4BVBA

Crystal structure of human sirt3 in complex with the inhibitor ex-527 and adp-ribose
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
273
structure length
273
Chain Sequence
KLSLQDVAELIRARACQRVVVMVGAGISTPSGIPDFRSPGSGLYSNLQQYDLPYPEAIFELPFFFHNPKPFFTLAKELYPGNYKPNVTHYFLRLLHDKGLLLRLYTQNIDGLERVSGIPASKLVEAHGTFASATCTVCQRPFPGEDIRADVMADRVPRCPVCTGVVKPDIVFFGEPLPQRFLLHVVDFPMADLLLILGTSLEVEPFASLTEAVRSSVPRLLINRDLVGPLAWHPRSRDVAQLGDVVHGVESLVELLGWTEEMRDLVQRETGKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NAD-DEPENDENT PROTEIN DEACETYLASE SIRTUIN-3, MITOCHONDRIAL
publication title Ex-527 Inhibits Sirtuins by Exploiting Their Unique Nad+-Dependent Deacetylation Mechanism
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 93
structure length 273
sequence length 273
ec nomenclature ec 3.5.1.-:
pdb deposition date 2013-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02146 SIR2 Sir2 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1600.10 Alpha Beta 2-Layer Sandwich SIR2/SIRT2 'Small Domain' SIR2/SIRT2 'Small Domain' 4bvbA02
3.40.50.1220 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold TPP-binding domain 4bvbA01
1YC2A 4JUDX 3CLTD 1PNOA 1Y9DA 2H4JA 2Q5JA 2UZ1B 2VJYA 4TWIA 4GG1A 2FRDC 2H2FA 3U3DA 3GLTA 2VBGA 1UPAA 4JUBA 4JU8A 1DJLA 3EY9A 4ZP1A 5EJMA 4G1CA 2A1UA 1Q14A 1T9BA 4K9LA 2Q5LA 4BN4A 5EJ4A 4QELA 1PT9A 4IAOA 2W93A 2EZ8A 1OZGA 2OO5C 4ZZIA 2VBIA 4FZ3A 2EZ9A 3GLRA 1YC5A 1T9AA 2UZ1A 1E3TA 4KGDA 4K9PA 4UTVA 2BRUC 4JUCA 4JD5A 1Q17A 2Q5QA 4Y6LA 3JR3A 4K9KA 3JWPA 2NYRA 4GM4A 2HJHA 4R8MA 4RMHA 4MPPA 5MFZA 5DEIA 1YBHA 2WVGA 1Q6ZA 1OZFA 5BWNA 2Q28A 4RJKA 1OZHA 1D4OA 2IHVA 1M2KA 4JSRA 2WVHA 2Q27A 2PGOA 2JIBA 1M2HA 2Q5OA 5K6TA 2FSVC 2VK4A 4UUBA 2OD2A 4V1CA 4UTNA 3E9YA 4UU7A 4JT8A 5MGNA 1QPBA 1ZPDA 2JLAA 3HWX1 3F6EX 4BUZA 1SZDA 1V5GA 4BN5A 1PTJC 4K9QA 4I5IA 3CLRD 2FWNA 2VK1A 5IMSA 3OE1A 4HDAA 1U28C 4FEEA 4L2IA 5DGDA 1JSCA 4X3OA 1HZZC 2OORC 1V5EA 2EZUA 2OD9A 5EJ8A 2WVAA 5BWOA 3LQ1A 4BVEA 3FSJX 4Y6QA 5AHKA 3ZGOA 3ZGVA 4BVBA 4RMGA 1EFPA 3U31A 4K9MA 5DGTA 1V5FA 3EA4A 4JU9A 4UU8A 4BVGA 2C31A 3IAFA 3D4BA 5MFPA 3PKIA 3ZG6A 1YI0A 1XLTC 5EJAA 4QPZA 2QQFA 4K9NA 1PO7A 1O97D 1M2GA 4JT9A 3K35A 5K3SA 4RJIA 4JUAA 1EFVA 3IAEA 4BVFA 4BVHA 5FEMA 4FVTA 1S7GA 4Q9DA 5MF6A 3CF4G 4GM1A 1OVMA 2EZTA 4COKA 4D5GA 4MPJA 1PNQA 2NXWA 1YI1A 2X7JA 4JUFA 2H2DA 3RIYA 3F6BX 4UTRA 3FLMA 2H4FA 4KXQA 1UPBA 1Q1AA 5EJ7A 3EYAA 2H2HA 2A1TR 2FR8C 4UTXA 2JI6A 1T9CA 2JLCA 5EJ5A 4KPUA 4C78A 2EZ4A 4QQ8A 4D5EA 1YHYA 4HD8A 4UUAA 4F56A 2PANA 4BV2A 1YNOA 2PGNA 2VK8A 4F4UA 2H59A 1M2NA 4RJJA 2Q29A 4RMJA 1YHZA 1Z8NA 1O96B 4L3OA 4IF6A 4V1CI 2JI9A 1SZCA 2QQGA 4X3PA 3FZNA 4GP9A 2B4YA 3PKJA 5EJ9A 2JI8A 3D81A 2AG0A 4FEGA 4MPRA 2H2IA 3HWWA 5K6RA 4MZXA 3D7KA 3GLSA 2H4HA 4J1TC 2AG1A 1NM5C 1MA3A 4BV3A 1U31A 5D7NA 4IG9A 4TWJA 5K2OA 4Y6OA 1S5PA 2FN3A 3CLUD 1PYDA 4GM0A 4K9OA 4V1CB 1U2DC 2VBFA 3PDHA 1POXA 4J16C 5FYQA 2V3WA 3RIGA 2H2GA 1U2GC 5EJ6A 1MCZA 3CLSD 1YTLA 4GPEA 1T9DA 4O8ZA 2DJIA 1POWA 1J8FA 1PI3A 4C7BA 4UTZA 1N0HA 1PVDA 4MQ5A 2IHTA 1BFDA 2JI7A 2IHUA 3GLUA 4RMIA 1M2JA 5BWLA 1UPCA 1ICIA 2OD7A
chains in the Genus database with same CATH superfamily
4B45A 2XCRB 4QQRA 2P7IA 5CD1A 1CRZA 3JQ9C 2R1TA 5ELMA 5ED0A 3K9BA 4QDTA 3A4NA 2MSCB 3H3FA 2AFIA 2DM6A 3WLRA 2H4JA 4U2KA 3WWYA 2C8JA 3MM4A 2H4WA 2E4ZA 1LVUA 4PPYA 5H81A 5GVSA 3IEMA 2XKBA 2FPKA 2J7PA 4RXUA 4YP0A 4PV7A 1U2DA 3X2EA 5CJ2A 4U7WA 1VG9B 1TOAA 2O0LA 1HL3A 3QUSA 5K3AA 1CQIA 2D2FA 2X5XA 3RYCA 1ODCA 4YMGA 1EAYA 4YT5A 4ROSA 1RPNA 3RIMA 4Z5XA 3MVEA 2IPMA 5FL7D 4ZK6A 4KL8S 4CMIB 4AWBA 2QX6A 5H80A 4D4KA 3OA0A 5EQJB 1KHHA 1R66A 3DMRA 2EQ5A 4OM7A 5GPBA 3OO1A 2X41A 4P4SA 2B69A 4PAWA 1XNGA 2XGSA 3BKWA 1P45A 1WOMA 5GWXA 4S1VA 3KQYA 2F1JA 1TM2A 2Q4TA 4HDNB 5BN4A 2ZCJA 4EARA 4Y2TA 2PH1A 4KBYA 2BMAA 1L6RA 2R6FA 1H8HA 2EP5A 4FT4A 3EULA 1XEXB 3LSTA 4C7MA 4EG5A 5AW8A 3E27A 2E5WA 3QYAA 3SDZA 2I76A 2MIIA 3C74A 3E18A 1XCJA 2J3MA 4Y2SA 1F0NA 3UWKA 4MCIA 2P67A 3W5VA 1N2BA 4G41A 1W85A 2QLFA 2EDCA 1EJ2A 2PR7A 1YA6A 1Y8AA 2Q2NA 2W93A 2P77A 3O7WA 4NJEA 1XD2A 1X38A 3AINA 3ET5A 3I4FA 1X1RA 4G0OA 4JOQA 4LNHA 5IJXA 4YP9A 1G20A 2Q50A 4GXTA 5DLPA 4OGFA 1QLHA 3GXBA 2ZSDA 1VL2A 5B55A 2O2HA 3CKLA 1LH0A 3L9XA 4YS6A 4YN3A 5HWSA 4MP8A 3GLIA 4YAIA 5CCDA 3KYDB 3VUFA 5CXQA 4UBOA 1GR0A 4XM1A 1TTQB 4Y0VA 1ZM4A 4MIEA 3AZPA 5DXFA 3V8VA 2CDCA 4X8OA 4YDSA 5SZIA 2XE8A 3AVOA 4AKTA 4BLSA 4OXYA 1VLZA 4Q21A 4Q34A 5EP4A 4GOKA 4PC6A 4KUGA 2ONCA 5A71A 4N1AA 4F2PA 2PXAA 2X9NA 4XH9B 4CDNA 4LGYA 2ZBGA 3JQRA 3FR7A 1T1IA 1UBKS 5A3VA 3O4RA 5BV7A 1I3NA 2BVNA 2YRWA 3T5PA 2QT1A 1K4MA 3K4PA 4ISBA 4PN3A 1ZK3A 5TR9A 3NV7A 4DQVA 2RJ3A 3X1XA 1P0IA 2FMUA 1X8JA 3DNPA 4V02A 3HJNA 3HO8A 1YXMA 2OBNA 5HA5A 4EYEA 3SOPA 2PS0A 2QD4A 2BR4A 3H2HA 3WLKX 2ZYWX 2R7NA 2CNNA 4UVEA 2K5UA 3CUUA 4WK0B 2Y9PB 4EMBA 2ZI5A 3H1GA 4KE7A 4KNWA 1G8FA 4TMKA 2UXBB 1K06A 4AIIA 5JWHA 2ZPTX 1QQ7A 4BE7B 4RHTA 1P1HA 3EBPA 3K9WA 4BBJA 2FOXA 1JALA 3FSEA 3GDWA 4BOYA 5C7YA 1T5DX 4JJ4A 4AJ9A 1AB6A 1WPQA 2WVGA 3L40A 4C7JA 3LECA 3ET4A 2VJPA 5IT9A 3LQQA 1XCMA 3EFEA 4BBAA 3PRJA 4RJKA 1EGAA 3BRSA 1KHTA 1SCDA 3CQ9A 