4BVBA

Crystal structure of human sirt3 in complex with the inhibitor ex-527 and adp-ribose
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
273
structure length
273
Chain Sequence
b'KLSLQDVAELIRARACQRVVVMVGAGISTPSGIPDFRSPGSGLYSNLQQYDLPYPEAIFELPFFFHNPKPFFTLAKELYPGNYKPNVTHYFLRLLHDKGLLLRLYTQNIDGLERVSGIPASKLVEAHGTFASATCTVCQRPFPGEDIRADVMADRVPRCPVCTGVVKPDIVFFGEPLPQRFLLHVVDFPMADLLLILGTSLEVEPFASLTEAVRSSVPRLLINRDLVGPLAWHPRSRDVAQLGDVVHGVESLVELLGWTEEMRDLVQRETGKL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NAD-DEPENDENT PROTEIN DEACETYLASE SIRTUIN-3, MITOCHONDRIAL
publication title Ex-527 Inhibits Sirtuins by Exploiting Their Unique Nad+-Dependent Deacetylation Mechanism
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 93
structure length 273
sequence length 273
ec nomenclature ec 3.5.1.-:
pdb deposition date 2013-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02146 SIR2 Sir2 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1600.10 Alpha Beta 2-Layer Sandwich SIR2/SIRT2 'Small Domain' SIR2/SIRT2 'Small Domain' 4bvbA02
3.40.50.1220 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold TPP-binding domain 4bvbA01
5EJAA 1S5PA 2PANA 4UTVA 1PNQA 2JI8A 2H2FA 1S7GA 2FWNA 2VK4A 3IAEA 4BV3A 4GM4A 1PTJC 1U28C 2Q5OA 1V5FA 5AHKA 4JD5A 2VK1A 4I5IA 3FZNA 2H4JA 1N0HA 1DJLA 1Q14A 1QPBA 4JUDX 2QQGA 4FEGA 4BVGA 4UTNA 1Y9DA 1BFDA 4J16C 4UUBA 2V3WA 2JI6A 3OE1A 3D7KA 4MQ5A 1YNOA 2A1UA 2WVAA 4X3OA 3U31A 3EA4A 4D5GA 2OO5C 1T9AA 2Q28A 4FZ3A 4UU7A 2H59A 4K9LA 2EZUA 4RJIA 2OD9A 2IHUA 1ICIA 3ZG6A 5EJ5A 1OZGA 2H2GA 1JSCA 4GP9A 3GLSA 1U2DC 2JI7A 2VBGA 1T9CA 2H2HA 5MF6A 4BVHA 1UPCA 3RIYA 1M2HA 2HJHA 4GPEA 2A1TR 4ZP1A 4BVFA 2FRDC 1HZZC 1EFPA 4Q9DA 4L2IA 3LQ1A 2VBFA 2NYRA 4Y6QA 4GM1A 1M2GA 2EZ9A 4C78A 1NM5C 4UTXA 4D5EA 5EJ8A 3F6EX 3EY9A 2Q5LA 3RIGA 4JSRA 4Y6LA 1MCZA 4RMJA 1UPBA 1PVDA 3FSJX 4K9MA 4TWIA 2VK8A 1M2KA 2B4YA 2Q5JA 2IHVA 4RMIA 1PYDA 2IHTA 3PKIA 4C7BA 4R8MA 5DGTA 4UTRA 1UPAA 1Q17A 4BN4A 5EJMA 2FR8C 2JLAA 5IMSA 2W93A 2X7JA 1T9DA 4KGDA 1V5GA 1T9BA 3HWX1 3GLUA 3IAFA 4JUBA 4GM0A 3K35A 1E3TA 3GLRA 3PKJA 4V1CI 5BWNA 5DEIA 4Y6OA 5MFPA 2JIBA 2OORC 5MFZA 1YI1A 5EJ6A 3GLTA 4IAOA 1D4OA 4K9PA 4HDAA 1O96B 1EFVA 3PDHA 2H4HA 2EZTA 4FVTA 5MGNA 1YC2A 3JR3A 1Q1AA 4JUCA 2VJYA 2H4FA 3EYAA 5BWOA 4BVBA 4FEEA 5K6RA 1OZFA 2C31A 1YHYA 2JLCA 4UU8A 2UZ1B 1POWA 4O8ZA 1YHZA 3U3DA 2PGOA 4V1CA 1V5EA 3E9YA 4F4UA 4KXQA 2EZ8A 4BV2A 2JI9A 3CLTD 4MZXA 2Q27A 4IF6A 4JU9A 1POXA 4V1CB 4RMGA 4COKA 1Z8NA 5FEMA 3CF4G 4K9OA 2DJIA 4L3OA 2H2DA 4BVEA 5FYQA 3F6BX 4JUAA 4TWJA 2BRUC 4K9NA 2AG0A 1YI0A 1Q6ZA 2H2IA 1SZDA 2WVHA 2NXWA 4X3PA 1PNOA 4IG9A 2OD7A 4JUFA 4MPJA 4MPRA 1MA3A 4BN5A 5BWLA 4BUZA 1XLTC 1M2JA 1SZCA 1J8FA 1YC5A 1OZHA 3JWPA 1PI3A 2AG1A 1U2GC 2PGNA 3D4BA 4GG1A 4J1TC 2Q29A 3ZGOA 2OD2A 5K3SA 4K9KA 4F56A 3HWWA 1PT9A 2VBIA 3CLUD 1YBHA 4MPPA 1ZPDA 4KPUA 2UZ1A 3ZGVA 4UTZA 3CLSD 1M2NA 5EJ9A 4HD8A 4JT8A 5EJ4A 4UUAA 2WVGA 2FSVC 1OVMA 4K9QA 5K6TA 4G1CA 3CLRD 5EJ7A 3FLMA 1U31A 5DGDA 4RMHA 4RJJA 2FN3A 4QQ8A 5K2OA 4JU8A 4JT9A 4QPZA 1PO7A 2QQFA 3D81A 5D7NA 4ZZIA 4RJKA 1YTLA 2Q5QA 4QELA 2EZ4A 1O97D
chains in the Genus database with same CATH superfamily
4IJWA 4Z0TA 3U7IA 4QRIA 2X1HA 4BECA 2XVYA 4OM7A 2DWUA 1O77A 1K7EB 1N9GB 3BTVA 4MQ6A 1BVUA 3GJSA 1EXNA 3TZEA 3W8EA 1SHTX 5KS2A 4O4HA 1IL0A 1O03A 1G59A 2IWHA 4NL4H 4DXAA 5I8PA 3VVLA 1EKXA 2ERXA 3WDLA 2VUTA 5BNTA 1S7GA 1DUVG 3FX2A 1YVEI 4INJA 4CKWA 1L5OA 2PX0A 4A92A 5IWCA 2Y1EA 3G2IA 3JQBC 2ZTVA 4NCNA 2IYAA 5FD8A 2R85A 3STHA 4ER7A 2BFDB 3ZH2A 2F43A 4AJLA 1VCOA 1G3MA 4XDGA 3WSVA 5JSZB 1T1IA 2V8OA 2GF2A 3QE4A 3LUJA 1UDAA 4C9BA 1Z07A 3CWQA 4NWIA 5D1NA 1L7OA 2PGDA 4RDCA 4QQKA 1P7ZA 2V6MA 3H9QA 4EGAA 3V4RA 4ZYYA 2Z6UA 1QPBA 3OLXA 3WB1A 5JW6A 5FFMA 2ECOA 1USWA 3WO1A 4O4JA 1L7EA 2JFYA 2OL4A 4OMCA 4JVNA 1BX3A 1N3BA 3S2FA 1TK2A 5LB2A 1XRNA 3KKQA 4D9JA 2H29A 2ZZKA 4Q37A 4D57A 1R0WA 1UWVA 2CVFA 4DF3A 3FVWA 3GT3A 2MYPA 2O3RA 2HSEA 1MC4A 4YRKA 5C1OA 3R3HA 1E6UA 1QFXA 2GD0A 4U02A 1VA5A 1W85A 2RHBA 3DS8A 3ZZMA 3DZBA 2E6KA 1MPTA 2RBEA 2ZJ1A 5IAKA 3U4DA 1M5TA 2ZIAA 2PQ0A 5JADA 1RI4A 1XZQA 3ONEA 3U31A 4P4UA 3QVOA 1RXYA 3RANA 4AS1A 1TQ4A 4LZJA 2IYYA 5H82A 4F38A 3JAKA 3EA4A 5BT9A 3ZVNA 2WEKA 1N32B 4KB5A 4C04A 1XP5A 3KWMA 2CXTA 3HWSA 4HR7A 4UU7A 1CJUC 5F23A 1FUKA 4EF5A 1CR0A 1NJSA 1AKEA 2BIFA 1G1MA 3G8DA 4L07A 1AY0A 2C4KA 3OQIA 3NYIA 1GNPA 1ZCFA 3T4PA 3G9QA 3WGIA 3L8YA 3F3KA 2JZOA 3C7TA 1MHTA 2H7CA 1V41E 2BGUA 2GEFA 4IZ6A 2VWHA 4PNHA 5CXQA 3SHWA 5KNBA 3K1AA 4GD3Q 3ILVA 4DBZA 3CJQA 3DF7A 3FPFA 1QGUA 4NJEB 1JF8A 3E7WA 1COWA 3KE8A 3MINA 2A94A 4MGKR 3PC3A 2WUVA 1BYIA 5AKLA 4Z4EA 1T9HA 4G1BA 4D0GA 1NPDA 5HR5A 4YPVA 5ICSA 3I61A 1NVFA 1VKHA 4TV8F 1YB2A 1HDOA 3OA2A 3V8BA 2PZAA 3ABRB 3B3FA 3JALB 4DQVA 1XEXB 3QHQA 2QP3A 5AW6A 1KI4A 1YR3A 4X71A 4BVHA 2N1BA 4NQZA 2QTTA 1SPXA 3LQ4A 4UHDA 3VJMA 4MARA 3PICA 1HT1E 4H3HB 3KAKA 5AYVA 1QZXA 2B1RA 2CCKA 5CDGA 1TYCA 3L7NA 1PW7A 4F60A 2XWSA 2IF2A 2IDZA 2A1TR 2DWOA 3AG5A 3X1XA 3RBXA 2B8NA 3MWGA 2N3ZA 3KOZA 1H2BA 2FU5C 4F7WA 2XDQA 2D2FA 3AVPA 2HD4A 4KYVA 3B89A 2DH6A 4IFBA 4UFNA 4I9HA 2Y0PA 5HJ7A 3IV9A 2XUGA 