4BUVA

Crystal structure of human tankyrase 2 in complex with n-(4-(4-oxo-3, 4-dihydroquinazolin-2-yl)phenyl)thiophene-2-carboxamide
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
210
structure length
208
Chain Sequence
GTILIDLSPDDKEFQSVEEEMQSTVREHRDGGHAGGIFNRYNILKIQKVCNKKLWERYTHRRKEVSEENHNHANERMLFHGSPFVNAIIHKGFDERHAYIGGMFGAGIYFAENSSKSNQYVYGIGGGTGCPVHKDRSCYICHRQLLFCRVTLGKSFLQFSAMAHSPPGHHSVTGRPSVNGLALAEYVIYRGEQAYPEYLITYQIMRPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Para-Substituted 2-Phenyl-3,4-Dihydroquinazolin-4-Ones as Potent and Selective Tankyrase Inhibitors.
pubmed doi rcsb
molecule keywords TANKYRASE-2
molecule tags Transferase
source organism Homo sapiens
total genus 68
structure length 208
sequence length 210
chains with identical sequence C
ec nomenclature ec 2.4.2.30: NAD(+) ADP-ribosyltransferase.
pdb deposition date 2013-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00644 PARP Poly(ADP-ribose) polymerase catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.228.10 Alpha Beta Alpha-Beta Complex Phosphoenolpyruvate Carboxykinase; domain 3 Phosphoenolpyruvate Carboxykinase; domain 3 4buvA00
4TJYA 4BUYA 4L0SA 4UVLA 4L33A 4UVNA 4TJUA 4UX4A 4UFUA 3SMIA 4BU9A 3SMJA 4L2KA 4L32A 5ADQA 4UVYA 4L7PA 4AVUA 4HLFA 4HYFA 4HLMA 4J3LA 4TJWA 3CE0A 3KJDA 4L7OA 4UVOA 5AL3A 4BUEA 4I9IA 4HMHA 4L10A 4TOSA 5ADTA 4UI6A 4UVTA 3BLJA 3KCZA 4KZLA 4UXBA 5ECEA 4UI8A 4PJVA 5EBTA 4LI7A 3UH2A 4BJ9A 4PNSA 4L09A 4PNLA 4W5IA 4BJBA 4HKKA 5ETYA 2PAWA 4IUEA 2PQFA 4BUWA 4BU7A 4KRSA 3C4HA 4PMLA 4GV0A 4TVJA 4UUHA 4UNDA 5C5RA 3GN7A 4L6ZA 4BFPA 4BUIA 4PNNA 4ZZZA 5ADRA 4ZZYA 3UDDA 5C5QA 4UI7A 4MSKA 4TK0A 3KR7A 4N4TA 4UVUA 4BUDA 4PNMA 4UI5A 3KR8A 4UVVA 4L2GA 4L7LA 4UW1A 4OA7A 4GV7A 4TKIA 4BU6A 2RD6A 3GOYA 5ADSA 3P0QA 3P0NA 4PNTA 4J21A 4UVWA 4HLHA 5LXPA 3L3LA 4OPXC 4MT9A 2RF5A 4L7UA 4N3RA 4UVSA 4W6EA 4HLGA 5A00A 3SE2A 4HKIA 1A26A 4GV2A 4U6AA 4BU8A 4X52A 4UFYA 4AVWA 4F1LA 4HLKA 3GJWA 4DVIA 5FPFA 4UVZA 4PAXA 4HKNA 1PAXA 1GS0A 4ZZXA 4L7NA 4L0VA 1EFYA 4BU5A 4J1ZA 4PNRA 4K4EA 2PAXA 