3R3XA 4MRRA 5TEVA 1J06A 5JAUA 3LUDA 3DDZX 3FCUB 1XRQA 1F0PA 5BQ3A 1D7AA 1ZH8A 3PC6A 1Z7EA 1DC5A 1BVUA 4II3A 1VBFA 4P4UA 2A6PA 1F2TB 2Q27A 1O2DA 1QHFA 2BGNA 3EWAA 3W9YA 1GITA 3VOTA 5KYTA 3TG2A 4Z4GA 3W5DA 1U0GA 2P6OA 3G0BA 1NTRA 5A5EA 5IKEA 5HZMA 1TQDA 3VMMA 4LZWA 3PR1A 1Q1GA 2H5LA 4NMLA 4OYYA 5FCDA 5GTDA 4N6OA 3FNBA 2QTBA 3TJMA 4V1CA 4NESA 5ARDA 3RRNA 1VE3A 3ZK7A 2R4QA 3TZBA 3BAZA 1QGUA 4LZJA 4YXWD 5J43A 2X2PA 3PTLA 1C7JA 2KX7A 2E9SA 4GMKA 5K9ZA 4PPGA 1TYAE 3MOIA 3NHJA 5DHAA 3KT0A 1Z18A 5E95A 1X74A 3BE4A 4A0SA 4XAQA 1Q3KA 1VBKA 1LNZA 2XVYA 2QMOA 3ME5A 1E20A 4RHUA 5FTJA 3CRQA 2VDJA 3EZNA 3ZEIA 1LWNA 4Q7QA 1QIEA 3F7TA 3OP1A 4OK5A 3CUVA 3E9MA 4IDNA 1ULTA 1ORIA 1Z5NA 1G8HA 3NEAA 4M0MA 1DCFA 3K92A 3CVJA 5HUHA 1XWFA 1TK2A 1OAOA 2CXRA 5IAGA 3QA9A 1VMKA 1Z83A 4NG4A 4U7PB 4CQNA 4O25A 2GRJA 1UBCA 2I6XA 3DZJA 3TZEA 2J9RA 2XGGA 5F98A 4L9WA 4M53A 1EUZA 4KO2S 3SC3A 2HLDA 3AQIA 4I1VA 3NWEA 1A7AA 2ZYAA 4B80A 3TI7A 3T9EA 1M74A 2IDKA 2WTNA 3TW0A 2IS4A 3RSZA 2P11A 5B1IA 1SKYB 3N2KB 4X6YA 4ZI3A 1QRSA 3NWBA 2BI7A 5EZSA 2BMDA 4LQLA 3U4CA 4CQMA 5BQFA 2JIOA 1DDOA 2AEJA 4XFKA 1UDAA 1ZM2A 1TFUA 2JJQA 1AF7A 1F4VA 1YS2X 2O4CA 4FEEA 1H2WA 1TI7A 4MUHA 4OV6B 4YMUA 1YAHA 4XPZA 3OQOA 3HNPA 1UK9A 4K40A 2H07A 4C0BA 3EDYA 2EZUA 3M6UA 4ZVUA 5K1ZA 3GNQA 2X2FA 1DIAA 4OGWA 4QYXA 1RHJA 4FFSA 4NJOA 3FCYA 3UFBA 3OOWA 1OBVA 1XMXA 3FVTA 1Z28A 5FA6A 4D25A 3DLAA 2EHJA 4BZWA 2TMYA 4IJMA 1E7WA 4OHZA 3LQ1A 1J0AA 2JATA 3LYAA 1HOXA 2P3SA 2DULA 3FSJX 3PE3A 4TXJA 1IHPA 4LK2A 2OGTA 3NCHA 3C87A 4RHYA 2A9QA 2VBCA 3GFOA 5BYBA 5K8VA 2HO4A 1JN0A 5KYYB 4BJ3A 2AB0A 3EFOB 2A33A 3M1AA 4HQLA 4P81A 1GTZA 2Q46A 4ME6A 1QHHA 2AX3A 5I7OA 2SCUA 2PFSA 1N3LA 2C5HA 3D02A 4HGQA 2Q1SA 4R98A 4N0DA 4AKIA 5JJBA 3IUQA 4MW5A 2ZB3A 3RTDA 1JIQA 1EBFA 4EBBA 2RD2A 1QTRA 2IZ5A 3F9IA 2WFLB 3Q98A 2ECPA 3TAHA 3JQFC 4FMPA 3PKIA 4M7WA 1MQ8B 1ZBDA 1VECA 1P2GA 1A76A 4O4HA 4XJXA 1EQAA 4CQJA 3KUKA 1XCBA 4BEBA 2YS6A 2BV3A 4JOBA 3WB2A 1LDBA 2ZS7A 2VDUE 1J9GA 4FHEA 1SUIA 2HOQA 1KIMA 3JATB 2ZREA 1ZITA 3RSOA 3GIDA 2GAFA 4B1FA 1DXHA 1W0JA 4CF4A 1AT1A 1DRUA 1VHLA 3KPVA 5AOBA 4E5YA 3E82A 3H75A 3M4JA 2QUAA 3OEHD 2GBCA 3WFIA 1E89A 5EN4A 1H69A 2Y1EA 3UHPA 3WIBA 5JQWA 3ZIAD 1IMOA 2WJ4A 3SXUA 1BWQA 2C1XA 3HUUA 1Q7RA 2R8EA 4FN5A 3V2UA 4PCVA 1MJNA 1KDTA 3U1VA 3EA5A 2QUHA 3IYLW 3WOHA 4KREA 2WWIA 2DB3A 4UHKA 4IV5A 3D4NA 2YASA 4X8MA 1Z2NX 1V41E 1Y48E 1SN7A 3SF8A 4MW0A 5EINA 1HORA 1EZ1A 1T8WA 2AC2A 2L2QA 5L8VA 3VC3A 5AM2A 1BU5A 1UC8A 3SZMA 1VDMA 2WYWA 4Q1AA 4AQ7A 1KYWA 1AZWA 1IJKA 2ZRAA 3W04A 4BIMA 3LX6A 1OE0A 4L9AA 2GKOA 3QUTA 4GLFA 1HM5A 1AVTA 1AZTA 1PL6A 2FWMX 2RKBA 2G07A 3INNA 1BA2A 1IUNA 4M0EA 4AJLA 2AMVA 1C9YA 3WP1B 5DNVA 3VZBA 4MGEA 2QUZA 5T4FA 2JA2A 2YY5A 5DBFA 4Q03A 2ZE5A 3PT9A 2GLTA 4KXFB 3IP9A 1OGYA 1XT6A 2A7QA 2RJOA 2G8NA 2AR9A 4DQUA 3F1KA 2IXBA 5DGXA 4GXNA 3B13B 2YTZA 4I50B 4LTNA 3AKZA 4NYJQ 4FR2A 1XQXA 3VGJA 4I36A 5JNSA 4G5XA 4MRVA 1C7FA 1KEEA 4R81A 1KI8A 2QW0X 5BW5A 3CG4A 2PX3A 4YO7A 3VYVA 3WGZA 3C8MA 2HV8A 1EFTA 3R44A 2HCRA 2NG1A 1TF7A 4NICA 2ZAYA 4PLHA 2ZM5A 4H7HA 2PMBA 1T9ZA 1TYDE 5HTKA 1BGWA 1JR3A 1AQLA 1OU4A 1Q0LA 1EP3B 1CZUA 1UFOA 1JEDA 1XROA 2P0EA 2ZT6A 1HDCA 1DKMA 3KDAA 3R3JA 1CULC 1FW8A 1XZEA 3JWIA 1SU4A 3BS4A 1W44A 4HDSA 3DSRA 5BNFA 1XRLA 2YZKA 4OL0A 1JXMA 2OP0A 3SYMA 3QKRA 5TRTA 3Q9NA 4FS3A 1WW8A 4DBZA 4MVJF 4DZRA 2ZEJA 2J7KA 2ZATA 3HJCA 3HJBA 3RANA 4AY4A 2QIOA 1ACLA 4G2TA 3VO2A 1Q7GA 4M0DA 1AHHA 4FMBB 4IO1A 4IMPA 3RVPA 3WK4A 2YC2C 3K6SA 4QU8A 3HO1A 1GNPA 3OPQA 2RBKA 2N47A 4RSGA 4TTSA 4TV8B 3LU1A 3ZZUA 4U2GA 1JHOA 4DNPA 1U6JA 1F1JA 3RIEA 2ALJA 1P2DA 1KVRA 2WVJA 1GGNA 4DVJA 4D4HA 1H4SA 2R84A 1C9KA 9MHTA 4LIPD 1KS9A 1LZLA 4DV2B 5BN3A 2Q7XA 3E3OA 4L6AA 3U61B 2WTMA 1UFRA 1VB3A 3RU7A 2BFNA 2KBEA 4LWZA 2NADA 4BNNA 4YMSA 2NTEA 2VQFB 2PD4A 4GQBA 5F78A 5SV2A 2XD4A 3AUSA 1CDEA 3BMOA 3D7NA 3DF9A 1L5RA 2VG8A 3O4VA 2OZVA 4XEHA 2A84A 5IDWA 3ENVA 2G9UA 5ER9A 1I4LD 2A3RA 1J09A 3VR4D 2ZBUA 3OHPA 3HJUA 4TQGA 4DG8A 3MCAA 2J5KA 3PXDA 1F9EA 3Q15C 3QKIA 1K4KA 5ALLA 4AF8A 1S01A 3AEZA 3Q7IA 3HWWA 1H93A 2FK7A 1PR2A 1PE0A 1AOXA 4LRTB 1ZGGA 1V39A 3HKBB 1FNMA 1P5HA 1UBSB 1RRGA 4Q4JB 1ZMOA 4F60A 4UBLA 3DV0A 5EZYB 4J1TC 4C9BA 1DX4A 4B31A 3ENNA 2XTJA 4MW6A 4N7BA 1P18A 1DQSA 5I7FA 3RC7A 5ALIA 3G1UA 4EUEA 1OZAA 3HJTA 3L82B 3NG1A 5COQA 5JALA 2C5GA 3SE7A 4B84A 4FI3C 3PK0A 2BBTA 4LGVA 4AYXA 5FLXA 3DTYA 3GGCA 3I34X 5JAHA 1F8XA 3L92A 4PG4A 4RA9B 5D6OA 4EO4A 1SZPA 1KI7A 4XUDA 4CU5A 1Q7BA 1TVMA 5H82A 4ZT7A 4UHCA 1JIKA 4IICA 2R2GA 3BEOA 1JG3A 2A4MA 2IL1A 1QK3A 4L50A 2PKXA 2XHZA 1N1MA 1EWKA 1T5HX 1Z74A 2X7HA 3HKCB 4EL5A 1RZ3A 3N7TA 2N1BA 4JL6A 1S2DA 2EW8A 1P6XA 4RLHA 3RFXA 3G5AA 3C1TA 3UT5A 3TW8A 2J3LA 2H2GA 2R87A 2XVMA 1SCUB 4G5RA 5L9AA 3GELA 3WO1A 1SHUX 3EGEA 5KVSA 5P8WA 1XZNA 4G5HA 5JBNA 1ZSNA 5ITZB 3GLGB 4NRDA 4AY5A 1XHLA 1VPEA 3EDQA 3KJHA 4Q3CA 4A2CA 1RMQA 2FN4A 4BVKA 3BF7A 3HMKA 4DTIA 1T9DA 5E1BA 3U40A 3P27A 4MK4A 3CBQA 4EA8A 4O2AF 4E15A 1PI3A 1ZFNA 3BL6A 1C1XB 2KHZA 3GJ7A 2RMKA 1GTSA 2NVUA 3KHTA 2OVFA 2BEWA 2X5KO 2OCAA 1ISJA 1JHRA 2EBFX 3DQZA 4TL6A 4K81B 2YUIA 4U6QA 4WY2A 5ESXA 3FM9A 5B1HA 3TNDA 3AVUA 4NCBA 1J21A 1QP7A 