1GU0A 1NJGA 3VKHA 3WMEA 4BX8A 4ZK6A 2DFLA 1GGMA 2Z2YA 1N0WA 3V33A 4HAUA 2Q8QA 3REQB 2JFQA 5JANA 3LAWA 2QTLA 4GT1A 3HA7A 4N3CA 4EMBA 5EP4A 1H85A 1H22A 3LBAA 1PS8A 9GPBA 2V0GA 1PL6A 1XKXA 2IOQA 4W5NA 2EEPA 3B3GA 4LXTA 4P54A 1NXQA 4G4SP 1XD9A 1PJQA 2F1KA 1KO5A 1FFEA 2XUAA 2I1QA 2SCUB 2QQ0A 1UEJA 3PP8A 5K1ZA 4YFYA 1D2AA 3OIUA 1GPMA 4B40A 5DNYB 5E3JA 1FFDA 2Q4BA 4RHUA 1QHHB 3QKUA 3RI3A 2OTCA 4J75A 5LU8A 3PFBA 3HVHA 5H81A 1L5QA 2ID8A 5JCJA 2BOVA 1UPBA 1P7PA 3WK8A 3N8DA 1BU8A 4GECA 4HDNA 2VPQA 2VK8A 3REGA 1XXHA 5FF9A 2GBIA 1JJBA 3A05A 2HKIA 1U7DA 2VJBA 3Q7QA 2XGJA 2GOYA 4GOXA 2FZEA 3GMIA 2GYWA 2O2EA 1TFUA 3K9NA 2VP2A 4KN8A 1UOQA 3VC3A 5LFAA 1GO2A 1DT5A 1QGAA 4N3BA 3KE9A 4X45A 4EJ2A 1ZICA 3IDAA 1PYDA 5LXTF 4X44A 4MYCA 2PBLA 4CCWA 1PWXA 2D2IA 5KSWB 4NXMB 4MVJA 2QTNA 4ND5A 1BE8A 3OM8A 5AKEA 3TXAA 2O48X 4ENWA 2GFIA 5ALVA 1GYPA 2FEKA 2H7XA 3DF9A 4KIFA 4NECA 3WL7A 1PK9A 3TUZC 3CLTC 3OTHA 2MT9A 1JEQA 1YF3A 3AIKA 1PR5A 2OZPA 3A32A 3AEQA 3GGCA 4QFCA 2DFTA 2BM8A 2Q5EA 4Z7OB 3JVVA 4TLCA 4D8UA 3LFHA 4MA4A 1IK4A 1FVOA 1H2YA 3IUMA 3KR2A 4GKBA 1E9VA 4D9KA 3HWX1 2P2LA 4JLDA 6ABPA 3K9CA 4H18A 3A4NA 3H83A 4RKWA 1TC2A 1ZM7A 2VDUE 4L5BA 1OLSA 2PS3A 1I3CA 3HUFA 4OHXA 3I2IA 5G2OA 4BMXA 3Q2OA 2X2PA 4FX2A 4ISBA 5JYDA 4E2XA 1N8NA 4PHHA 4UUOA 1JIJA 3BSWA 2V5AA 1KJIA 5MFPA 3ZGLA 3WGMA 2JS7A 2WIGA 2EFHB 3TCKA 3UMCA 1UMBA 4L73A 5AM2A 3MTBA 3PGVA 3WLMA 1F6BA 4HQLA 2VJKA 4PYQA 2QUJA 3U60B 5ELMA 4GZ3A 2W0SA 1NIPA 4P3PA 1DC8A 1RE0A 3HI6A 2QS9A 3F6PA 2C3PA 3U61B 3Q1LA 4Y2TA 5EWMA 3QKRA 4MAFA 4Q05A 1PS0A 2AE1A 5JPDA 1V3QE 3KQPA 2YXNA 4JC5A 4RZSA 3ZWAA 4RIGA 4DA0A 1P9WA 3BTSA 4DJFC 2DGDA 2HBZA 1CUHA 3JYHA 1OH7A 2GA9A 2XZDA 3IAS6 2YHIB 3JAWA 1YBFA 5ISMA 2IH5A 1G42A 1LD3A 4IJUA 1PWZA 2A3NA 2MDTA 3UFXA 5CT6A 2RAPA 2PLAA 1FRQA 4WZ6A 1M6VA 3FYTA 4D98A 2YICA 1NJ2A 3AFOA 1M7HA 1JQKA 1UANA 4GNKA 2IYRA 2XTNA 4F2GA 3AVOA 4BQOA 3DZCA 3EQ8A 2ZSEA 1E2HA 4PO8A 2NSHA 5IDYA 1FYEA 3RVPA 1T13A 5HZGA 1EUQA 2DHEA 1CU1A 2D7CA 2X6TA 2XV1A 3RW9A 3N8HA 2O0MA 1QZZA 2C2BA 3T9AA 1XZ8A 1P3Y1 1P5ZB 4FGKA 4HLCA 3E3MA 4MIEA 1I3MA 1VYVA 1YH3A 2XT0A 5T3UA 2IKQA 3ISTA 4JBNA 2QTMA 5DJ5A 3NVAA 3M6WA 5L4LA 3V1UA 2GS9A 4DSNA 4TMZA 5KX5F 3B2EA 4MIYA 4YDRA 4WZAE 4QO8A 1CTQA 5TQVA 2PKXA 1E5TA 2J31A 1LCIA 1UC5B 2R4TA 4TV9B 5FJJA 5AQEA 4MUJA 4FGLA 1ZCZA 4WV3A 5AW0A 2W7TA 4PCUA 3NTOA 3P45A 5GWXA 4C20A 3R5JA 4UCWA 3JQDA 2CDRA 3HLTA 5AP9A 3ZVMA 4JYAB 2R5NA 3WE7A 1HXHA 5KMGA 2JGDA 2QLFA 3CIOA 1Z83A 4OK5A 2BJHA 5F1PA 1T8UA 1Z88A 2JHFA 1W0JD 1I2ZA 3CONA 1Q0SA 2UV8A 3OX1A 4AKSA 3M6VA 1PJAA 1N2BA 1RPTA 5BMVB 1SHUX 3LBIA 3A6HA 4Y6PA 3VPAA 4C21A 1J1UA 1M5UA 3IP9A 3TL6A 3PR2B 4WZBE 2VTVA 2HA2A 2C3MA 3K9QO 5TGTA 1QBKC 4BNZA 3A27A 3A9UA 3MTEA 2OLKA 4IILA 5FBRB 1KYYA 3BA1A 2PKRA 2DUWA 2J7PD 4OJKA 5FPTA 5ITSA 1ILEA 3GROA 4GKAA 2R5WA 4HMQA 2BFBA 1JYEA 1RJWA 4ZYZA 3CNQS 3RUIA 3QLEA 1W0KA 5KYYB 2F9MA 2ODEA 5BV0A 2BSXA 2GBFA 3DEKA 1ZRNA 3O8BA 4RPJA 4ZIRB 3NHJA 3D4PA 5BQPA 3RU3A 4E5NA 3LDAA 4KYTA 1JPNA 4BV8A 2Q4TA 3HR8A 3QVVA 5IAJA 2XMRA 4S1TA 5GGYA 1ZWLA 2AN1A 3WK9A 1EFTA 1O6GA 1U7XA 1Q7BA 2JIDA 2QMOA 3ESAA 3CVYA 3WYEA 1E94E 1USKA 3OF5A 4ZARA 1SULA 3FCCA 3TSZA 4JLAA 1FXSA 1HFEL 4RH3A 1GGEA 5ARCA 3O8OA 1SCUB 3TDMA 2IYSA 2YUIA 2I9KA 1SR8A 2BL4A 3MGAA 1F3OA 3FUUA 3P9KA 4JL6A 3Q72A 4R2JA 2IV3A 1XDUA 2NQ2C 4YQZA 3C3XA 4OJQA 2Z1DA 2HA6A 5B7GA 5K8TA 3EVFA 1GUFA 2G82A 4PPYA 3QLUC 1M67A 3VR6A 3ZE2B 5JH7A 4JI4B 1XHLA 2E4YA 4FOPA 4KE7A 3P2JA 2ZVJA 1BW9B 5HS4A 1ZK3A 2GZMA 1WXXA 2FHPA 4JUFA 3EF3A 3U44A 4M9RA 4RELA 3SDSA 5ALNA 4MWBA 1MA3A 4B6QA 4ID3A 3GGJA 3R7AA 3R8FA 3KL2A 3QU9A 3GH3A 1YBAA 3JASB 3TMKA 4EH1A 5F3WB 1TKCA 3WLKX 5LYJF 1I6WA 1I3LA 1XZJA 3MB8A 5BVHA 4Q0MA 3VC7A 1RW4A 3VC1A 2K2QB 4HFRA 1YDWA 3CX7A 5EP3A 5JAQA 5JD4A 1SKAA 2A67A 1CUFA 2FG6C 3GCWA 2X41A 1LDYA 3SVLA 3RG2A 2O8EA 5TJHA 3EVGA 4CPDA 3Q9NA 5BN4B 2AFVA 1U2GA 4K2AA 4G25A 5A5VA 2Z4RA 4AAYA 3GGGA 4JI0B 3LUDA 3IDQA 5EE9A 1GITA 1B6RA 3BH6A 1QHXA 3JWPA 3AQ4A 5IAEA 5J3JA 5IC6A 3C1TA 5IANA 4N7JA 1CRZA 2YNMD 3I23A 3I1FA 3LWZA 4R3WA 5FOXA 1D4FA 4ND6A 1L4FA 1L5ZA 2AJDA 2E0IA 3I6QA 4WJZA 1CJSA 4MR7B 3VA7A 4LWOA 4EDFA 3AJAA 4OQPA 3QBJA 4Q66C 2ZWAA 5KYWA 5AJHA 3V8MA 2NPOA 3T5PA 2AG8A 3BDVA 1AF4A 5BV8A 5FNVB 4MYHA 3NKVA 1DGQA 2LBPA 1VP3A 3OG9A 4FFBB 5FQOA 3OX4A 2C4UA 2ZANA 3TAXA 4K8OA 4A6PA 2Q5HA 4ZMSA 2IS1A 1V1MA 4IIJA 2UZ1A 2ZB8A 4CQNA 4BCDA 1ECFA 1LNSA 3E5NA 3G2HA 3D6FA 4D3XA 5JMTA 1VYUA 3PYLA 1FUEA 3A6DA 2CXQA 1NZFA 2B1QA 2C97A 5AWFC 5H7XA 4EY3A 4FMBB 5UKDA 2JATA 1LC3A 1N1EA 4BO8A 2HRDA 4C7XA 3OCVA 4AG5A 4CL0A 2O8FA 4NAVA 4O2AF 1IY0A 3ZI7A 2PIDA 2O8VA 5EN4A 2JBAA 1LTKA 1Z4QA 2EP5A 5CB0A 1UC9A 3ADDA 1Q1GA 1IN7A 2OZLA 4M1EA 4RAOA 2WMOB 4BRWA 1MB9A 2JASA 4ENTA 3OJFA 1HQCA 2PE5A 1Y5IA 3NT2A 2I2XB 5COBA 2PT7A 1F7VA 1H6DA 5DM4A 2WWIA 2MIIA 2QRVB 2W71A 1ACLA 3H87A 2EFEB 3MM4A 5BP7A 1A7UA 5EPOA 4LCJA 3QF7A 4EYKA 1VE9A 2OAQ1 1ZK0A 1D6NA 3Q11A 5DVZA 2NUAA 3N2NA 1CR6A 1UQRA 1WXDA 4F92B 4P3OA 5IJ9B 1K8YB 2PKQO 3MC1A 3IR6A 4DJAA 3ITEA 3EZNA 2PUHA 5DGCA 3DM5A 3NTXA 4UQLA 1CZOA 2UVQA 1G7TA 3LRPA 4ZOLA 1TTQB 5HCUA 1VL6A 2A9QA 1Z0FA 1G4HA 1A98A 1P7YA 3CM0A 5BOSB 3DWFA 5E7IA 