4BUTA

Crystal structure of human tankyrase 2 in complex with 4-(4-oxo-3,4- dihydroquinazolin-2-yl)benzene-1-sulfonamide
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
210
structure length
208
Chain Sequence
GTILIDLSPDDKEFQSVEEEMQSTVREHRDGGHAGGIFNRYNILKIQKVCNKKLWERYTHRRKEVSEENHNHANERMLFHGSPFVNAIIHKGFDERHAYIGGMFGAGIYFAENSSKSNQYVYGIGGGTGCPVHKDRSCYICHRQLLFCRVTLGKSFLQFSAMAHSPPGHHSVTGRPSVNGLALAEYVIYRGEQAYPEYLITYQIMRPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Para-Substituted 2-Phenyl-3,4-Dihydroquinazolin-4-Ones as Potent and Selective Tankyrase Inhibitors.
pubmed doi rcsb
molecule keywords TANKYRASE-2
molecule tags Transferase
source organism Homo sapiens
total genus 68
structure length 208
sequence length 210
chains with identical sequence B
ec nomenclature ec 2.4.2.30: NAD(+) ADP-ribosyltransferase.
pdb deposition date 2013-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00644 PARP Poly(ADP-ribose) polymerase catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.228.10 Alpha Beta Alpha-Beta Complex Phosphoenolpyruvate Carboxykinase; domain 3 Phosphoenolpyruvate Carboxykinase; domain 3 4butA00
4BUEA 4OPXC 4BUSA 4UW1A 4L7NA 4XHUA 4BUVA 2RF5A 4BUYA 4TK0A 3MHKA 4BJCA 1WOKA 3GJWA 4HYFA 3GOYA 3P0NA 5C5QA 4BU6A 4TKGA 3KR8A 4J22A 5ECEA 4L6ZA 5C5RA 5AKUA 4L33A 4PY4A 4UFUA 5FPGA 4AVWA 3KJDA 4L2FA 4L0SA 4TJWA 4DVIA 3SMJA 4GV7A 4HMHA 4UI7A 4UVLA 3C4HA 2PAXA 3U9HA 4I9IA 4UXBA 4TKFA 5ADQA 4TK5A 4UI5A 3U9YA 4UI8A 4TVJA 2PQFA 4L09A 4UNDA 4UVWA 4UI4A 4J3MA 4GV2A 4UI6A 4K4FA 4TKIA 4TJYA 4BS4A 4R6EA 4PNLA 3UH4A 5ADSA 4R5WA 3UA9A 4BU5A 4BU8A 4L7UA 5ADTA 3BLJA 4L6SA 1UK1A 4UX4A 4UVZA 4UUHA 4W5IA 4MSKA 5C5PA 4HKNA 4HLMA 5AL4A 4ZZYA 4OQAC 4PNTA 4L7PA 5ETYA 4J1ZA 4L7RA 4HLKA 4PNNA 4W5SA 4GV0A 3SMIA 4J3LA 4UVVA 4HLHA 4F0EA 4HLFA 4L2GA 2X5YA 4N4VA 2PAWA 4L0TA 3UH2A 5FPFA 4F1QA 4RV6A 5AL1A 4K4EA 4UVOA 3L3MA 3MHJA 5AEHA 4LI7A 5LXPA 5DCZA 3C49A 4AVUA 4N4TA 3GN7A 4UVNA 4PNMA 4UFYA 3L3LA 4MT9A 4ZZXA 4PNQA 4L7LA 1A26A 3CE0A 4L2KA 4MSGA 4BU9A 4UVTA 4BJ9A 4BJBA 3KCZA 3GEYA 1UK0A 