3ZLBA 5JAOA 4C7XA 1RC8A 5CW1A 3DS8A 4EA7A 3BXFA 1BQ4A 5I7HA 2V98A 3EZYA 2V6GA 1U5CA 1OXUA 3F5MA 3D3NA 3T7SA 1GL6A 1H9BA 4BE4A 4MCHA 4UU1A 3JY6A 1Q0SA 2OOKA 5JY1A 2JEZA 3USCS 3T9DA 4U00A 1BSVA 2Y0PA 4WIAA 1U5BA 4KR9A 4Q4HB 3DWFA 3RTAA 1FDRA 1M2OB 2K7ZA 1N3YA 2MDTA 2J09A 1M8GA 1QO9A 1LDYA 1BQEA 2R8PA 3I01A 5I8ZA 2HMUA 2D0OB 5KCMA 4YJ3B 2WAOA 1ZY2A 3ZK8A 1EGVB 4MRNA 2ADOA 4EW3A 3MXOA 3GARA 4Q48A 3T3DA 1XTJA 3PZBA 3OLYA 2ZIEA 4MGHA 2RHMA 4M9QA 5AK6A 2FH5B 1T6XA 2WB4A 4OAOA 4PSUA 4EMTA 2H17A 1K1EA 3GRZA 3PQ6A 4ATNA 3MTDA 4XLZA 5EXEA 4Y9TA 4OUDA 2HREA 5E6RA 2PH7A 1KEWA 4L5BA 1RZRA 2R4UA 4FCVA 1H94A 3KSRA 4GEKA 5ARCA 3RJ5A 3BMQA 4MQEA 1S2IA 2H1IA 1ZIXA 1GIAA 3KPJA 1MD9A 1QH1B 1J8MF 4KACA 5EHGA 3EF3A 3D5TA 2OSVA 3B85A 2A1UA 1Q0RA 5CVJA 4DS3A 1BROA 4CQLA 3UBTA 2C8VA 4LXUA 1NI4A 3S8YA 1ULZA 1QIJA 3VNVA 1OI3A 1JZQA 1J0DA 2NX2A 3X2FA 4FBLA 1B0ZA 2G83A 3V55A 5AIBA 3LXXA 2ONJA 3R3SA 4BN4A 2B78A 3UTDA 3JPWA 1AN9A 4JT2A 2IVZA 3H7IA 2QVZX 3L43A 3GEGA 4RDIA 2X8BA 4QJIA 4XWAA 5REQB 4NF2A 4CFYA 2FG5A 2RIPA 3DZFA 3NV9A 8MHTA 5CX1A 3P2OA 4YRRA 2B4TO 2FPIA 2V7TA 4TS1A 1USWA 3DCNA 3A2KA 2KLHA 4HT3B 1A2KC 4B82A 5LNK1 4DC0A 2EZ9A 2OY0A 2FDCA 3A3OA 4IX9A 4GWGA 4JBIA 1SU7A 4TTVA 3L6OO 1YFLA 3WRWA 5AXCA 1WSDA 3WWEA 3K0HA 4C2AA 4XJVA 4RHXA 1V8OA 1APBA 3WYAA 3FTQA 4NJMA 3H97A 4XIGS 3V1KA 4B2IA 2F64A 3LTNC 4KE8A 4CIWA 1FUKA 4Q3KA 1ZVJA 5LLDA 3N39C 2Q3FA 2FN9A 3PGMA 4MWCA 2VDWB 4IIJA 5DNEA 4CEHA 2G6TA 2EV9A 4ISCA 1GAQA 1LBTA 1T26A 2P1ZA 1XU9A 1C0PA 4R1SA 2F90A 1IHDA 4IOKA 1OFVA 1OV4A 4FFLA 4YT8A 1F4PA 3P0IA 4B7CA 1L4HA 4I6GA 1KDYA 1G3MA 2BBOA 4MYCA 3F2VA 4D0RA 3ISJA 3HBMA 3HBFA 1LBIA 1VMDA 1YQ9A 1T4MA 4FFMA 3HB1A 4JLDA 5CB6A 4B3SB 4KV9A 4WCFC 2L17A 5JCXA 2WKPA 3GY0A 4YWHA 4MHSA 4K8OA 4YRPA 2VRWA 2H7YA 2OCXA 2XCIA 1JB1A 3BIOA 2ZWAA 3EMVA 1TE2A 4HEHA 3ROQA 1M8PA 1INLA 1M0WA 1T10A 4B5KA 1E1QD 1RNLA 5E3JA 2Q45A 3NEYA 2IYQA 3GJXC 1ILEA 1Z4QA 1QGAA 4NE2A 1WZIA 2CHEA 2JHPA 1LTQA 1NFFA 3EG5A 3OIGA 4LDZA 2DC1A 2IEZA 3F8WA 1E3EA 1L3IA 3GH1A 3IQIX 3MWFA 3BWBA 2WAMA 3UXEA 4Y6SA 1US8B 1VSTA 3FSRA 1UXGA 4JI3B 3GXOA 4B74A 1JLHA 1PZEA 3LC7O 1I1HA 3CVUA 1YRYE 4OKIA 3ORFA 4CLOA 1TPYA 2WQ7A 3C4JA 1LPNA 5I4KA 5DLDA 1U0NA 5ECGC 1KYTA 2JAHA 2EFDB 1KI4A 2HN9A 3AVPA 5HK9A 1QV7A 3ZY2A 4KB5A 3QVMA 4DMFA 2WQZA 1L5YA 2GETA 3NATA 5EG5A 3HDYA 2AQHA 1ZVMA 2XQJA 1T1EA 2YXPX 4CG2A 1QDEA 4C3VA 4KQKA 4LZZA 3PIRA 5I9LA 3G2KA 1GY8A 3KOXA 3PQ3A 1NGSA 4DLSA 3FMGA 3T9AA 4MR8A 1DC7A 2HCTA 2XUAA 4TRJA 3R8CA 2J87A 4FYJA 3SBXA 1AXEA 2V97A 2X4IA 3DGFC 4NNOA 5I9TA 3W79A 2GUWA 3B2QA 1IB0A 1YO6A 3GFFA 3IVGA 3SYRA 1KOFA 3CPEA 4TSFA 2XVAA 2JB9A 1FP6A 2JLAA 3C0KA 4GR9A 3F6EX 2VJMB 3DHVA 4D81A 3W8NA 2IU0A 2PYIA 3DDUA 3QBTA 2V59A 4N3GA 1HZJA 3A9RA 1KMNA 3IJEB 1BMQA 1E2UA 1U98A 1DAIA 1XMVA 1SZDA 4PC1A 3KKNA 2VP6A 1P5RA 1T0PA 1P5ZB 2BFDB 1ZW1A 4UHFA 3WK9A 3HXQA 1E98A 5GONF 4RY8A 2WILA 2V7WA 3QIAA 1XI2A 5DP1A 3B52X 5B6IA 1IOVA 4I5IA 1SQSA 3IEPA 4YCDA 1LF5A 1TVEA 4BRSA 4F4FA 1FFSA 2P6NA 3RKUA 3J80A 1E2HA 2ZSHA 4DNFA 4RABA 4C04A 4F9FA 3V9PA 2JK0A 3ESXA 5E7JA 2B3DA 1UZMA 1R4MB 1JKJA 3GRVA 3L0CA 4OOEA 5JD3A 2WFZA 5E8JA 3F8TA 3WGIA 2XDAA 4WLEA 3VYWA 4MVXA 4LBYA 1S2MA 4RKFA 4I66A 3K9LA 2IU3A 4JI0B 1QBGA 3KKOA 4D6YA 4MMZB 4E51A 2NU6B 3GP3A 4OJTA 3OIWA 3GUCA 4TN5A 5ALXA 4F04A 4YCNA 5CG2A 2H4ZA 2QW1A 2DG2A 3E81A 1VYVA 4GKAA 3TQOA 1KQNA 4RD4A 4POOA 1V71A 5MN4A 2PMCA 2DP4E 4LWQA 5BWOA 2AI2A 4TXHA 4V0ME 3VR5D 2RH4A 4DADA 1HXHA 2GEDA 3JZAA 4MQFB 1SXQA 3M6FA 3SJ7A 4FBMA 1T4CA 2ZJ8A 2JD2A 2NTNA 4NWIA 5EPUA 4DWVA 4KODA 3WKBA 4M54A 2BGJA 5F1YA 1OFTA 3PGLA 4K9MA 4L02A 1QVRA 4PZPA 1QNFA 4PGAA 1EPUA 2NO7A 5A4MS 1PZMA 4PO8A 1VCIA 2J4DA 3OOEA 2WUDA 1WSBA 3CT4A 1SXJE 4V0OA 5CHEA 3SSNA 1XDBA 4NYMQ 4XIFA 5A9TA 1L1EA 3WB0A 1P39A 3EQ7A 1VBNA 1O9BA 2PZLA 2FMIA 3ZS9A 3PENA 3SICE 2WV7A 3DM5A 2PU7A 4FKBA 2C2GA 2E4VA 2EC5A 2FN7A 1IY9A 1K0UA 1XTBA 1KSJA 2Q0QA 3D2AA 4PQYA 1H2AS 4FNOA 3G2IA 3BIJA 3L46A 3VISA 2F3RA 5JD6A 1SBYA 1FUYB 1NN3A 3PRKE 1I01A 2C4MA 3RJ9A 4IJVA 1K8QA 2WIKA 5E8RA 1WUKS 3LL4A 2HZBA 5CFLA 3KCQA 3DOCA 3EFBA 4RBNA 3HUDA 1O97D 1MQAA 1OI2A 3OX2A 1GPLA 1MOZA 5J2UF 3HP1A 1TM3E 5ITWA 1R6DA 4UMEA 2ZRCA 4B4UA 5IT5A 3PHHA 1GUYA 4ZZ3A 3QEAZ 3H2ZA 1TJ5A 3FFAA 5IXSA 3C16C 2BUAA 3Q2OA 1NBAA 1U7TA 2GBPA 3ZNOA 4A82A 4EA6A 2GEUA 5JNWA 5L3ZA 2M6RA 2QJOA 5H0IA 2VO1A 1LGYA 3KWFA 1Y8RB 2O52A 1JYFA 3MGAA 3G17A 4TMXA 4BIIA 1F60A 2H31A 3I12A 4AJNA 1SOWA 1J33A 1W76A 5BSGA 5IXJA 3ONDA 1YR8A 1RBMA 3S27A 5G0TA 3ZCSA 2B34A 5CDTA 5G1OA 1NY6A 2EFYA 2VRNA 4LW8A 5M34A 3H9GA 1U9CA 1Z0FA 4U3JB 1IZ8A 1AHNA 3P9SA 4ZT5A 3N2NA 4ZVQA 1FJXA 3VTAA 3VYRB 1C7EA 1OAKA 1OT5A 1QG2A 2GPJA 1NQVA 1OFIA 2G70A 4EZEA 3OQ6A 4RFSB 3AM3A 3K8ZA 3DKVA 1TMYA 3LCCA 2HU8A 2YVQA 3O8QB 3T4XA 1LBHA 2UUOA 4BO3A 5CAEB 1QRTA 1R10A 2IU4A 4FXPA 1X13A 5CM2Z 4BASA 3BJMA 5E3IA 3DBIA 1WXQA 4PX3A 2BH9A 1ZHOA 1ORRA 2VYFA 4R2JA 2W2LD 1SQFA 2J9XB 1OPRA 1E2JA 1M1NB 3H8JA 3I2GA 1KP3A 2JI6A 4NXNB 2O8FA 3CWCA 4J4HA 1TGYA 1DPFA 2FKAA 3ICVA 1CVIA 2CHVA 4J0KA 4QEKA 5F5XA 4OFBA 3ZNNA 2LW7A 2VSNA 2EZ4A 4XW2A 4EKDA 4ZQEA 1YUMA 1TPZA 3RAFC 1SCQA 1ZYUA 2EAUA 5AVVA 5L6MB 4DNXA 2ZS9A 3JD3A 