4FYMA 3DR5A 2HUPA 3A9VA 1Z37A 4LCEA 5K2OA 2W83A 2Y9PB 2QJTA 2QQEA 3WTCA 2M6RA 3WRXA 2GPYA 3QLTA 2PDAA 1HKHA 4MMXB 4WEQA 1V5WA 4PZPA 4U6SA 1WPQA 3CXRA 4PG5A 4PRZA 3FOEC 5IEJA 1J0AA 4G9BA 4QXQA 1XZFA 2I29A 5G53C 1OPRA 3ZXUB 4C4YA 3DHWC 4OYLA 4DMGA 3S8EA 4LJRA 4Z53A 3V9PA 5B12A 3EC1A 3WMFA 3ABQB 3IKMB 4BBJA 2WZCA 4M76B 4A2WA 2UZ4A 3M70A 4QLOA 3PVZA 2JIQA 5A7HA 2BEKA 5KHOC 2FDCA 2XR1A 1QU3A 3UUWA 5IVDA 1GA6A 5JPCA 1R0XA 3D3WB 2X1VA 1EK1A 3QZUA 3D6AA 4YHHB 1YK1A 1Y42X 2PSHA 4PRKA 4WNIA 3WLTA 3X2FA 4MI9A 3PGA1 1A8HA 4I2VA 1J90A 4ZVMA 3WGNA 3EY4A 1D3AA 3RJ9A 3B5JA 5J5VA 4B31A 3QU7A 1G8AA 3BA6A 4S35A 2H7VA 1V7QA 1Q0QA 2VH5R 3GARA 4L9RA 4QNMA 3E0QA 3T94A 4DM4A 4E94A 5KHLB 9MHTA 4LS3A 1S2DA 1KXJA 1SRRA 4HWKA 1D2MA 2WU3A 3B6ZA 1L7XA 4UM5A 4JI3B 2FB9A 4E4YA 3BHIA 5GOZA 3SD7A 1A9YA 4REQA 4BGUA 2BTEA 1X1RA 3OHMA 4G63A 2I2BA 5TVKA 4MRMB 3SZGA 2QNRA 2IF0A 3ZCSA 2VNAA 3VPBA 2HA0A 3PQ6A 5AI0A 4DSUA 1A5ZA 3IAS1 4KMOA 4OQLA 2HDOA 1GTJ1 5FL3A 3RK0A 5AK5A 1FP2A 1M2FA 3PHLA 4OXNA 1K63A 1XD8A 4UJ3A 3WBKA 1WY5A 1Z4MA 4OQXA 4G6ZA 2AFIE 4BLOA 1V71A 2J3DA 4GXRA 4NYJQ 4R31A 4YACA 1WQ1R 1FW6A 1IHYA 3DW3X 1KBOA 3WQBA 4MS4A 3TZ6A 3KV1A 3UAGA 5TS3A 1JJFA 4C4AA 1JGTA 2XVMA 2WJZB 3M4ZA 4IR7A 2V74B 4QATA 1A8QA 5E4FA 1NW7A 2H92A 3C3PA 5C8VA 1USVA 3B9RA 3RJZA 1ZMRA 4FFWA 3LXXA 5B37A 2AOXA 1Y3FE 4BLQA 4C2BA 1QYRA 3TVDA 1R50A 2GDZA 2W2KA 1EYZA 4JJ4A 2P27A 2W22A 4Q1VA 3MFYA 3UUEA 1A9ZA 3IOMA 3IVMA 3ZW9A 4WMLA 4DIFA 1Z4LA 1XOIA 4MINA 2FKAA 3DV0A 2B83A 2WWYA 2DR0A 1KY5A 1S9HA 4GVPA 2PMBA 3A10A 4LDPA 2YIMA 5IC5A 4YXWD 4QFBA 3NT5A 2P3LA 4YQFA 4MDEA 2HHJA 1VG1A 2YW2A 4DFDA 5CB4A 5JBIA 3ILYA 2VTDA 1MO4A 3A6JA 3INTA 2P2CA 1J2YA 2X6RA 1JR3D 3DMPA 3RBZA 1E1QA 3RF6A 1IAVA 2GKOA 3EZ7A 2YWEA 4ZCLA 3GRZA 4LY9A 1RAGA 3WFJA 2GK7A 3UWSA 1WXIA 4XWAA 1FDUA 3RUAA 1V1RA 4OQNA 5A4FS 3RYFB 2FRDA 3N8GA 3DXYA 1VCMA 2ZW9A 3OT4A 4QUGA 3VNRA 1UADA 2BFFA 2O2SA 2NUPA 3NGXA 4LNAA 2P1RA 4S1OA 5F7ZA 2X3FA 4Z0NA 1QFYA 4TM8A 2J4FA 3R8CA 2VA8A 5EIEA 3CFYA 3I52A 3DFFA 1EUCA 1DLIA 1XQXA 2VZ0A 2CFCA 3KYBA 3TXXA 3WSWA 3RKRA 2DZDA 3D02A 4JASB 2Q6KA 2JARA 1GVHA 3B1WA 4MS1B 2RHOA 1J1IA 3ASZA 1P60A 2CNDA 3LQ1A 4RYLA 4C01A 1FP7A 3TQOA 4EY8A 1KRHA 1IY8A 1PUXA 1WW8A 3DSRA 1CUBA 1L4BA 1TCBA 4HN9A 3U1TA 2V6JA 3FTFA 4MRAA 3K1YA 4JR1A 4IGKA 4C78A 2GSWA 1NFRA 3CVWA 5FLXA 2I3BA 2LCQA 4BVLA 4U7JA 1KVRA 5JAPA 4X1IA 1S1MA 4Q1EA 5JYCA 4FT4A 2B21A 1SMKA 1OFHA 2QMQA 1JFVA 2L18A 3BGDA 3HJTA 4IGIA 2X42A 4UD6A 1V3VA 2GKSA 5L9AA 3OZUA 4TYYA 3EMDA 2BONA 3DMTC 2R6GA 1HLGA 3DHEA 3C8ZA 1JIUA 2VDVE 1GDHA 2ZATA 3NHZA 4GGMX 3LPMA 2C1XA 2IUEA 4Q7KA 1QU2A 2IXBA 4MQUA 3RTGA 4JLMA 2VWGA 4CEHA 3DDHA 3TD6A 4E22A 1JMYA 5CG2A 1DXQA 1JDZA 2RHTA 1JSXA 5JSFA 1AMNA 4J9VA 3AUJB 3IIJA 3NP9A 3R3JA 4BQFA 5J4KA 2RMKA 5T41A 3U3XA 3I1YA 3QFCA 1C0LA 1AKNA 4QGFA 2B5OA 1MOZA 5F2NA 4CUJA 1KYTA 1DQPA 1V25A 5ELXA 3ICQB 4G4JA 4LFAB 2ZWPA 3EPPA 3PKIA 4Z1OA 5F4ZA 3ZDRA 4IWYA 4A5SA 3PUKA 2PUCA 2OM6A 2A9JA 1KERA 2IGTA 2OHXA 5I7OA 4NICA 3FBGA 5REQB 4ZC1A 3WLSA 4C0QC 3P9YA 2OGWA 4GI3A 1P4RA 2PTHA 2WLTA 5IVKA 3A6FA 1G4AE 3I3OA 1ECPA 3A1CA 2D8AA 3EARA 3UATA 3ET5A 2ACKA 4XB1A 2OXRA 4D2IA 1IVYA 1VE3A 4OSEA 4XAQA 5E7MA 1UBKS 1ODSA 1ZH6A 3FOAA 5LNK6 1QK3A 3AL3A 3RRNA 4BL5A 1XA4A 2EXXA 2ZOSA 3W6UA 4K6GA 4A23A 3LCMA 1P4HA 2O6HA 3MHPA 5DTIA 3HUTA 1HL7A 3VSDA 2AUMA 1G6Q1 2BGRA 2QX9A 1CCWA 3D1LA 5BSMA 8ABPA 3MHTA 3GJ4A 1C0EA 1IUOA 2X8JB 4BRSA 4A03A 2FPPB 1NMYA 4KO4S 5K0NA 3V3KA 2Q21A 2O7SA 2VP5A 1FCJA 4EVQA 3KLMX 2PBRA 2RE8A 4ZVQA 4PAGA 3UJHA 2QRNA 4LOLA 5IAAA 1JFFA 1O96A 2X3UA 1XG5A 3AETB 2QZ9A 3T1YB 1G8YA 5I9IA 3OEHD 4KOAA 2DCUA 4UM7A 3KXIA 4I3FA 4EAAA 4B34A 4DJEC 4HNHA 4EGSA 2HN9A 2Y76A 1P5FA 4GSYA 4MP8A 1P1BA 2AQHA 2DC1A 1QGED 2VN8A 3BCUA 3I42A 4J3FA 4DIKA 1SBNE 1NDHA 1P8AA 1GLNA 1SHJA 1ZLXA 2MSDB 1DBWA 4GYYA 1J9GA 3ILXA 3P4XA 5ADWA 1QHIA 1SEVA 2YWGA 4YUZA 2HU5A 5AUQA 1JFTA 1BTOA 3T5DA 2RH8A 4UE3S 1XKQA 1XZPA 3DNPA 3GUUA 3PEWA 3SX4A 1IOWA 4UHHA 4EQZA 4H7IA 3OQOA 3H97A 4IUDS 4NJMB 1C1DA 3ZV5A 4CHGA 4WKCA 5B58T 3KKOA 3PQCA 2ZAYA 4HDRB 2Q9CA 3BZUA 2VAXA 4XX0A 4ZRNA 5EE1A 3GRKA 3GLGE 1YS2X 3RK4A 1QFZA 4IIUA 4ARBA 4Q3EA 3BMXA 1OTHA 3H16A 4NFYA 1T4GA 3NHLA 4HZUB 5IJ0A 1Q19A 3IT2A 3PBKA 4NJOA 3HNPA 2XZOA 4FNAA 4FJ1A 4NYMQ 2DWCA 4ER0A 2I99A 4HPWA 2P4HX 5IW8A 3R74A 2OFFA 1GAEO 1JU4A 1Q74A 1PQYA 1S1CA 3IH5A 2HREA 5HTOA 1N2JA 1YQXA 4FC7A 1GAWA 2FQXA 4OATA 1E5XA 4E5VA 3UJ3X 5JCPA 1DLJA 1YC2A 2IEGA 3C8DA 3W1EA 4AWXA 1Y6JA 1IAQA 2BHTA 2CW5A 4G1EB 4TV8A 4NZMA 1SCKA 4ER3A 2UYHA 2WT4A 1B2LA 3OU6A 4JX8A 4KPFC 1EFCA 1FXWF 1Q7RA 1RR6A 2C5FA 2ORIA 3FI9A 3WLJA 3PNLA 1G20E 4NK5A 3AIMA 1GKYA 2FUKA 4GR4A 2HNBA 3GOHA 4ER5A 1KVQA 5DKFA 3LBNA 1M7GA 3LJKA 4ITVA 5CCBA 5DHUA 3JRWA 5LMZA 1RAIA 1H1LB 1E6MA 2QX7A 2NVUB 1LDBA 3N53A 5FAXA 4QA9A 3PL5A 2UZ3A 2V7QD 4QGSA 1VMAA 2W4IA 2WKWA 4HH1A 4C7KA 5EE3A 5FBHA 2JJ2D 3KLPX 4J7UA 3VZBA 2DWPA 4AKHA 1T9GR 1XO1A 4OB6A 1TMKA 2GNOA 2RKBA 1F38A 1JQBA 1WA5A 4YS6A 2HK9A 3SC2B 2BBWA 3USCS 3W2FA 4N5NA 5C5CA 3EMBA 2XNSA 2R7LA 4X5OA 1DRVA 1XYVA 3I12A 5K4AA 1AQLA 3BMCA 1J1ZA 3TO5A 1QV7A 1TA9A 3OZTA 1BS9A 4A2QA 2R4UA 3TVTA 1GPDG 1X7XB 4H6PA 1XEAA 