4BVAA

Crystal structure of the nadph-t3 form of mouse mu-crystallin.
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
311
structure length
303
Chain Sequence
KRAPAFLSAEEVQDHLRSSSLLIPPLEAALANFSKGPDGGVMQPVRTVVPVAKHRGFLGVMPAYSAAEDALTTKLVTFYESHQASVLLFDPSNGSLLAVMDGNVITAKRTAAVSAIATKLLKPPGSDVLCILGAGVQAYSHYEIFTEQFSFKEVRMWNRTRENAEKFASTVQGDVRVCSSVQEAVTGADVIITVTMATEPILFGEWVKPGAHINAVGASRPDWRELDDELMRQAVLYVDSREAALKESGDVLLSGADIFAELGEVISGAKPAHCEKTTVFKSLGMAVEDLVAAKLVYDSWSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Mouse Mu-Crystallin Complexed with Nadph and the T3 Thyroid Hormone
pubmed doi rcsb
source organism Mus musculus
molecule tags Oxidoreductase
molecule keywords THIOMORPHOLINE-CARBOXYLATE DEHYDROGENASE
total genus 107
structure length 303
sequence length 311
chains with identical sequence B
ec nomenclature ec 1.5.1.25: Thiomorpholine-carboxylate dehydrogenase.
pdb deposition date 2013-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02423 OCD_Mu_crystall Ornithine cyclodeaminase/mu-crystallin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1780.10 Alpha Beta 2-Layer Sandwich ornithine cyclodeaminase, domain 1 ornithine cyclodeaminase, domain 1 4bvaA01
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4bvaA02
3E8XA 2C07A 1ZMOA 1YQGA 4FBGA 4WJZA 1DFGA 1DPGA 1NX6A 4UVIA 4BGIA 4DIFA 4EYEA 4MVJP 2O3UA 1ADBA 3ITKA 3VPSA 4ZN6A 4QQRA 1FDVA 1DLJA 2Q46A 3A9WA 3ZCXA 4CM9D 3GNSA 1F0YA 4I1IA 4I5EA 1Y9EA 2R2GA 1E3WA 3AOGA 3JQFA 1A9ZA 1BW9A 1GQYA 3KYCA 3RKUA 4FC6A 3JQ8A 1R4MB 3AY3A 2O7SA 4K26A 4W82A 2NQTA 2ZYAA 2C82A 5A02A 1NVMB 4DIOA 3ZHBA 4BO3A 2EEZA 4NJMA 4F6LA 1N1EA 3FPCA 4WK6A 4Q9NA 1MC5A 3ZHZA 3JSAA 1I24A 2EWMA 2ZATA 4JIGA 1NXQA 4YEDA 3TQHA 1DC6A 1WMAA 4EUHA 3H7AA 4N5MA 1ISJA 3RC1A 5LDHA 3U4IA 2DTDA 4MP3A 4HX5A 2GRAA 3L4SO 4BS9A 3GAFA 4NBVA 5JCJD 1SBYA 1DO8A 2YZ7A 4CQLA 2R6JA 2DBVO 3I6QA 1H6CA 1HETA 3PGJA 1OMOA 3INRA 2FZWA 4MINA 4R1TA 5BNTA 3B6ZA 3GH3A 5ILGA 4DRYA 1G1AA 4ESOA 3F4LA 2A94A 5DZSA 1GEEA 2A35A 2YUTA 1KIFA 3VPHA 3M1AA 3WTCA 5AXDA 3JQAA 2IZZA 3ZH2A 1IHYA 3DBLA 4M49A 4IY1A 3ZWWA 1GYQA 4R69A 4DA9A 3LT1A 4NPCA 4MVJF 5I7VA 2EF1A 4OJNA 1QSGA 1C1DB 5FFFA 4Q3CA 4ZQGA 4BO1A 4R5HA 3DOCA 1MG0A 4OQZA 1DDOA 1NAHA 3I1JA 1W73A 4Y67A 1HDGO 1CWUA 1T24A 3CUKA 4RDIA 1XGKA 2Q1WA 1EQUA 4H7PA 4RPHA 5G0SA 1GQ2A 4NZ9A 1VSUA 4QEDA 5DULA 1SC6A 4FFLA 2IEDA 5EPOA 4YRBA 2Q3EA 3ONDA 4IMRA 5ENVA 3K2BA 3D64A 3JQ7B 4F6CA 3O4RA 5JYEA 1ISFA 1DAPA 3ROKA 3GFBA 1ULUA 1OBFO 4I9UA 1MFZA 3NTOA 2PR2A 1DHTA 1IL0A 4B8ZA 2Y66A 1L7EA 2AW5A 5G4LA 2B0JA 1KERA 3AU9A 2GN6A 3PI7A 3WBFA 4W9NC 3EVNA 1P9LA 1KVUA 3WGQA 4JP3A 4F46A 9LDBA 5T8KA 3EZLA 3WXBA 4AJPA 2ZKLA 5IZCA 3PVZA 1PZEA 1QYCA 3CZMA 2ZIZA 4BUCA 1K6JA 1LRKA 3FBGA 1V35A 3FN4A 3LSYA 1EDOA 3I9NA 4WLVA 3PFFA 2YHIB 3HSKA 5G2OA 1H6BA 2PKRA 4QECA 1FXSA 1DIHA 1X0XA 2XOXA 1UR5A 2D5CA 3GVCA 3W8DA 4LRSB 1X14A 1KEVA 2E48A 1U5AA 4BMNA 4FGWA 4Q3EA 1SEPA 1DSSG 1YVEI 3INGA 4UUPA 4CUZA 3TOXA 5JYDA 5JMWA 1AE1A 4TQGA 1JWAB 2Z1MA 3IJPA 4NBTA 4EEZA 1PR3A 2FP4A 5G4KB 1EFKA 2Y1DA 3VC7A 1O94A 4NBUA 3D4PA 4RPLA 3WGYA 3D7LA 2AMFA 3FWNA 3K2EA 4PRLA 4E2XA 1JAYA 2NTVA 1DIRA 1MGOA 2P91A 1GUZA 1K89A 3OH8A 4KWIA 3OQBA 4G65A 3WR5A 4MDHA 4QFCA 1YJQA 3IL2A 4L8VA 5TT1A 1UZNA 4J7UA 3RQSA 3HDJA 4J49A 3UCFA 4EI2A 3VH1A 1A71A 3H6KA 4ITUA 2DU8A 2X86A 2PGJA 2ZB8A 1U7TA 1AHIA 2GR9A 3Q0EA 1PU2A 3JQGA 1UAGA 2NTNA 3I83A 3BMOA 3V1TC 1G6KA 4ZGWA 3ZHYA 3RC9A 4JXKA 4BO6A 1MFPA 4LVCA 1JVBA 2JD1A 1YOVB 3ASUA 1OFGA 4BNZA 3GDFA 4S3MA 3QVTA 4J1TA 4Z9XA 1FMCA 2EW8A 1HLDA 4PLFA 2OFPA 2BFPA 4J7CA 4NK5A 5LDGA 4I8XA 1P0FA 2B35A 5ENDA 1GADO 1GZ4A 1DRWA 1E0DA 2PV7A 2DPGA 2Z5LA 4CM4A 3GHYA 1X1TA 2O2SA 5AXBA 3HHPA 4B4VA 5IJZA 1QP8A 4D43A 5TLSA 5TS3A 5A04A 3JYQA 2EKPA 3U4CA 4EUEA 5IFLA 4KDFA 5CDSA 3C1TA 3OEYA 5JAIA 3GQVA 3PIIA 1LEHA 4AL4A 2HMUA 3T4EA 1NHWA 1CQJA 1WDLA 3GR6A 4YYZA 1LDMA 4EDFA 3C7DB 3MTGA 1X13A 5DF1A 4NQZA 3BXXA 4BO4A 2AG5A 4CM6A 2VT2A 4Q3NA 2VWGA 4U0KA 1NQOA 2A9FA 4FSHA 1WLYA 4ND2A 1AUPA 3RJ9A 2YY7A 1Z73A 1KEPA 4RVSA 2V7PA 4EW6A 5KJ1A 2H9IA 3OA0A 1J5PA 4TRJA 2PNFA 3C7AA 3TZHA 3DBHA 3QHAA 1B8UA 4LISA 3ZWMA 1E3IA 2DFVA 4XQEA 4XRRA 1U5CA 1QXSA 4IUYA 4NG5A 1XG5A 3RC2A 4Q3DA 4MKRA 2EKLA 1T2AA 1EEHA 5H81A 4F45A 4GX0A 1R4NB 1P1KA 2PTGA 5DNAA 1ID1A 2PA3A 1E7SA 4FR5A 1F17A 1QYWA 2GSDA 4BKQA 2RHCA 1WW8A 1P1HA 3NT4A 2DC1A 2CF5A 2Q49A 1NQTA 4P22A 5KJEA 1M76A 4KP7A 1DJNA 4J43A 2Q99A 4RCVA 2XXJA 1I36A 3UICA 4J4HA 1JQBA 2WYWA 3FD8A 3WIDA 5BSHA 4D41A 1U28A 4HUJA 5EL0A 2DFDA 4CLDA 1H93A 3ZW8A 5THQA 4X54A 2WD7A 2GGSA 3OM9A 4PLHA 2C7GA 4WE3A 5H83A 4FC7A 1WDMA 4NNJA 4MP6A 2D0IA 2O3TA 1UDAA 1TA4A 4BNIA 4YJHB 5ER9A 3IUSA 3C85A 4PCVA 1Y81A 4YBZA 1ZXBA 3WNVA 4WECA 1HLPA 4YDRA 5L7TA 2PZMA 2BFOA 4W6ZA 2P9EA 4CMHA 1VM6A 1HSOA 3QLJA 4IBOA 1PS0A 4D3FA 1C0IA 4BKUA 5BQFA 2DUUA 3EW7A 4GKVA 2ET6A 3BMCB 3GFGA 5IF3A 5TQVA 1K5HA 1KOLA 1EQ2A 3ZWVA 3LC7O 1VE9A 2BMAA 2J5QA 4LCEA 3C24A 2G5CA 1B15A 2GN4A 2R00A 3KYDA 4K6FA 1UUFA 1N5DA 2V6FA 4JNKA 1HKUA 4NJOA 1LBEA 1XQ6A 2EV9A 1LQTA 3OJFA 3VDRA 2NLOA 1P0CA 2V6MA 3GGOA 5B37A 4HKTA 5L51A 5G0VA 3DONA 2WTBA 2CVOA 2I67A 2VCYA 