3MK31 4E12A 2NO4A 1CP2A 1E4EA 1P2FA 3L1JA 3UJ3X 1JHMA 4EF6A 1MX1A 4F5DA 4B9EA 3FOFC 2OKCA 3WGMA 4YT4A 5B64A 1LPOA 1NVFA 2OV6A 3WYBA 9ABPA 1G38A 2GHQA 1ZGBA 5I8PA 3R75A 3SEFA 3UMSA 1QHIA 2EKBA 1YBFA 1F2DA 3UJPA 1EFLA 2WI8A 1K27A 1ACJA 2JNWA 2BFCB 2WWGA 3WTCA 1RXVA 1TZJA 4GXRA 5FHQA 1RLJA 5EE9A 3TAUA 2HH9A 2FPGA 1P6UA 3KK0A 4FD2A 5EGSA 2ACKA 4CL2A 1NJ1A 4DR3B 4IF6A 1V45E 1HEUA 3D2BA 3UO8B 4CUZA 3PQDA 4HEA1 1UAAA 2A8YA 5FWYA 3K1AA 1Q0QA 3NTLA 4K26A 1NW5A 1S2GA 3IDOA 1D3AA 5CNJA 4BLOA 2A5FA 5BVGB 1CYEA 1D4FA 1NONA 4I4NA 4J2TA 5BSVA 2F43B 5TMBA 2ATEA 2PUGA 2XXAB 1T1RA 1NUAA 5KTTA 3GWGA 1JXQA 4CR8A 4DZTA 3OURA 3HL0A 2VQ6A 5C5DA 4RL6A 5JQGF 3A27A 3CNHA 1J20A 4AZTA 4L07A 1RD4A 4MAMA 4N12A 2XCUA 5A9RA 1EKXA 5FPKA 2VF7A 3NO4A 1IEVA 1BMFD 2H57A 3O73A 4TXMA 3JPYA 4JFAA 3ROZA 1Z63A 2RHCA 3VXKA 4N8DA 3HRHA 3V1TC 3T5GA 1KPIA 3GZ4A 4PS0A 3TSZA 4AX4A 4IWXA 1OH5A 1ORHA 4G86A 2O1WA 1CR6A 5TJHA 2PLAA 4IEEA 1A4XA 2NT3A 3PXGA 4ZYTA 2BM8A 5I8WA 3MBIA 3C48A 4BFYA 1BWRA 1CQXA 4EVIA 4FEAA 4AMUA 3ABOB 1KK0A 2FE4A 3JQCA 2PLFA 3GFGA 4M86A 1DAFA 2YJGA 4ZCLA 3O8LA 1P4JA 1K5DA 1BKDR 1R9JA 6ABPA 3ITNA 2H4HA 2AC7A 1B93A 4HDMB 4OHRA 1QZTA 4D4JA 3JAWA 1WHTB 3W06A 1GGKA 4R0MA 3PHBE 1NG1A 3NBQA 1AV7A 3ADPA 3I9MA 1FSZA 2PGIA 4JB0A 1T2CA 4MV4A 5C0OE 3R7NA 3KEFA 4DOMA 4D9HA 2WTUA 1BGXT 2Q6LA 4OP1A 1PJQA 4S1OA 3GLFA 1OH8A 4HXGA 3VU0A 4MQ4A 4QBGB 2PX5A 3NBZC 2AOWA 3AFOA 1KA9H 4WZ6A 4XLTA 4O1MA 1ZNQO 1EK6A 1Z2DA 2UYGA 3SEQA 4F92B 2JBWA 3T7RA 2IEAA 2UV8A 4XPIA 5JADA 3TRFA 2I6FA 3T1NA 3RUDA 4IH4A 5K8IA 4WN9B 4UBKA 3KQOA 1M6VB 1LNSA 3AX6A 4TT8A 4JVNA 3KHUA 2CNDA 3J7TA 1ZLXA 2ZAGA 4BMYA 3V8EA 1DPGA 4C05A 4QEZA 1EZZA 4NCKA 1XYYA 2HNBA 2XSZA 4JITA 4QREA 1GN9A 4ABTA 5CA0B 1NV8A 4EHAA 3HXLA 1QONA 1CNEA 2RK4A 1V37A 2JGMA 2ZSJA 3AB8A 4KE9A 1J2RA 1AKUA 3F5DA 4R41A 3UAWA 1X86B 3P9QA 4X91A 4ACAA 3CVXA 2ECOA 2NXEA 1GARA 4TQUS 4E70A 621PA 1SXGA 2GPWA 1HT2E 4HDOB 4J0FA 1DC8A 1DMSA 4Q7EA 1KY5A 1M6NA 3ZJ4A 3KKPA 3AERB 1IWBB 3NDIA 4GVXA 2JHGA 2XMZA 1AQJA 3HBLA 4I2NA 2XA1A 3KELA 1S3GA 4G8CA 4LSGA 1OFUX 5IVKA 3NOXA 2CB0A 3LWZA 5FFNA 1L5KA 2DKNA 1ABEA 1N6KA 2AW5A 2REQA 1PQPA 1ZJ6A 1J7KA 2RGDA 2NYUA 1IG0A 4INJA 2AF3C 3K5WA 2XWJI 1XL1A 2OZLB 1GUZA 4X7MA 4MULA 3TKAA 5JFOA 2GUGA 3RO7A 2EARA 5JR3A 3BULA 1QVAA 3D6JA 3EF0A 3SAJA 1OYOA 3ZI0A 1ML3A 5KX5F 4AWXA 5H8WA 5D8DA 1QPGA 2ETXA 3B8EA 4CM4B 1QTIA 2WOOA 1CHNA 2EFEB 3KYJB 4UQPA 3EZ2A 4TV9F 4MWZA 5BUSA 3D6FA 1UK7A 5CFQA 4DW8A 4EYOA 3EPPA 1IXZA 3BRCA 2OCLA 4XDYA 4FB5A 1QFYA 2XEDA 4CG1A 3DMDA 3N74A 4FDAA 2P90A 4QWWA 4ARSA 4R1LA 4ARVA 2V6BA 4AQYB 5EAIA 3ETLA 2FRDC 4JJZA 4HY3A 4LXIA 4HYQA 3CNBA 2INGX 3DLTA 2JFWA 4M1KA 5GJWC 2P9HA 1FNNA 5HFJA 3WMFA 3ZHVA 1D7OA 4NABA 3TOZA 1K2WA 5K7SA 1ADJA 2O9JA 4Q9IA 3O83A 4KAFA 1GA1A 1RI4A 3V2IA 3CZMA 2QG9A 2X19A 4L1KA 4GU5A 4WCFA 4GGOA 2MHCA 3L8CA 4IIUA 1EQUA 1Y0BA 3O4FA 3MOSA 4ZI7A 1Y3FE 1CERA 1XZQA 2QOEA 3LUHA 3OCXA 1N92A 3OQPA 3CUSA 1QE0A 3CF4A 4GS5A 4M21A 5BNWA 4G1CA 3L1UA 4D8YA 3HXMA 1RJGA 4XQCA 3GZNA 2P30A 2SICE 2Z5VA 3VKFA 1UT5A 4R3NA 4BN0A 3TWOA 1FFAA 2VDRB 2G5PA 2ZAOA 1X42A 3CJQA 3AB7A 3DEFA 4HWOA 2NXCA 4R9NA 4HX9A 4E32A 4IMRA 3ZVLA 1B00A 3I39X 3T0GA 1CRLA 1DJNA 2HWKA 2VNJA 1AKNA 3FNIA 5AKJA 5TEWA 1YUNA 1C1HA 4BATA 1H1LB 2W8BA 4NFLA 1CLEA 3HA3A 3L84A 5B2ZA 1UBMS 1YIDA 2NXJA 3OFND 2FFHA 5AJUA 2VF8A 4EPXA 4W4TA 5JLAA 4HBGA 2A14A 1Q7TA 2G28A 4R2WA 3BXGA 3GAMA 4XIYA 2I55A 4FILA 3U3KA 4ZT6A 4AYTA 4EH1A 2XVXA 4KMMA 5TMEA 2C2WA 2X6TA 3DULA 4ZVTA 1GZSA 4GWKA 5CTJA 5DI3A 3M1YA 4X1YA 1LLUA 2JASA 4P7BA 3GP8A 1V2HE 3EUFA 3UPTA 3DW3X 1YD7A 4KRGA 4B6QA 2RC6A 3CEAA 1SHTX 5BVHA 1DWPA 5AK4A 2LP4Y 3B1WA 1W6RA 1K88A 2QI9C 1UJMA 1ZUHA 1TLFA 1TKAA 7AT1A 2XKKA 2AFHA 1M6YA 5JBQA 1KZ6A 1JWBB 4PE5B 2GA8A 5U4XA 4P53A 5BORA 4NMXB 1QF9A 1N4DA 1OLXA 3UYKA 1FTGA 5AR1A 1IULA 2OBFA 3L7KA 1J9ZA 2UAGA 4JJAA 3WVNA 3DE1X 1EX7A 1TM4E 4QASA 4HNTA 3H2JA 2EVWX 5LSAA 4KBGA 1U3WA 2HWWA 3C24A 1E99A 1TXGA 3HHPA 1BXZA 1F5SA 2WNIA 4H27A 1N5DA 1O6GA 1U3TA 4HK4A 2P4SA 4L4XA 4LQDA 3O91A 4Q4AB 4E5VA 3T38A 3B3GA 5FOUA 2X2OA 4G4SO 4NCIA 3DUWA 1CJSA 2GZHA 1JAYA 1U4OA 1JZTA 3W1EA 3VPGA 3LQKA 4YDHB 3V6LA 1XTZA 3HZHA 2W2OA 1KDVA 2OHGA 4N6GA 3RAPR 4G5YA 1JAIA 1VIMA 1GNVA 2ZAIA 3B6JA 4ES6A 4QBIA 3HKDB 3T5CA 2Y0EA 3A10A 4BS9A 1RU3A 4IZ6A 2G0NA 4FHGA 2QNBA 3OZTA 1G8MA 3TCXB 3MPUA 3UGJA 1WIWA 2ATIA 3NEPX 3RVKA 5LWHA 1BX3A 4IV0A 4O2LA 4B9AA 2X1MA 1CY1A 1UWCA 3ZCXA 4Q3EA 5KOYA 1KQFA 1PJTA 1M7GA 3IVXA 5CIQA 3SP1A 1YS7A 3RSCA 3UOAB 4QJ3A 3PWKA 1YZGA 3KYDA 4MLCA 3ICOA 5G40A 3R7SA 3A4LA 2YHIB 4H7IA 4M98A 2R6JA 3WHPA 5A4FS 3Q2KA 4X45A 2HMVA 4J3NA 2GBGA 4Z4FA 3P7MA 1DKRA 1SC4A 1XJQA 4EL0A 1XTUA 1XNJA 1UXJA 4WE3A 3K32A 3QBEA 1S4QA 1KTIA 4Q1FA 4TLLB 4EA9A 3ST7A 3A06A 4EW6A 3KOOA 3P52A 4IHJF 2CSXA 3AXSA 1E1CB 1NBHA 3F3SA 2FPOA 3T7EA 5IZ4A 2EFJA 1VPWA 1EFPB 1GTMA 4DPMA 1WMSA 4IDAA 4C6TB 4PQFA 3WKAA 1X1CA 2WG2A 3D4LA 4B3BA 4ABYA 1R8SA 2J0VA 1WTAA 2QR3A 1YHNA 3MTIA 1GYRA 1WDKA 3MJHA 5DEOA 5IDXA 2OGWA 4BKUA 4ND6A 3FGPA 4TLBA 1QAOA 1XQ9A 3K16A 1ZL2A 2J0UA 3O1LA 2HBQA 1QYVA 2PMKA 3VZSA 3ZDEA 5M04A 3NTVA 1I30A 3HFRA 1SQ6A 3MRVA 4HGRA 2C20A 3CHYA 5G1PA 3RU2A 