4OA7A 4PNRA 4UVXA 5A00A 5AL5A 4BUWA 4DQYC 4L34A 3SE2A 3HKVA 3W51A 4PNSA 4KZUA 4TOSA 3PAXA 4PJTA 5LYHA 1EFYA 4UVSA 4UHGA 4UI3A 4UVUA 4TJUA 5EBTA 4PAXA 4HHYA 4F1LA 4X52A 4HHZA 2RCWA 5AL2A 3FHBA 4L70A 5AKWA 4L32A 4GV4A 4M7BA 4KRSA 4BUDA 4LI8A 4LI6A 4L10A 5LX6A 4BU7A 4BUIA 4L7OA 4PJVA 3UDDA 4L31A 1GS0A 5ADRA 4IUEA 1PAXA 4UVYA 4UVPA 4BUFA 4L0IA 4J21A 4BFPA 3P0QA 4U6AA 4KZLA 4L0BA 4TORA 3P0PA 5AL3A 4HKKA 4PMLA 4L0VA 4OQBC 4BUAA 4BUUA 4W6EA 3KR7A 2RD6A 4HKIA 4HL5A 4BUTA 4BU3A 4HLGA 4N3RA 4BUXA 4KZQA 4ZZZA
chains in the Genus database with same CATH superfamily
1YLHA 4BUEA 4OPXC 4BUSA 2QF1A 4L7NA 4UW1A 4XHUA 4BUVA 2RF5A 4BUYA 4TK0A 3MHKA 2OLRA 4BJCA 1WOKA 3GJWA 4HLGA 4HYFA 3GOYA 3P0NA 4GMMA 5C5QA 4BU6A 4TKGA 5FH5A 2QEYA 2FAHA 3KR8A 1KHGA 2RKDA 4J22A 4L6ZA 5ECEA 1J3BA 5C5RA 5AKUA 4L33A 4PY4A 4UFUA 5FPGA 4YW8A 4AVWA 3KJDA 4L2FA 4L0SA 4TJWA 4DVIA 4GMUA 3SMJA 4GV7A 4HMHA 4UI7A 2QF2A 4GMWA 3C4HA 2PAXA 4UVLA 3U9HA 4I9IA 4UXBA 1OENA 4TKFA 4TK5A 4UI5A 5ADQA 3U9YA 4UI8A 3MOEA 4TVJA 2PQFA 4L09A 4UNDA 4UVWA 4UI4A 4J3MA 4GV2A 4UI6A 2RKAA 4K4FA 4TKIA 4TJYA 4BS4A 4R6EA 4PNLA 4OX2A 2OLQA 4GNOA 3UH4A 4R5WA 5ADSA 3UA9A 1II2A 4BU5A 4BU8A 4L7UA 5ADTA 3BLJA 4L6SA 4WPVA 1OS1A 1UK1A 1YTMA 4YW9A 4UX4A 5FH0A 3DT2A 4UVZA 2ZCIA 4UUHA 2RK8A 3DTBA 4W5IA 4MSKA 5C5PA 4HKNA 4HLMA 5AL4A 4ZZYA 4OQAC 2RKEA 4PNTA 4L7PA 5ETYA 4J1ZA 4L7RA 4HLKA 4PNNA 4W5SA 4GV0A 3SMIA 4J3LA 4UVVA 4HLHA 3DT4A 4YWBA 4WPUA 4F0EA 4HLFA 5FH3A 4L2GA 2X5YA 4N4VA 2PAWA 1AYLA 4WOUA 4L0TA 3UH2A 5FPFA 4F1QA 4RV6A 5AL1A 2RK7A 1KHFA 4K4EA 4UVOA 3L3MA 3MHJA 5AEHA 4LI7A 5I67A 1M51A 5LXPA 5DCZA 3C49A 4AVUA 4N4TA 3GN7A 1YVYA 1YGGA 4UVNA 4PNMA 4UFYA 3L3LA 4MT9A 4WL8A 4ZZXA 4PNQA 4L7LA 4RCGA 2PXZX 1A26A 3CE0A 4L2KA 4MSGA 4WIEA 4BU9A 4YWDA 4UVTA 4BJ9A 4BJBA 4GNLA 3KCZA 1KHBA 3GEYA 1UK0A 4GNPA 4OA7A 4PNRA 4UVXA 5A00A 1K3DA 5AL5A 2QEWA 4BUWA 4DQYC 4L34A 5FH2A 3SE2A 3HKVA 5FH4A 4PNSA 4KZUA 4TOSA 3W51A 3PAXA 4PJTA 2GMVA 4GMZA 4WPTA 1EFYA 5FH1A 5LYHA 4GNMA 4UVSA 4UHGA 4UI3A 4UVUA 4TJUA 5EBTA 4PAXA 4HHYA 4F1LA 4X52A 2QZYA 4HHZA 1AQ2A 2PC9A 2RCWA 5AL2A 