4Z9YA 3U0BA 3FDZA 4ARIA 1J24A 3RJMA 2ZZMA 3EOBI 1UJ6A 4C05A 1TAHA 2W00A 3PGJA 1QF9A 2EW2A 3I30X 1E18A 3OEEA 2HBQA 4DMUB 4C7OB 3BAFA 1N2XA 1NP7A 2FK7A 4OKNA 3ULKA 3GEMA 1M75A 3W9YA 4A8PA 2QRQA 2Z1NA 4AZ0B 4C4RA 1ZSVA 2G76A 2PL1A 3NUGA 3PS9A 4M21A 2CKMA 5C5DA 1H4SA 3RYHA 4UJ5A 1IZ7A 3I64A 2A9PA 2ACEA 3QVXA 3EAGA 1KC3A 3GJ8A 3N74A 4K46A 4DQ0A 4F4DA 5B4UA 2UU9B 4MCAA 3I62A 3AC0A 4HNQA 4KO2S 3IE2A 2RGGA 1BFKA 3WLAA 5AK6A 3IDOA 5DCWA 3A3NA 1KGSA 1TQDA 1TI7A 5AVQA 2QYSA 2H2DA 4RZQA 3W2IA 3SJBA 3K0HA 4BWVA 2W0MA 4GU5A 1QHGA 1JS1X 1NX9A 1DKUA 2JI4A 1QQ6A 3BD7A 3TMAA 4PX5A 4EYOA 1KFCB 5L95A 2V54A 4UAGA 2AG0A 4EAQA 5LXTA 2RC6A 3IBSA 1QRTA 3HK2A 3HV0A 3ZC3A 1SA0A 5HKOA 4IOKA 3FUTA 3NB0A 4DR5B 1GGVA 1T15A 1U8XX 1CVRA 1VE6A 1PQWA 1WLSA 3HDYA 3ZDAA 1AOXA 4ZXFA 4LHWA 5C18A 2VQFB 5SICE 4U8HA 4IG9A 1EJ0A 4GC9A 2HPVA 3W3AH 3J81A 2ZIUB 2H4YA 1LEHA 5HMMA 4AXBA 2C29D 5IF9A 4TTSA 4LZPA 4YRQA 3NETA 3Q3IA 3QFSA 3VH4A 4LY0A 2FUNB 1BS1A 1JE0A 3NORA 1AS2A 1XLTA 2XVXA 4M7WA 4MKHA 1S3IA 2HPHA 2PGJA 2C83A 3NALA 4PNPA 3S70A 4K1XA 1MGPA 3IDZA 3RRYA 1DJPA 5K3OA 1JVSA 3RS5A 2B25A 1EE2A 4V39A 1TVMA 3L7MA 5BVGA 3QBTA 5KWSA 3AV3A 3OLZA 4OLAA 1OXVA 4EHFA 3TJRA 1M2JA 2FGJA 2EWVA 4RTSA 4DV7B 1QG6A 1EP2B 1JRLA 1HNNA 4X62B 4IJ6A 2GPAA 1WXGA 1OVGA 1S89A 3KSBC 5IK2A 1JTVA 4GL2A 1KEEA 5K45A 1SC9A 4IIVA 1R0ZA 1ABFA 1V11B 2Q1XA 4RANA 2QBYA 2SNIE 2F43B 2XTZA 2PL9A 3MOIA 5CBKA 4P38A 4TRJA 3HHPA 4K03A 1US8B 2A9KA 1G9XA 4J2TA 2P2SA 3E7PA 2Q6IA 4IX9A 4OTZA 5BT8A 2HMTA 1PL7A 2WTEA 1SY7A 5JFTA 3ZOKA 5I47A 4S1VA 2GZHA 2JA2A 3ZNQA 3AR5A 3PHIA 4ERXA 4OOEA 4JLJA 2F90A 3CO5A 3EZGA 1E69A 3OIGA 4R1SA 4RF3A 2HHCA 3KK0A 4LGYA 4B4OA 3AHDA 4EKIA 3QHPA 4OF4A 2IXAA 1PNVA 5K0BA 1I4WA 5JS7A 2AK3A 3ZU3A 4MI3A 2Z6AA 3FGNA 3D7MA 3FOBA 1IMOA 2AF3C 5DRYA 4B2IA 4XWYA 3ZGVA 5TRTA 5COQA 4NMLA 3PFFA 1D5WA 1SC3A 4YLEA 5B1DA 4QX6A 3IMFA 2GD6A 3SFVA 1G3QA 1MABB 3ZCQA 5AM3A 2GYYA 3CLHA 3QOXA 2Z08A 3RSSA 4MMYB 3PJGA 4OO3A 1PRYA 2N46A 2Y1FA 3LQKA 4UZSA 3JWGA 5I8WA 3HM2A 3BK1A 1NL3A 5ICGA 1P9LA 1RJ9A 2QT9A 3CRZA 2EQ5A 1ZJ5A 3RHFA 1KU6A 1QB8A 1CYDA 1F5NA 1I3OA 3L0CA 5K4GA 2VYVD 4RLSA 3BFPA 1G16A 4KODA 1W76A 4FMPA 3SSMA 1IMJA 5EJGA 4MJ7A 1S2MA 4U5QA 4J0IA 4GXTA 3RVBA 4DXDA 5CYPA 2XXJA 1NGSA 8ADHA 3MN1A 3PGMA 1QX4A 3F3MA 3N2KB 2CXRA 3O92A 4FCTA 4M88A 2WM3A 3FMGA 2IUUA 5AKHA 1IBKB 2IXTA 1GGJA 1WW3A 3B7WA 1F0KA 1QAMA 2IHBA 4OP3A 3WK6A 2GZDA 2O0KA 3QI7A 4JYBA 4MB0A 2BBSA 1CSEE 2FLVA 3OTIA 4AJ2A 5HDQA 4X24A 3EDQA 4TXJA 1P6QA 4WUTA 2HCJB 3AUYA 5LM3A 5CFNA 4AKTA 4TUYA 1NVWQ 2CL6X 1ZMTA 1ENZA 4QLBA 2NVWA 4FNGA 1KZ9A 3BCRA 4G0ZA 4O2BB 5BN3B 3KQOA 1I1NA 2GN8A 5DHRA 3VZQA 3NHAA 1QBGA 3CEMA 4MAMA 2G1JA 4BB9A 2WWHA 5IX8A 1U99A 3VR5D 5HIMA 2JLVA 2VHWA 3NC1C 3M3PA 4GOOD 2G28A 1QUEA 3K6JA 3WS7A 2KE5A 3OE7D 4XRRA 2YC4C 5IH7A 3WMXA 1IY1A 3E3NA 1FF9A 1L5RA 3P27A 4BNFA 4WXRA 4OGLA 1Z5GA 3K0CC 3OPYI 1ZR2A 4GVLA 2VSFA 2P6OA 5E6UB 4CBVA 3KBBA 4F1WA 3NAMA 1ZRMA 4J0FA 2X9QA 2XSZD 4C0JA 2G77B 1PTJA 2NUTB 2Z9DA 3BG5A 4XLTA 3W6ZA 1WB9A 2BISA 2JGEA 4RL6A 1A50B 4RNDB 3BMOA 4R2XA 1G64A 4ZZ1A 4JC4A 4P83A 1XZBA 1UMCB 2YV1A 3HZZA 4TL9A 2HYDA 2WIAA 3PR3A 3N7TA 5EXEA 4BWYA 2CV2A 1C4OA 1MIOA 4P0TA 2XQKA 1NPTO 1HMYA 1D5CA 3BSFA 5IT9A 5E6SB 4W99A 5BR4A 2QUZA 1QG2A 4AZ3B 4PC2A 1MH9A 1L7RA 4NQRA 1E9RA 1X7GA 2Y1KA 2Q3JA 2TMGA 2ZRDA 4GXNA 5HKLA 4DCMA 4AMBA 4L4ZA 3LCRA 1FSSA 3PTAA 1IC6A 4XFDA 4I8XA 3NKFA 2G4CA 4UHFA 5LYJA 1DE0A 1G4UR 4JXJA 4CIYA 2RDMA 4WA7A 2IE0A 3RSOA 1MO5A 3T7AA 1E0SA 1U8AA 3AJRA 5EQJB 1KXZA 4DUPA 2BZSA 3GCXA 1KFJB 3C8HA 4XR9A 4L0DA 2FEPA 1GCUA 1V2GA 2CXXA 2ZBEA 4HQNA 3RSZA 4POAA 1DSSG 1NRIA 2WLSA 2ZRKA 4YJ2B 4BZQA 5KU7A 3ISVA 4IXNA 3SNKA 3UAOA 1X0XA 1JEQB 3D7KA 4IH9A 3GOQA 1IHOA 3R5HA 4TT8A 1KEWA 4W7IA 1XZEA 5FWYA 2IYVA 4PYKA 2YWHA 3DVAB 2L69A 3N59A 4K6MA 4TN5A 1ESMA 1LU9A 1UMDB 4RESA 5CYFA 5LJLA 3KX2A 2EEZA 2JCSA 4HNGA 5CT8A 3VO2A 4LGCA 3W5HA 2WIFA 5CH8A 1OLSB 4QIHA 1MQAA 3SYNA 3PEFA 4JEMA 3NHMA 1PJ2A 1Z9BA 2B5WA 2H1RA 1XXHE 4FC6A 2ODNA 3L01A 3NT4A 4ZT2A 5KNBD 4JBGA 1HRKA 3ROXA 1PHPA 2C9MA 3I9V6 4H6XA 2GVNA 3DPIA 4RZ2A 4CU2A 3GUHA 1U2DA 1QNLA 1XYYA 4KQ9A 4ZICA 5LWHA 1OB5A 3T6KA 3DMGA 2NAPA 3GFVA 4NATA 1N6NA 4NV3A 2GBCA 4MVJE 4XSVA 4OHWA 4H1WA 3TF5A 2IC5A 2O07A 2ZYDA 1DQNA 3B48A 4ID9A 4CKEB 3JQAA 4WFIA 2OXIA 2ZSJA 2YN4A 3OOHA 2AN5A 3H2BA 3QMWA 1J49A 5CLJA 4MRSA 2P5SA 2BGJA 4MUYA 1K7CA 1BHSA 2FZKA 4LMBA 4XIIA 5JT1A 3EEOA 3CB4A 3KR1A 4Q4LA 2VFAA 1NJ6A 1SC6A 2EBWA 5EMJA 1Z2AA 1ECJA 1FRFS 1GZ5A 1KI6A 1C7FA 2CY0A 2ORWA 1H0KA 3TQHA 1N57A 3LT0A 2O3JA 4JC0A 1BSVA 3JAWB 5GV8A 1HQKA 4ZK2A 4GR9A 3QKIA 3JQRA 2O7QA 1L5FA 2SBTA 3MMXA 3CW9A 2OO3A 3FTQA 4PF1A 5I48A 1M6VB 3DTTA 3ORSA 1GR0A 1T5HX 3W9BA 4CTKA 4BNXA 2QYOA 4E1AA 3BJRA 4L2IA 2PSDA 4KSCA 4F4HA 4YDQA 4QSHA 1WQ3A 4IHJB 1IOZA 1F0YA 4FCVA 3VDNB 3H65A 5AIBA 4OSOA 3QWBA 4AXXA 3O3OB 3AEXA 3EXFA 4LZWA 4CXMA 1LXCA 3N5KA 4ILEA 3E7XA 4ZHQA 3NOVA 3DOIA 3ENQA 2FMHA 1QMGA 2OKCA 3A04A 3QELA 4GAEA 5CTAA 1JHOA 3WNBA 1JKIA 1Q2UA 1ISHA 3N6RA 3WKAA 3P96A 4ME6A 4MV1A 3KUDA 3WQQA 2CUZA 1VBMA 2VWQA 3FAZA 1OILA 3N1UA 5FTMA 1TJ3A 5DLPA 3SDBA 1G7RA 3BULA 2A88A 2CVZA 3L0SA 1J8YF 2HXSA 3ND7A 