4P82A 4JI6B 3IAM6 5D51S 4D9CA 1JR6A 1JFLA 3ZKWB 4FGSA 2ORIA 3PC4A 1TA9A 3OCZA 4FOSA 2NSHA 5AKLA 4B43A 1BVRA 1XJ0A 1ZK0A 4ZOEA 3HY3A 3NU1A 1R9GA 1XO1A 2FDRA 3USES 1Q95A 2E4XA 3G0GA 1F12A 4BJ6A 2ZR7A 2ZTHA 1MAWA 4CV0A 5LZ9A 2V0GA 5BN5B 3BDIA 2D2EA 3H6KA 4LY9A 1W581 1H2RS 2XMCA 1RRMA 2FSFA 3QVGB 5DMHA 4BP8A 1UBNA 4O5OA 1U28C 3RYFB 1PQUA 3FFBA 2UYHA 1I4WA 3COJA 1CD5A 4QU5A 3IT3A 1DC4A 1B43A 3LHFA 3OOYA 1OIVA 4OB7A 2NQ2C 1PWHA 3TIGA 1EUQA 3EB9A 5HJ7A 3WLAA 5B58T 3R7LA 1ODSA 1Z6XA 1FTQA 1ZCZA 4MJXA 3LXMA 1I32A 3KC2A 2OOSA 3ZBTA 3KYIB 4EB0A 5IT4A 3PE4A 2WHQA 2Y2UA 4G36A 3E15A 3ZGOA 2VXYA 3CY6A 2P2YA 3LUPA 4MW9A 1TJNA 3NBFA 4ZCQA 5B6PA 2QYTA 3GD5A 3U31A 2VTDA 1KETA 3OLCX 1U8YA 2DTEA 4WKGA 3MUNA 3Q8MA 1E58A 1XAGA 4AK9A 4DLYA 1LV7A 4FB4A 4XE5A 4E2FA 5C18A 5CH3A 2Z04A 1CUZA 1OFUA 5ALOA 3OT4A 1Z29A 4OQQA 5LQSA 1KZ9A 2J32A 2H1RA 3FRJA 1Z15A 3CISA 3QVKA 2PT9A 4WCVA 1L5GB 1X3LA 1P9LA 1FF9A 1X2EA 3KPWA 3W9UA 2GLXA 4ZC1A 4DT1B 3LI2A 1ADGA 3IR7A 4IJQA 1WKVA 3ER6A 1NRJB 3FYHA 3TUZC 3I62A 1GZDA 4Z86A 1T25A 2DR3A 3Q7EA 1GQYA 2JAUA 3NNSA 1U11A 3BKXA 3H1BA 5FQOA 3NCTA 2OV1A 4EG8A 3E2MA 3R6GA 4XA8A 2XY4A 2W4QA 5BYJA 5IASA 3WGOA 1USIA 2VAMA 2ZWOA 4CDRA 2NUTA 1Y6RA 4OQDA 2BI8A 1Y1SA 2CHFA 2VJAA 3CRW1 3IKLA 1D8AA 2H1VA 2DBYA 3W4IA 3UFXB 1UZUA 3U13A 1Q2UA 2DY1A 3L06A 4MI9A 1QDUA 1JILA 1WABA 2D1QA 2Y66A 3IA7A 3LFHA 2IYOA 2VNAA 4YXWA 3HEAA 4I9FA 4LBZA 4OQZA 1TK9A 1XWWA 1DEHA 1Z07A 2W98A 3F4KA 1XTQA 3HI6A 4RZUA 2G9VA 5DTIA 5E9QA 5L3SB 2IEGA 3GA5A 3OETA 2BIFA 2BZGA 2H52A 2H8GA 2QSJA 3MTAA 5B1EA 2Q5IA 1B8PA 1X7ZB 5FEMA 3VA7A 5CT9A 3OM9A 5JSQA 3CYFA 5KHAA 3U4DA 1ZRNA 4C4OA 1H2XA 2H7CA 2D74A 3LIPA 4I9NA 4WDRA 1EB8A 2WFAA 3KKLA 1I4TD 1NPTO 4JP8A 5KPDA 2P9GA 1FP4B 2CNWA 3SF0A 2BAGA 1X1QA 4LUCA 4DCNA 4R2MA 5GIPE 1PUJA 3NHKA 1J0BA 4CETA 1NVKA 1YQDA 2K87A 1YI1A 4EW2A 4FCWA 3AJRA 2PIDA 4Q3BA 2WFMA 5DKFA 2OLJA 4LV8B 5ESDA 4C2UA 4EFLA 2I4NA 4RTPA 1SWVA 2H1OA 4TOIA 4D3YA 5CVCA 5J5VA 1E62A 5HQTA 2Z3ZA 1P1RA 2J6HA 2IV2X 4DHEA 1H3FA 4DA4A 3N2EA 1LRJA 2A9VA 3U7QB 3WAGA 3W3AD 2PKWA 4PNPA 1H23A 2ZI7A 2AXNA 4QHYA 1HWYA 3UMBA 5CPBA 3QYPA 1D2CA 1XZPA 1QX4A 3HXTA 4QT0A 5HR5A 2NUPA 3JATA 3OSUA 2CVHA 3ZLVA 3LV8A 4QPDA 1VIVA 4DG5A 3GEBA 1XLUA 4AMZA 3OQMA 1TUGA 4M1ZA 4PWYA 1SCKA 1SBCA 5K3OA 2CT8A 4WEQA 4HD8A 3C3JA 3A05A 5ELXA 4ZO9A 2ZE8A 1QAQA 1KJ8A 3COWA 4HF7A 1U8TA 3KNZA 1HSZA 3VX3A 1T2VA 2WU3A 3E9CA 4MLDA 1A8UA 1YR1A 4O2BB 2YC4C 1GRNA 4BB5A 4FKMA 4F21A 5I4IA 4DV1B 5LYJF 1YS4A 4TVOA 1VSQA 3UQYS 3JALA 3AH8A 3PG5A 1DUVG 3GG9A 4UTOA 4K6CA 1TK3A 5ANRB 2B6HA 3G3EA 3S2GA 3T4UA 2F7SA 3JZFA 3RHSA 5I4BA 2Y8EA 1L4YA 4CLRB 1PJLA 4NFSA 3FUCA 3CKKA 3H5OA 2WAXA 3N6XA 3UOWA 1N7HA 1T34A 5BPFA 4Y9RA 5CLQA 2DE0X 2PVSA 1UM8A 1Z3IX 2XF2A 2QROA 4GXQA 4KO8A 2HR1A 4KPYA 4I50A 2YL2A 4WFKA 2C2MA 3R6DA 5F9HA 2QAGB 1NW8A 4MKRA 5FUMA 1XXHA 1XZ8A 1SVWA 1U0LA 3KQLA 1H8ED 2FZ4A 1B74A 3M3HA 1C1YA 4JGIA 5IUNC 1NYRA 2W6ID 4NECA 3NDPA 1R4NB 2JI8A 2QR5A 1ITZA 2VRBA 3B7WA 2P91A 3WLSA 3AXTA 2R47A 3D7LA 4FEGA 2QZJA 2N9UA 4QARA 3P4XA 5J4YA 1V5WA 4MKZA 1ADFA 5IN5A 4QPJC 1E66A 1ZK2A 2JGLA 1MB3A 1U2ZA 1U8CB 3EGDA 5GAJA 4C5AA 3F3YA 2R7LA 4WY8A 4OK6A 4Y9SA 4C0AC 3ZYZA 2LWIA 5HYVA 2WWHA 2JC3A 3B3AA 3O8NA 5BOSB 1I1OA 1CY6A 3DOFA 4CM1A 1FBTA 3D7KA 4QFDA 4R83A 4W9NC 1PWEA 2NN3C 4JGGA 4Q82A 2QORA 3W6UA 4D41A 4OHYA 3T4EA 3H9BA 4F1WA 2ZGVA 1NNSA 3DPIA 4DDUA 1MA3A 3A9UA 2RHWA 4X41A 5EIHA 5L3QB 1X80B 3ENWA 5JD5A 2G8LA 5JSUA 5KVVA 3W7BA 1YCHA 1V1MB 3D0RA 3EQZA 4D43A 5JJCA 3ZJTA 4TV8A 4G84A 1M5RA 4BBPA 3EISA 5A0TA 1FS4A 3H19A 1GGMA 4FC6A 1SB9A 3QXXA 3GLQA 3SFTA 1XK6A 2I1VB 1QYRA 3UMYA 3ZIUA 3ZHZA 3Q8KA 2CUNA 3ZXUB 3FPSA 3HH8A 3NFRA 5AJZA 1XMIA 3SYTA 1QU2A 3CH4B 1R6TA 3EVCA 3K6KA 1NJ8A 4HAUA 1KDPA 2FOLA 2LPMA 1FEZA 2FRDA 1U0SY 4ER5A 1O97C 3R5KA 5EQTA 4CTNA 1E8DA 4ZZ1A 3WYNA 3AJAA 4WK4B 2O5EA 1UXHA 3RSQA 1TCCA 1RBZA 2XOKA 2V74B 5SY9A 2DBZA 4LXQA 1CS0B 2IELA 3DHEA 4MYTA 3N0WA 5CGZA 1RLUA 2XNHA 2ADMA 3B3JA 3RVDA 5I45A 2VP5A 4J3JA 4MDEA 2I3DA 4KI7A 5GJCA 4QEDA 5B4UA 2RBEA 3I3OA 3EGCA 1ZVVA 2Z4SA 3HBJA 3H4MA 3VNSA 4D4MA 5JD4A 3FR8A 3IUEA 4ZC8A 3N2GB 4GH5A 2X0FA 4B6GA 1MFZA 3IBTA 3FPFA 4YDQA 4N4AA 4OU5A 1UOOA 2Y99A 2OPBA 1FYXA 3R7FA 3KXIA 4F84A 5EZYA 3H5TA 1A9XA 2XNSA 4R9UC 1GU1A 1KI1A 3IPYA 3N70A 5DJ5A 4UULA 3OZEA 1QUFA 4GZ6A 4PONA 4XVCA 1A50B 1QU3A 4A2PA 2XEXA 3P45A 2CYAA 2Y4OA 1V3UA 3AJ8A 2NV6A 4XUCA 3O4JA 4TUYF 5G0UA 3DL0A 1PJAA 4GYWA 3DP7A 3E5RA 5A2QA 4WKBA 4TROA 2CLKB 1XFDA 1G8GA 3UJAA 3VAAA 3AEQB 5KPJA 1CJMA 3BL8A 3QU5A 4D2IA 1B42A 4BX9A 4F45A 2VYND 1Z35A 2R68A 3PB3A 5H7XA 1J8QA 2GOYA 4NHOA 1KOGA 1E5XA 1NXTA 1YR9A 1ULAA 3IOEA 1CJBA 2D62A 4U9UA 4O3FA 1OAAA 4G4IA 3A6GA 5FD8A 1BS9A 2UZ1B 1Y4UA 1U7OA 2AN3A 3BOSA 3NP7A 2NACA 2D7CA 4CHTA 2VAXA 3QLEA 1NE7A 2BCGY 3RR2A 4TWIA 2QF7A 5KKAA 4W5OA 5ITZA 3GLGA 1ND6A 3JRNA 2NU9B 5MN5A 4KWIA 2WYVA 1QYCA 3R7WB 4CI0B 1ZD3A 4MDYA 1OT3A 4PY2A 5NULA 4O59O 3WGUA 4DMKA 4RLFA 5U9CA 2X5JO 3WLOA 2G40A 4CDGA 2M1ZA 4F8JA 3SVLA 3PBKA 4KWHA 2YY7A 4FC7A 1V3VA 1ZH6A 3CRNA 5BSFA 3X44A 1C7ZA 1DC3A 5B1DA 3T7CA 2I1QA 3RKRA 2QT9A 1E9CA 1ZISA 4FHFA 3Q0IA 4DDHA 2RH8A 3QU7A 3ZLJA 1Y89A 4ESOA 2PWAA 