2WE8A 2B5WA 5T57A 2AEJA 2FPIA 3TSCA 4XJSA 5JCJA 3RD5A 1EK5A 3NT5A 1U4SA 3IS3A 3L0DA 4JROA 2EP7A 4BOYA 4FFOA 2W2LD 4GX5A 2X4GA 2YQ5A 3UH1A 5CG2A 3FSRA 3KRTA 4BL5A 1D7OA 4QFDA 4L4RA 4OM8A 1ZSVA 2E37A 3P7MA 5KOIA 1TLTA 1DIGA 1NQ5A 1E1KA 1UZLA 1ZXLA 1DXYA 2XAAA 2ZCUA 1U3TA 2EGHA 3PJEA 4LMPA 2X22A 5JSFA 2HMTA 2IODA 1N9GA 2CF6A 3QV1A 5JE8A 4L74A 2GERA 5DCYA 4WEQA 1LTHR 2E4AA 1N8KA 3JYNA 4IQGA 2VRBA 1A7KA 8LDHA 3AM5A 3D0OA 2J3JA 2ZQZA 3GUCA 1ZIDA 1E6UA 2JJYA 3WGTA 4HP8A 3AW9A 3FTNA 1UAYA 1ZMTA 2X9NA 4IJKA 2WD8A 3A4VA 1VL8A 2EHDA 4N54A 1YQXA 2O2YA 3JQEA 2G1UA 1PWZA 1R0LA 3FPLA 1I01A 1Y8RA 1GZ6A 1LDYA 1MP0A 4I5FA 1NHGA 2Q50A 4IDAA 4CQMA 1LDBA 4OAQA 4ZRMA 1DEHA 5IDYA 5JC8A 1EUZA 2VT3A 4CV0A 5B4UA 4DL9A 3K6JA 3QVOA 1VPDA 1UXGA 1NYTA 2C2YA 3BTUA 5JO0A 4EJ0A 3TL2A 1EE2A 5L4NA 4CUKA 3FR8A 1BHSA 3QWFA 1O9BA 1WP4A 3R1IA 3V5NA 5BNFA 4WGGA 4CMIA 1WNTA 4NR0A 3MWDB 3TOZA 2F00A 4YAIA 1ORRA 3JTMA 5F1KA 3DBRB 3ZU2A 3NX4A 3ZWCA 3OP4A 4IZHA 4NBWA 4FIZA 1OZAA 3U49A 4E30A 1YH3A 3JD3A 4KQWA 4PG4A 5F3RA 4DBZA 4UUOA 5U1PA 4U5QA 2CDAA 3BMQA 3PQDA 4TZTA 3AUAA 5EQDA 3UAGA 4YAJA 2WD7B 4XYMA 4J2HA 5IG2A 4B4OA 2WJPA 4NK4A 4J3FA 4B7CA 2PKQO 4YWJA 4E12A 2ZJ0A 1Q0HA 2VNSA 2VWQA 1BXGA 4FGSA 4AJIA 2VZ9A 4LW8A 2W2KB 1MUUA 2G17A 3HDQA 1H5QA 4YJFA 1NNUA 5C3MA 5CDTA 4M87A 4IQ0A 2QRLA 4R1SA 4A03A 5T6BA 3SX2A 3OEWA 4YRAA 5G0WA 1DIAA 3EY4A 3LZ6A 3P19A 1GY8A 1HT0A 2O23A 1W6UA 4GH5A 3W1VA 5C7IO 4BNGA 3GVIA 2Y1OA 4HADA 3ZWAA 3H9EO 3AI2A 4PG5A 1U9JA 3CZRA 3KBOA 1G0OA 4DMLA 2Y67A 4ND3A 4RZHA 1JVSA 2NU6A 3N58A 1RM5A 2PH3A 1OAAA 4GKBA 4DPKA 4L4SA 3L6OO 4IINA 3WQRA 3ADPA 4P4NA 5TGDA 3H9JA 1I32A 2ZTUA 3GLQA 3C7CB 3GGPA 2BHLA 4E5NA 4KOAA 4F3YA 2JFGA 3LYLA 5MDHA 3OETA 1Q7BA 1Z7EA 1MXHA 1A27A 4XDYA 4BVAA 1XDWA 1A7AA 4WASA 1R0SA 5A9SB 4GSLA 4K9DA 4D42A 4NHEA 3PZRA 1HXHA 2FR1A 2Q45A 5CHEA 1HYHA 2CY0A 1PJTA 2VQ3A 1UJMA 2ZK7A 3GRPA 2P9GA 4NFYA 3AM4A 3B1KA 3EAGA 3HJAA 2B37A 2Q1UA 5KVQA 2BLLA 1I2CA 2GUGA 3G49A 1XLTA 3GUYA 1ZFNA 5JBIA 4Z3DA 2HAEA 3WSVA 1C1DA 2D3TA 2WM3A 1RM0A 1O5IA 1YDEA 1DIBA 3QJ5A 2NM0A 2LDBA 4AVYA 4RVHA 2DVMA 4BO8A 1BWSA 2FN7A 4H16A 5L3ZA 2NQ8A 3WYBA 1H2BA 3L07A 1ZUD1 1ZJZA 3VZPA 2C0CA 4IDFA 4GMGA 5ICMA 1MX3A 3FBTA 1LSOA 4QSMA 1E5LA 2HJRA 4BMSA 4Z0PA 2OBYA 3UCXA 2UYYA 4URFA 2C20A 3PEFA 2CVZA 2GPTA 2RIRA 2UAGA 3PWSA 4WKGA 5EESA 4ZD6A 9LDTA 4IQ8A 3NTQA 4YRDA 4GSKA 4R01A 1EUCA 1Q2XA 1PWXA 4OIMA 3WFJA 2Y1FA 3D3EA 3IMFA 2YYYA 3H65A 4BNYA 1ISGA 5TIIA 1F8FA 1FDTA 3K30A 3JD0A 3S2IA 2W90A 4GWGA 1VL0A 1I5RA 2DM6A 3DZGA 4I5GA 1AXGA 2IEBA 1XCBA 1DHRA 3GAZA 4GAEA 4NBRA 5L95A 2VZ0A 2VYVD 3FNFA 3VZQA 1VLLA 4MVJH 4BQRA 2CDBA 5DN9A 1P1IA 3ZNNA 3FNHA 3ZDFA 2YV1A 3DHEA 3L4BA 2IE0A 3ONFA 4R51A 4Z9YA 1MLDA 2P5YA 2J8ZA 4DYDA 4CLOB 1R4MA 2AQIA 3MJ4A 2ZYDA 3NDJA 1ENOA 1MXFA 3HB4X 3GGGA 1RWBA 3D4NA 4G5HA 4I9NA 3NV9A 3RSHA 5DOZA 2YQ4A 4BGUA 2ZB3A 1M75A 4RZIA 3RVDA 4YVFA 3U9LA 1A9YA 2YHIA 3DBRA 1WZIA 5AQ1A 3MJTA 2W98A 1SCUA 1T2FA 2WWRA 1Q1NA 2ZTVA 2C7VA 3PHIA 3ZI0A 1N2SA 3WX0A 1GZ3A 3GOHA 3PXXA 5DCUA 3VPFA 6LDHA 4BB5A 4N5LA 3H3FA 5HA5A 2Z95A 4DIBA 5TJHA 4KUEA 4TSKA 1Z74A 5C5IA 4WUVA 4UVHA 4A2CA 1BXGB 4E33A 2E49A 3KYDB 4ALKA 4CQMB 5GMOA 3IIEA 1EDZA 3VPGA 5JY6A 1IUKA 2C29D 4RQTA 2YJZA 3E5RA 4CQLB 3BZUA 4FD3A 2FR8A 3CE6A 5JNLA 3JQ7A 3GDOA 3KEQA 3DR3A 1V9LA 4HNHA 4ALMA 4EEXA 3DHYA 4AJNA 5F5NA 1ZK1A 3NRCA 3D4OA 2I99A 4PLTA 3DAGA 1C1XA 3NT2A 1Q7CA 3VH2A 2FSSA 1IY8A 4IS2A 4RVFA 1I2ZA 1LSSA 1KVTA 4NFHA 3WMXA 3X2EA 5HWSA 3KVOA 1ZK2A 4M86A 1LLQA 3ZWNA 3UF0A 1GPJA 2Y05A 2Q4BA 1CYDA 4MKXA 3DBLB 1Y1PA 5IDWA 3MZ0A 4CL8A 3ONEA 4BNKA 1YRLA 2EJWA 2GF2A 5A3JA 1Y5RA 2QRJA 2Q1SA 1C3VA 2VHXA 2NADA 1WDKA 2HCTA 3L6EA 4FJ2A 3WFIA 3SJUA 1T1SA 2J5KA 2BI8A 3I9OA 4B7XA 3VVCA 1HE3A 1GQQA 2HMVA 1SO8A 2O3QA 4CR8A 3AFMA 4ZA2A 2IXAA 3NDRA 4HXYA 1Y8RB 2DT5A 3AOEA 3GMDA 1B14A 2WDZA 4XWYA 1KVSA 3ITDA 4XB2A 1B2LA 1BSVA 4JQCA 4RF2A 1KETA 1PJ2A 3JQAD 3IP3A 3PHJA 5FI5A 1GU7A 3LC1O 2IZ1A 4CMGA 1HE4A 1U3WA 2HK9A 2B5VA 3MJCA 3UGKA 2ZCVA 3AFNA 3KZVA 3PZBA 2O4UX 2V65A 2Y0CA 2Q2QA 3AUUA 4YCAA 4CLRB 4XGKA 5JO9A 3RBXA 2CFCA 5JAZA 1YL7A 5KKCA 3F47A 2X9VA 5G0UA 4JCOA 4U6QA 2AA3A 1FK8A 1Y6JA 3QW2A 2I3AA 2QQ5A 2NU8A 3DZJA 4E2ZA 4XYEA 1SPXA 5A06A 2RH8A 1H2HA 2HDHA 1BTOA 3RUAA 4QO7A 1Z7BA 3RROA 4YT2A 4OKNA 5H82A 4M89A 3RFTA 2X0RA 4IMPA 3IKVA 2ILTA 4JBIA 4QTZA 5ITVA 1TI7A 1MB4A 4E32A 2DLDA 1GD1O 1NPDA 4M1QA 3TZQA 2VZ8A 3G0OA 3IP1A 4FFPA 1DC3A 1B8VA 2DPHA 4XGIA 4XRGA 3ENNA 3QVXA 3BA1A 4RDHA 3PWKA 1ZNQO 1LXCA 2FOIA 1ZK0A 1EK6A 3AUTA 4OXNA 3S1LA 4GX2A 3WJAA 2XPCA 1VI2A 4CUJA 3LVFO 1C0KA 3I9JA 3KHUA 4ALIA 2HK7A 3SC4A 2P4QA 2AHRA 1ZEJA 4UAGA 2IRWA 1E3JA 2V6GA 3BMNA 4GVXA 1FDSA 1VJ1A 1P1JA 3W8FA 4BNFA 3DAPA 1BRMA 1I3MA 4A0SA 4YAGA 1R4NA 3I52A 1XR3A 3EK2A 5U4QA 5DOVA 5HTOA 2J5RA 2CSUA 1GAEO 3BMOB 5DBGA 5IN5A 2NU7A 3O9ZA 4XIYA 1YXMA 3JQGB 4OGWA 4XCVA 4R41A 4MVJI 1T2DA 3UKOA 4B4WA 2DBRA 3VH4A 1LLCA 4KMSA 4LRTB 3DBHB 3FI9A 3WWZA 3NKLA 3VZSA 1PJCA 5KVVA 3PDJA 1YBMA 4H3VA 5L4LA 5I7FA 4ZU3A 2W8ZA 3ZNPA 2X5KO 4D3DA 5ER6A 3RC7A 1EVIA 2PY6A 2UUPA 2BFAA 5LC1A 1IZ9A 3CKYA 5EJ2A 3X2FA 4TKLA 5KJFA 3GG9A 3M1LA 4E13A 1P3DA 3QWBA 1PJBA 2DUWA 3VPXA 4CMBA 2BGKA 