5ENZA 2J9FA 3PGXA 3OY7A 2VJNA 4RTOA 3L5OA 2PX4A 4US2R 2X58A 5KX5B 1GGFA 3GJ6A 3HJGA 1GY8A 4G0XA 4E5SA 3DC7A 3HBMA 1KY3A 5KMGB 1Y9ZA 2C94A 2JGDB 2B2CA 5E95A 1EFUA 4X6UA 1T0JB 3WNVA 4LYYA 4Q4JB 2IHTA 3B6JA 3D54D 2WSLA 2JCXA 1Q57A 3IP8A 2CNNA 3IJ5A 1LV8A 4M0MA 5FBZA 2UZIR 4HAOA 4BXOB 3ID6C 5IKEA 3IBGA 2AL7A 3CH4B 3IVRA 1ODFA 4NENB 5ESRA 5A9TA 2OY0A 1KMHB 2XW6A 3JQ8B 3SFTA 5CLFA 4YJ3F 3QA3E 5DTMA 1RWMA 2H52A 2OBYA 3EVBA 2GX6A 1ZD9A 4GOJA 4UNQA 2IIPA 3RRMA 1U90A 1ZGBA 2CYCA 1EDOA 4GPTA 3O4FA 1ZC4A 3NNNA 1DAEA 1M1YA 3PDIB 3THYA 1Z34A 4V3BA 3IUBA 5CBPB 4KKXB 4XKJA 1FFXB 3AF2A 2FPIA 3OC0A 1Y6FA 2B6NA 1FL9A 1KO8A 3UY4A 5AW5A 3PTZA 2I6FA 3N3BC 3FHTA 1CR2A 5AI4A 4BQRA 4NU5A 2F67A 3GJTA 2P9ZA 3NC0C 5EXXA 3B6IA 5AVJA 4KYIB 1E1KA 1ZITA 4I6JA 3WC4A 3WMRA 3VZDA 5K3AA 3RD5A 2GLUA 5TEVA 4PPQA 2YY6A 1QANA 2P0AA 4DM3A 3PCRB 4LI3X 4GICA 2ZS8A 2FVXA 3NLLA 1BDIA 1JAYA 1OSNA 3W5DA 1G8PA 1YGPA 3IHKA 3O5AA 1J5EB 1OXUA 2OQIA 2QMYA 2YOFA 2CVQA 3V97A 4HNTA 3WXBA 4TS4A 4YRFA 2RD2A 1FTSA 4GVXA 3FCUB 3X2EA 4XYGA 4YONB 1UDWA 1VSTA 2X7HA 5JMPA 1YRHA 3DMHA 4DNXA 3IPCA 5KAMA 3JW8A 1AS3A 1D8TA 4DCCA 3RSGA 3FI0A 4ZO9A 3G0HA 3OZRA 4JNKA 3WY9A 4R01A 2XCIA 4JITA 5IUNC 3OOYA 1Y8RB 4YUAA 3PT5A 3GHYA 4R2KA 4OJYA 3B7GA 3N2IA 2BMFA 3H2KA 1VB5A 3G8YA 1EXDA 2I2AA 1B26A 1N6OA 4N3AA 5H9VA 2VDNB 1X74A 1N2SA 1XKLA 2Q1UA 3RC2A 1NIJA 3LKBA 3OP1A 4Y2RA 3BFVA 1HFKA 4LXUA 3K15A 3V9AA 2Q4EA 1AHIA 2WU0A 5FYDA 5JXHA 2PD3A 2JCYA 1KZ4A 3AKDA 2ECPA 4NRDA 1A82A 2AF4C 4BMYA 2ID9A 1E3EA 4TMWA 2PR2A 1C50A 2EGUA 2V6IA 2YQ5A 4UDXX 1JEAA 5CK5A 2IVZA 3Q9SA 4CWAA 5B30A 4FWTA 2NADA 1RE1A 1NBMA 4E88A 3DE2X 1SWVA 4D46A 3P2IA 5AI9A 4AICA 2VAMA 1QZUA 3V7WA 4WPGA 4B84A 3K2QA 3LFTA 5T6BA 4EFLA 1SD2A 2XMDA 4ZC8A 3HJFA 3NTRA 1OAAA 1J56A 3MT0A 1RVV1 1OZFA 1R5JA 3AYXB 2IUTA 1RLMA 3I1JA 1VHQA 2C03A 4WKGA 1ZJWA 3OAAD 4OREX 3WDSA 5GM1A 4IIJB 2UZ1B 3QYFA 3SR4A 3H7AA 5K0LA 4ZDJA 4E12A 1UDBA 1XPRA 1P7VA 2WIBA 3NZEA 4IGFA 2YRXA 3N70A 1POWA 4PIMA 5K7SA 2FQQA 4JA2A 1N9ZA 2QR2A 4G0NA 3F3YA 5ECDA 3RS9A 4FHEA 1MNAA 1SH7A 4AI6A 1YCGA 4CI9A 1CLUA 3E9YA 3RFTA 1XAGA 1BEEA 1G98A 3VZPA 4FZ5A 4OMDA 5AVWA 2AVDA 1QH8A 2OZLB 2XDAA 2ATVA 3PF9A 3CUTA 1J09A 3VKGA 3DZHA 3I83A 3I92A 3MF4A 4ZKDA 2J6HA 1CJTC 2ZI4A 5C7OO 1DOAA 2N47A 4PZ9A 5IT4A 1B0ZA 5JRJA 2D2VA 1VMIA 2A9RA 4JVOA 3K4PA 1XMIA 5GONB 4E7OA 1CP2A 1LNQA 3VOTA 2QAIA 3CLRC 1IOLA 2F3UA 1TOAA 1W581 2AE2A 3ORFA 2NUAB 3LY9A 4G26A 2W90A 4GX1A 4NBKA 3KSRA 1KZYC 2PKQP 4U3JA 2JD2A 3OZWA 3KVYA 2DJIA 3Q8XB 3EBPA 2J08A 3LPDA 5AKYA 5ICEA 1LBIA 1OX4B 3GBVA 3QTBA 4JUIA 3KTAB 4NSNA 3BSYA 1RLOA 4K9RA 4PXSA 4Y2JA 4RY0A 4MYTA 5K3CA 3RDPA 2P9YA 2DX7A 5FTJA 4CE6A 5J4LA 4P0PB 4LK2A 4LBWA 2KM1A 3USES 3LGSA 1WZEA 3WIUA 2NN3C 2IZ0A 2ONYA 2PQ2A 3REFA 5SY4A 1WUTA 3HO1A 1UJ4A 4GEKA 3RBVA 1MC1A 3FIJA 4RGQA 4YMLA 4Q4AB 1WDTA 1DKOA 1B0PA 2FUG6 2VHCA 5LA6A 2ZIWB 2ETVA 4N0QA 3ZDEA 2C1ZA 2B4RO 4BQQA 1JIVA 4F7DA 3RARA 2PKCA 3L1IA 1Q84A 1SCBA 1WZIA 3IXLA 4KWEA 1OROA 4RSMA 4BGDA 5KSYA 4DV5B 2E9SA 4P4NA 3MAGA 1T3ZA 1T5BA 1XK7A 5E1MA 4DV2B 1JH8A 4MV8A 4JVLA 4BFCA 2TSYB 4FYWA 3AVTA 4PLYA 4YRRA 5F52A 4X8MA 2H08A 1Z6GA 5IHXA 1F3LA 2DHRA 2ZGVA 3K1TA 3LT5A 4PZZA 4QARA 4TWBA 3IQWA 4QDZA 4EW2A 1L9XA 3D3KA 3IQHX 3LECA 4D56A 3DZIA 2FEAA 3NBMA 3NPMA 4LDAA 1QVAA 4F4IA 5C81A 3SWWA 4UM9B 2O8FB 2X5KO 5B1SA 3PNSA 4I4LA 2GCPA 3DAHA 3ZZUA 2IYFA 4S2EA 2G09A 4LFBB 1E3MA 3W5BA 3OICA 5G3YA 1CVIA 3OZXA 3RT7A 4H6WA 3WADA 4M6WA 5ITZB 3B8EA 2QTCA 3AOGA 2M2IA 1HTBA 2GF0A 2XMSA 1G21A 1FNCA 2WM8A 4EPWA 1KYXA 3FVVA 4ZO7A 4KL8S 3P2OA 4FLFA 3TVYA 1A0OA 1IZYA 3QPWA 1Q11A 1U4SA 4WERA 5F4BA 5KVCA 1YBHA 2QN9A 5LOVB 4URFA 2EKPA 2W2VA 1PDOA 3C14C 2O7VA 2JFHA 3GEDA 3BE4A 1EFRD 3CLSD 2CXHA 3BYZA 3NC4A 1ZMBA 2G9RA 4TYMA 2LDBA 2PRKA 3SKYA 1GNVA 1LZKA 1VYHA 1JWBB 2YWRA 3O73A 4ZRMA 1PF7E 2B61A 3P2KA 3L8FA 2XDWA 4KLZA 4Z0HO 5F9HA 2IEYA 4JYZA 2ZTMA 1JDBB 2QMHA 1Q12A 3JD0A 2FQYA 1ZN9A 3RWBA 1SUIA 3THXB 3LF2A 2W2KB 2V4UA 4MYUA 1N5LA 1O4WA 2Q4RA 1JU3A 3L84A 3O1HB 3EISA 1UM9B 1Z33A 4W5WA 2AXNA 2EARA 1IRIA 4DLVA 4EB0A 3NYRA 1Q0PA 4HNVA 1F8XA 1PR4A 2GN6A 4NG4A 3AYZB 3IP5A 4DR1B 1UKYA 1FXWA 1PT5A 1KNQA 3EULA 4QVIA 1M76A 1RRKA 3F3SA 3H1FA 1KARA 3HN6A 3I9JA 4G1CA 3I2KA 3MD9A 3CEPB 4B4DA 4C06A 1BQEA 2WV7A 3UQZA 5I7FA 3DWGA 5LQAA 3QEOA 1Z6XA 4CLRA 4Y9TA 3DH0A 4X6YA 4BB0A 2VTBA 9LDBA 4IF4A 5EPEA 3G85A 2PUWA 2ZAMA 4E1VA 5C8DA 4BKRA 5CTJA 4AYTA 1XYGA 3ZE8A 1F2UA 1KJ8A 1EZ4A 3MUNA 4Q7QA 1O6FA 1HLFA 1F48A 1RKVA 1RCUA 3F0TA 4QEKA 4EJSC 2RGWA 2OCPA 2XVAA 3Q7SA 2AW3A 4JSTA 4M7RA 4F93B 1SVNA 2OK7A 1JECA 4R8RA 5KUTA 5L45A 3UPDA 2R6FA 3ER8A 121PA 4ZZIA 5AVOA 1L6IA 1Z16A 1PKEA 4JLSA 1BXGA 2YWCA 3O8DA 2VDJA 1OD6A 3PXAA 4Q82A 3R5FA 5BSRA 1N2CE 4F97A 4MULA 3RTEA 2O1WA 3BEDA 4K1LA 4KK3A 1KTIA 5HIIA 3W3AA 1O97D 2PNJA 2IV2X 5A0VA 1WP9A 1FYFA 2MSWA 2ANBA 5DOZA 5A4AA 4OFXA 1B16A 1IM2A 2BHLA 3NIGB 2WF5A 4H9GA 1PJLA 4OXQA 5DTEA 4UM9D 2OYSA 2BE9A 2E5WA 3DZJA 1U2ZA 3IXQA 2ZVDA 3JSAA 4M8NE 4JB0A 2ZK7A 3U16A 4DYDA 4N1AA 2MYTA 4BMDA 3ASVA 3FCAA 4LE2A 2FR1A 1YIOA 3Q1KA 2EJCA 5K0TA 1A3CA 3PDJA 3W0LB 4PEVA 3ENWA 1KDVA 3I5UA 1DKNA 4H3SA 1TPYA 4M89A 1R74A 1BRMA 3EVAA 4N3NA 