3FHBA 4L70A 5AKWA 4L32A 4GV4A 4M7BA 4KRSA 4BUDA 1NHXA 4LI8A 4R43A 4LI6A 4L10A 5LX6A 4BU7A 4BUIA 4L7OA 4PJVA 3UDDA 4L31A 1GS0A 5ADRA 3DT7A 1PAXA 4IUEA 4UVYA 4UVPA 4WIUA 4L0IA 4BUFA 4J21A 4BUXA 4BFPA 2FAFA 3P0QA 4KZLA 4U6AA 4L0BA 4TORA 2PY7X 1K3CA 1XKVA 3P0PA 5AL3A 4HKKA 4PMLA 4L0VA 4OQBC 4BUAA 4BUUA 4W6EA 3KR7A 3MOFA 4HKIA 1KHEA 4HL5A 4BUTA 4BU3A 3MOHA 2RD6A 4N3RA 4GNQA 4KZQA 4ZZZA
chains in the Genus database with same CATH topology
1YLHA 4BUEA 4OPXC 4BUSA 2QF1A 4L7NA 4UW1A 4XHUA 4BUVA 2RF5A 4BUYA 4TK0A 3MHKA 2OLRA 4BJCA 1WOKA 3GJWA 4HLGA 4HYFA 3GOYA 3P0NA 4GMMA 5C5QA 4BU6A 4TKGA 5FH5A 2QEYA 2FAHA 3KR8A 1KHGA 2RKDA 4J22A 4L6ZA 5ECEA 1J3BA 5C5RA 5AKUA 4L33A 4PY4A 4UFUA 5FPGA 4YW8A 4AVWA 3KJDA 4L2FA 4L0SA 4TJWA 4DVIA 4GMUA 3SMJA 4GV7A 4HMHA 4UI7A 2QF2A 4GMWA 3C4HA 2PAXA 4UVLA 3U9HA 4I9IA 4UXBA 1OENA 4TKFA 4TK5A 4UI5A 5ADQA 3U9YA 4UI8A 3MOEA 4TVJA 2PQFA 4L09A 4UNDA 4UVWA 4UI4A 4J3MA 4GV2A 4UI6A 2RKAA 4K4FA 4TKIA 4TJYA 4BS4A 4R6EA 4PNLA 4OX2A 2OLQA 4GNOA 3UH4A 4R5WA 5ADSA 3UA9A 1II2A 4BU5A 4BU8A 4L7UA 5ADTA 3BLJA 4L6SA 4WPVA 1OS1A 1UK1A 1YTMA 4YW9A 4UX4A 5FH0A 3DT2A 4UVZA 2ZCIA 4UUHA 2RK8A 3DTBA 4W5IA 4MSKA 5C5PA 4HKNA 4HLMA 5AL4A 4ZZYA 4OQAC 2RKEA 4PNTA 4L7PA 5ETYA 4J1ZA 4L7RA 4HLKA 4PNNA 4W5SA 4GV0A 3SMIA 4J3LA 4UVVA 4HLHA 3DT4A 4YWBA 4WPUA 4F0EA 4HLFA 5FH3A 4L2GA 2X5YA 4N4VA 2PAWA 1AYLA 4WOUA 4L0TA 3UH2A 5FPFA 4F1QA 4RV6A 5AL1A 2RK7A 1KHFA 4K4EA 4UVOA 3L3MA 3MHJA 5AEHA 4LI7A 5I67A 1M51A 5LXPA 5DCZA 3C49A 4AVUA 4N4TA 3GN7A 1YVYA 1YGGA 4UVNA 4PNMA 4UFYA 3L3LA 4MT9A 4WL8A 4ZZXA 4PNQA 4L7LA 4RCGA 2PXZX 1A26A 3CE0A 4L2KA 4MSGA 4WIEA 4BU9A 4YWDA 4UVTA 4BJ9A 4BJBA 4GNLA 3KCZA 1KHBA 3GEYA 1UK0A 4GNPA 4OA7A 4PNRA 4UVXA 5A00A 1K3DA 5AL5A 2QEWA 4BUWA 4DQYC 4L34A 5FH2A 3SE2A 3HKVA 5FH4A 4PNSA 4KZUA 4TOSA 3W51A 3PAXA 4PJTA 2GMVA 4GMZA 4WPTA 1EFYA 5FH1A 5LYHA 4GNMA 4UVSA 4UHGA 4UI3A 4UVUA 4TJUA 5EBTA 4PAXA 4HHYA 4F1LA 4X52A 2QZYA 4HHZA 1AQ2A 2PC9A 2RCWA 5AL2A 3FHBA 4L70A 5AKWA 4L32A 4GV4A 4M7BA 4KRSA 4BUDA 1NHXA 4LI8A 4R43A 4LI6A 4L10A 5LX6A 4BU7A 4BUIA 4L7OA 4PJVA 3UDDA 4L31A 1GS0A 