4RV6A 4TKGA 4L0TA 5AEHA 4MSGA 4BUXA 4N4VA 4BU3A 3GEYA 4L70A 4J3MA 4PY4A 5AKWA 1UK1A 4OQAC 4HHZA 3FHBA 3W51A 4BS4A 4UVPA 3L3MA 3UA9A 4UVXA 2RCWA 5FPGA 4M7BA 4L31A 4L0BA 5DCZA 4F0EA 1UK0A 3P0PA 4R5WA 4L0IA 4LI8A 4KZUA 4W5SA 5AL5A 4TKFA 4BUAA 4TK5A 4BUFA 4L6SA 4HHYA 4R6EA 5AL4A 1WOKA 3MHJA 4GV4A 4J22A 4UHGA 4L34A 4F1QA 5LX6A 2X5YA 5AL2A 4BJCA 3PAXA 4KZQA 3MHKA 3HKVA 4TORA 3U9HA 4BUUA 4BUSA 5AL1A 4L2FA 4BUTA 4UI3A 4OQBC 3UH4A 4UI4A 4XHUA 3U9YA 5LYHA 4BUVA 4LI6A 4PJTA 3C49A 5C5PA 4DQYC 4K4FA 4L7RA 4HL5A 4PNQA 5AKUA
chains in the Genus database with same CATH superfamily
2PY7X 4TJYA 4WL8A 4L0SA 4UVLA 4L33A 4UVNA 4BUYA 4TJUA 4UX4A 4UFUA 3SMIA 4BU9A 3SMJA 4HL5A 4L2KA 4L32A 5ADQA 4UVYA 4L7PA 4AVUA 4HLFA 4HYFA 1YGGA 4HLMA 4J3LA 4TJWA 1M51A 4GMMA 3CE0A 3KJDA 4L7OA 5FH5A 3MOEA 1YVYA 4UVOA 5AL3A 4BUEA 4I9IA 4HMHA 4L10A 4TOSA 5ADTA 3MOFA 1OENA 2PXZX 2PC9A 4UI6A 4UVTA 3BLJA 3KCZA 4KZLA 4WPUA 4UXBA 5ECEA 1K3CA 4UI8A 4YWBA 4PJVA 5I67A 5EBTA 2QF1A 4LI7A 5FH0A 3UH2A 4BJ9A 4PNSA 4L09A 4PNLA 4W5IA 4BJBA 5FH4A 4WPTA 4HKKA 5ETYA 2PAWA 4GNPA 1AQ2A 4IUEA 2PQFA 5FH1A 4BU7A 4BUWA 4KRSA 3C4HA 4PMLA 4GV0A 4TVJA 4UUHA 4UNDA 2OLQA 4WIUA 5C5RA 3GN7A 3MOHA 4L6ZA 4BFPA 4BUIA 4PNNA 4ZZZA 5ADRA 4ZZYA 3UDDA 5C5QA 4UI7A 4MSKA 4YW9A 4TK0A 1OS1A 3KR7A 4N4TA 4UVUA 4BUDA 4PNMA 4UI5A 3KR8A 4UVVA 1KHFA 4L2GA 4L7LA 4UW1A 4OA7A 4GMWA 2RKAA 4GV7A 1KHEA 2RD6A 3GOYA 4TKIA 4BU6A 5ADSA 3P0QA 3P0NA 4PNTA 4J21A 4UVWA 4OX2A 2FAFA 4HLHA 5LXPA 1YTMA 1NHXA 3L3LA 4OPXC 2RKDA 4MT9A 2RF5A 4L7UA 4N3RA 4UVSA 2QZYA 4HLGA 4W6EA 4WIEA 5A00A 4HKIA 3DTBA 1A26A 4GV2A 4U6AA 4BU8A 4X52A 4UFYA 4GNMA 4AVWA 2OLRA 4GMUA 1J3BA 4F1LA 4HLKA 4R43A 3GJWA 4YWDA 2QEWA 2ZCIA 4DVIA 5FPFA 4UVZA 4PAXA 4HKNA 1YLHA 1AYLA 1PAXA 1GS0A 4ZZXA 4L7NA 4L0VA 1EFYA 4BU5A 4J1ZA 4PNRA 4K4EA 2PAXA 4RV6A 4TKGA 4L0TA 5AEHA 4MSGA 4BUXA 4N4VA 4BU3A 3GEYA 4GMZA 4J3MA 4L70A 4PY4A 1UK1A 4WOUA 5AKWA 2GMVA 2RKEA 4RCGA 2QEYA 4OQAC 4HHZA 3FHBA 3SE2A 3W51A 4BS4A 4UVPA 3L3MA 3UA9A 3DT4A 3DT2A 4UVXA 5FPGA 4M7BA 4L31A 4L0BA 2RK7A 5DCZA 4WPVA 4F0EA 1UK0A 3P0PA 4R5WA 5FH3A 5FH2A 