4HF7A 2OVFA 3LYUA 2R62A 4C7JA 1T36B 3TNYA 2ZUUA 4PO1A 1XRRA 1AA9A 2CXSA 4J0GA 1VIMA 3WG9A 1E60A 3LF1A 4ZFNA 1X1EA 2AQKA 2JD0A 3GP3A 4WCVA 3OTOB 3KTOA 4BVGA 3OSZA 2AOVA 2C2ZA 2O5EA 4A26A 3M6AA 1ECLA 4YRAA 4ZO6A 5AK4A 5K05A 4EEKA 5IZ4A 2QSUA 4U4AA 1ULBA 4QTZA 1DT3A 3IA7A 3KC2A 1Z6PA 2IHZA 3OT5A 5FDFA 1ND6A 4PANA 4LFCB 4B2LA 2O8DA 4U2EA 4KR6A 4CG0A 2E4UA 1G6HA 5B3JA 4CYMA 3IP3A 3L1HA 1EXVA 2N1MA 1Y8CA 2R8EA 5HCIA 2BFNA 1QC5A 4D41A 1LTQA 4EG4A 3I0ZA 3JY6A 2PUDA 2RCYA 1D2GA 1S01A 2VNSA 3CBGA 1P1JA 3WR5A 1C7EA 2OXTA 3IHWA 1IZ0A 4YJHB 2C4VA 5JZ9A 1ZKDA 2YJ5A 1NF9A 1K7XB 4D5GA 5ELLA 2HWXA 2Q45A 1ZLYA 2PS9A 1I7SB 3I45A 1JKJB 3BCHA 3VHXA 3K6KA 4L4YA 4GZ5A 1OU4A 2X5XA 3O9MA 4QECA 2VATA 4KO8A 1VHLA 4P53A 4RE5A 4LIPD 2HRQA 1UFQA 1P91A 2Z8XA 3BMNA 3P0HA 4UXHA 5I45A 4EA9A 1Y4ZA 2P9EA 3I9FA 1E1QD 1BGXT 1HF3A 2IKSA 1OXSC 1E79D 5K51A 3OPYA 2YFHA 2X8BA 3VM6A 4RD2A 1GCOA 3IUSA 5EZSA 3QI2A 2VTKA 2FW0A 2BT4A 2R44A 5EPUA 5K8UA 1P73A 5EERA 2MSLA 2A9FA 2W2MA 4PVCA 3MMNA 5FWXA 1W35A 4EG5A 3MXOA 4DLBA 2QV0A 2QVCA 2W2TA 3EQ6A 3N0XA 4FGZA 1N36B 2DJ5A 2BCJQ 3DDNA 5CDUA 1MMFB 3K8OE 4GP7A 4Y7DA 3T9BA 3RIHA 1YA6A 3T3OA 1I7NA 1X9GA 1QF6A 1CUGA 5IM5A 3K0AA 2HZ7A 4W82A 3THXA 3GP8A 5IXYA 1RQPA 3C45A 3HKEA 3OUTA 4TYNA 1LW6E 2MWMA 4XARA 2VO1A 3ONDA 1C80A 1MN6A 3U4GA 4AZVA 2XHZA 3CF6R 2G07A 1JT2A 1L7AA 1LF0A 1RACA 3U9SA 4BKPA 4J3JA 2FX5A 3OKFA 1P4SA 2XYVA 1D7AA 2GWRA 2I4TA 4MW2A 4X7BA 1ZD1A 5AVUA 5FOQA 2WICA 2E4ZA 4UMDA 3X1KA 2FG5A 2NVBA 1D1TA 2G72A 3DDSA 2XMQA 4AC9A 4DRXB 4F3RA 3WOVA 4DKJA 3V8EA 3NNDA 4DCUA 3ZTTA 2QLMA 5ALRA 2KSQA 2F3QA 1T8TA 2XRMA 2BDTA 3GLHB 5TMPA 2ZYAA 3IGFA 1O9HA 2R25B 3LKZA 4BZPA 1GM5A 1UBMS 3RIGA 2YVAA 3FZQA 3OE4A 3O95A 4FEYA 3T41A 3ANTA 3VHQA 2C5EA 3BXXA 1N6IA 4FFOA 1WVMA 2R1TB 1U6JA 3RVJA 3NGMA 1AMOA 1WV0A 3DLBA 1BMTA 2PA3A 1EHCA 1PVDA 1EBBA 1GRQA 2R1VB 1J0XO 2Y1GA 1W5BA 3FSJX 3OU2A 4AF7A 1P1RA 4BLVA 1QM5A 3P2YA 3CW2A 4EY6A 1KH2A 3F5FA 2FUG1 5CLQA 3J80A 5KVVA 3B9PA 4EHDA 2YWJA 3LX4A 4CIXA 4U1RA 5DYNA 1F2TA 1QGOA 4R2WA 1L1RA 4L02A 4TTQA 4R54A 4R1QA 4POOA 4I36A 4E31A 5JEEA 1C8KA 3LL7A 4IKPA 3EJ6A 4RHFA 4OQYA 1G5RA 3AR8A 2I6GA 5ECWA 4YBZA 3TG8A 6REQA 3CO0S 2ZJYA 4ZV4A 5JJ5A 2D3TA 2E1RA 4BN4A 1TMYA 1XHFA 3EGXB 4DMHA 3IT1A 3JWEA 3QWIA 3MT8A 4NPCA 3VKFA 3G0BA 2HV8A 4LY6A 2QUKA 2ZIFA 5I7WA 2ECFA 2NTVA 1NOKA 1LZLA 5CA1F 4LJSA 1C3XA 1UEXC 5CM9C 5SZKB 3SZMA 4I4IA 3ZVRA 5JQGF 2EP7A 3CSDA 1Y6GA 2GAIA 4WK4B 4EELA 4ND2A 1N7JA 4RK5A 1B6SA 2FDRA 1IY2A 1NBOA 2HT6A 3KT6A 4K9DA 1R9NA 3D0RA 1PWEA 4ZO8A 3UNXA 2HK6A 3H2YA 3TSWA 4AS3A 4D4MA 3Q3CA 2HQBA 2QVLA 4QAQA 3ZNOA 4ARZB 4BO4A 2I6TA 3TS1A 4B3SB 3EFEA 1R00A 2NXJA 2GEUA 4DOMA 1L8QA 5FX2A 3FDIA 1O4VA 1TT5B 2PSEA 3A3YA 4QUEA 1I0IA 4FHDA 1GN9A 4C2TA 4KP7A 1GPBA 3DV2A 4IYRA 2AW5A 2C4MA 3DMNA 3K70C 1GA1A 5YASA 2V1XA 1BIFA 3SLKA 4JLOA 1CR4A 5AR1A 3W4IA 3K2EA 4I4TB 1IN4A 3GRRA 4N40A 5INTA 1FA9A 4M38A 1W1UA 3N2GA 3L0YA 1M1XB 3HR4A 3VPSA 2ZSIA 3PFIA 1D0IA 3IELA 4CGZA 2VNIA 3R3ZA 1R0LA 2YJNA 4JNCA 1BCSB 2Q46A 3GNQA 7REQB 4B48A 1C9JA 3EIUA 4B35A 5BO5A 3Q3HA 3TOVA 1D4OA 1TUEA 1RQRA 5EIBD 4ENRA 2KQUA 1JDVA 1CZNA 3BRWD 1LK0A 4KC0A 4MH0R 4DWJA 3NBQA 3VR3D 2HMAA 3FUXA 5DDIP 3TQSA 1RMQA 1X70A 3PUYA 4RA9B 4I81A 1D9XA 5DN6A 3SNHA 3EXIA 4DPLA 5BVGB 1ESNA 1K6IA 2IGBA 4HPXB 1V6CA 4YB8A 4Z9FA 4A82A 1C9YA 4V02A 3HXOA 1JHDA 1AO0A 5C7YA 2CK3D 3C7KA 1IQRA 1DJOA 1TVKB 3IV7A 1NN3A 5FNZA 3TW4A 3WB2A 1D9ZA 1JHMA 2CXOA 4EBBA 5E3HA 3M5DA 1TE2A 1OXTA 3LX5A 3MLBA 2Q2OA 2H5JA 3GEGA 4A0QA 5KPDA 1KEEB 1T1EA 4CFSA 2W6MA 5AKKA 3ITKA 3ELBA 2GT1A 1GZ6A 1QUFA 3CJTA 4AUNA 3PENA 2RHDA 4MHSA 3TOXA 2E5LB 3Q8KA 3F67A 2YWDA 2BGIA 4KI7A 5AJUA 4D9HA 1GP2A 3M6UA 4AY5A 3FMFA 2EX4A 4JUCA 4I1UA 2B92A 1EAMA 1DUIA 3MK31 5IBPA 3EYAA 3QXSA 1GLVA 4DANA 4HGPA 3UMGA 1QJ4A 1Y9AA 3CJRA 3IEUA 3M8KA 4M2LA 1Q0HA 4ZVTA 5FKJA 4NE2A 4PZYA 3ZQ6A 3WWZA 3TK1A 4XGRA 4YRMA 1DOHA 3ZTWA 2E4VA 3SYLA 4DCTA 5EIFA 1IQ0A 1NNUA 2HCBA 1J70A 1UKEA 1XQ6A 1TX4B 3LUHA 1DL5A 4UMEA 1EG7A 5C4GB 5B1EA 1TUIA 3R3YA 3IOYA 4B46A 3PWSA 2GZSA 4WX2B 2V59A 5ECYA 4UMVA 5CFRA 4HG2A 1P1IA 2ILTA 4TZ6A 1IWOA 2XGGA 2PGOA 1A2KC 2LIPA 1UBHS 1ODKA 1M74A 3B6EA 3RAPR 1WCIA 4RQBA 3ENVA 5CVTA 3KJEA 1RLTA 5KI6A 1BEZA 4II2A 2EFDB 3NBUA 3AUFA 3R5KA 5TMDA 4MOWA 4CT4B 3KYCA 5I9LA 2EZ8A 1FUYB 4FK8A 1D6SA 4CJXA 1CY6A 4DC1A 3PZRA 2JVJA 4HYTA 1L1EA 1T2DA 3B8HA 2GTPA 4JT2A 1ZUNA 3L8ZA 4QXMA 1J2UA 1M1UA 1OAKA 2GYVA 3FPSA 4M0FA 3WZMA 2C88A 1FB5A 4JU9A 4L51A 4EHAA 4D9EA 1RM4A 4O25A 1AK2A 1GA4A 3OLYA 4BRZA 3CZAA 4HWOA 5JFGA 3MBKA 4ZMBA 4RMGA 3HR7A 4JL5A 2V98A 4RS3A 1CZRA 2EYUA 3KQMA 3RYIB 4COKA 4CKYA 2G04A 3GFGA 4AP6A 3MBOA 1KK2A 1WX1A 1Y4DE 3GD5A 3GO4A 4UPDA 1RLJA 3FTPA 5AH0A 1PFQA 1ISPA 4RDHA 1X80B 2P41A 3H5VA 3K5WA 3W05A 3TLGB 1N5DA 1R4NA 1P31A 1RHUA 1WTCA 1X8JA 2XQFA 4HFNA 4WOKA 5E7QA 2GNPA 1KDZA 2ZZNA 1V4NA 1Z82A 1ZRHA 1Q1BA 4KV7A 1CXZA 2PD6A 1H2ZA 1NVEA 1IK6A 2OCYC 3EW9A 3DGEC 2IX9A 1HFJA 3EAQA 2B94A 1XZAA 4TN1A 5E9AA 2IXFA 3U9TA 1HE8B 1RC0A 3PCTA 3ROEA 2DYKA 4UZEA 1NRJB 3L0ZA 2QI9C 2G25A 1NQXA 3RYCB 2JIRA 3K09A 5EAIA 3DOJA 3HLYA 3JTMA 1GRVA 3BB1A 1ORRA 3WB9A 3ZV7A 1JJAA 3OCCA 2BC9A 3YASA 3DFMA 4JKIA 