5ADRA 3DT7A 1PAXA 4IUEA 4UVYA 4UVPA 4WIUA 4L0IA 4BUFA 4J21A 4BUXA 4BFPA 2FAFA 3P0QA 4KZLA 4U6AA 4L0BA 4TORA 2PY7X 1K3CA 1XKVA 3P0PA 5AL3A 4HKKA 4PMLA 4L0VA 4OQBC 4BUAA 4BUUA 4W6EA 3KR7A 3MOFA 4HKIA 1KHEA 4HL5A 4BUTA 4BU3A 3MOHA 2RD6A 4N3RA 4GNQA 4KZQA 4ZZZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BUE A;  4OPX C;  4BUS A;  4UW1 A;  4L7N A;  4XHU A;  4BUV A;  2RF5 A;  4BUY A;  4TK0 A;  3MHK A;  4BJC A;  1WOK A;  3GJW A;  4HYF A;  3GOY A;  3P0N A;  5C5Q A;  4BU6 A;  4TKG A;  3KR8 A;  4J22 A;  5ECE A;  4L6Z A;  5C5R A;  5AKU A;  4L33 A;  4PY4 A;  4UFU A;  5FPG A;  4AVW A;  3KJD A;  4L2F A;  4L0S A;  4TJW A;  4DVI A;  3SMJ A;  4GV7 A;  4HMH A;  4UI7 A;  4UVL A;  3C4H A;  2PAX A;  3U9H A;  4I9I A;  4UXB A;  4TKF A;  5ADQ A;  4TK5 A;  4UI5 A;  3U9Y A;  4UI8 A;  4TVJ A;  2PQF A;  4L09 A;  4UND A;  4UVW A;  4UI4 A;  4J3M A;  4GV2 A;  4UI6 A;  4K4F A;  4TKI A;  4TJY A;  4BS4 A;  4R6E A;  4PNL A;  3UH4 A;  5ADS A;  4R5W A;  3UA9 A;  4BU5 A;  4BU8 A;  4L7U A;  5ADT A;  3BLJ A;  4L6S A;  1UK1 A;  4UX4 A;  4UVZ A;  4UUH A;  4W5I A;  4MSK A;  5C5P A;  4HKN A;  4HLM A;  5AL4 A;  4ZZY A;  4OQA C;  4PNT A;  4L7P A;  5ETY A;  4J1Z A;  4L7R A;  4HLK A;  4PNN A;  4W5S A;  4GV0 A;  3SMI A;  4J3L A;  4UVV A;  4HLH A;  4F0E A;  4HLF A;  4L2G A;  2X5Y A;  4N4V A;  2PAW A;  4L0T A;  3UH2 A;  5FPF A;  4F1Q A;  4RV6 A;  5AL1 A;  4K4E A;  4UVO A;  3L3M A;  3MHJ A;  5AEH A;  4LI7 A;  5LXP A;  5DCZ A;  3C49 A;  4AVU A;  4N4T A;  3GN7 A;  4UVN A;  4PNM A;  4UFY A;  3L3L A;  4MT9 A;  4ZZX A;  4PNQ A;  4L7L A;  1A26 A;  3CE0 A;  4L2K A;  4MSG A;  4BU9 A;  4UVT A;  4BJ9 A;  4BJB A;  3KCZ A;  3GEY A;  1UK0 A;  4OA7 A;  4PNR A;  4UVX A;  5A00 A;  5AL5 A;  4BUW A;  4DQY C;  4L34 A;  3SE2 A;  3HKV A;  3W51 A;  4PNS A;  4KZU A;  4TOS A;  3PAX A;  4PJT A;  5LYH A;  1EFY A;  4UVS A;  4UHG A;  4UI3 A;  4UVU A;  4TJU A;  5EBT A;  4PAX A;  4HHY A;  4F1L A;  4X52 A;  4HHZ A;  2RCW A;  5AL2 A;  3FHB A;  4L70 A;  5AKW A;  4L32 A;  4GV4 A;  4M7B A;  4KRS A;  4BUD A;  4LI8 A;  4LI6 A;  4L10 A;  5LX6 A;  