4L0IA 1XKVA 4LI8A 4KZUA 4W5SA 5AL5A 4TKFA 4BUAA 4TK5A 4BUFA 4L6SA 3DT7A 4GNQA 4HHYA 4R6EA 5AL4A 1WOKA 3MHJA 4GV4A 4J22A 4UHGA 4L34A 4F1QA 5LX6A 2X5YA 5AL2A 4BJCA 2FAHA 3PAXA 3MHKA 3HKVA 4KZQA 4TORA 3U9HA 4BUUA 4BUSA 1K3DA 4GNLA 5AL1A 4L2FA 4YW8A 4BUTA 4UI3A 4OQBC 4GNOA 4L7RA 3UH4A 2RK8A 1KHGA 4UI4A 4XHUA 3U9YA 5LYHA 1II2A 4BUVA 4LI6A 4PJTA 3C49A 1KHBA 5C5PA 4DQYC 4K4FA 2QF2A 2RCWA 4PNQA 5AKUA
chains in the Genus database with same CATH topology
2PY7X 4TJYA 4WL8A 4L0SA 4UVLA 4L33A 4UVNA 4BUYA 4TJUA 4UX4A 4UFUA 3SMIA 4BU9A 3SMJA 4HL5A 4L2KA 4L32A 5ADQA 4UVYA 4L7PA 4AVUA 4HLFA 4HYFA 1YGGA 4HLMA 4J3LA 4TJWA 1M51A 4GMMA 3CE0A 3KJDA 4L7OA 5FH5A 3MOEA 1YVYA 4UVOA 5AL3A 4BUEA 4I9IA 4HMHA 4L10A 4TOSA 5ADTA 3MOFA 1OENA 2PXZX 2PC9A 4UI6A 4UVTA 3BLJA 3KCZA 4KZLA 4WPUA 4UXBA 5ECEA 1K3CA 4UI8A 4YWBA 4PJVA 5I67A 5EBTA 2QF1A 4LI7A 5FH0A 3UH2A 4BJ9A 4PNSA 4L09A 4PNLA 4W5IA 4BJBA 5FH4A 4WPTA 4HKKA 5ETYA 2PAWA 4GNPA 1AQ2A 4IUEA 2PQFA 5FH1A 4BU7A 4BUWA 4KRSA 3C4HA 4PMLA 4GV0A 4TVJA 4UUHA 4UNDA 2OLQA 4WIUA 5C5RA 3GN7A 3MOHA 4L6ZA 4BFPA 4BUIA 4PNNA 4ZZZA 5ADRA 4ZZYA 3UDDA 5C5QA 4UI7A 4MSKA 4YW9A 4TK0A 1OS1A 3KR7A 4N4TA 4UVUA 4BUDA 4PNMA 4UI5A 3KR8A 4UVVA 1KHFA 4L2GA 4L7LA 4UW1A 4OA7A 4GMWA 2RKAA 4GV7A 1KHEA 2RD6A 3GOYA 4TKIA 4BU6A 5ADSA 3P0QA 3P0NA 4PNTA 4J21A 4UVWA 4OX2A 2FAFA 4HLHA 5LXPA 1YTMA 1NHXA 3L3LA 4OPXC 2RKDA 4MT9A 2RF5A 4L7UA 4N3RA 4UVSA 2QZYA 4HLGA 4W6EA 4WIEA 5A00A 4HKIA 3DTBA 1A26A 4GV2A 4U6AA 4BU8A 4X52A 4UFYA 4GNMA 4AVWA 2OLRA 4GMUA 1J3BA 4F1LA 4HLKA 4R43A 3GJWA 4YWDA 2QEWA 2ZCIA 4DVIA 5FPFA 4UVZA 4PAXA 4HKNA 1YLHA 1AYLA 1PAXA 1GS0A 4ZZXA 4L7NA 4L0VA 1EFYA 4BU5A 4J1ZA 4PNRA 4K4EA 2PAXA 4RV6A 4TKGA 4L0TA 5AEHA 4MSGA 4BUXA 4N4VA 4BU3A 3GEYA 4GMZA 4J3MA 4L70A 4PY4A 1UK1A 4WOUA 5AKWA 2GMVA 2RKEA 4RCGA 2QEYA 4OQAC 4HHZA 3FHBA 3SE2A 3W51A 4BS4A 4UVPA 3L3MA 3UA9A 3DT4A 3DT2A 4UVXA 5FPGA 4M7BA 4L31A 4L0BA 2RK7A 5DCZA 4WPVA 4F0EA 1UK0A 3P0PA 4R5WA 5FH3A 5FH2A 4L0IA 1XKVA 4LI8A 4KZUA 4W5SA 5AL5A 4TKFA 4BUAA 4TK5A 4BUFA 4L6SA 3DT7A 4GNQA 4HHYA 4R6EA 5AL4A 1WOKA 3MHJA 4GV4A 4J22A 4UHGA 