3MWEB 1Q0QA 2X0JA 4AG3A 1M66A 4BKRA 4MIYA 5J23A 3OA2A 1P1RA 2VUTA 4MOWA 4CLRA 4IM7A 3VZRA 3JD2A 1CIVA 4OQYA 4MVJA 2LDXA 1GL3A 1L7DA 3I4CA 3JYLA 1Y8QA 2HU2A 5F21A 1GUYA 3RFXA 4HFJA 1F12A 2RHRA 3IC5A 4Q3AA 4CMJA 5C7LO 4W4TA 2VHWA 3GZNA 3DMYA 1DC5A 1PZGA 4E3ZA 2G76A 4CMEC 2Y99A 1E7YA 3DTTA 3SEFA 1YOVA 2X6TA 4ND4A 1PQUA 5U9CA 1YBVA 4GMFA 2GLXA 1YGYA 4TMFA 1B3BA 2BKAA 2DQ4A 1TXGA 5JY1A 4MKZA 4KDEA 4NH4A 5TNXA 4CLEA 4Y9DA 3V8BA 4PG8A 4E0BA 1NFRA 4MVJM 3NJ4A 3S2EA 4J1QA 3GPIA 2GDZA 3ENKA 4JN6B 4CM5A 3OJOA 3R3SA 3PFWO 2VOJA 4XQ9A 5K0ZA 4IJWA 3QWIA 2O3RA 1H0KA 1SAYA 4DUPA 1ZVMA 1YQDA 1FJHA 4OOEA 4PZDA 3H9QA 1PQPA 3F5SA 3BAZA 4K28A 1E6EA 2GD1O 1SEVA 3OBBA 2QZZA 5A9TA 3DMTC 2I5PO 4RPGA 3ZV5A 3JCZA 1NPYA 1PL7A 1OC2A 2C5AA 4WLEA 2H1SA 3EYWA 2E82A 5I7SA 2F1KA 3GNTA 2Q4EA 5AOVA 2FZEA 3I6IA 4XKJA 3BYZA 5JDIA 4FOSA 1CERA 4HY3A 1E5QA 1PJQA 3RJ5A 3EMKA 4PG6A 4UVEA 4L73A 1R66A 1ZJYA 3PLNA 4JP2A 1KS9A 2FMUA 4PG7A 3GVXA 1UXKA 3EHEA 4WLOA 1KEUA 3Q9NA 5JS6A 5DP2A 2AQKA 2P4HX 4PVCA 1P33A 1T25A 1R6DA 4TRNA 1UP6A 3GEGA 1B7GO 4EJ6A 5TT0A 5EINA 4Z6KA 3U0BA 2I9PA 5L4SA 3RU9A 2VYNA 3DAFA 3W4IA 2OO5A 4DLAA 2GNAA 1VRWA 3HN7A 4BO2A 4J4BA 4R54A 3FTPA 4N5NA 1U4OA 4WOKA 1GPDG 2UVDA 3EZYA 3E82A 2P5UA 4Y6PA 4YT5A 1BVRA 5I8WA 3B1FA 1ZW1A 2EKQA 2QIOA 3PQFA 4N7RA 4CLOA 1RJWA 1PJ4A 2A92A 3VOSA 2FR0A 5DT9A 4XYLA 2D5AA 1GR0A 4RF4A 1JAXA 1EUDA 4UEKA 5IZ4A 1XIVA 3M2PA 5L45A 1E3WB 4R16A 1VL6A 5F1PA 3O8QB 1WAMA 3RUDA 2J6IA 1PZHA 5CG1A 4AJ1A 1H6DA 3P2YA 4XIJA 5JDCA 3WICA 4AJ4A 2RAFA 4PIVA 1ADCA 3JQFC 3KB6A 1PX0A 4JJIA 4YQZA 3DFZA 3H9GA 3S2GA 3ASVA 3GPDG 4I5DA 1ML3A 1P31A 4E2WA 4AJEA 1I0ZA 2BRUA 2GZ3A 3CPSA 3MOIA 4YQYA 1IULA 3GG2A 3ZV6A 1D4FA 3ZU3A 3H5AA 3L77A 3RFVA 3BHJA 1PL6A 2D8AA 2OGUA 1U2DA 5TF4A 1F8GA 4FS3A 1VSVA 4FCCA 4MVJE 4R68A 4R1NA 1TT5B 5T8KC 1HEUA 2RBEA 1FDWA 3FR7A 5CDGA 1RM3A 1JW9B 4C7JA 1QYXA 1H94A 5EERA 1C14A 1NR7A 2PFGA 4J16A 1ZSYA 1PTJA 3UCEA 3BMNB 1KC3A 5JFOA 3AY7A 1BDBA 2YV2A 3ZU5A 1LX6A 2NTJA 5ICSA 2AEMA 1MV8A 3GK3A 3GRKA 1T2EA 2B4TO 4XB1A 5BT9A 2HKIA 4J91A 2G82A 1PQWA 4NDNE 2HO5A 3KTDA 1CDOA 4GGOA 4OSPA 2PZKA 2NVBA 4KQXA 4D7AA 3FHLA 2OMEA 3E6AA 2YDYA 1ONNA 1PJLA 4BB6A 1ZK4A 1G0NA 3H2SA 3JQDA 3JYOA 1YONA 3CXRA 1BW9B 1CJCA 3K96A 2NU9A 2I76A 1F14A 3JQ9C 1P74A 3C8MA 1LNQA 3DDNA 4ROSA 2YV3A 1XU7A 3PJDA 5A9SA 4IDDA 3PJGA 4KWHA 2VUSA 3U4DA 3WYEA 1O0SA 3I9KA 2JFFA 4RVGA 1NVGA 1T26A 4RLHA 1SB8A 2AG8A 4BNHA 2X9GA 4E5PA 1HDRA 1KEWA 1HE2A 3JQBA 4NIMA 2PH5A 3G1UA 5B4TA 2TMGA 4LK3A 2WMDA 3F3SA 3HDHA 1IZ0A 4AJ2A 4PZEA 2X5OA 3AWDA 3B70A 4D0SA 1I2BA 4RORA 2O50A 1CF2O 1OI7A 1LLDA 2HMWA 4GPD1 1DFIA 4J0FA 3KEOA 1DBVO 3MJEA 4CLHA 4E5MA 3H5NA 1OOEA 1VJ0A 2Y0DA 1GDHA 3LDHA 1Y8QB 3QE3A 2XXBA 3RUIA 2Y68A 5DBFA 2A4KA 4AFNA 1WZEA 2P2SA 3EGOA 3WOHA 3FRJA 4IJVA 2UV8A 4OOFA 3NUGA 2HMSA 1JWBB 4XR4A 4IDCA 4IS3A 3OECA 1NR1A 5T5QA 1ISMA 1ZCJA 4UEJA 1U1IA 4H15A 1LSJA 5I9NA 4D79A 3A14A 3PPIA 3RIHA 3N74A 3K8ZA 4R9SA 1HL3A 1WPQA 4GI2A 5AXAA 4G81A 1X7HA 5I8ZA 4GLOA 4E2YA 1C0LA 1N9GB 3JQBC 2EIHA 5CP8A 5JC1A 1R0KA 1YB5A 3QVWA 1J0XO 1DAOA 4TZKA 1NWHA 1HTBA 4ZVVA 3NYWA 5CPFA 2FWMX 4WCFB 2OP0A 1V8BA 3UXYA 4P8RA 4Z0TA 4EITA 3U5TA 3PGXA 4FW8A 5BSGA 1ADGA 1J49A 1VJTA 1X15A 4RQUA 1HDZA 3NEPX 7MDHA 1WVGA 1X7DA 1ZSNA 1EVZA 4PFJA 3RUHA 1LLUA 4E31A 1ULSA 4KTTE 4WNCA 1NAIA 4KZPA 5TSDA 1C1XB 2YFHA 4YACA 1E7WA 5JDIC 2OZPA 3TWOA 4RVDA 4CMAA 4IJUA 5CEEA 3RUEA 3QIVA 4LSMA 4EBFA 4AJOA 1R12A 2H6EA 2D2IA 3QP9A 5JAMA 1ZBQA 4FFRA 4Y6RA 3KYBA 5GZ6A 5FEUA 2Y1EA 1IB6A 3Q6IA 2WSBA 4OKIA 1M6HA 4LN1A 2CNBA 1EFLA 1PGPA 1SB9A 2EP5A 4R3WA 5L7WA 1I33A 2C5EA 3ST7A 4WCDA 1EVJA 4FOOA 4FN4A 4YT4A 1U7HA 2Z1NA 2JAPA 3I9LA 3TZKA 1HE5A 4P4LA 3PHLA 4RF5A 4GBJA 1HSZA 4W9NA 1KVRA 3ROQA 3ETEA 1A72A 5CDUA 4EJMA 1PS8A 2NSDA 4Q39A 1YS4A 3JQ9A 4D44A 3GEMA 2J3HA 4CM3A 1YJ8A 5JW6A 3SLGA 2JHFA 4XX0A 4YPOA 4PVDA 4R4JA 3UW3A 3EC7A 1NM5A 1T4DA 3GEDA 2PD4A 3D1LA 4KUHA 1YO6A 2AQ8A 1ZKMA 4RV9A 1YDWA 3PLRA 5EIOA 2O48X 2JCYA 5COBA 2QHXA 3ZV4A 1JLLA 4J2OA 5K9ZA 3CIFA 2EGGA 3U4HA 4DYVA 4FB5A 2NWQA 4PLZA 2AEFA 3M6IA 1QG6A 4J7XA 3WLEA 1KBZA 3CSDA 1QYDA 4O1MA 2HK8A 1P1FA 4BV9A 1O6ZA 1YL6A 2VOEA 1WWKA 2B36A 3DO5A 1X7GA 4EUFA 1GTMA 1RPNA 2VTDA 5C7OO 3KM0A 3ZWOA 5TJ9A 4L75A 1N1GA 3ON5A 4FQ8A 1I3LA 4UEOA 3QQPA 1ADFA 5KVSA 1DRVA 4NU5A 3UVEA 4IIVA 4DTIA 3UN1A 2AE2A 2WYUA 3KLPX 4EGFA 1B8PA 4RO0A 4J4TA 4Z3KA 3I3OA 3SBOA 4IDGA 4BNTA 3BTOA 3H8VA 2X58A 3LF1A 2V6BA 3QWHA 4PLGA 2FPGA 1KYQA 1UXHA 3DOJA 2PGLA 4P38A 3DFUA 1UZMA 5TC4A 3PYLA 3WGOA 1N92A 1T4BA 4A27A 1PGQA 2EW2A 3KO8A 3MOGA 2PZJA 3PDUA 4KTVE 5IDQA 4UUMA 2EG9A 3MTJA 3OQ6A 3DZKA 1EBUA 4HNGA 4ZQFA 2EERA 1LUAA 4L0QA 3WLFA 1X1EA 1Y7TA 1E3EA 1LI4A 4L76A 1E7QA 1QRRA 1R37A 3NTRA 2VTEA 3ROPA 4D45A 5A3VA 3OFSA 2YHUA 2D59A 3GVPA 3Q3CA 1XELA 4JLWA 3E9MA 5A5EA 2BELA 1BGVA 4AJLA 3KOUA 1H6AA 2YFQA 4U8GA 4XJTA 3ANNA 1ONOA 1O95A 3TFOA 2PWZA 3D5QA 1JN0A 2JD2A 1PGOA 4ND5A 1BMDA 1LDNA 2HLPA 3GT0A 4CM8A 5BSFA 1SZJG 2B69A 4IGFA 2QYTA 4RL6A 1CRWG 3ZNOA 3WIEA 3RCBA 1ENPA 5KWEA 4PLCA 2ZQYA 4WCFC 1HZJA 3ZV3A 3JV7A 3O26A 4U6SA 2C2XA 3Q2KA 4ZICA 4JGBA 1O8CA 5EMHA 4HWKA 4BHTA 3HUDA 5IXYA 5HBRA 1MA0A 3PP8A 4IIUA 2X5JO 3OIGA 