4BEJA 4MKFA 3QG1A 2GN4A 3A0UA 2BLNA 3D3WB 1Z6PA 5EUCA 2BLLA 3HVUA 4DLAA 2B2CA 3LK6A 4R7TA 4LWPA 4D3ZA 5I9SA 1CPYA 2PXXA 3EZLA 4QELA 4QXPA 3SZLA 1ODJA 1PS0A 4JKYA 3I09A 3PUVA 3B1KA 5FOSA 2BGTA 1E2PA 4M8KA 3FF4A 3ER9A 2H11A 1JMYA 4ARCA 1DNPA 1OZGA 1WCV1 2Q6VA 4LDJA 4ERNA 4BGDA 2JFZA 1GGVA 2OO5C 3LA6A 3AP2A 4PYRA 4RXMA 4EYKA 1J24A 3HN6A 4PLZA 3E2IA 5JYCA 1RHUA 4FHDA 1KZ1A 2BGIA 2C8LA 1HQYE 3A6JA 4LNAA 1SHZA 2TMKA 3FWHA 4OXRA 5BT8A 1LPSA 4B48A 3SDSA 3A8TA 5CNIA 3ZCRA 5LQUA 4DL9A 5HUJA 1YBAA 2FZEA 2ZJ2A 4IWNA 5LYYA 1KFEB 1CX9B 5DZSA 1DO0A 3MCUA 3Q7RA 4CE6A 4J0EA 1XZHA 1CJVC 2IYEA 3FYUB 4JCCA 1L4EA 5CVEA 5U4QA 4JBNA 2WHPB 3BB3A 4YJGB 1QQ5A 1WRBA 3HYLA 4MKIA 1WHSB 1WG8A 3WB9A 5ETJA 2FU5C 2IWRA 4AJHA 3JWJA 2XYRA 3R9XA 3MJFA 3PJRA 3Q5EA 4QODA 3EDOA 3UAGA 3ABQB 4E5UA 4JD5A 1R0ZA 4WERA 3U37A 4H3KB 1Q17A 4Z0HO 3RS0A 4B5LA 5ECWA 3LCRA 5DF1A 2W48A 2W4IA 3RH0A 5EP1A 3ZHXA 1Q5PA 4MRMB 3RREA 1U90A 5K03A 3HABA 2I7DA 4FMDB 3OF2A 1EK5A 4MUEA 4ZRNA 5FNVB 1G7CA 3FKQA 5CFOA 2GJ4A 3RSLA 3WZMA 2VDNB 2H7VA 3E5HA 5G41A 2XUOA 4Z53A 2JLVA 3L2OB 5AI6A 1Y6JA 4RQAA 4V3BA 3IB3A 4XYEA 3L4BC 5EKXA 2H6EA 1P9RA 4OUKX 2VJOA 5DASA 4BZQA 1KR2A 2BFFB 4EGCB 3I5MA 5AW0A 1JYSA 3IAS1 1U28A 2V5AA 2VDVE 4PLGA 3QFRA 5AKIA 2QXUA 4D45A 4IVNA 1XNRB 5F12A 3OX3A 5FF9A 5K51A 4XQ0A 3WDLA 1IH8A 4OSOA 2IHVA 3HB4X 2JLRA 4ZVOA 1XF1A 4BV9A 1XAIA 1W94A 1JVNA 2CVOA 3F67A 1C1DB 1M2KA 1W0KA 2GHTA 1YS1X 2JIRA 3DEYX 3UG6A 4OHUA 1FZQA 1G55A 3ANMA 4BL5A 4K3UA 3AY7A 1LSJA 3AR9A 4RZQA 3W5HA 2YZMA 3MUFA 4GD3Q 4JL8A 4Q02A 2G25A 4N3NA 2XUJA 1RRFA 3DE4X 5CLIA 2I99A 4J7AA 5TQ0B 5HZKA 3EOBI 5KOHA 3OWXA 5LFAA 4YCCA 1VKRA 2PSDA 2XDQB 4RF5A 5EC8A 3WSVA 1N5JA 4J0CA 1NE2A 4CBVA 1IONA 2NIPA 5BR4A 3BCHA 4TSRA 2D5BA 4PZZA 5C2JB 3QVJA 2A9FA 1L5VA 3DGEC 1E7YA 1K3UB 4L78A 2QTWB 3DNMA 1DB3A 2GO1A 2OXFA 3DL7A 1HT3A 3NH9A 2QN3A 3HGMA 4IM7A 1EFCA 2NZVG 4A2WA 1OHHA 5BXYA 4PNEA 3F7OA 5EKUA 3UAOA 1PCXA 4BWFB 2G08A 4BMCA 1L1FA 4DAOA 4RSHA 4Y3UA 3NYRA 3ASYA 3LBNA 1OR8A 2HY7A 2JGKA 4X44A 4XVUA 5M29A 3IESA 4A23A 2Q5FA 1M72A 4KFRA 4NAHA 3HM2A 2W2PA 2XE7A 3PXUA 2QSUA 4K9QA 4UATA 4YK7A 4HLQB 1URPA 3PWTA 4DB4A 2OXEA 3MS4A 4JYMA 2AR0A 4JWTA 4AICA 2FW7A 1PQ4A 3C43A 4YLEA 1M1UA 3NIFB 3PFBA 3ZXSA 1US8A 4M4SA 1O58A 1E7MA 1V47A 2YCBA 4FR5A 2QN1A 3B53X 4GP7A 4P6VF 5CLLA 3PVSA 4PHFA 2C98A 4LGMA 3W8FA 1RYFA 5JHHB 4KMOA 1XRMA 4GL2A 4JX9A 4Z9AA 3VNRA 3REFA 3A6KA 4K1XA 3K15A 5KNCD 3IA2A 4H3HB 1PEAA 1OIWA 5DSTA 4M1QA 2XCSB 5LU9A 1U7PA 1NLZA 2G4CA 3RYTC 1NSTA 3O9MA 3N3AC 3H9EO 5AQEA 3I3SR 3SFZA 4GX1A 1LW6E 1SXHA 4LDAA 4ZO6A 2YH2A 4H7EA 1HDRA 3GHHA 3KYCB 3RU3A 1E2IA 1XG5A 2XF8A 1YRLA 3DC7A 3MOGA 4HAVA 3ZR4B 1UCFA 1N9KA 1RYEA 3LXUX 4FW9A 3VNBA 4BQFA 1S9DA 2VF5X 4YMHA 4TXNA 3P2IA 1UOQA 5JWOA 3ECSA 5TC4A 2QRHA 3VVBA 3AF3A 3H3XA 1JR2A 3ZZTA 3U7RA 3E03A 4E08A 3AM1A 2E21A 1PS8A 3H5IA 2VCEA 3SJZA 3E9RA 4E22A 2YVLA 1PFYA 1VGVA 1YS9A 3C41J 1Z82A 2GTPA 4IH1A 2B94A 4Q9JA 4ZAYA 2VF2A 3RBAA 4C6HA 1T8YA 1DV2A 2O05A 3TR6A 5AK3A 1U63A 2CLHB 1YZ3A 5DWVA 5HTOA 1BE8A 2K6GA 5HZHA 1RSZA 4LRUA 1XMSA 1SC1A 2IW3A 4DMMA 3OJWA 3AETA 3DEHA 2Y1CA 4P7KA 1RRPA 5T4EA 3F97A 4M7OA 2ZTMA 4HGNA 1F2UB 1VYHA 4IJUA 3ZLUA 1MAVA 2HCJB 1KY2A 3GX1A 3UA4A 2VA8A 1QCYA 4MUJA 4LJAA 4D4IA 4BU1A 3FBTA 3K3PA 4M22A 4LJ5A 4UEOA 2O2GA 2Z2XA 4MS3B 4ZCIA 4IJKA 2VJLA 4NG5A 2EX1A 3QQ5A 2R25B 3A37A 1VLQA 1W1WA 2IGBA 5DLYA 5HDBB 4E13A 5K99A 1ZSYA 2Q4DA 2ZRPA 3IAEA 4LF6B 2YMMA 5IDVA 4WK2B 1CJTC 1X8KA 4FEYA 5KAMA 1XPOA 2CNBA 3K72B 4IHJA 2CXSA 3PSAA 4QBKA 5JG7A 4NU6A 3ND7A 1NU6A 1SOMA 3SM9A 2V6JA 4AWAA 1K6XA 2WT9A 3UW1A 2HA3A 5BWBA 2ZUTA 2P0AA 1NATA 2OFFA 4E6PA 1Z2PX 3QYJA 1CE8B 3KLBA 4HH4A 4MQFA 5IZCC 4EAQA 2PCJA 2RAFA 2PWYA 2NXWA 2PQ0A 5EJ2A 2YBEA 2OM2A 1SU6A 1SBZA 3EUAA 3W7VA 4XIIA 2Q4EA 4ZOQI 1R3DA 3N07A 2CUZA 4JOCA 4KDRA 4P3YA 3RIYA 3F6BX 4JLMA 1AURA 2W6JA 2PK3A 3MB8A 4Y2HA 5THXA 3SXJA 2OV3A 1KC3A 3FZEA 2BGGA 3WO0A 1L1RA 1QZ3A 2PX6A 4ER7A 5DDIP 1XD9A 3EQ9A 1C29B 4KW7A 4YJHB 5H5JA 1BH2A 3STWA 4Z7OB 2C4TA 1L8XA 4FE4A 5AVYA 4Z51A 4KYUA 4YR7A 2UUAB 3IIEA 1VLLA 1YB2A 4LHSA 2I4LA 4NZZA 4RIFA 4UCWA 4XI9A 3F7NA 1PNVA 5KTPA 4QNMA 4I55F 2E1RA 1BFKA 2Q2VA 1LS1A 3IMGA 2P0YA 3L8ZA 3QFCA 1VG0B 1XRPA 3KL2A 4Y2YA 1N77A 2GILA 3K8OE 4M2LA 1KP2A 1BWSA 2IXAA 3FFWA 3P96A 3LD9A 5F35A 3WI7A 4W9NA 2FQXA 1PT5A 4LSWA 4Y1RB 4EEKA 1EX6A 5CBKA 1YUBA 5LNK6 3PF9A 1HR0B 1QPZA 1PRYA 2DPLA 4Z4HA 3GK3A 4R9RA 1GQOA 4Y0AA 4P22A 4YROA 4EQZA 3IRVA 4YWJA 5K3FA 2CZCA 4FIZA 3OMWA 3ROTA 1IXKA 2SECE 2PGNA 1RACA 4DV6B 2C4KA 1T4DA 4Z1MD 4EDFA 1WUYA 1Y8RA 5AVTA 4PHTA 2OZKA 3N8HA 3F3KA 1U2RA 4Q0MA 4Z9YA 4R5HA 3QE4A 2AOTA 1YJ8A 2JFOA 3C4QA 3OE7D 3P9XA 3OIUA 3QF4B 3K09C 2XMPA 4I5EA 2XH8A 4E46A 1XDUA 3AYXB 1D6SA 2VRCD 3W90A 3KFXA 1OCEA 2WF6A 3CF6R 3DVQX 2UYCA 1HO3A 1G98A 3IP8A 4FSDA 4YCLA 3I0MA 3A6DA 4QBHA 1F8FA 3LYHA 2BYTA 3TGPA 4JQZA 4O5AA 2IV3A 4JH0A 1G3RA 3AO0B 2WMNB 5IFLA 1JTEA 2H3HA 1YR7A 3G85A 4RVFA 4U8GA 2DFKB 1AF4A 1Z2AA 1GV1A 1E0AA 4N76A 4Q9LA 3RYHB 3Q40A 4AP5A 5JUWA 2XRZA 3V32A 4LCJA 1TLLA 1NMEA 2AUMA 1GPKA 4S2EA 3LS2A 5I51A 5EIWA 4XUGB 3NWJA 4OSPA 5A7GA 4GMFA 4N01A 4R8VA 2J3DA 1M1NA 5EEHA 2B0CA 1NMSA 2BL4A 3EW7A 