2WZQA 3MOGA 3OX3A 1YD7A 2JPDA 2X7XA 3QPBA 2Z3ZA 1KMNA 4Z4QA 1LSUA 1MJGM 1NQTA 1V16B 4LBVA 1FP6A 4RX1A 3TUIC 5I51A 5LP6B 3PNVA 1XDGA 3O2NA 4EKNB 3D6NB 1UBGA 2NZXA 4J0JA 1GGNA 3IEIA 4D99A 1RWKA 3G1WA 1P0CA 1C3OB 2PK3A 2D06A 1Q91A 4PN3A 1I1HA 3EIWA 3R09A 2VEOA 3QBVA 2GHQA 1U2GC 3FJ1A 2MINB 3UT5A 4HDQB 1SBZA 3DOCA 3KOOA 3KUXA 5KOJA 5JYBA 4D7AA 6CHYA 2V58A 1BJKA 2DFPA 3P9XA 4HUQA 5DISB 4NBLA 4W5JA 2Z30A 1R6DA 1ONSA 3NGLA 5HRUA 1ZM4A 1ZUIA 1BO6A 4DLAA 2N42A 4DLKA 1RQ2A 5AO9A 2VBIA 5JROA 4HC4A 4KXMA 3TSCA 2GPBA 3C1AA 2HRCA 3QF4B 5AQ1A 5TDHA 4MV6A 1Y3HA 3BIJA 1XQWA 2IP1A 3SYKA 3K9BA 4J7AA 2WFLA 1HR0B 1XEWY 4E5KA 1E4EA 1YDHA 3VPXA 2BH2A 3JVDA 3S5JA 1UKAA 3LCCA 1J7KA 3EW7A 4GLLA 2O7NA 4PAWA 5TVGA 5BN5A 4B44A 1FVXA 3KSUA 4DBLE 2J67A 4HD8A 4ZAFA 2J5BA 1GOTA 3HO6A 4DIOA 1S2IA 2WABA 3O31A 5JNLA 3L6RA 5JNWA 5JAUA 5KSZA 1QS0A 1WSBA 3T3NA 1Z4JA 4JQYA 1UODA 4FUQA 2TMKA 2MOKA 1GPNA 5HKBA 1NBEA 2PO7A 4RVUA 1WZUA 1XIVA 4R7TA 3NVDA 5IJWA 3KQYA 2JCGA 5BYAA 3CLSC 1XFAA 4A9AA 2IYEA 1MB3A 3OIWA 3P19A 4XWKA 5BY2A 4MA0A 5C32A 2BLLA 5L3RA 2Z2JA 1Q1EA 2RHWA 3TPZA 4DPKA 3L79A 4IKOA 3TIFA 1D8AA 3AKCA 1II8A 2QPAA 2VJQA 2W6ZA 2JFZA 2FN7A 1O5IA 2P91A 2P9BA 3FROA 2HRZA 2WUGA 3KUKA 4Y0AA 5DLQC 4C0AC 4QHSA 3P5BA 4WLEA 1MB0A 4JP3A 3LLUA 3ZLBA 4UOEA 4KQFA 1T8YA 2V5UA 5T4EA 3VR4H 4DCJA 4GLBA 1Z7GA 3EVDA 1OWPA 1X9IA 1JG7A 5EKTA 1F5SA 2ODAA 4G89A 3A1NA 1W87A 5FR2A 3F2IA 2IZ5A 1E1NA 4P3YA 3ZEIA 2NT3A 2A58A 2XCOA 3WL4A 5KTOA 4JQCA 4R84A 2X0RA 1EBUA 1FU4A 1H0RA 2AJLI 2R8OA 2ZE8A 1WF6A 3GPDG 3PU6A 4KAXA 4O2AB 2JH9A 4AQDA 1Y1LA 4QQ8A 5K20A 3SI7A 3AMVA 3PI6A 5DNWA 3AHFA 1E3DA 4ATNA 5L51A 2IX3A 3JZAA 5CFPA 1RHMA 2A4KA 1AKMA 5FL7A 3GLFE 4Q16A 1FBTA 3K0FA 3MUOA 4LDZA 1CY1A 5KBYA 1E9CA 4AF8A 4FSHA 5B1IA 1PIWA 2SICE 4DCOA 3PA6A 1KZ6A 5C51B 4L6CA 2PS1A 5JOQA 3WRXC 1JLLA 2ANCA 3ICWA 3RREA 1E1CA 4ZAVA 1XK6A 5EJAA 1OGYA 3A1VA 3AW9A 4MGIR 4ZVKA 4YQEA 1ZG3A 1U28A 1ZGCA 2XPCA 3ICEA 1PNQA 3PQ5A 4KU4A 5IVPA 1JG2A 2PEZA 3IDFA 4G5HA 5EHQA 1YU9A 3ZIAD 3QPVA 2EWMA 1AGXA 1VKRA 2ZT6A 1X7WA 1A5SB 3ESCA 3OOSA 4OHMA 2NO7A 4RM3A 1BHJA 1F51E 2REQB 4CGYA 3Q6NA 1Z6AA 3WP1B 4RIFA 3R9XA 2H4WA 1WHSB 2RONA 5GMOA 1QQ5A 3ZVLA 3H04A 4KDEA 5TPZA 1OIVA 3H86A 1CEYA 4DAEA 4X1YA 1SUWA 3DOOA 3QUBA 4XTCS 3R3UA 1G3RA 3U7QA 3WBBA 1V2HE 1NQ5A 3A6GA 4B5KA 4BNUA 3K1ZA 4B71A 4DVGA 1AQUA 1NN0A 4J03A 1IPEA 3ZWCA 1WZ2A 1GN8A 3ENNA 1CS0B 3KHKA 4KVFA 5A4JA 1EUDA 3L18A 1NHWA 3GNSA 2X15A 4Q7JB 5IULC 3IOBA 4EABA 2XUPA 4NAHA 3IYLW 3ZY3A 3A70A 3UN1A 4EYEA 1DWOA 1JHYA 2REOA 3H5TA 3W4KA 4I7EA 3LDGA 2YHUA 3E9EA 4LVUA 3LHSA 1L3IA 2GK4A 1EM8B 4QULA 4YMIA 1Y8QA 2OK8A 2WP0A 4Y2GA 1J9EA 3CSUA 5JQWA 2GTHA 2QTGA 3R2JA 1XCGB 4Y6SA 2CDAA 4UEQA 2BFCA 3L46A 2H65A 2OXCA 4U2GA 2ECKA 5ALPA 4CM9A 2I7XA 3CY6A 5CH3A 4OBBA 3DV9A 4DC0A 3KJGA 1Y5MA 2PL5A 4N65A 4B2YA 5JNVA 2RIPA 3MCAA 1UUFA 4P22A 2Q28A 4EHHA 4ZJUA 2WTUA 3OO0A 3KG2A 3V6MA 2EBFX 3NJ8A 2J5KA 3L6CA 4AULA 4D8TA 1B8UA 2WNIA 4IHQA 2VHJA 4K9LA 4ZJYA 4K28A 1UK7A 2XZTA 4AL4A 1TU4A 2OD9A 3PWZA 3PI7A 1W2WB 1VRVA 3FPGA 5G4LA 5IHPA 4GXQA 1WCWA 4J43A 1XKTA 1Z18A 3H11A 1CE8A 2PBZA 4NU6A 1ADJA 3ZYZA 1NQAO 3L9XA 4UOQA 4LJ4A 1EWQA 1GQSA 1TO1E 4EMSA 3UAVA 3G79A 2UKDA 4PLVA 3ROQA 5BMVF 1MC5A 2DVMA 2P9TA 3KZXA 4HWSA 4EMUA 2JLZA 4D02A 1TVEA 4R0NA 4XEHA 2FFRA 3RWMB 1BVRA 4AWBA 4EKEA 4BQNA 1HG1A 2AI3A 4DSOA 1C7IA 5FTLA 2WUDA 1FX0A 3NEPX 4ENVA 4GP6A 1Z17A 4OM8A 4TVSA 1M1YE 2C5LA 2G5CA 4L8YA 3ZZ1A 3OJOA 1MB4A 4EG7A 2VZLA 5A4KA 1DARA 3B20A 3MCUA 2LE0A 5DTJA 3HFJA 2FRDC 1NVDA 2ZSHA 1KYIA 4GIBA 1EFPA 1Z5OA 2J9RA 4ZOEA 2O19A 1BH6A 1U5AA 1XTIA 2Q3HA 4NZOA 3AVVA 1R4MB 1F9AA 1RWVA 4A4DA 3DVQX 4CIVA 3HACA 3KV3O 4LBYA 2YXEA 5JV5A 4BCBA 3BVPA 4P31A 5TNXA 4HDMB 2XOKD 4OXKA 3DXFA 3AVXA 4E14A 4I66A 1HT0A 3PSHA 5AM4A 3BQMB 2XB6A 1T9KA 1RJFA 4RXUA 4ENUA 4I8IA 4FN5A 2HJWA 1MAAA 3DNMA 4EA7A 5FWNA 5HUQA 4GWLA 2XMGA 4TOIA 1THZA 4XGKA 4MQFA 1MZPA 1X13A 2BZ0A 3MYYA 3GRFA 5B6JA 3KWJA 3T52A 1GNTA 4Z4CA 2GAAA 1JVBA 2Q5LA 1HDYA 1QONA 4Q93A 3NHYA 2O5RA 2VH1A 3DKRA 4PIPA 4EM6A 1STOA 3JD2A 1QSGA 4FYHA 4N82A 4TKUB 4YFVA 4R69A 5F73A 1UK6A 1XMVA 1TGYA 4GHWA 1CEEA 2E4WA 1DKPA 1PE0A 4WASA 3EC7A 1EHIA 3KD2A 3M3DA 2WKRA 2EX1A 1QVRA 1Z0DA 1P33A 2QE7D 3G5UA 1YR6A 4LC9A 2QD5A 3H0KA 4URVR 2XMPA 1A9TA 3REOA 2I7CA 2ZJ6A 2NYVA 1K68A 4P35A 5TV2A 1W9HA 1NUUA 2ID7A 4RMIA 1I4TD 4R9NA 3QUSA 2D5LA 1RQLA 2AMJA 1VL5A 2YV5A 2JJ8A 4G1FA 5F7XA 3IA2A 3BBLA 4IEEA 4G0QA 2XAAA 4UTRA 3H05A 2VCHA 2EW8A 3H5OA 1LS6A 1Q20A 1QH8B 4DM7A 4REMA 4Q1BA 1A9RA 4FINA 4UFPA 2PRYA 4ZCRA 5SYMA 5IMSA 4H1VA 4UHJA 1NBME 1T9DA 2FAXA 4Q6WA 1EXMA 4ZU6X 2BGKA 2JIPA 3KU4A 1T8RA 2FPOA 1ILWA 3KJHA 3NDIA 4HL6A 3V34A 2JIZD 3KKKA 3VNAA 4ENSA 1Q7CA 3AM5A 5CXUA 1B8PA 2M9MA 3JQCA 3DOHA 1KNXA 1NVUQ 1DRWA 3SC4A 4L4SA 1NZJA 2Y0DA 3GJ0A 3SZOA 4UNSA 1H6CA 1F4LA 3H1GA 1ZP6A 3OQBA 2W2LD 1H2RS 4O08A 4C0WA 3EOAI 1O58A 4ZALA 4ACAA 5CD9A 3QP9A 3F9CA 4K88A 1JSZA 5IZCA 4AF6A 1XQ9A 2AFHB 1XEWX 1MIHA 1WD7A 1YHNA 2ZB3A 1VPVA 5FNVF 2AYXA 3C5HA 4OHOA 4RPHA 4Y18A 4F46A 1Z08A 2C99A 2CSUA 2DAPA 1M3SA 4A8JB 2YS7A 3N0WA 1EVQA 1IB0A 1KTVA 1W9MA 4BKUA 1JUDA 5E9JA 3X44A 4A0SA 5MFZA 4PV7A 4KR0A 4YAEA 5MN5A 