4DC1A 5L9AA 1JKIA 1BDMA 3GZNB 3MJSA 4BNXA 4TVBA 4PLPA 2DBQA 4JJGA 3G79A 5A1TA 2QYSA 1L1FA 4DWVA 4UUNA 3ABIA 3A1NA 5IAAA 4M55A 5T67A 5JDCC 3STHA 5T64A 2BFMA 1C0PA 2W2KA 4BNUA 1PR9A 2ZYGA 2PD3A 4CR7A 2EJVA 1RYDA 3DL2A 1QKIA 4PZCA 3S55A 4FJ0A 4PGFA 3UHAA 2BGLA 2DKNA 3G3EA 4Y98A 1PSDA 2G0TA 3LC2O 1V3UA 4J1NA 1AXEA 1Z6ZA 1QMGA 3WNQA 2HQ1A 5DDIP 3S2FA 3GN1A 2GCGA 3MCVA 4HFNA 4ZHSA 3PTZA 3NGXA 4BNWA 4BO0A 2GZ1A 2BD0A 2WE7A 3B20A 4LCJA 1GV1A 4BV8A 1FDUA 5CEJA 4B3IA 1M6WA 4OXKA 1LC3A 4OO3A 2CUKA 1DC4A 4XA8A 1R16A 4QXMA 4W99A 1GYPA 3QY9A 3WS7A 2OHXA 3ANMA 1NWCA 3K9QO 3DQPA 2NVUB 1V6AA 5KJCA 5JPIA 3CTMA 4CMIB 3AK4A 3BIOA 3ICPA 5KIAA 3JQAB 5ILOA 2IDZA 3O38A 2ZB4A 3DZFA 4B79A 4YR9A 3GDGA 2NNLD 2X8LA 3DHNA 3JD4A 1B26A 1HYGA 3Q2IA 2X0NA 3PQEA 3ZU4A 1D8AA 1GEGA 4PLWA 1ZEMA 1ZH8A 3U62A 3S8MA 1TB4A 4AJJA 3UFXA 3IUPA 4RPJA 1ZO8A 3Q1LA 3TJRA 4CM9A 4YT8A 4Q3BA 4YJDA 4MP8A 2I3GA 2UDPA 3W6UA 2FSVA 2Y1GA 4LGVA 4YAEA 3CMCO 3SC6A 1X0VA 3HNPA 3KV3O 3GC6A 4A73A 1LJ8A 4YTEA 2ZTMA 3IQDB 5EQFA 1XHLA 1HF3A 1DJQA 2BI7A 4P4GA 4XYBA 1AHHA 2D4AA 2JL1A 1ARZA 3MEQA 1Y5MA 3HFSA 3PHHA 1UDBA 4DXHA 1NVTA 1I3KA 3T7EA 4ONEA 1XKQA 3WGHA 2VRCD 1YE3A 4C4OA 4WPGA 3VAZA 1U8XX 3F4BA 1K6XA 4II2A 2I65A 4JJFA 1RYEA 2DAPA 1S6YA 4J1SA 2QX7A 5F1OA 2BF7A 3AJRA 4INAA 1W0CA 1A5ZA 1YKFA 5JAQA 4O6VA 3VDQA 4W7HA 3PWZA 1K0UA 1PGNA 2W4QA 4NFSA 4K1LA 5A05A 2OL4A 3H5RA 4JBGA 1IE3A 4UREA 3WGGA 3CEAA 4B3HA 5KVCA 4DQVA 3ULKA 5GZ1A 4ID9A 3DXFA 5IDXA 4RGBA 3L9WA 4W7IA 2P9CA 3V1UA 3PK0A 3RBVA 3UOGA 5HM8A 5FYDA 3TFQA 3F46A 3WG9A 4NU6A 2NV6A 4TWRA 3HG7A 4GLLA 4BNNA 1A4UA 1HRDA 1BXZA 4YAKA 3H4VA 1TT7A 5BSEA 1EVYA 5CAEA 2JD0A 4UVGA 3SXPA 2J3IA 1PEDA 1GUFA 2PZLA 3V1YA 2GN9A 2SCUA 4WLNA 5DP1A 2B83A 3OJEA 4DLBA 3ZN2A 3KYCB 3IOYA 4JK3A 4E5YA 3P2OA 3KETA 4J9UE 1MC4A 1ENZA 1ZK3A 1O89A 4GVLA 4ALNA 4OXYA 1V3TA 4YXFA 3OF2A 4DREA 4J6FA 4IGEA 5G0TA 1LDGA 3TRIA 5HS6A 2YW9A 3LT4A 2FRDA 4ALJA 3CMMA 4XEHA 1NTOA 4YB8A 4J0EA 2UUOA 1D3AA 3DZIA 3RUCA 5COQA 5CFZA 3RUFA 1E7MA 3VH3A 4XDZA 5L40A 4JBHA 3ADOA 4NMHA 4XGNA 5JMPA 1SOWA 2POQX 5KJ6A 4L4XA 2IYPA 2HSDA 3D5TA 2FHSA 3BHMA 4O0LA 1WXDA 1VC2A 1B16A 4CM1A 2H63A 4RJTA 1JTVA 2JCVA 4FDAA 3GF4A 3AOEC 2CMDA 2O7QA 3EVTA 4GQAA 4Z9FA 4BKOA 3BMCA 4QUKA 2VWPA 3IAHA 4G2NA 1J6UA 3AUSA 3JD1A 3WJ7A 4Y8VA 3G17A 2BH9A 4BIIA 4GX1A 3W8EA 1LU9A 3EUWA 4OMUA 1M2WA 2OP1A 2YDXA 1Q0LA 3Q9UA 4DGSA 1JU9A 3GA0A 4BO7A 4BNLA 5ITWA 4A7PA 1P45A 3E03A 1NQAO 1YB1A 2WYVA 1D1TA 4CM7A 3AY6A 2NACA 1TEHA 2X7HA 5IZCC 2QW8A 4LSWA 5K6AA 1AGNA 1E3SA 2BGMA 2ZB7A 3ICCA 1IPFA 3I4FA 3H9UA 3TF5A 1BG6A 2E6UX 2X23A 1PGJA 2OOSA 4MJLA 1E77A 1ENYA 5CPBA 6ADHA 3AI3A 1AN9A 1GYRA 4D3SA 1PIWA 5DCWA 1DFHA 3HADA 2ZJ1A 1I8TA 3LT2A 4PN3A 3W6ZA 1NASA 3GHHA 3L9XA 3DZHA 4MIEA 2VYND 3RWBA 1LRLA 1U3VA 2AE1A 4FPXA 3NDIA 1SNYA 2Q2VA 5F5LA 1DLIA 5AVOA 3WGZA 4AJHA 4OH1A 1LSUA 2IXBA 3ZWYA 4XZ3A 3ETDA 1I10A 1UH5A 4WEOA 3D3WB 2CZCA 3LT0A 4R5MA 1NPTO 4BGVA 4WLFA 1BVUA 3E18A 2J3KA 4A5OA 1PZFA 1T1RA 3I9MA 1GCUA 3K73O 4DQXA 2O3SA 5KNLA 1CQIA 2W2LA 3V2GA 5I7EA 1HDCA 1SMKA 3ANLA 5HS4A 2QRKA 1ISHA 1KC1A 4Y6SA 4BNVA 3WB9A 1PJ3A 4CR6A 3ZWXA 3OJLA 2HJSA 3W4KA 2NVUA 4IDEA 4CM8B 2VUUA 4BNMA 4CJXA 1TT5A 3W4JA 4DPLA 4O59O 5A03A 2DTEA 3C3XA 4ZJUA 4RF3A 5B12A 1VKOA 3NJ8A 4Z0HO 4FFMA 4PLYA 3K92A 1UXIA 1H9BA 5C37A 5KTKA 3LLVA 3AU8A 3FF4A 1HYEA 1GFSA 3TPCA 1E92A 3PYMA 4YJGB 4B7UA 2I66A 1VKNA 4CV3A 3BTSA 2RCYA 5A4DA 3IKTA 1ISIA 3DMTA 4BNJA 5BNIA 4GWKA 3VTFA 2VRCA 3GVHA 4I08A 4B4UA 3E9QA 3ZW9A 4HFRA 2Y1CA 4E21A 2PD6A 3LF2A 5A9RA 1IPEA 4M8SA 3L6DA 3ZGYA 2JHGA 4CM4B 3IJRA 3O8QA 3BTVA 4MO2A 3KSDO 3PJFA 3WWYA 4FJ1A 4CMCA 4OSOA 3OICA 1UDCA 1FF9A 2FY8A 1YB4A 3R6DA 5FF9A 4A26A 1JKJA 3CH6A 1F06A 2QG4A 4A10A 2DTXA 2PK3A 4OHUA 2JKVA 5AXCA 1DOHA 4GGPA 1R15A 2QZ9A 3UUWA 4DC0A 3E9NA 3PYXA 1W8DA 4WLUA 4TVOA 1HDOA 1IYZA 5THKA 5TX7A 2B4QA 3HFGA 4AICA 3GZ4A 1QV7A 3C1OA 1HDXA 3OHSX 3RI3A 2Q2WA 3VKUA 5KCZA 4E5KA 3LU1A 1PS9A 2HRZA 3DTYA 2NVWA 3N7UA 2Y93A 5MGBA 4XD2A 1DRUA 3TZ6A 1UP4A 4YJFB 4OL9A 4M54A 2OXIA 3GMSA 3QA9A 1A4IA 1QR6A 4NI5A 1LDEA 3FNGA 4CMKA 3FNEA 1HDYA 4PRKA 1M67A 4CV2A 2GO1A 4N18A 4DQUA 4GL4A 4E4YA 1N7HA 3H2ZA 3ZHXA 5GZ3A 2VWHA 3HN2A 5G4KA 1NP3A 1ONPA 1RKXA 1QORA 3HWRA 4IPTA 5CDYA 2RH4A 1K3TA 3U09A 4MIOA 4D46A 1EE9A 1XEAA 1DB3A 3QSGA 4U0JA 3BMQB 1V3VA 3QRWA 2VN8A 4O5OA 3JQ6A 4UULA 4ZQEA 3LQFA 1HZZA 1EMDA 1V0JA 4XR9A 3HDYA 1P77A 1Z75A 4KUGA 2Y0EA 2NUAA 4AJKA 3E1KA 1Q7GA 3F6YA 3PRJA 1E1LA 1GCOA 2AQHA 1Y9AA 2VYVA 4ND1A 1XYGA 3B1JA 1I3NA 3IDSA 2TMDA 1GV0A 2GN8A 5FI3A 3ZNQA 1QV6A 1K2WA 4HBGA 4K6CA 3QWAA 3DZBA 4QX6A 3BHIA 3KSUA 3ORFA 3NAQA 3CINA 3VTZA 3OMLA 4J90A 4BO9A 3ROMA 1J4AA 4RPKA 1QYVA 1D1SA 2PKQP 4IXTA 3TZCA 3E48A 1N7GA 4CPDA 5K6AC 1B0AA 3TL3A 4BKPA 2O4CA 4U7WA 4XQCA 5JLAA 1TVEA 1QLHA 1UP7A 2GYYA 3K5PA 1IOLA 1U2GA 3SJ7A 1U8FO 3G1TA 5ADHA 1LA2A 3LK7A 2PGDA 4O63O 3F1LA 4DMMA 1P44A 2CD9A 3WYCA 4ILKA 4NJMB 3DB2A 2B4RO 1E1MA 5KKAA 5JXWA 4IXWA 3TDKA 1LQUA 2FPPA 5HRUA 1E3LA 3JQ8B 1Z82A 4R1UA 4HV4A 3KUXA 4LVUA 4S1VA 2DBZA 4YJGA 4EZBA 2C54A 4WCFA 2R00C 3I23A 1KY4A 2JAHA 2C59A 4XQGA 5I9MA 2PLAA 1SOVA 2VHVA 3OIDA 4IZIA 4HFMA 4WNIA 4BMVA 1BXKA 4LMRA 5A5FA 4OYRA 