4BU7 A;  4BUI A;  4L7O A;  4PJV A;  3UDD A;  4L31 A;  1GS0 A;  5ADR A;  4IUE A;  1PAX A;  4UVY A;  4UVP A;  4BUF A;  4L0I A;  4J21 A;  4BFP A;  3P0Q A;  4U6A A;  4KZL A;  4L0B A;  4TOR A;  3P0P A;  5AL3 A;  4HKK A;  4PML A;  4L0V A;  4OQB C;  4BUA A;  4BUU A;  4W6E A;  3KR7 A;  2RD6 A;  4HKI A;  4HL5 A;  4BUT A;  4BU3 A;  4HLG A;  4N3R A;  4BUX A;  4KZQ A;  4ZZZ A; 
#chains in the Genus database with same CATH topology
 1YLH A;  4BUE A;  4OPX C;  4BUS A;  2QF1 A;  4L7N A;  4UW1 A;  4XHU A;  4BUV A;  2RF5 A;  4BUY A;  4TK0 A;  3MHK A;  2OLR A;  4BJC A;  1WOK A;  3GJW A;  4HLG A;  4HYF A;  3GOY A;  3P0N A;  4GMM A;  5C5Q A;  4BU6 A;  4TKG A;  5FH5 A;  2QEY A;  2FAH A;  3KR8 A;  1KHG A;  2RKD A;  4J22 A;  4L6Z A;  5ECE A;  1J3B A;  5C5R A;  5AKU A;  4L33 A;  4PY4 A;  4UFU A;  5FPG A;  4YW8 A;  4AVW A;  3KJD A;  4L2F A;  4L0S A;  4TJW A;  4DVI A;  4GMU A;  3SMJ A;  4GV7 A;  4HMH A;  4UI7 A;  2QF2 A;  4GMW A;  3C4H A;  2PAX A;  4UVL A;  3U9H A;  4I9I A;  4UXB A;  1OEN A;  4TKF A;  4TK5 A;  4UI5 A;  5ADQ A;  3U9Y A;  4UI8 A;  3MOE A;  4TVJ A;  2PQF A;  4L09 A;  4UND A;  4UVW A;  4UI4 A;  4J3M A;  4GV2 A;  4UI6 A;  2RKA A;  4K4F A;  4TKI A;  4TJY A;  4BS4 A;  4R6E A;  4PNL A;  4OX2 A;  2OLQ A;  4GNO A;  3UH4 A;  4R5W A;  5ADS A;  3UA9 A;  1II2 A;  4BU5 A;  4BU8 A;  4L7U A;  5ADT A;  3BLJ A;  4L6S A;  4WPV A;  1OS1 A;  1UK1 A;  1YTM A;  4YW9 A;  4UX4 A;  5FH0 A;  3DT2 A;  4UVZ A;  2ZCI A;  4UUH A;  2RK8 A;  3DTB A;  4W5I A;  4MSK A;  5C5P A;  4HKN A;  4HLM A;  5AL4 A;  4ZZY A;  4OQA C;  2RKE A;  4PNT A;  4L7P A;  5ETY A;  4J1Z A;  4L7R A;  4HLK A;  4PNN A;  4W5S A;  4GV0 A;  3SMI A;  4J3L A;  4UVV A;  4HLH A;  3DT4 A;  4YWB A;  4WPU A;  4F0E A;  4HLF A;  5FH3 A;  4L2G A;  2X5Y A;  4N4V A;  2PAW A;  1AYL A;  4WOU A;  4L0T A;  3UH2 A;  5FPF A;  4F1Q A;  4RV6 A;  5AL1 A;  2RK7 A;  1KHF A;  4K4E A;  4UVO A;  3L3M A;  3MHJ A;  5AEH A;  4LI7 A;  5I67 A;  1M51 A;  5LXP A;  5DCZ A;  3C49 A;  4AVU A;  4N4T A;  3GN7 A;  1YVY A;  1YGG A;  4UVN A;  4PNM A;  4UFY A;  3L3L A;  4MT9 A;  