4OQXA 1F8YA 2Q0SA 3RWOA 5B4TA 5JXIA 2MYUA 4DLNA 5EZQA 5ESWA 4KXYA 3JSXA 1TM7E 3GRYA 4UUNA 2REBA 1RLOA 1VI6A 3A36A 4KK3A 4EJ6A 3ROPA 1NAIA 2WMYA 4P08A 4BTLA 4A6EA 3EAQA 2DKOA 1HFKA 4XQGA 5DGIA 3THSA 4OA8A 3DQPA 4RD6A 4IGEA 3Q0EA 1ISIA 1DP4A 2Z3VA 3H9UA 2AG1A 2XKJE 5A1JA 2CCKA 3EIWA 3NOQA 4MYHA 4M88A 1ZJZA 3L04A 1SCIA 4ZJYA 3H4TA 4C29A 1G41A 2OZEA 1S96A 2PGLA 5K2OA 1WZ2A 2YR0A 2W2LA 5LZ7A 1UBOS 3I2FA 5LXTB 1CZLA 1MJGA 1SD2A 1ONOA 2FFQA 1NLUA 1DDGA 1T13A 3OF5A 3THYA 4KR7A 2IDJA 3TMAA 3O1HB 3QLVC 2JRLA 3Q0TA 4DPKA 5BVGA 3OP4A 2F43A 2XXAA 1H66A 4H9GA 4N9QA 1CV2A 1QC5B 4Z8XA 5I7VA 4RULA 3B5JA 1MDBA 1R4AA 3LQ2A 4H3VA 1YULA 5E9JA 4GECA 4YCBA 5F7JA 8ATCA 1MOQA 2H0AA 3P94A 1YMUA 3H42B 1BX1A 3TAXA 4DXHA 1MG0A 1D1TA 2PM8A 1P2VA 3QWHA 5K3CA 1ZXXA 2N42A 2R8ZA 2I54A 4KQ6A 1D2MA 1FFGA 4QLOA 3AOGA 2EDAA 4RU1A 2GA9A 1GRCA 3WLQA 1JIVA 3OJ0A 2EX0A 4MTLA 4PF1A 4DMLA 5L7WA 1EUDA 4GYJA 4L16A 1O9GA 3MBKA 4QQNA 3VZDA 1I3OA 1K3TA 4AXXA 4AX8A 2P3OA 4JJFA 4C7VA 4BLUA 1R0KA 2HXSA 5B37A 3LUAA 2AHRA 2F9FA 3LOPA 2DLDA 4RXTA 2CJFA 4W5RA 2ID8A 4GSKA 3M6XA 4MYDA 3OESA 1FLVA 2Q3HA 3C3EA 4HDMA 4AP6A 3DTVA 4E5DA 5KEIA 1ZD9A 4YASA 4BLRA 3TLZA 4URFA 2GM4A 2FW1A 4WXRA 4ALIA 2FG6C 1MBZA 3WDKA 5JZSA 3VHXB 2PAFA 3VR0A 6Q21A 2WZDA 4F72A 5A3RA 1I2DA 1QLJA 4DCMA 4JBLA 3DW1X 5KBYA 1DAOA 5TXGA 5K3EA 1R2QA 4LRYA 2OO5A 1GDHA 2H0RA 4BLWA 3VRHA 4IXTA 5C8XA 3ADBA 1NM5A 5C4MA 2ZJFA 1DFGA 1L7QA 3NDRA 5LOVF 3BZWA 3RLIA 1SBHA 4GSYA 1TLTA 4MUIA 3CEJA 1IQPA 4J7CA 3WHLA 3AFHA 5G4KB 2WKRA 4WN9A 3AU9A 2WSSD 1P6QA 3F1LA 3ILVA 4FFVA 4ON9A 3ZX5A 1SURA 1DINA 1V11B 3FPHA 5E1DA 4DAEA 5BV2P 2Y1GA 4Z7JA 2GPBA 4GUAA 3WZ2A 1X7GA 5A3QA 2BM1A 2HJGA 2GTHA 2O1XA 2ZI3A 3RARA 1WXIA 3C5HA 3ZDCA 3TLYA 3DVAA 4RHFA 1JQAA 2VP2A 2FCAA 1RZVA 4G2NA 3QJGA 4NPAA 4FMCB 5B7QA 1BIFA 3H04A 3CMCO 2NUAB 4MQLA 5FIUA 3KRTA 4D8UA 1JF8A 5AJWA 5ARBA 2R8OA 1P2UA 4Q7LA 3ZIDA 3DONA 4GOXA 5JMOA 2DUUA 2C7OA 1J25A 3HI4A 1JDBB 2XW6A 3FVVA 4ZP1A 3ZDBA 4CF6A 2IPXA 3AERA 2ACEA 3OG9A 4IDPA 1TC1A 4B6JA 8GPBA 3QVWA 3MMPA 4DBVO 1Z0SA 4G4JA 2LDBA 1J8YF 1RE1A 4G5FA 3RRFA 2PKEA 4CV1A 4R1NA 4U7FA 3EWIA 3EAGA 5IYZF 4AUMA 3QEBZ 3D6VA 3V2GA 5LZ4A 3ZHYA 2FF7A 3W4KA 2HD4A 3L4BA 5EMLA 2ZRDA 3REOA 3O2SB 2OBLA 3CB4A 1RADA 1Y8CA 2AZ4A 2BMWA 2C96A 2YV2A 3VR1A 3CX7A 4IAOA 1MVLA 3B82A 2QRQA 5FV4A 4HPXB 4JLNA 2HADA 5D3QA 1SUEA 4V03A 1WE2A 4Q05A 3T7KA 3W2HA 4A0HA 4GX0A 2XE4A 2PXHA 3DXZA 1J97A 1XEFA 2V7XA 3CNQS 1UPFA 2Y1WA 3AR8A 5TMDA 3ZQ6A 5J23A 2WWRA 1FUIA 2ZYUX 121PA 3HN2A 5HQ3A 1JSXA 2FY8A 3CEPB 3E0QA 1S3SA 3E0XA 1JS1X 3RT1A 2DFVA 4K87A 1PR4A 2HPVA 3I9V1 3R5SA 1Z45A 2B82A 4TMZA 5ICFA 4KGDA 3KCNA 5IJAA 4BO8A 4YFVA 1J23A 4D6XA 4MUAA 4G9GA 2ISCA 4HTFB 2BM0A 4YMLA 4J7XA 1H0KA 5DHRA 2HEIA 1W5FA 1PYOA 1Z06A 4G26A 5HF5A 3MCVA 3AL2A 4I5DA 3OMLA 3N0RA 1UBLS 2BP7B 4B0OA 1Y6GA 3MJTA 2F1KA 3NHRA 1Z38A 2P9QA 4MS1B 1U7ZA 4N7JA 3H2SA 1VPLA 5FP0A 3M33A 1T1SA 2W0SA 3OKFA 1IBCA 1TM1E 4DA9A 2R0QC 3NGXA 1M5UA 5T4HA 1UFQA 3RV3A 4EUKA 1KIFA 2EX4A 3T0FA 1A9PA 3JQAD 3LLUA 4EHKA 3QX9A 2PSFA 4ALNA 5E1MA 5J47A 1LBQA 3OIVA 1VHJA 1TW2A 5MN6A 3QOWA 3PFIA 4BMSA 2VTBA 4X3CA 1DQNA 3P5BA 1RPTA 1Z34A 1AGPA 5JMTA 4MVCA 1C0LA 1DX9A 1NP7A 4REQB 5KQSA 3VSCA 1AM4D 1K68A 4HEA6 4P58A 2IEYA 4RSMA 3A70A 2I33A 4ZA2A 4IKEA 2XKAA 2B36A 1JQBA 4JN6B 1EM6A 2X6QA 2D00A 2O3RA 2UKDA 4MWOA 2PZFA 1TCBA 3BWXA 4XGRA 5T8KC 1H1TA 4L2IB 2PEZA 5CEFA 2J9FA 3PXAA 3R3WA 2XT6A 4BDTA 5DN6D 4Z3DA 8LDHA 3T5AA 3AF6A 1WV1A 1L9XA 1JPNA 4JLOA 5FUBA 4TTAA 1WXXA 1UANA 3C6QA 5BSMA 1L4MA 4P7GA 4C01A 2ZITA 2YJZA 4NCJA 5AI9A 4RJTA 3IP3A 4OAPA 4K88A 4ZOBA 3EHDA 4IFBA 2DR2A 4IUCS 4QDUA 4I3HA 3O8BA 1P4AA 3CB2A 3KE9A 3T3EA 5KKNB 5JFGA 1ISGA 1QHNA 4UNIA 4G07A 3N2IA 4NXMB 3BVPA 1WULS 3FPEA 3PA6A 5HE8A 2VQEB 3RRXA 1S0UA 4M7PA 1EWRA 1J07A 4OMDA 4LFAB 2HCBA 4XWYA 1SPXA 1C9EA 1W6UA 4BJHB 4Z0NA 5IM5A 5KAPA 1OD6A 2W8ZA 1T6ZA 4Q24A 2V7QA 4LMRA 4Q4AA 1XGKA 3R7DA 3OWHA 3PC2A 3F3MA 1EXWA 5EMMA 1K5GA 3LLVA 5HJEA 5HSGA 4R0NA 5F21A 4CKCB 3GUHA 1Z2EA 3N1UA 1WD5A 2G5CA 4CKEA 3K0KA 1KO8A 1E3IA 3SPXA 4EY5A 4BN5A 1V35A 3KAQA 1TD1A 4OATA 7REQA 3PX7A 2OO3A 1OLUB 3BRWD 4KH1A 4TYQA 4BLTA 4YRKA 4Y1FA 3D8TA 1IDOA 1LSSA 2XWSA 3HKDA 3WQQA 2LDXA 1WKBA 4ZXPA 3O2NA 3MGKA 2EGUA 4GZMA 4R31A 1DLJA 2P65A 2YKGA 1DHRA 2OUIA 3BE8A 3GBPA 5T41A 1OREA 2HSDA 2QJRA 2R00C 3GUZA 3SJBA 2ORVA 5K01A 1OB5A 2C4VA 2PUAA 1C7IA 4EYGA 2QMEA 1X9GA 2QL9A 4IOJA 5FADA 4JR0A 4N65A 1KMIY 2ZIWB 4V2UA 4XZ3A 4AG5A 5I7EA 1V3TA 1ECPA 4JIMA 5LQMA 3L1KA 4QLAA 4NKRA 3KDSE 1CFZA 3KB1A 4JXZA 1UH5A 2YHIA 3VUEA 2AN5A 5CJJA 4YAOA 4OM8A 2PZMA 2V7BA 2IYYA 1IN5A 3GLHE 3MWDA 3S6JA 5C8DA 4MIKA 1FW6A 4JVOA 1DIHA 3CW2A 4BQIA 2F8SA 4PIPA 3UKJA 1NVBA 3JYQA 4FFRA 1YRHA 2ZJYA 3T3MB 1IHOA 3RVOA 5IZCA 3BM5A 3CH5A 3N86A 3DOIA 1ZEMA 4TN1A 1KE1A 1E6EA 3AJDA 3NKVA 2VAPA 3ZGVA 2QENA 4GLOA 4UUOA 2H5JA 3W5JA 4WSOA 1AHPA 1EFPA 4AF7A 1R64A 4TLEA 3PCRB 1XZCA 3F74A 4G0NA 2I7XA 1K9SA 4C6TA 3LZDA 2AN4A 5HF9A 3UB3A 1V2GA 2AXEA 1N8NA 2QMQA 3ZU3A 3SVTA 4ZVSA 4NAUA 1YL6A 3GZTB 2FWAA 3GBSA 2PWBA 5KU1A 1QG6A 2PMWB 4AULA 1GPJA 5GINE 2PLNA 1UKEA 2AGVA 2B8WA 4LY0A 3ADCA 3D4BA 1A7UA 2OSBA 3DE6X 3LYUA 1V5IA 1G21E 