1WMBA 4ZQHA 1NFQA 2H5LA 4B3JA 3GNQA 4D0RA 2JCXA 5L53A 1QLJA 3DOOA 1NFFA 2IZ0A 1PL8A 4TRRA 3RAJA 1ZZEA 2CVQA 5CEFA 1HWYA 1E1NA 2CDCA 3H3JA 1IHXA 2VHZA 3I5MA 3WQQA 4E6PA 5JCXA 3QVSA 1W4ZA 5AYVA 4FFNA 3E5MA 4CLXA 1K6IA 1NBOA 5IXSA 2XF8A 5ES3A 1T2CA 1CETA 3FCOA 2WEKA 4CMEA 4C7KA 5COAA 1H9AA 5EN4A 3TN7A 3OIFA 3P5SA 3HQ4O 1KVQA 1KY5A 3A28A 3KLMX 4ALLA 2GASA 1XWFA 3ETGA 3DEYX 3OQ1A 1YL5A 2X0IA 3RBZA 4DPMA 3DBVO 3NGLA 4UVDA 3WBBA 2OBNA 2Q1TA 4I9HA 2HRBA 5FWNA 1U3UA 1PJSA 4BO5A 3FWZA 1S7CA 3AI1A 1E7RA 1EBFA 1JKFA 3RKRA 3EDMA 1MG5A 4L9RA 3WQSB 1B3RA 3HB5X 4QT0A 5IN4A 4WOJA 3LLSA 5DBIA 4RLSA 2OUIA 3VVBA 5I9LA 4MVJG 2EXXA 3C1AA 4DLLA 4MPDA 3OJ0A 2IYOA 3PIDA 2JFHA 4ZRNA 4DBVO 3A06A 3AM3A 1OC4A 3KSZO 4DVJA 3OSUA 3RASA 4CL3A 4YJHA 4II3A 3PHGA 1YBAA 4CODB 2D1YA 1XU9A 3GY0A 3VKVA 4XYGA 4J9VA 4MVJD 4TROA 3COSA 3O03A 4PLVA 5TRTA 4TKMA 3ZWPA 4B8WA 3TNLA 2O3JA 3K31A 4RVUA 3T7CA 1LC0A 3WGIA 3MJVA 3V2HA 1RM4A 4ZQBA 3SLKA 3WMWA 4CV1A 2I6TA 5B4VA 2OORA 3JQCA 3R0IA 3VHRA 4BQPA 2GZ2A 1JA9A 3ZWBA 1XSEA 3GN2A 2HUNA 1JDJA 2AXQA 5B1YA 3L4BC 3WTBA 1YWGO 1I30A 3F5QA 2X1HA 1XQ1A 3T4XA 3V2UA 5BR7A 1LRJA 4JX8A 2VHYA 3KXDA 1EZ4A 3R3JA 4R9RA 8ADHA 4YA6A 5L7YA 3HZZA 1Z45A 3RU7A 3DWFA 5GY7A 3HE3A 1UXJA 3D3WA 4TRMA 3SVTA 3U3XA 1XA0A 3WDSA 2P68A 3Q11A 4BGEA 3JYPA 3INTA 3M2TA 4QO8A 4IDBA 5LCXA 2VNAA 3F9IA 3DC2A 4R3NA 4CQMD 3WSWA 7ADHA 1CEQA 3ZZNA 1E6WA 2ZTLA 3F1KA
chains in the Genus database with same CATH superfamily
1ZMOA 1QBGA 2WHXA 4LE1A 4FBGA 1U7DA 4BGIA 5EAIA 4EYEA 4W5TA 2O3UA 3EF0A 4JP1A 4HS4A 5C8YA 3UGTA 4ZN6A 3NVMB 2CJFA 2XNDD 4UZSA 2R6CA 5AW5A 1R6TA 2ZUDA 4GZMA 2R25B 3OUTA 1F4LA 1G8MA 4P5PA 2CJWB 4AIIA 4QYSA 1E8NA 2CB9A 3F3YA 3WISA 4K05A 3L92A 3L8YA 4X1OA 4I5EA 3RKSA 4DM4A 1EJ2A 4IX1A 4ENVA 3DMRA 1BW9A 2XUJA 3KYCA 2OUKA 3L7DA 1PBTA 1P73A 3JQ8A 5CLGA 2IY8A 4RTPA 2O7SA 4S24A 3V97A 2FNAA 2ZYAA 4A1FA 1RHRA 2C82A 1NVMB 1WOMA 1CHNA 3ZHBA 1NZFA 4NJMA 4M22A 1HZZC 1N1EA 3GGJA 2QN8A 4S35A 4DA0A 1VLQA 1E4OA 1I24A 2ZATA 3HKBB 4L28A 1NXQA 5EJAA 5I9LA 4GPEA 3U5ZB 3FMPB 1SFRA 4N5MA 3V6LA 1ISJA 2MOKA 3BXFA 4MYDA 5BV7A 4JQZA 5CNIA 4ZVTA 3NYRA 2ZVJA 1P4JA 4TGLA 3GAFA 4NL4H 4NBVA 3KAKA 1J0EA 1QIMA 3Q7RA 5C8ZA 2R6JA 4GZ3A 3PPVA 4NARA 3ZG6A 1FRVA 1EWQA 3F73A 2KE5A 1KFJB 1TL7C 2ZI4A 1G9XA 2GAOA 4GICA 1RACA 2WT8A 3IQWA 4G1EB 3RRNA 3GB9A 1P5JA 1RYNA 4HX2A 3GH3A 1QO7A 5EWMA 4R83A 4DRYA 3V8VA 3F4LA 4ESOA 4CKCB 1V39A 2JIDA 1YA8A 2ZULA 2A35A 2NPIA 1NVEA 4O2BB 3UHFA 4DJDC 2VO1A 3VPHA 5IANA 3GLIE 1E60A 5JRJA 3LKZA 3UMBA 4DLTA 1N7IA 3M3HA 3EQ6A 4AKTA 4OLHA 5HG0A 2FFHA 3CH4B 1IHYA 3AJEA 5AESA 3DXXA 4K2HA 4K6HA 4M49A 3ZWWA 4YX9A 4JMPA 1GYQA 4E07A 4YQEA 1XRLA 5IJ0A 5HVNA 3MOSA 3ICOA 4DA9A 5J4YA 1V6SA 1DKMA 1Q57A 3T7AA 3LRXA 2QP3A 4OJNA 1NF8A 2XOKA 1QSGA 3AESA 4EY7A 3CLUD 3FTQA 2DX7A 1ZX1A 2WA1A 3ZE2B 2VBCA 1DDOA 1K92A 2JIPA 4BXOA 3I1JA 3K1AB 3K9NA 4Q02A 4PZ0A 5TQ2B 1YB6A 1CWUA 1T24A 3CUKA 3GJ4A 4RDIA 3ROXA 1XGKA 3KXIA 4RPHA 4HN2A 3TNFA 1GQ2A 2O0HA 4NZ9A 3OE7D 2C4MA 2XMCA 4NPHA 4TTPA 2PUAA 4YRBA 2ZJ5A 1AQYA 3ONDA 3CJRA 2CD7A 1QANA 3G89A 4YI3A 4WFKA 3K2BA 2Z2ZA 3TSWA 1ABBA 3S8YA 4JGIA 3O4RA 1FNDA 4MI6A 4LWOA 2FUCA 4DLRA 2D8MA 3V1NA 3K5HA 4MS1A 5KX5F 5IJAA 2QTRA 4WBXC 4PGHA 1G20E 3GFBA 2D1FA 4D6PA 2C99A 5DLYA 1POXA 2GD0A 1SC1A 3AVPA 5ELMA 4RULA 4TZ6A 2ZIUB 2PR2A 5I01A 2CV2A 1IL0A 1VA5A 2MSDB 1H4SA 5G4LA 1P9NA 1SVNA 4K9RA 5B7GA 1FSGA 1W88B 3HL0A 4W9NC 4D99A 4FVTA 2QQ0A 4NC9A 1E2NA 2OK8A 2YJTD 3L8FA 3ISJA 4FT4A 3WGQA 3PQ3A 2ODAA 9LDBA 3WXBA 3X0DA 1PZEA 1QYCA 2IIBA 3OY7A 4OHRA 4RYDA 4D9EA 4B80A 2OQRA 2PYZA 3Q7TA 3B13B 1IXRC 4TKVB 3FVVA 2W2TA 1USIA 2NP7A 3A1DA 3BKXA 3I9NA 4N0QA 5AVSA 3M4NA 3RHTA 4RK1A 2Q5EA 3P0RA 1OI4A 5G2OA 4G0UA 4M2LA 5TF0A 1RJFA 1X0XA 3HZRA 2MYUA 2XOXA 3V4RA 1TZBA 2W2OA 1GZ5A 3LUKA 1C30B 4ZJYA 4DSNA 5LKAA 4MHOA 4Q1BA 3INGA 5CGZA 1UMKA 4B32A 3NTLA 1A9QA 1AE1A 5JMWA 4ZDKA 2PUDA 2EOAA 4OBBA 1RWNA 2F6RA 4NBTA 1UBSB 1ZH2A 1EFKA 2Y1DA 3VC7A 3V9AA 4Q3OA 1P7YA 2FSGA 2OCPA 2ZTSA 2ATIA 4Z2YA 3VNSA 3WGYA 2AMFA 3FWNA 2ZRJA 4KAJA 1PJRA 5KU1A 1HM5A 1L0BA 4TUYA 5ERYA 4RLFA 1MGOA 3DE1X 1KYYA 1T6YA 3E2PA 3ES9A 5AHRA 1GUZA 4EFNA 5ULLA 1J39A 4TTRA 1N5MA 2IKQA 4EI8A 3HKDA 1V4VA 3TTUA 3CRMA 2RGWA 1C50A 2V5AA 4L8VA 5CBPA 2FEPA 3P9YA 4MW7A 5AVKA 4B5KA 4L5CA 4IWYA 4J7UA 3HR4A 3VISA 1M6VA 1P0IA 2IEGA 2IC5A 1KDVA 3ZZ0A 3ZCRA 1NXSA 1A71A 3H6KA 5FULA 4AP9A 4Y9UA 1PSZA 4ITUA 3T9BA 3RVBA 4ZP1A 5LP6B 5BSVA 1LQ2A 2IOYA 4UZEA 2RB4A 1CNMA 4M0KA 3I42A 1KPGA 4D96A 3JQGA 3I83A 2JH9A 2WSYB 4HWTA 5F2KA 2XB8A 4IVQA 4KQFA 1IVYA 2H11A 4UHJA 1YE5A 1MFPA 2FHPA 2RHJA 3B1ZA 4MKFA 5HKBA 1T8RA 3K71B 3U44A 2GVDC 4G0QA 1S2DA 1KKLA 1M2OB 2FLWA 1XTSA 1L5GB 3VU1A 2BKXA 2CLMB 2J48A 5F7ZA 4DMUB 4F93B 2OD7A 3QVTA 4J1TA 3TLEA 1TC2A 4DDHA 3LZDA 3D6FA 1WZ2A 2BY4A 1XRQA 2W48A 5I3CA 3I2FA 1XEWX 4LPKA 3CWCA 1JHAA 1MAUA 3GV0A 3R9XB 2G5GX 1P0FA 4W5RA 3LQQA 3SQNA 3ZTWA 3JAWA 1TM1E 1GZDA 3HCFA 1E0DA 3N2KB 4X1KB 1CZUA 1X94A 2ODTX 2QWXA 3QITA 1T9AA 3SQOA 3HFJA 4ZV4A 3BFPA 5A04A 5LJLA 3MQ2A 2ODPA 3UWDA 3U4CA 4EUEA 2BIFA 3UC9A 5IFLA 3O0TA 5CDSA 2FAXA 4YUXA 5FQOA 5JAIA 4HF7A 2X1VA 4BJ6A 3QPCA 4J0IA 3T4EA 3ETNA 1BO6A 2X77A 5CK5A 