2R7KA 2MJLA 2VRWA 3L49A 2EC5A 1AHHA 2VG8A 4N03A 1GTG1 3D6VA 1DINA 4NNOA 4NH4A 3LLVA 3PFWO 4JMPA 4ZGGA 3RAGA 2L0XA 4R9SA 1JIXA 1RWOA 4D9FA 3PITA 4LZZA 5DTRA 1KGDA 3SIWA 4LGMA 1QRRA 2I65A 1HURA 3RNOA 5CGQB 2XXAB 4LJ8A 3C16C 2L2QA 4KXYA 1XDSA 4NS4A 4WNCA 1OBOA 3T7JA 2YV2A 3UK1A 2VQDA 5BYKA 1TM4E 2P9HA 3VI3B 2W42A 3UBTA 2IPOA 5F5NA 3CZCA 3QXGA 4MB6A 2H0QA 5C0OE 4EMTA 1K75A 5HKAA 1Y98A 2OV8A 3D8NA 4ARCA 2VDKB 4QU0A 3QQ5A 4LXQA 4IXWA 3NP7A 4LDQA 4R0VA 1SD5A 4AS2A 3MQ4A 3LOUA 2RG1A 1CF9A 3HU5A 1V8OA 4XOUA 3VDMA 4C3UA 2FLWA 3NHWA 2XTMA 3W2TA 5IT5A 4B6SA 3VOAA 5AK0A 1H5QA 1HC7A 1Z12A 2WZDA 3L05A 1XWFA 5EJFA 5F78A 1P8JA 1KP3A 2C8KA 2F7SA 1G2OA 3ABOB 1GKKA 5IBQA 1DHTA 4MJ3A 1DEHA 3HEAA 1RVDA 4OAQA 3UUGA 5KCZA 3DTVA 3TQQA 1FTWA 1QZ3A 3VNBA 3ZHRA 4JSYA 4EK9A 4S04A 3FB1A 3TH5A 5HYVA 4FDLA 1J22A 1WO8A 3F6YA 1IBRA 1DTWA 1NBAA 3CN9A 1P2GA 2Z2XA 1GKLA 1Z35A 1YQTA 2VJYA 3PNMA 1VMDA 1ZOLA 3KXKA 3UJ6A 2XD4A 1G21B 2NNLD 1E7WA 1YB6A 4DLYA 2BMEA 1JLHA 1LJ8A 1W5SA 2VR1A 3SXUA 4Z5XA 1AV6A 3HG7A 1GQYA 2AA3A 3RVOA 2QN1A 5KAPA 3ENZA 4PZDA 2H5IA 2RK3A 3AR6A 1OREA 4JYCA 1E9AA 4RPCA 4B4UA 1OUMA 1X6VA 3CNLA 4ECAA 4ER6A 3IIIA 4LF9B 4OLHA 4XGIA 3FVRA 2WD7A 1OFTA 4F6RB 2UYYA 1GYQA 2QR3A 3PPYA 1R7RA 4E21A 1CY2A 4TLDA 3FYUB 1YOBA 2DTXA 3FSGA 1GSIA 2IS4A 1X38A 4R1OA 3F6CA 4LMAA 5EWLB 3NHSA 1U7WA 1N75A 2WG1A 2DUNA 3HDVA 3P1JA 4DLRA 1JXQA 3I2JA 4Q4CA 3A4TA 2JA1A 3HPRA 2C07A 4BAUA 4JIMA 1NLFA 4EG1A 2HBRA 3TSYA 3L4KA 3OD1A 4MWDA 2BW0A 2NZVG 2X2OA 2NSYA 3AEKA 3OLVA 1I6LA 2E4AA 3K9WA 5A5EA 2NZWA 1S3FA 3GVXA 4GUDA 3BSSA 4NXNB 3JCZA 2B1JA 2G8NA 2QR5A 4RTRA 2DBZA 3GWGA 3PQ8A 2R47A 2VK2A 2WIJA 2WWGA 3PNQA 2XQGA 1PZXA 3BHNA 1YR2A 3MJTA 4LF6B 3ZDXB 2Z9BA 2P4UA 3L5KA 5DP2A 1GEGA 5HWSA 3QEAZ 4D6XA 1YR1A 2R00C 4CKBA 2UVPA 4WJLA 3IAM6 1YZYA 4QWWA 3QXHA 3R7BA 1I01A 3CF4G 4K9OA 1T4BA 3KTDA 1EGVB 2WJJA 3BWDD 2PRIA 3TLJA 1W49A 2O2XA 2OLJA 3E22B 5GVRA 3FCSB 1Z63A 5AI5A 1EQAA 3RRZA 1N2ZA 1QHEA 4HY3A 3WK7A 5EIXA 1ND5A 4ZDIA 4YA6A 5KYXA 4O29A 4GPIB 1KEVA 1OV4A 1U0TA 2C7BA 2FF7A 2YJZA 2QZSA 3QY0A 2QWXA 2ISQA 2J45A 2Y4NA 1UXGA 4YAIA 4UUPA 1SG0A 1W59A 4KXWA 1MENA 4E03A 1SZDA 3H4IA 1NXOA 2DPGA 2NXWA 4X3PA 4IO1A 3AO0B 3VYUB 1CF2O 5FBQB 1ZAYA 1P6XA 2OD7A 1NBIA 2YXDA 3ICPA 4TVKA 2NU8A 4DTCA 2I6QA 4HYEA 2OBMA 1KZ1A 1DXYA 1J6UA 1NHGA 2D59A 2Q6LA 2C3YA 3I28A 4RDXA 1ZS9A 3P2MA 4UUQA 5CA1A 3JARA 1RPAA 2Q9BA 1NJ8A 4BBAA 1ZOSA 2IOFK 1MEJA 3R3WA 3SIRA 1PHRA 1DFHA 2IOHA 3TPCA 2A5JA 3GJ5A 3SK0A 1FNSA 4G2TA 1E3IA 4KYUA 1FU8A 2V96A 3NBZC 4NPHA 4LC1A 4IIHA 1Z13A 4XUGB 3C4JA 5BV2P 1TM3E 4QU5A 1XLTC 3DFKA 1G3UA 1VE1A 4OLJA 1RXUA 1IM8A 2HDHA 4QJ4A 5TT0A 5L3SB 2PRSA 5BQ3A 4JI6B 1PD0A 3KQWA 4ALLA 4B5LA 4CM4B 1B00A 2Z0MA 2GJ4A 3WTBA 1QNFA 4PC6A 4DA7A 4WADA 3FAKA 5THKA 4KNYA 4FNMA 3RUCA 5HKKA 3HXLA 1IN1A 2C2OA 2D1SA 4UCXA 2WHPB 2CFSA 4HNAA 2J9ZB 3MJCA 3N39C 1T0IA 1OC4A 2ENWA 3KXLA 3PE6A 4G9GA 2CVOA 2YDXA 2VAVA 3ZZTA 4PN7A 3VNQA 1RPZA 3QU5A 4GQIA 3CKKA 2XCUA 3L06A 4DYHA 5LSAA 4TLAA 3UPTA 3ZIDA 3GPCA 2OV2A 3I6IA 3HWWA 1R4ZA 4I9UA 2JAWA 3NH9A 3FFWA 4N5LA 3QTTA 1D07A 3H6GA 2JK1A 3BQ9A 1Z7WA 4KFUA 2WSIA 1RM0A 4JAVC 4NLLA 4Q1DA 1S02A 3QEKA 4XVQA 3U1BA 1BD3A 3AJDA 3LPCA 3IVAA 2WHRA 3QIVA 4PYOA 4KPUA 1HT2E 3ZCVA 2CGEA 5AVXA 2O8DB 5F35A 3A0UA 4MWZA 3VVCA 5L3QA 2D3WA 1YZFA 1WD5A 1JKMA 1TQ6A 4PBRA 2NU6B 2NYUA 3S2SA 1RYZA 3UK6A 5HZHA 1GNSA 1VPTA 3E0XA 4HQ0A 3OURA 1YRQA 1T10A 4P84A 4Y1GA 4ETMA 4UUAA 1JEDA 4FFRA 4HKTA 4DJTA 5CDHA 1E3QA 4F5EA 3BWMA 1VHJA 2P5UA 1SQFA 4Z0PA 1E98A 4AY6A 3TDNA 3Q40A 4R9RA 4BFSA 2X5JO 3HTXA 3FPKA 5ER9A 2WNSA 2OAEA 2QD2A 3LY7A 3WGTA 3C8UA 5AVZA 1C7RA 3IALA 2OHIA 3TLXA 2RGAA 2NO5A 3ED1A 3KKNA 3PIRA 2DE0X 4RD3A 5G40A 3RO7A 3WKBA 4CTMA 4HB2A 4H60A 3ZJUA 2ZWVA 4IVNA 3E9NA 1C9NA 4WY2A 2XF8A 1U0RA 1UWLA 4XYBA 4QGBA 4FM9A 1YVDA 3AQIA 3V5NA 4YP1A 4WCFB 3H3FA 1I80A 4CLOB 5IH3A 5I4BA 4CU5A 5EE0A 4DMFA 1AO3A 2FMKA 3KXPA 4F6CA 4D3DA 1PJTA 3TLZA 2BD0A 2OOSA 4COOA 4YJKA 4LOKA 2CFOA 1SOVA 3FPJA 3HCOA 1L5NA 3M3HA 2CXUA 5KZMB 1CDZA 1WXHA 4HYYA 2PGAA 4DV4B 1G5FA 4Y2HA 4RJJA 3RC8A 1N9GA 2AXPA 3ON5A 4WI1A 1I2CA 2O8BB 3OM1A 4L72A 1MO3A 3H5IA 3MJVA 3U4AA 5TJ9A 5A4IS 3HB1A 3I04M 3LPNA 4Y98A 4X8OA 1ZK4A 3HDTA 2XMBA 3ICCA 4OGFA 1NSYA 1XDWA 3OPVA 4E15A 3HCWA 5D7NA 1GG5A 2C59A 1XTTA 2JAPA 1Z4OA 2BFDA 4YCJA 4KLNA 1CPYA 1IUKA 2GYUA 3ZU5A 4HX9A 4UEOA 1O0SA 5DNDA 1A2BA 3KOMA 1XTKA 4PFJA 4CMAA 4PFKA 5JSZA 3ERCA 2AJ8A 2C82A 3LQYA 3TGLA 1F20A 3EHEA 4AX8A 4DCNA 4MUBA 1RQGA 4PO3X 1T5IA 5D3QA 3PDCA 1OQAA 1Y80A 3T5BA 2RI1A 2D5IA 4U39A 1MV5A 4OOFA 4PM4A 4BMVA 1UWCA 4B3FX 5AW7A 3VC2A 3A1UA 1J2RA 1ZWKA 9LDTA 5P8WA 2PUAA 2V9CA 2QXYA 4M54A 2WFAA 5DULA 4E08A 5DTQA 1FFAA 4EHNA 1PTJC 4US1R 1FS6A 2K7ZA 4XXHA 1SCDA 3IT0A 4CKZA 3PC7A 2Q5OA 5EJ2A 1OASA 2WB4A 1JDNA 4TKVB 1SU4A 1KI9A 1CNFA 4DBLC 3T7RA 4I5IA 1V96A 3TEJA 3C39A 3C3MA 3HJBA 1RADA 3LOQA 3A6EA 1P39A 1TIPA 4UHKA 4KWIA 3T4UA 5EGSA 1KVUA 3ET4A 3M4NA 1IG0A 1RXEA 1NR7A 4J16A 1B3RA 3T0FA 4CLXA 1WR8A 4IM7A 1DC7A 3MTDA 5CNIA 3F5DA 2ZIVB 2QN6A 1QE0A 3B51X 3BTOA 4UTNA 5SY6A 3VGJA 3WBFA 1HK7A 1VBFA 4I08A 4HMOA 3QNUA 5BUZA 5M29A 1DXHA 5TGDA 2XA9A 1XTVA 1NVGA 5IASA 1KR2A 3U3KA