4L34A 4F1QA 5LX6A 2X5YA 5AL2A 4BJCA 2FAHA 3PAXA 3MHKA 3HKVA 4KZQA 4TORA 3U9HA 4BUUA 4BUSA 1K3DA 4GNLA 5AL1A 4L2FA 4YW8A 4BUTA 4UI3A 4OQBC 4GNOA 4L7RA 3UH4A 2RK8A 1KHGA 4UI4A 4XHUA 3U9YA 5LYHA 1II2A 4BUVA 4LI6A 4PJTA 3C49A 1KHBA 5C5PA 4DQYC 4K4FA 2QF2A 2RCWA 4PNQA 5AKUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4TJY A;  4BUY A;  4L0S A;  4UVL A;  4L33 A;  4UVN A;  4TJU A;  4UX4 A;  4UFU A;  3SMI A;  4BU9 A;  3SMJ A;  4L2K A;  4L32 A;  5ADQ A;  4UVY A;  4L7P A;  4AVU A;  4HLF A;  4HYF A;  4HLM A;  4J3L A;  4TJW A;  3CE0 A;  3KJD A;  4L7O A;  4UVO A;  5AL3 A;  4BUE A;  4I9I A;  4HMH A;  4L10 A;  4TOS A;  5ADT A;  4UI6 A;  4UVT A;  3BLJ A;  3KCZ A;  4KZL A;  4UXB A;  5ECE A;  4UI8 A;  4PJV A;  5EBT A;  4LI7 A;  3UH2 A;  4BJ9 A;  4PNS A;  4L09 A;  4PNL A;  4W5I A;  4BJB A;  4HKK A;  5ETY A;  2PAW A;  4IUE A;  2PQF A;  4BUW A;  4BU7 A;  4KRS A;  3C4H A;  4PML A;  4GV0 A;  4TVJ A;  4UUH A;  4UND A;  5C5R A;  3GN7 A;  4L6Z A;  4BFP A;  4BUI A;  4PNN A;  4ZZZ A;  5ADR A;  4ZZY A;  3UDD A;  5C5Q A;  4UI7 A;  4MSK A;  4TK0 A;  3KR7 A;  4N4T A;  4UVU A;  4BUD A;  4PNM A;  4UI5 A;  3KR8 A;  4UVV A;  4L2G A;  4L7L A;  4UW1 A;  4OA7 A;  4GV7 A;  4TKI A;  4BU6 A;  2RD6 A;  3GOY A;  5ADS A;  3P0Q A;  3P0N A;  4PNT A;  4J21 A;  4UVW A;  4HLH A;  5LXP A;  3L3L A;  4OPX C;  4MT9 A;  2RF5 A;  4L7U A;  4N3R A;  4UVS A;  4W6E A;  4HLG A;  5A00 A;  3SE2 A;  4HKI A;  1A26 A;  4GV2 A;  4U6A A;  4BU8 A;  4X52 A;  4UFY A;  4AVW A;  4F1L A;  4HLK A;  3GJW A;  4DVI A;  5FPF A;  4UVZ A;  4PAX A;  4HKN A;  1PAX A;  1GS0 A;  4ZZX A;  4L7N A;  4L0V A;  1EFY A;  4BU5 A;  4J1Z A;  4PNR A;  4K4E A;  2PAX A;  4RV6 A;  4TKG A;  4L0T A;  5AEH A;  4MSG A;  4BUX A;  4N4V A;  4BU3 A;  3GEY A;  4L70 A;  4J3M A;  4PY4 A;  5AKW A;  1UK1 A;  4OQA C;  4HHZ A;  3FHB A;  3W51 A;  4BS4 A;  4UVP A;  3L3M A;  3UA9 A;  4UVX A;  2RCW A;  5FPG A;  4M7B A;  4L31 A;  4L0B A;  5DCZ A;  4F0E A;  1UK0 A;  3P0P A;  4R5W A;  4L0I A;  4LI8 A;  4KZU A;  4W5S A;  5AL5 A;  4TKF A;  4BUA A;  4TK5 A;  4BUF A;  4L6S A;  4HHY A;  