4EY6A 1JBQA 1NOIA 4NBSA 3C7DB 3MTGA 1X13A 5DF1A 4NQZA 1NY5A 1Q0TA 3BL6A 2AG5A 4CM6A 2VT2A 4U0KA 2VWGA 3VNRA 2YS7A 5JMOA 1AUPA 1GTZA 3JALA 3DFMA 2Z9DA 2HHLA 3CZ4A 3RJ9A 1CY1A 1NVXQ 1AZWA 5IUNC 2EGUA 1C7FA 2GFHA 1RI2A 2O1WA 2ZP1A 4B33A 1M2GA 2PNFA 2Q9UA 1DS6A 3C7AA 1JHUA 3TZHA 3S8EA 5DI3A 4DDKA 4LISA 1N4DA 3U9TA 1Y33E 2MT9A 4YRFA 3KHSA 5CLIA 3BRWA 3LXRA 4ZANA 2W83A 1KNQA 1QXSA 4IUDS 5CIQA 2VSOA 4NG5A 2OILA 1NL3A 1KIMA 4CTNA 4JWTA 5CFRA 3L8DA 3QQ5A 4NCXA 2DZDA 5CVTA 2XQGA 3CNBA 4FYXA 4TMKA 5LMNB 2PA3A 4Q9JA 1P9RA 3I73A 3VR3A 3X1WA 1J2UA 1F17A 1KIAA 1PK7A 1QYWA 2GSDA 3M7IA 3NT4A 1X7WA 2BHSA 4ENRA 2V7EA 3HV0A 4MVCA 1NQTA 2XDWA 2G8LA 3W7AA 4BWYA 3IULA 3SR0A 5CBKA 4J29A 3A31A 2N46A 1L8OA 3SMQA 4YV7A 4GP9A 4DNPA 3UPUA 1UK8A 2XXJA 4O5AA 1P5FA 1UJBA 3SVTA 1EP9A 3AIKA 4LV5B 2G9NA 3G0HA 1KO5A 4PNZA 2IXGA 2ST1A 2ZRHA 3HNOA 4NG4A 1ZM9A 4Q34A 4ED9A 5BSHA 3QUBA 2P9BA 2AF3C 4L4UA 3CISA 1K2VN 1XQXA 1GNPA 2DSTA 1QYIA 1H2RS 4HDKA 4PLHA 3P8ZA 4EW2A 1WDMA 3NVAA 1KA9H 2FKNA 1K3FA 3H17A 5EHXA 2XGJA 2IS1A 4PSKA 5DPMA 1ONSA 4IF4A 2O8FB 2ZIXA 1NJFA 4QJIA 1OFIA 3GLHE 4NOKA 4A0QA 4BNIA 2E55A 4WXPA 4BJHB 3C85A 6GPBA 5BNZA 3NO4A 3AHJA 3QX3A 5I5EA 1LB1B 1F8XA 2IOFK 2WHRA 5EWLA 3UMFA 3K6SB 5IWAB 4BN4A 4NE2A 3AESB 1P1CA 2E2WA 4MQEA 3FKSA 4X00A 3WNVA 1HLPA 4YDRA 6ABPA 2CCGA 2PZMA 4R1LA 4DUGD 3CR8A 3CW2A 1RKVA 3AXTA 3A37A 5AKJA 2NXEA 5J4KA 1IFXA 1HSOA 4J3JA 4GIBA 1XHEA 4IBOA 4US1R 1ZM2A 1PS0A 3TLJA 1C0IA 2WQZA 5BQFA 1DAKA 4EPWA 2NGRA 1MH9A 3PUWA 3MCTA 3L0YA 5TQVA 3LC7O 3TOVA 3RTGA 3U3ZA 3LS2A 3N6RA 2GO7A 3VHXB 4AT1A 4CI0B 2QU7A 4R84A 3BBPA 1B15A 1VPWA 1KU0A 4GRIA 5LYJA 2GN4A 1Z8HA 4FEGA 1CS0B 3FUVA 4D4IA 3MCWA 3C14C 2ACEA 3KKMA 3KYDA 1UUFA 4J16C 2GXSA 2DULA 1HKUA 2XGSA 3U7HB 2IEYA 1LQTA 4YMIA 1MC8A 2VEOA 4R31A 5CB8A 4GM1A 1RZUA 2PEZA 4HKTA 1B8NA 4JJAA 5G0VA 3DONA 5ICGA 5HUHA 2F43B 1XMSA 4K1XA 4S2EA 2VCYA 3FMGA 5KCMA 2FPIA 4R2LA 3T0IA 1ZWKA 4EHBA 3OFJA 4QBHA 1JTFA 1ZN8A 4MZXA 4RJLA 1EK5A 2NV0A 4TT3A 3IS3A 2NP6A 4A6PA 2CKDA 4FFOA 1ZVKA 1CF4A 4KN8A 3OKAA 4K9MA 3JZMA 2ZQ5A 2YQ5A 4YCBA 3UH1A 2XVXA 4BL5A 1D7OA 4A23A 2E37A 3PE4A 4TSFA 2PANA 2ZDHA 4PYIA 3R8XA 4RXTA 2CMKA 4D9IA 1TLTA 1DIGA 1NQ5A 1IH8A 3HB7A 1A82A 4ZKDA 1PD0A 1ZXLA 2P2CA 2XAAA 4OQ4A 4MW0A 4RD2A 3ZE7A 1ORWA 2HMTA 5LWQA 1VIDA 4KXFB 3AMVA 3PQ4A 2OV6A 1MOZA 3I5UA 1DELA 1KDRA 2GERA 4B83A 4W5NA 4H08A 1DDGA 4MRAA 3T1OA 2E4AA 4V0MA 1N8KA 1UWKA 3L05A 2VRBA 4WA7A 3BPSA 4LX8A 8LDHA 1DV1A 2GMWA 2H16A 2J3JA 3D0OA 3Q3VA 2JJYA 4LNUB 5F33A 4BVGA 4EJSB 1BWQA 1EXVA 2VHJA 2X9NA 3DV0B 4IJKA 5AT1A 2B3TA 3IOBA 2YXBA 3A4VA 1VL8A 1BN6A 2ZU0C 2EVWX 1JEAA 1EGVB 4ZOEA 5BSUA 1MZPA 1G6HA 3SOPA 3WWCA 4KO8A 4YCCA 2Z6AA 3TVYA 4N6NA 1I01A 4Z0NA 2H2DA 4JT8A 1R18A 3KZKA 1WSBA 1GZ6A 1FDRA 4LAFA 4LRXA 5LKRA 4ITVA 4EA8A 4OAQA 5JC8A 3TD9A 4ZYXA 1EUZA 2O2XA 3P4YA 5B4UA 1AD2A 3K6JA 1U0SY 2WZDA 1G8PA 1H4TA 2R7LA 3A9SA 4HLQB 4U3JB 1NRIA 2XUOA 2B9VA 4XIGS 4L15A 2I8LA 3VX4A 3EEIA 4EJ0A 2AC2A 1E4VA 3FR8A 4K9SA 1T5HX 1UQUA 2BFFA 3AB3A 3GLGE 3T8YA 1O9BA 1WP4A 3QYJA 3R1IA 4R9VA 4DCGA 1RYYA 4EY8A 5DGTA 3DMNA 4LJ7A 4JMLA 4WKCA 4L3WA 5EP4A 1UFVA 2Z4SA 1ORRA 2ZWPA 3JTMA 4X8OA 5AR1A 5MGNA 1EX6A 2B82A 5KWIA 1FB5A 5KYVA 3PQ6A 3ZKWA 3OP4A 3MQFA 3DKKA 3AVXA 1K1EA 3KUDA 4B2PA 1DUVG 3I2HA 4G4SO 4MI9A 4GF5A 5EIBC 1JFTA 3GBPA 4BN0A 5U1PA 2C2ZA 4WZ6A 3I62A 1RPTA 2CDAA 1Q1ZA 1G5FA 4BLVA 4PZ9A 4DAEA 1D04A 4ZDWA 3M3DA 5E7QA 5CA0A 2QD4A 3X1ZA 1R3DA 1JQ3A 1FRZA 2B6NA 2BCGY 3VR6H 5JQGF 4V1CB 2GZMA 4XYMA 1BDIA 5IVIA 2WSSA 1UM9A 4RAOA 1AUXA 3HRKA 2HMYB 4CYMA 2ATEA 3HJCA 4MRRA 1Q50A 2Y76A 5H16A 1PR2A 4I55F 1I4LD 2EAUA 1ZPDA 1XA4A 1XNHA 4J3FA 5EKDA 1EM8B 2PKQO 4RY9A 4BDSA 4E12A 1UBHS 1N2ZA 2N9UA 3AI7A 2W7TA 1NJ1A 3JVUA 4NYIQ 1R8JA 4JYCA 1UZAA 4RSHA 2GHQA 3QKSB 2M32A 1DJMA 2PT5A 2G17A 1YF3A 4DV1B 3O4JA 4YJFA 1H8HA 2H5EA 2NYVA 4M87A 4GKAA 2C83A 1ZDMA 3HCCA 1YZLA 2XBLA 1KXZA 1U6JA 4EARA 2XRZA 2YN4A 3LDFA 4E5NA 1CLUA 4JC4A 3EY4A 5T3YA 1W6UA 1CY7A 4GH5A 4NPAA 5J59A 4BNGA 1X7ZA 4HADA 2VJAA 4NZOA 5EHNA 2J9ZB 3DWEX 4MGZR 3CZRA 3G7NA 4OI2A 1OGYA 4DMLA 1JHOA 1IHUA 4MZDA 1OBCA 4KXUA 3WLNA 4HWOA 3TTTA 1UJNA 3NFRA 3N58A 2PH3A 3OE7A 1M2OA 4REMA 1ZRHA 5T4EA 4FBLA 3AF5A 1U3GA 2ZBQA 4HDNB 1IBMB 1DG1G 1I7QB 1E0JA 4GKBA 2R6ZA 4LE0A 3MWLA 1DIOB 3A6DA 1VA4A 4CQNA 2Z3WA 2ATVA 1ORVA 2JK0A 3PE6A 3AVWA 1J1UA 2WMYA 2I8AA 4QGSA 1MB3A 3C7CB 3GLQA 2BHLA 4X71A 4KOAA 4RL4A 4EMUA 3K05A 1EX7A 1XCMA 1Z7EA 4O4JB 2A14A 1HQDA 4DJ5X 5D85A 5H5JA 1QX3A 1R0SA 3LYAA 5DBHX 4K9DA 5K8IA 3ENQA 3ESCA 3ESXA 1FUKA 3T1YB 1HXHA 1J33A 1RMYA 2FR1A 5AKYA 4B34A 5KNCH 4G4SP 4H7DA 1R0BA 1PJTA 2WJAA 5A1JA 4NYMQ 3UHJA 3GRPA 1TU0A 2YXNA 4MRNA 3WB0A 1KAEA 3JR7A 5KOHA 2IHBA 4TKUB 1SUSA 1ZKDA 3B1KA 3EAGA 1KFBB 3CRW1 5HX7A 3U60B 2DG2A 5AHOA 1USVA 3RPEA 1VIVA 4OQXA 4QFBA 4Z1OA 1AZTA 1XLTA 3N5KA 1Z4LA 5TQ2A 2YVAA 1GNVA 1Y3HA 4Y2XA 5JBIA 1DTWB 3IP5A 4G0NA 3EA0A 4HMOA 2XWPA 4WNAB 4ERXA 3WSVA 1Z2DA 3ZKWB 2V4UA 1R6BX 4CDGA 1O5IA 1VJCA 3L6CA 2F4NA 1BYIA 5HUQA 4IMJB 2V3VA 5ALGA 5LA6F 3G0GA 5AWFC 5AVWA 1B0ZA 3UTDA 4COOA 3KTAA 4PC7A 3WYBA 1H2BA 4R05A 3L07A 1M8JA 5HNKA 3G2QA 4TT8A 3AKZA 3W9SA 3HEBA 4I3HA 3V4SA 4XXHA 4OMFG 3GX1A 4UTXA 