4WL8 A;  4ZZX A;  4PNQ A;  4L7L A;  4RCG A;  2PXZ X;  1A26 A;  3CE0 A;  4L2K A;  4MSG A;  4WIE A;  4BU9 A;  4YWD A;  4UVT A;  4BJ9 A;  4BJB A;  4GNL A;  3KCZ A;  1KHB A;  3GEY A;  1UK0 A;  4GNP A;  4OA7 A;  4PNR A;  4UVX A;  5A00 A;  1K3D A;  5AL5 A;  2QEW A;  4BUW A;  4DQY C;  4L34 A;  5FH2 A;  3SE2 A;  3HKV A;  5FH4 A;  4PNS A;  4KZU A;  4TOS A;  3W51 A;  3PAX A;  4PJT A;  2GMV A;  4GMZ A;  4WPT A;  1EFY A;  5FH1 A;  5LYH A;  4GNM A;  4UVS A;  4UHG A;  4UI3 A;  4UVU A;  4TJU A;  5EBT A;  4PAX A;  4HHY A;  4F1L A;  4X52 A;  2QZY A;  4HHZ A;  1AQ2 A;  2PC9 A;  2RCW A;  5AL2 A;  3FHB A;  4L70 A;  5AKW A;  4L32 A;  4GV4 A;  4M7B A;  4KRS A;  4BUD A;  1NHX A;  4LI8 A;  4R43 A;  4LI6 A;  4L10 A;  5LX6 A;  4BU7 A;  4BUI A;  4L7O A;  4PJV A;  3UDD A;  4L31 A;  1GS0 A;  5ADR A;  3DT7 A;  1PAX A;  4IUE A;  4UVY A;  4UVP A;  4WIU A;  4L0I A;  4BUF A;  4J21 A;  4BUX A;  4BFP A;  2FAF A;  3P0Q A;  4KZL A;  4U6A A;  4L0B A;  4TOR A;  2PY7 X;  1K3C A;  1XKV A;  3P0P A;  5AL3 A;  4HKK A;  4PML A;  4L0V A;  4OQB C;  4BUA A;  4BUU A;  4W6E A;  3KR7 A;  3MOF A;  4HKI A;  1KHE A;  4HL5 A;  4BUT A;  4BU3 A;  3MOH A;  2RD6 A;  4N3R A;  4GNQ A;  4KZQ A;  4ZZZ A; 
#chains in the Genus database with same CATH homology
 1YLH A;  4BUE A;  4OPX C;  4BUS A;  2QF1 A;  4L7N A;  4UW1 A;  4XHU A;  4BUV A;  2RF5 A;  4BUY A;  4TK0 A;  3MHK A;  2OLR A;  4BJC A;  1WOK A;  3GJW A;  4HLG A;  4HYF A;  3GOY A;  3P0N A;  4GMM A;  5C5Q A;  4BU6 A;  4TKG A;  5FH5 A;  2QEY A;  2FAH A;  3KR8 A;  1KHG A;  2RKD A;  4J22 A;  4L6Z A;  5ECE A;  1J3B A;  5C5R A;  5AKU A;  4L33 A;  4PY4 A;  4UFU A;  5FPG A;  4YW8 A;  4AVW A;  3KJD A;  4L2F A;  4L0S A;  4TJW A;  4DVI A;  4GMU A;  3SMJ A;  4GV7 A;  4HMH A;  4UI7 A;  2QF2 A;  4GMW A;  3C4H A;  2PAX A;  4UVL A;  3U9H A;  4I9I A;  4UXB A;  1OEN A;  4TKF A;  4TK5 A;  4UI5 A;  5ADQ A;  3U9Y A;  4UI8 A;  3MOE A;  4TVJ A;  2PQF A;  4L09 A;  4UND A;  4UVW A;  4UI4 A;  4J3M A;  4GV2 A;  4UI6 A;  2RKA A;  4K4F A;  4TKI A;  4TJY A;  4BS4 A;  4R6E A;  4PNL A;  4OX2 A;  2OLQ A;  4GNO