4R6E A;  5AL4 A;  1WOK A;  3MHJ A;  4GV4 A;  4J22 A;  4UHG A;  4L34 A;  4F1Q A;  5LX6 A;  2X5Y A;  5AL2 A;  4BJC A;  3PAX A;  4KZQ A;  3MHK A;  3HKV A;  4TOR A;  3U9H A;  4BUU A;  4BUS A;  5AL1 A;  4L2F A;  4BUT A;  4UI3 A;  4OQB C;  3UH4 A;  4UI4 A;  4XHU A;  3U9Y A;  5LYH A;  4BUV A;  4LI6 A;  4PJT A;  3C49 A;  5C5P A;  4DQY C;  4K4F A;  4L7R A;  4HL5 A;  4PNQ A;  5AKU A; 
#chains in the Genus database with same CATH topology
 2PY7 X;  4TJY A;  4WL8 A;  4L0S A;  4UVL A;  4L33 A;  4UVN A;  4BUY A;  4TJU A;  4UX4 A;  4UFU A;  3SMI A;  4BU9 A;  3SMJ A;  4HL5 A;  4L2K A;  4L32 A;  5ADQ A;  4UVY A;  4L7P A;  4AVU A;  4HLF A;  4HYF A;  1YGG A;  4HLM A;  4J3L A;  4TJW A;  1M51 A;  4GMM A;  3CE0 A;  3KJD A;  4L7O A;  5FH5 A;  3MOE A;  1YVY A;  4UVO A;  5AL3 A;  4BUE A;  4I9I A;  4HMH A;  4L10 A;  4TOS A;  5ADT A;  3MOF A;  1OEN A;  2PXZ X;  2PC9 A;  4UI6 A;  4UVT A;  3BLJ A;  3KCZ A;  4KZL A;  4WPU A;  4UXB A;  5ECE A;  1K3C A;  4UI8 A;  4YWB A;  4PJV A;  5I67 A;  5EBT A;  2QF1 A;  4LI7 A;  5FH0 A;  3UH2 A;  4BJ9 A;  4PNS A;  4L09 A;  4PNL A;  4W5I A;  4BJB A;  5FH4 A;  4WPT A;  4HKK A;  5ETY A;  2PAW A;  4GNP A;  1AQ2 A;  4IUE A;  2PQF A;  5FH1 A;  4BU7 A;  4BUW A;  4KRS A;  3C4H A;  4PML A;  4GV0 A;  4TVJ A;  4UUH A;  4UND A;  2OLQ A;  4WIU A;  5C5R A;  3GN7 A;  3MOH A;  4L6Z A;  4BFP A;  4BUI A;  4PNN A;  4ZZZ A;  5ADR A;  4ZZY A;  3UDD A;  5C5Q A;  4UI7 A;  4MSK A;  4YW9 A;  4TK0 A;  1OS1 A;  3KR7 A;  4N4T A;  4UVU A;  4BUD A;  4PNM A;  4UI5 A;  3KR8 A;  4UVV A;  1KHF A;  4L2G A;  4L7L A;  4UW1 A;  4OA7 A;  4GMW A;  2RKA A;  4GV7 A;  1KHE A;  2RD6 A;  3GOY A;  4TKI A;  4BU6 A;  5ADS A;  3P0Q A;  3P0N A;  4PNT A;  4J21 A;  4UVW A;  4OX2 A;  2FAF A;  4HLH A;  5LXP A;  1YTM A;  1NHX A;  3L3L A;  4OPX C;  2RKD A;  4MT9 A;  2RF5 A;  4L7U A;  4N3R A;  4UVS A;  2QZY A;  4HLG A;  4W6E A;  4WIE A;  5A00 A;  4HKI A;  3DTB A;  1A26 A;  4GV2 A;  4U6A A;  4BU8 A;  4X52 A;  4UFY A;  4GNM A;  4AVW A;  2OLR A;  4GMU A;  1J3B A;  4F1L A;  4HLK A;  4R43 A;  3GJW A;  4YWD A;  2QEW A;  2ZCI