4O4HB 1E5LA 3EBPA 3UCXA 2BMEA 3K32A 3M83A 2C20A 1N0UA 2UAGA 3PWSA 4MIKA 9LDTA 4BZQA 2VPWA 4TLLB 4UDNA 4YRDA 2YC4C 5DNDA 2OV3A 2E4ZA 4B3BA 3ZX5A 4FD2A 2QR3A 3IMFA 2IYUA 3H65A 5B3JA 1NJ6A 4G0MA 2CNLA 4PS0A 4BNYA 5HKAA 2VC2B 3M6MD 1I6LA 2DHCA 2H00A 3JAKB 3K30A 3KQLA 3LAWA 5AK3A 3ZE9A 4DIKA 4RTJA 1E0AA 4XVQA 1AXGA 1XCBA 1DHRA 1C7EA 2WBLC 3DUWA 1BOOA 4NBRA 1KDYA 2VZ0A 4JLPA 5L95A 4IIFA 4WT7A 5HF9A 4BASA 4D8XA 1VLLA 3MRTA 4UD6A 5JUWA 2CDBA 4AP6A 3U13A 1XTZA 2HPAA 1USGA 2NW6A 3LY8A 3RVKA 4YRIA 3ZNNA 1KS2A 2IHZA 2OXEA 3NFYA 3ZVLA 1SKYB 2JGNA 5CITA 1CDDA 3HWX1 2G6BA 3M81A 1QPZA 1F2UA 1JL3A 3L8GA 4R51A 1MRSA 4Z9YA 4DG9A 4HDAA 2AQIA 2ZYDA 3NB0A 1D2EA 1ENOA 2Q3JA 5FCDA 1MXFA 1S3SA 1DKQA 5B30A 2V3WA 1RWBA 3D4NA 2PQ6A 2I3DA 1EFVB 3H8WA 4I9NA 3VVMA 3L41A 4ETNA 2FLKA 4QUBA 1JQJC 4F5ZA 1FP7A 2ZB3A 4RZIA 4YVFA 3U9LA 2BGJA 3DSRA 2L82A 1I80A 3SSMA 1SHKA 5AQ1A 4X8MA 1AURA 2GM4A 1EYZA 4RLQA 5DTMA 4UQOA 3R2JA 4UNNA 2ZTVA 1XCOA 3GFFA 4LRUA 4PYOA 2JGFA 5D87A 3TBKA 5IYZA 1GZ3A 4ZYUA 3QI2A 3VPFA 3FZEA 1MT3A 2HGZA 3FMIA 4CL8A 1YK0A 2QMYA 1T6BY 3ZYZA 5DYGA 4WH0A 5E2AA 5FBVB 1Z08A 2Q9AA 3QXXA 3C5CA 4DIBA 5JVDF 5CK4A 5F3DA 1FYWA 4TSKA 2IV2X 4FMPA 4XCXA 1R10A 4AY5A 1Z74A 4OP3A 1RR6A 2AMVA 3P94A 2IYLD 4PX3A 2A57A 4WUVA 2XMDA 1ESCA 2J9FA 1U31A 2X8JA 4QIHA 1CUFA 4D4LA 1A77A 3KYDB 4HDQB 4UCWA 5JY6A 2H2AA 4CU2A 3MGCA 2IY9A 3IP6A 1TUEA 3P26A 2AFHA 3U9SA 4MDEA 4HMQA 4J0KA 4LCBA 1JA1A 3OE4A 1WPGA 2CMGA 4NE9A 5JNLA 1Z83A 1HOTA 2MCFA 4FHDA 2FR8C 3F9CA 5G40A 3IUEA 3RFCA 4Q4HA 1NJSA 5L3QA 2OHOA 4H0CA 4UM5A 4JLBA 2YZGA 1JJVA 2I99A 5JI3E 4EPTA 3ESBA 2G9UA 5H80A 2BISA 3GZJA 3K1AA 3W34A 2FSSA 4ZO9A 5LBUA 2D2VA 1HQYE 4RVFA 4DR6B 1I2ZA 1L7OA 1U1EA 2ZT5A 2GF9A 1LSSA 1KVTA 2IOQA 2OCGA 1N0IA 3C41J 4NFHA 1M1ZA 1WSAA 5HWSA 3TFWA 4DV3B 1J9EA 2CFRA 5LIRA 2YJ5A 1NF2A 1GPJA 1N8SA 2Y05A 3OPYB 4M98A 4L9AA 2QTWB 4ZZ3A 3LDAA 4UFPA 1Y1PA 1LK7A 2QK4A 4C0JA 4ARBA 3LJKA 1YS1X 1ZI6A 1YR8A 2GF2A 3K6KA 1XE3A 5BSRA 1GFIA 2FK7A 5HIJA 4YRGA 3E5NA 2DQZA 2Q1SA 3RRXA 1EG7A 2VHXA 1WDKA 5DMXA 5CAEB 4CKCA 5C1DA 2R85A 3TKYA 1UFKA 3KB2A 4EY3A 2QP4A 4CR8A 4ZA2A 3VV3A 2IXAA 4PYNA 4X94A 3RSSA 5A7FA 1Y8RB 2DT5A 4TL8A 1B14A 2B30A 3NBZC 1JXMA 5J5AA 1U0JA 2HCJB 4DLWA 1KVSA 5JHGB 5JADA 1SCAA 1B6GA 2GXUA 2WIKA 2C5HA 4G0ZA 1B2LA 4O4LA 2BCJQ 5JVDA 1BE8A 5A4AA 1A8PA 1BSVA 5JXJA 3G23A 2BJVA 3PC8A 1G59A 5LQCA 3AVVA 4BBAA 1VIAA 3IP3A 4KRYA 5FI5A 3I1FA 4CMGA 1HE4A 2HK9A 3MJCA 2B5VA 3SSNA 3UGKA 4F1KA 4N3CA 3CV3A 2FUKA 3NTUA 1ZAYA 5EE9A 2GHIA 2Y0CA 2GETA 3OTGA 4GP6A 1KQPA 3AUUA 4KVGA 3C0KA 2IPMA 3G2LA 3L5KA 1IRIA 3TW0A 5KKCA 2O7RA 1X92A 3S7TA 1FUIA 2HN9A 3DC7A 4U6QA 2B3DA 3E9RA 2AJBA 4YXWA 2HXYA 1HI9A 3TQOA 1U02A 1Y6JA 3QW2A 2I3AA 2QQ5A 4DJAA 4E2ZA 5KMGA 4JENA 1F0KA 1PFWA 2RH8A 2ZRAA 3BXEA 1BTOA 4JB3A 2IA5A 2P5SA 2JA2A 4PPQA 5DSZA 3RS8A 2OCAA 3DKIA 1M6NA 4JLKA 2BEJA 4F3RA 4OKNA 5H82A 4M89A 2VATA 2H0QA 3PSHA 5JJCA 2GD2A 2ZIXB 2WHPA 1J20A 3ANYB 4CIYA 3RYFA 2DLDA 4L8WB 5IBCA 2GBLC 2QBYB 2JI8A 4M1QA 1JEQB 3G0OA 3IP1A 4ZYTA 5GONA 1DC3A 1B8VA 2OHHA 3PC8C 4MR7B 4XRGA 3GT4A 3THXA 4RDHA 1VLHA 4RHYA 3S1LA 1EK6A 1W19A 3AUTA 3BXZA 5CR9A 3OEED 5IVDA 4NSNA 1JF8A 1J2JA 2V97A 4NCBA 3WJAA 1ZGZA 3CHYA 2OCDA 1JQ5A 3EXFA 2C96A 1QOPB 3GEPA 3CGWA 4Y6OA 3KHUA 2F1HA 3BE8A 3CUWA 4IO1A 1X8XA 1IN6A 3HCEA 4ALIA 4GPBA 2P4QA 3MTBA 4JI0B 2AHRA 3BGSA 4ZAWA 1ZEJA 4BLOA 2DR2A 2QJFA 2VKTA 5AIAA 1WLSA 4JI1B 2PZEA 1D5CA 1E1RD 1U7WA 1S01A 2IXFA 3SHFA 1YMQA 4BNFA 5BVGB 2A86A 4XWWA 3DE2X 4UEWA 4B79A 1NW6A 2QM7A 4DV4B 3OKFA 1LPMA 2G1JA 1V4NA 3I52A 5EMJA 4QQFA 3WIOA 5KUTA 5U4QA 2YWXA 3FIUA 3ZCTA 1N3BA 2J5RA 1U1CA 2KPOA 2CSUA 5LLDA 1GAEO 3TMYA 4RHUA 4OHVA 3BEDA 2HIGA 3JQGB 3CM0A 4KDCA 1Z63A 3IGFA 1U04A 3ECCA 3ZJVA 2O1SA 4B4WA 1RPAA 2HH9A 4AF8A 3KQYA 4LRTB 5K0SA 3LP8A 3WGKA 5FUVA 1CQPA 1QRAA 1NZDA 2M6SA 3C6KA 3VZSA 5KVVA 1XNRB 3PDJA 4LHEA 4CXMA 3P2EA 2MTBA 1YBMA 3ZEAA 5L4LA 3OOWA 2PWPA 1RIFA 4IVPA 4RK7A 5BWBA 3MS2A 5A0FA 1Q1BA 3SD7A 1F20A 4YGXB 4D3DA 4AKEA 4URUR 5KINB 1NVDA 1EVIA 4EKNB 5C31A 5AW7A 2P6UA 3T3PB 1Q12A 2PFSA 3BUSA 5EJ2A 1Q1AA 5FUBA 5HDQA 1B93A 1T4CA 3SJZA 4C4PA 2IU0A 1N6LA 2DUWA 4NX2A 2AYXA 4CMBA 2BGKA 1GNSA 4MARA 3K0CA 1MRNA 4Y6LA 4B6SA 2X0JA 4TPKA 2I4OA 4MW6A 4C4ZA 1C7RA 4BKRA 4MIYA 4D9NA 2B1JA 2M6KA 5BV1A 3OMXA 4FGKA 3SN6A 1P1RA 4MOWA 2LRHA 2VT6A 3RS9A 1GP2A 4ZEVA 1KQ3A 1I2DA 3IAM1 3W2TA 1SC9A 1VLMA 1L7DA 4QA9A 2C3YA 4LRWA 2J9YB 4M9RA 3FLEA 3KZXA 5A2GA 2VH2A 3HYCA 3UJBA 2HU2A 2ZR7A 2QTNA 3OTQA 1GUYA 1D9ZA 3H2GA 4Y7CA 4HFJA 3SF8B 3IC5A 2R44A 3BQNB 1P0QA 2QUZA 1I7LA 3GZNA 3FNBA 4RACA 5E95A 3O2JA 2YZNA 3ND6A 3DMYA 5CT9A 4MEBA 3RT1A 5FEUA 1RT9A 2G76A 3UAXA 4DWJA 4TKVA 3T1HB 3BFJA 2K4MA 1ADJA 1EK0A 3OOYA 4QT4A 4DV7B 2X6TA 3IQIX 1BHQ1 2OT3B 3M5CA 2ZUEA 5U9CA 4LY6A 4RK0A 3A4LA 4DMFA 1ZONA 1WBJB 2FJUA 4RM3A 2IH2A 2GLXA 5FADA 3W2HA 2CXUA 3DULA 1U63A 4AKSA 1B3BA 4LZPA 5TMBA 5BR8B 3BGDA 1PD1A 1XQVA 4TN5A 4NH4A 3TM5A 4BLWA 1FUEA 3C4VA 1CUEA 4Y9DA 3U1VA 2JLZA 2I03A 2Y1WA 3BE5A 3S2EA 5KNBH 1N1MA 1RP7A 1E9VA 1ZA1A 1VFNA 3BWVA 4CM5A 4GNRA 3PFBA 1JHVA 2HPHA 3PFWO 1KQFA 1NSYA 1CJKC 4DV6B 1SXJA 1Z3IX 3TTVA 2YC2C 3VR4D 1EWKA 2R751 2Q7XA 2NZUG 3IILA 3JSXA 