A;  3UH4 A;  4R5W A;  5ADS A;  3UA9 A;  1II2 A;  4BU5 A;  4BU8 A;  4L7U A;  5ADT A;  3BLJ A;  4L6S A;  4WPV A;  1OS1 A;  1UK1 A;  1YTM A;  4YW9 A;  4UX4 A;  5FH0 A;  3DT2 A;  4UVZ A;  2ZCI A;  4UUH A;  2RK8 A;  3DTB A;  4W5I A;  4MSK A;  5C5P A;  4HKN A;  4HLM A;  5AL4 A;  4ZZY A;  4OQA C;  2RKE A;  4PNT A;  4L7P A;  5ETY A;  4J1Z A;  4L7R A;  4HLK A;  4PNN A;  4W5S A;  4GV0 A;  3SMI A;  4J3L A;  4UVV A;  4HLH A;  3DT4 A;  4YWB A;  4WPU A;  4F0E A;  4HLF A;  5FH3 A;  4L2G A;  2X5Y A;  4N4V A;  2PAW A;  1AYL A;  4WOU A;  4L0T A;  3UH2 A;  5FPF A;  4F1Q A;  4RV6 A;  5AL1 A;  2RK7 A;  1KHF A;  4K4E A;  4UVO A;  3L3M A;  3MHJ A;  5AEH A;  4LI7 A;  5I67 A;  1M51 A;  5LXP A;  5DCZ A;  3C49 A;  4AVU A;  4N4T A;  3GN7 A;  1YVY A;  1YGG A;  4UVN A;  4PNM A;  4UFY A;  3L3L A;  4MT9 A;  4WL8 A;  4ZZX A;  4PNQ A;  4L7L A;  4RCG A;  2PXZ X;  1A26 A;  3CE0 A;  4L2K A;  4MSG A;  4WIE A;  4BU9 A;  4YWD A;  4UVT A;  4BJ9 A;  4BJB A;  4GNL A;  3KCZ A;  1KHB A;  3GEY A;  1UK0 A;  4GNP A;  4OA7 A;  4PNR A;  4UVX A;  5A00 A;  1K3D A;  5AL5 A;  2QEW A;  4BUW A;  4DQY C;  4L34 A;  5FH2 A;  3SE2 A;  3HKV A;  5FH4 A;  4PNS A;  4KZU A;  4TOS A;  3W51 A;  3PAX A;  4PJT A;  2GMV A;  4GMZ A;  4WPT A;  1EFY A;  5FH1 A;  5LYH A;  4GNM A;  4UVS A;  4UHG A;  4UI3 A;  4UVU A;  4TJU A;  5EBT A;  4PAX A;  4HHY A;  4F1L A;  4X52 A;  2QZY A;  4HHZ A;  1AQ2 A;  2PC9 A;  2RCW A;  5AL2 A;  3FHB A;  4L70 A;  5AKW A;  4L32 A;  4GV4 A;  4M7B A;  4KRS A;  4BUD A;  1NHX A;  4LI8 A;  4R43 A;  4LI6 A;  4L10 A;  5LX6 A;  4BU7 A;  4BUI A;  4L7O A;  4PJV A;  3UDD A;  4L31 A;  1GS0 A;  5ADR A;  3DT7 A;  1PAX A;  4IUE A;  4UVY A;  4UVP A;  4WIU A;  4L0I A;  4BUF A;  4J21 A;  4BUX A;  4BFP A;  2FAF A;  3P0Q A;  4KZL A;  4U6A A;  4L0B A;  4TOR A;  2PY7 X;  1K3C A;  1XKV A;  3P0P A;  5AL3 A;  4HKK A;  4PML A;  4L0V A;  4OQB C;  4BUA A;  4BUU A;  4W6E A;  3KR7 A;  3MOF A;  4HKI A;  1KHE A;  4HL5 A;  4BUT A;  4BU3 A;  3MOH A;  2RD6 A;  4N3R A;  4GNQ A;  4KZQ A;  4ZZZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...