A;  4DVI A;  5FPF A;  4UVZ A;  4PAX A;  4HKN A;  1YLH A;  1AYL A;  1PAX A;  1GS0 A;  4ZZX A;  4L7N A;  4L0V A;  1EFY A;  4BU5 A;  4J1Z A;  4PNR A;  4K4E A;  2PAX A;  4RV6 A;  4TKG A;  4L0T A;  5AEH A;  4MSG A;  4BUX A;  4N4V A;  4BU3 A;  3GEY A;  4GMZ A;  4J3M A;  4L70 A;  4PY4 A;  1UK1 A;  4WOU A;  5AKW A;  2GMV A;  2RKE A;  4RCG A;  2QEY A;  4OQA C;  4HHZ A;  3FHB A;  3SE2 A;  3W51 A;  4BS4 A;  4UVP A;  3L3M A;  3UA9 A;  3DT4 A;  3DT2 A;  4UVX A;  5FPG A;  4M7B A;  4L31 A;  4L0B A;  2RK7 A;  5DCZ A;  4WPV A;  4F0E A;  1UK0 A;  3P0P A;  4R5W A;  5FH3 A;  5FH2 A;  4L0I A;  1XKV A;  4LI8 A;  4KZU A;  4W5S A;  5AL5 A;  4TKF A;  4BUA A;  4TK5 A;  4BUF A;  4L6S A;  3DT7 A;  4GNQ A;  4HHY A;  4R6E A;  5AL4 A;  1WOK A;  3MHJ A;  4GV4 A;  4J22 A;  4UHG A;  4L34 A;  4F1Q A;  5LX6 A;  2X5Y A;  5AL2 A;  4BJC A;  2FAH A;  3PAX A;  3MHK A;  3HKV A;  4KZQ A;  4TOR A;  3U9H A;  4BUU A;  4BUS A;  1K3D A;  4GNL A;  5AL1 A;  4L2F A;  4YW8 A;  4BUT A;  4UI3 A;  4OQB C;  4GNO A;  4L7R A;  3UH4 A;  2RK8 A;  1KHG A;  4UI4 A;  4XHU A;  3U9Y A;  5LYH A;  1II2 A;  4BUV A;  4LI6 A;  4PJT A;  3C49 A;  1KHB A;  5C5P A;  4DQY C;  4K4F A;  2QF2 A;  2RCW A;  4PNQ A;  5AKU A; 
#chains in the Genus database with same CATH homology
 2PY7 X;  4TJY A;  4WL8 A;  4L0S A;  4UVL A;  4L33 A;  4UVN A;  4BUY A;  4TJU A;  4UX4 A;  4UFU A;  3SMI A;  4BU9 A;  3SMJ A;  4HL5 A;  4L2K A;  4L32 A;  5ADQ A;  4UVY A;  4L7P A;  4AVU A;  4HLF A;  4HYF A;  1YGG A;  4HLM A;  4J3L A;  4TJW A;  1M51 A;  4GMM A;  3CE0 A;  3KJD A;  4L7O A;  5FH5 A;  3MOE A;  1YVY A;  4UVO A;  5AL3 A;  4BUE A;  4I9I A;  4HMH A;  4L10 A;  4TOS A;  5ADT A;  3MOF A;  1OEN A;  2PXZ X;  2PC9 A;  4UI6 A;  4UVT A;  3BLJ A;  3KCZ A;  4KZL A;  4WPU A;  4UXB A;  5ECE A;  1K3C A;  4UI8 A;  4YWB A;  4PJV A;  5I67 A;  5EBT A;  2QF1 A;  4LI7 A;  5FH0 A;  3UH2 A;  4BJ9 A;  4PNS A;  4L09 A;  4PNL A;  4W5I A;  4BJB A;  5FH4 A;  4WPT A;  4HKK A;  5ETY A;  2PAW A;  4GNP A;  1AQ2 A;  4IUE A;  2PQF A;  5FH1 A;  4BU7 A;  4BUW A;  4KRS A;  3C4H A;  4PML A;  4GV0 A;  