1Y98A 3P8ZA 4RF3A 4KU4A 5JJ5A 2J7PD 3WWDA 2Z09A 3FCEA 3V5NA 4QUGA 4C6SA 4EKGA 1DHTA 1GT6A 3LW8A 4H1HA 1Z4LA 3MA0A 1XFAA 3K6JA 1REQB 3KR2A 4L27A 1OASA 3D3QA 3TSAA 5IABA 1DQZA 4H4CA 1WB4A 3JVIA 3HSKA 4V0RA 1XDWA 4DQ0A 1PHPA 2O8CA 4BUJA 3DZCA 4A8JC 2VNSA 1M2GA 1OLSB 4CODB 3LLMA 4CR7A 5BN5A 5H4GA 3P0FA 4UNSA 3C5VA 2QN8A 4EK9A 3QVGA 1UP7A 3GNTA 3TL2A 4XX1A 3U26A 4AO8A 2J3JA 2FWBA 4DSZA 5MDHA 1FP2A 1KJJA 2CW5A 4A8HA 4D9KA 5KOIA 2R1TB 3OTHA 1U5AA 1JPVA 1YASA 3L7MA 3D0KA 1XDGA 4YAEA 3KKQA 2V3CC 1FNSA 3I32A 4UXHA 3G7NA 3LF2A 2QXTA 4UVHA 4W5JA 4FVTA 1M66A 3JASB 4P83A 4DUYB 1PV4A 3BFXA 2G76A 3UXYA 4Q9DA 4JYCA 4UEJA 3V7WA 4ZPJA 5JVDA 2HK7A 1CRQA 3QUAA 3LW7A 1BS2A 1FDIA 1DL5A 3CIOA 4HNGA 1P0FA 3JXEA 5TARA 3UGTA 4COKA 2RJNA 1D0IA 2VT3A 2ORYA 1I4OA 3HVIA 4JLAA 3NKFA 5K0EA 5KSPA 3U7GA 3LLSA 1RLTA 1XA4A 2TS1A 3LP6A 1NBOA 2IH4A 1RIIA 4QULA 1HDZA 3GH3A 4MUYA 4ZYYA 2CSUA 3C6XA 4PHGA 2XOXA 2AZXA 4J0JA 3AUYA 4CEJB 2YXLA 2GEKA 1AKMA 1PK9A 4IFTA 4EKEA 4LYAA 1IPFA 2GAJA 1E1NA 4LI3X 3VTZA 2K2WA 3G2OA 3E9DA 3V1MA 1RM0A 5GOZA 3FGNA 4P4SB 1K7FB 1NVUQ 2OAGA 4BZPA 1FU4A 1GSHA 2OCIA 4NY1A 3W5AA 1LK5A 5IHPA 1C3XA 3LRXA 2XX3A 4KJZA 3THRA 3WJ2A 4ESHA 4TTQA 2FV8A 4U8HA 4FNAA 1QB8A 4NOKA 4J8PA 2B4KA 1ZI9A 2QE6A 2NO1A 2F3UA 3C3AA 4Z2AA 3ITDA 2XYQA 2Z8YA 4N0EA 1UQUA 4PG5A 2MWMA 3UFXA 3RC8A 1KDOA 4UZSA 5KTNA 3FDXA 4ZPXA 3JW8A 2DH5A 1L4LA 1KJIA 1OOEA 2VHJA 5I01A 1FSPA 1XD2B 5L3SA 3HDHA 3T1OA 3HTXA 1MPXA 3OQHA 2W58A 4RIEA 5F2EA 4HDRB 2BFBB 2WP8J 2PRYA 1Q1EA 1PD1A 1GZ5A 1XTSA 1RBQA 1JHDA 1ZKDA 4M8SA 4C0SA 1QYXA 1G291 4B3DA 1C3EA 1VLJA 4FT2A 4CIBA 2Q29A 1QHYA 4M1OA 4H6VA 4BYMA 1QO0A 2G1JA 3CJTA 4IP0A 3QLVA 4AJKA 1PFQA 2ZTSA 4OLJA 4EG6A 2NO9A 5EHXA 4JJGA 3KOWA 1DG3A 1VOTA 2B92A 3NIDB 3CWZA 2XCLA 3ZOZA 4FZ5A 1H5QA 4DC9A 1WU7A 3H1PA 3I2HA 1HH4A 3AUXA 1D2AA 5JI3E 3C1OA 4E2WA 1DE0A 4LF8B 2HDHA 3M6VA 4W1PA 1N4AA 4BFXA 1MVNA 4DFDA 2MR5A 1CDZA 1PIWA 1H1DA 4BB6A 1OBHA 3IHLA 5BSKA 4MCJA 5A3SA 1X1BA 4PC2A 2J3QA 3C1AA 4YYZA 1JP7A 1YZQA 4LMBA 3U7QA 4ZJUA 3U19A 3TIFA 5K0TA 2O2CA 1PBTA 3NYWA 3GPDG 4ZVVA 1MO6A 5KVQA 7YASA 5ALHA 3R9WA 3V33A 5TB5A 3TFQA 1YS6A 4W1RA 3CTMA 3RFFA 4EFNA 4YUZA 3HMQA 5I9BA 1FUUA 2JFHA 1R4ZA 4RDCA 5IAJA 2YXNA 1ESNA 2CXHA 4TX1A 5HM6A 2CLMB 3TF5A 2DR0A 3QFFA 1GEGA 4BKRA 2EKLA 3TVTA 5IT0A 1GSIA 5IK2A 1G7SA 1CJCA 2IF0A 1BJRE 3I1FA 3OX4A 4F3TA 4BGUA 3U3MA 4ZOLF 1VCHA 3SMQA 3VR3D 5CT4A 2RIRA 3EK2A 3KZXA 5HNKA 2R48A 5THQA 1TM5E 5U1PA 1QFZA 2BKEA 3MB5A 3NNDA 3SEZA 2Z2KA 3SG0A 2I80A 3AHEA 4RO0A 1I3CA 2AG8A 1Y3AA 3LCMA 4LVCA 2ZXFA 4M36A 521PA 3MEQA 4F6RA 2PLRA 3AHFA 2BI4A 3ZUGA 1ST2A 2A88A 2P6MA 1NI5A 3KEOA 5D7NA 3UMGA 4IG9A 3GMIA 4JEMA 4NCAA 2X0KA 3MQ4A 4M89A 4QPCA 2NQ8A 1R0SA 4Y6OA 4E5PA 1ZKMA 1OSNA 1P1JA 3W77A 4UE2A 2HLDD 1P4GA 4P5DA 2UZ4A 4ARBA 4GR4A 2DFLA 5SYAA 3S2UA 4LXHA 1GSOA 1PYDA 1SUFA 3ASZA 3W5UA 4GDFA 4I8DA 4V1CB 3I01M 3LM8A 2IODA 4CQMD 4L3VA 3IE0A 4W8GA 4LOIA 4G01B 3HR4A 5DNAA 1FUEA 1Q0HA 4Q19A 4AIRA 2GARA 2OXRA 3U81A 3ELWA 4UM9B 5HRUA 2BFWA 1N33B 4RGYA 1EDOA 5HCNA 1EUCA 1OW3B 3TRIA 2OCDA 2Z2ZA 4XDZA 4YNBA 2GSDA 4WXPA 3VDQA 4JA2A 4R01A 1U6KA 2P5YA 1X1AA 1J0CA 5BSHA 1BZYA 3QVVA 3V4ZA 1ANKA 5CVUA 1R4NA 1UKVY 2NO5A 3ZY5A 821PA 1ZUD1 1M34E 1R0LA 4TKMA 2X5NA 3A6EA 5LIRA 3QNUA 4BC0A 4DM3A 2R86A 4CL3A 1CFJA 1Z6YA 2HK9A 3ITKA 4R1OA 4JYZA 1U9JA 4MW7A 1KO5A 2PQ2A 3EEOA 4UEKA 4LQ4A 2X77A 2X13A 2X76A 5BOSA 3IXQA 1EXNA 2KSQA 5DHFA 3V8NA 4F97A 2QVXX 2DUJA 2E49A 1NAHA 2QVBA 2B5VA 5HGJA 4MINA 4EPTA 4OQFA 3WIEA 3ZK9A 1Y8QB 1PGNA 2H29A 1DTWA 4CQMB 2B4QA 3LY5A 2DECA 4JQCA 1P2BA 5A0VA 2FQWA 1K7SN 3C2QA 5L3QA 1GA6A 5ULLA 2IHUA 1A5ZA 1QV9A 2VDOB 2RHLA 3WBKA 1I2AA 1YL5A 4N8SA 1FNBA 1TAQA 4V0KA 1FYDA 4MNTA 1IWPB 3FCXA 2D2IA 2FPMA 4LYEA 4FK8A 5BWLA 2P2ZA 3VPXA 4WOPA 3UZUA 2WJIA 4ZAGA 5TY0A 3ZI7A 2O7SA 4OHCA 3ORHA 4HNVA 4DHWA 4YBZA 4ENSA 3OM0A 2NVBA 1FQKA 4RWEA 3ZHCA 1YDEA 3B6ZA 1N2CB 3KYBA 4JUDX 4KDFA 4UARA 4GPBA 3WP0A 1A72A 3FUVA 4YT2A 2AFIE 3AJ9A 3FI9A 3IUBA 1O08A 2LUOA 1WP4A 4IUYA 1ESMA 5AM3A 3NAQA 2DVMA 3LQYA 3VJKA 5AVRA 4ZYUA 1K8RA 4NBRA 1XMOB 1K08A 2C07A 2RCNA 1U0EA 1VL8A 2VYQA 1LKZA 3LDFA 4IGIA 1P44A 4EZBA 1HETA 3CRRA 1I6KA 2FXVA 1MUUA 3D1VA 5C32A 5IH7A 3CVYA 3RRZA 3L6UA 3K7EA 4MA5A 1V7PC 2OO7A 4FLEA 4KDEA 1CS0A 3VQTA 2FR1A 3K1JA 5CIYA 3VH4A 4O4LF 5C1OA 3U4QB 1O5TA 1UJ2A 3GWZA 1JVBA 1N75A 4YRCA 1DBSA 1ULSA 2H18A 2QT0A 2R6AA 2WPNA 2WJHA 1II0A 3GVXA 4O4HB 3V4VB 1QVVA 1FP7A 2WIFA 4RCVA 1C8VB 3L8HA 3ZE0B 1BQ3A 2QPLA 3TXXA 3GGOA 4LC1A 2Z8XA 4RD1A 3IOBA 3UT0A 3K2EA 3EMDA 4EGAA 1F06A 3VFDA 5J2TF 4BFLA 5I4CA 3BE6A 2RCYA 2FP3A 4Z9XA 4ZTUB 4UHHA 4JC5A 1SXPA 3RLFA 4YRLA 1JHQA 2QMUA 3IIJA 4F8YA 4W5TA 4UD6A 3IT2A 1BEUB 1NJSA 4NX2A 3H9JA 4IIYA 4JR2A 2CMGA 4BGIA 1L9KA 3WLHA 4WK6A 3SXUB 1XQVA 2PL3A 2YZNA 2NAPA 1KH1A 3E70C 5JSYA 1KU0A 1Q21A 1U1GA 1UC4B 1JNXX 3RQSA 5AW5A 4D8TA 3LZ6A 2X23A 2BISA 3TCKA 3SF8B 2EZ8A 2HF2A 3ND9A 4KIWA 5JS6A 2ZRFA 1GU7A 1QYWA 1HFEL 1G20E 1OPXA 3PNLA 5T8KA 4KR6A 2FK8A 1JAXA 5ABPA 2QUBA 2B98A 2QLNA 2NNWB 5CDYA 1N2OA 1Y1KE 3CX6A 4JBYA 4PCUA 3BCSA 1QYIA 1WS6A 2DQYA 2X4LA 2X8AA 4RSRA 4Z4EA 2UZ1A 5AHOA 3GLIE 1GTRA 4DUZB 5A9SB 2DWOA 1WA5A 4DLRA