2XAUA 2O8CB 1FJHA 1OYYA 4TTVA 3JTEA 4OOEA 3H9QA 1KAQA 4PZDA 5SICE 3T34A 4JI8B 1LVGA 2XRYA 1DX4A 3BAZA 3C6QA 1KE1A 2GILA 3PEEA 1E3MA 2EFEB 5HTKA 2X6QA 3OBBA 5FPKA 3TKAA 5HOEA 3J7TA 5FXMA 2J3EA 3JCZA 1PL7A 1NM5C 1OC2A 2ODWA 2JAUA 3FFBA 3KX2A 3OU6A 4JUIA 3IAM6 5L3QB 3EYWA 5E38A 3N1UA 1N1DA 4KXXA 1G38A 2NIPA 4RK4A 4HAYA 3PICA 5HKKD 2FZEA 2F8SA 3F3KA 3F9RA 3MBIA 4YMGA 1CERA 1T5TA 1U2DC 1MOSA 1WCXA 3CR3C 1DT3A 3PITA 4EG1A 4G97A 3JWHA 1MAVA 2OPBA 3HJHA 4UVEA 1G5QA 2REQA 2B8WA 3BDAA 1R66A 3KEFA 4K87A 5JS1A 1UFQA 3UAOA 2FMUA 2Z8ZA 3ZDZB 3PCTA 4HB4A 2YXDA 1UMDA 1BRTA 2W6MA 4QODA 4BVKA 4IQFA 2IUUA 4BLUA 5DP2A 4FZ5A 4PO3X 3H2JA 4PVCA 3B3QA 2B6HA 3KJIA 1K66A 2QVXX 3GEGA 4G37A 4NYJQ 4AMVA 4DCOA 1QB8A 4EJ6A 1F38A 4GU5A 5H3CA 5L4SA 4WBNF 3HCBA 4LSGA 3RU9A 3H8JA 1BHJA 3ZXYA 5E9QA 2ZWOA 1CNFA 1YFJA 1SXIA 3ENVA 2WOJA 4IRUB 1DQRA 1QQ5A 3SC2B 1KDOA 1EKXA 3D0RA 4HX9A 2AEEA 4N5NA 3EH1A 1GPDG 1WUYA 2UVDA 5FUXA 3GGDA 1ZJJA 1N5KA 2P5UA 3QU4A 3IPXA 4Y6PA 2ZS8A 5FBHA 3CUUA 4DABA 1MABB 2JI9A 2QN1A 4G0VA 4I36A 3RTBA 3NBQA 1DAFA 2OCBA 1JKJB 3RO7A 1PLLA 5ARDA 1PJ4A 2FPSA 1F2UB 3WLOA 5CFPA 4XWKA 1GAXA 2SBTA 2HT1A 4MQUA 5DT9A 3FMFA 3OX4A 5LXTB 5GP1A 4RF4A 2CLOB 4MKGA 3M2PA 1E3WB 1VL6A 5F1PA 2ZJ4A 3CSUA 5TPZD 5IULC 2RH5A 2IS4A 1SCBA 2CJWA 3PFKA 1WRBA 3O4GA 3O92A 1QHGA 2PJZA 3CT4A 3GJSA 2QT9A 1WUKS 2OV8A 1JI3A 2PX8A 1BIFA 2ICAA 3GPDG 1S5PA 3FYCA 2GZ3A 3ZXUB 1XTRA 3L7MA 2W5UA 4YQYA 3GG2A 3ZV6A 3AF4A 4BP1A 4JJ6A 2GB4A 3BSWA 4E15A 1PVVA 1PL6A 3NMUF 3G2OA 2QAGC 2AI1A 3N2ZB 4KGZA 3HKCB 2XBUA 4RKYA 3H11B 2ZPAA 4O2BA 4BLTA 1M1YE 2LKCA 5I45A 4R1NA 1PDVA 1QF9A 3QXSA 4OXIA 1TT5B 4QU8A 1XZFA 4Y9RA 3SIRA 4CKBA 2O2JA 6NULA 3R3WA 3FR7A 1Z18A 3WKAA 4AZ0B 2A88A 4EMBA 1JW9B 5J2UA 3ZGZA 1TCUA 3R7LA 4PZUA 3I6YA 4IRXA 3PDCA 4JI4B 4XJXA 2HA6A 1C14A 2BM9A 1QCCA 4C04A 2ZAMA 3FCYA 4DE5A 1QV9A 1RHUA 1ZSYA 3UCEA 1I51A 4RIEA 3AY7A 1BDBA 1G8JA 4L08A 1PT8A 1S2LA 2A0WA 1LPSA 1Z62A 1I6WA 2FW6A 4OJQA 5ICSA 3I37X 1VRCA 1DNPA 3QBTA 2VP6A 4G8DA 2HRCA 5EE3A 4AUEA 5EA2A 5D01A 2G82A 4NDNE 4KFRA 3CJQA 1CUJA 1TZMA 1YHZA 4MV3A 2Z2JA 3USES 5I7AA 4CKZA 4D7AA 2Q6OA 3EOBI 3C8DA 3FHLA 1PRYA 3WHIA 3UK7A 1EIWA 4ASUA 1A7JA 4E6PA 1E32A 3S6JA 1ZK4A 3M49A 3T4UA 4CDNA 1ABFA 4ZI7F 4MKIA 4RZUA 4B3TB 4DS3A 1E0KA 1BW9B 5E9JA 5J4VA 3OPNA 2YRWA 2JVJA 4LWZA 3TZEA 1EU1A 1P74A 4WOCA 5KYUA 3C8MA 3JX9A 4HNRA 1F6BA 2WHPB 1LNQA 3LO5A 3K1JA 4RNDB 2YV3A 1XU7A 3GJRA 4HNTA 1LJLA 2OCXA 3QE2A 4O4JA 4P3PA 3U4DA 3BKWA 5ALWA 1NVGA 1T0PA 2N3ZA 4M8IA 4RLHA 4AMBA 4IJ5A 1P80A 2IZOA 4Q0MA 1HDRA 2YWBA 4LMBA 1KEWA 3PX7A 4XB6B 4FFSA 1HE2A 1UF9A 2PH5A 3ZYCA 4I55B 5B4TA 4AG5A 3F3SA 4G07A 1NLZA 2XOKD 4DANA 621PA 1HQKA 1XRPA 3IAFA 5IKEA 2C03A 4RORA 3B51X 3G8YA 2CVPA 2QTHA 1GRNA 2NPOA 4WY2A 1CF2O 2ZBPA 4MV7A 1JIUA 1OI7A 4Y0NA 4ZMBA 2PSHA 4GPD1 4J0FA 3V4FA 3A6JA 1OOEA 4Z4CA 2GPNA 2CUNA 3LDHA 4TTJA 3QE3A 3T41A 1VDZA 2YX1A 5J3JA 4MW4A 2P2SA 2VQDA 4KQ1A 3WOHA 5D3MB 3FRJA 3FOAA 2VSYA 1HT3A 3LIIA 4HDMB 1J56A 5LIPA 4IDCA 5ALHA 1N6KA 5T5QA 1F6DA 2H5JA 3CC8A 4NABA 2MIIA 3CEMA 4YECA 1ISMA 1KSHA 2P1RA 2O59A 5B64A 5GM2A 3L1HA 5LVAA 4QPJC 4HH4A 4DXAA 1ZCJA 2W2XA 1U1IA 2XZPA 4UEJA 3CW8X 3A14A 3PPIA 1OW3B 3O8DA 3WAGA 2BGNA 2O57A 2RHTA 1R0XA 3GIWA 2FQQA 4WZBE 3HYTA 3AQ4A 1OPXA 5I8ZA 1E5XA 3VKHA 4GLOA 3W06A 1JG1A 5JC1A 1R0KA 2VJBA 5SY6A 4LF4B 4OHYA 1YJAA 2GPWA 1DAOA 4DC9A 1UBCA 5CPFA 3VR2A 4Q9LA 1OA0A 3SI7A 2X42A 2XR1A 1KZGB 2OXCA 1I7SB 1IPHA 1D5WA 1F2TA 1GGKA 2PMEA 3T1TA 3OC0A 4Z0TA 5HF5A 1E9AA 1W6RA 1FU4A 5BY2A 1RBZA 2Y9PB 4BZXA 1KXJA 4G5XA 4FNAA 1QH9A 4QHYA 4E1VA 4TS1A 2WYIA 3VUFA 1GCGA 7MDHA 1X9IA 3AIOA 4QVKA 3I0ZA 2NO9A 4PFJA 3I2JA 3R8CA 3EVFA 1LLUA 3GMIA 1NLMA 3H5OA 3PBKA 1C1XB 3QKUA 3WB1A 4RVDA 5JZMA 1W0JA 2RGNC 4O4LB 1U2SA 3RUEA 4BRWA 4OYYA 4CMAA 4DHEA 1L8AA 2YXLA 4BNDB 4KR7A 2CHUA 4EYGA 4U3JA 2YH2A 3ZWDA 4G1CA 5DSTA 2DCUA 1SBHA 4D82A 2G9ZA 1M34A 1FJXA 1NE7A 3NDBB 2V58A 3MN1A 2BTOA 5LB2A 1X1RA 1F4VA 5GZ6A 1QRDA 5IP5A 5ECGC 1XT6A 2C1EA 4DCVA 3Q6IA 3FDZB 3ZD9A 2WSBA 3BH0A 4BTEA 3RSFA 4CFYA 4EAQA 3BSYA 1I33A 4IHJA 1OU0A 4WCDA 3V4ZA 2YTZA 3ONVA 4TXNA 5ESXA 4LE2A 3K8OE 3TZKA 4C89A 4F92B 1V5WA 3C6ZA 3OFND 4AYTA 2X9QA 1X7XA 4POAA 5B7QA 4ARVA 2OZEA 2OLJA 3SEQA 3RSQA 4NE7A 3SSAA 3KHTA 2GTIA 3IV9A 1VCMA 4Q39A 2ZSKA 2BM1A 1DTEA 1EFRD 1P60A 2BR3A 3GQBA 3JQ9A 4GW3A 3LBAA 2EKDA 4AN1A 4D44A 3B38A 4GBED 1FP4A 2FX2A 4WFIA 5JW6A 3IKMB 4AULA 5AVJA 2JHFA 3K70B 1GZ7A 4XX0A 4YPOA 4ZVUA 4R4JA 4RGVA 4K0RA 3RB8A 3RIMA 3EC7A 2H1VA 3KVRA 3URKA 3Q8XB 3UW3A 1C41A 4EHHA 1IY0A 4MCJA 1JHDA 1EHIA 3U26A 1ZISA 4QLBA 4Y6QA 2C8VA 1HPLA 1YDWA 3PLRA 1KL7A 1OX4A 3GGCA 4R0NA 4RWZA 2JCYA 4P3NA 5COBA 3I6MA 2UUBB 1DCKA 4PYLA 2JAQA 2GAFA 4C6SA 1NQXA 1R0WA 2LVBA 2AFHB 3JS5A 5F4ZA 1EVLA 4K86A 3D8BA 1DCFA 1CRPA 1YVDA 2FW9A 2QM3A 1AQUA 4BMPB 4PLZA 1A7UA 4FMBB 3WLEA 3L6RA 2AUNA 5DHTA 4C2TA 3CSDA 1CIPA 1QYDA 1O6ZA 3RQIA 3ILSA 1IJKA 3FTCA 3R0JA 2QY6A 2DWUA 3K9BA 1X7GA 1W5TA 1GTMA 1RPNA 2BUAA 3RVOA 3KM0A 5AKHA 3DMFA 4FNGA 4PW0A 5EZ5A 5H3LA 3OTHA 5C7OO 3DHVA 3LUJA 4NCKA 5EUMA 5F9HA 4BEVA 5K0BA 2J45A 2QVLA 4H3KB 2ECFA 2HADA 1W48A 2WYUA 3KLPX 5K03A 1IHOA 4KRXA 4RO0A 1Z2OX 1WPRA 1YJBA 3AEUA 3DE3X