4TVJ A;  4UUH A;  4UND A;  2OLQ A;  4WIU A;  5C5R A;  3GN7 A;  3MOH A;  4L6Z A;  4BFP A;  4BUI A;  4PNN A;  4ZZZ A;  5ADR A;  4ZZY A;  3UDD A;  5C5Q A;  4UI7 A;  4MSK A;  4YW9 A;  4TK0 A;  1OS1 A;  3KR7 A;  4N4T A;  4UVU A;  4BUD A;  4PNM A;  4UI5 A;  3KR8 A;  4UVV A;  1KHF A;  4L2G A;  4L7L A;  4UW1 A;  4OA7 A;  4GMW A;  2RKA A;  4GV7 A;  1KHE A;  2RD6 A;  3GOY A;  4TKI A;  4BU6 A;  5ADS A;  3P0Q A;  3P0N A;  4PNT A;  4J21 A;  4UVW A;  4OX2 A;  2FAF A;  4HLH A;  5LXP A;  1YTM A;  1NHX A;  3L3L A;  4OPX C;  2RKD A;  4MT9 A;  2RF5 A;  4L7U A;  4N3R A;  4UVS A;  2QZY A;  4HLG A;  4W6E A;  4WIE A;  5A00 A;  4HKI A;  3DTB A;  1A26 A;  4GV2 A;  4U6A A;  4BU8 A;  4X52 A;  4UFY A;  4GNM A;  4AVW A;  2OLR A;  4GMU A;  1J3B A;  4F1L A;  4HLK A;  4R43 A;  3GJW A;  4YWD A;  2QEW A;  2ZCI A;  4DVI A;  5FPF A;  4UVZ A;  4PAX A;  4HKN A;  1YLH A;  1AYL A;  1PAX A;  1GS0 A;  4ZZX A;  4L7N A;  4L0V A;  1EFY A;  4BU5 A;  4J1Z A;  4PNR A;  4K4E A;  2PAX A;  4RV6 A;  4TKG A;  4L0T A;  5AEH A;  4MSG A;  4BUX A;  4N4V A;  4BU3 A;  3GEY A;  4GMZ A;  4J3M A;  4L70 A;  4PY4 A;  1UK1 A;  4WOU A;  5AKW A;  2GMV A;  2RKE A;  4RCG A;  2QEY A;  4OQA C;  4HHZ A;  3FHB A;  3SE2 A;  3W51 A;  4BS4 A;  4UVP A;  3L3M A;  3UA9 A;  3DT4 A;  3DT2 A;  4UVX A;  5FPG A;  4M7B A;  4L31 A;  4L0B A;  2RK7 A;  5DCZ A;  4WPV A;  4F0E A;  1UK0 A;  3P0P A;  4R5W A;  5FH3 A;  5FH2 A;  4L0I A;  1XKV A;  4LI8 A;  4KZU A;  4W5S A;  5AL5 A;  4TKF A;  4BUA A;  4TK5 A;  4BUF A;  4L6S A;  3DT7 A;  4GNQ A;  4HHY A;  4R6E A;  5AL4 A;  1WOK A;  3MHJ A;  4GV4 A;  4J22 A;  4UHG A;  4L34 A;  4F1Q A;  5LX6 A;  2X5Y A;  5AL2 A;  4BJC A;  2FAH A;  3PAX A;  3MHK A;  3HKV A;  4KZQ A;  4TOR A;  3U9H A;  4BUU A;  4BUS A;  1K3D A;  4GNL A;  5AL1 A;  4L2F A;  4YW8 A;  4BUT A;  4UI3 A;  4OQB C;  4GNO A;  4L7R A;  3UH4 A;  2RK8 A;  1KHG A;  4UI4 A;  4XHU A;  3U9Y A;  5LYH A;  1II2 A;  4BUV A;  4LI6 A;  4PJT A;  3C49 A;  1KHB A;  5C5P A;  4DQY C;  4K4F A;  2QF2 A;  2RCW A;  4PNQ A;  5AKU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...