4BVEA

Crystal structure of human sirt3 in complex with thioalkylimidate formed from thio-acetyl-lysine acs2-peptide
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
274
structure length
274
Chain Sequence
GKLSLQDVAELIRARACQRVVVMVGAGISTPSGIPDFRSPGSGLYSNLQQYDLPYPEAIFELPFFFHNPKPFFTLAKELYPGNYKPNVTHYFLRLLHDKGLLLRLYTQNIDGLERVSGIPASKLVEAHGTFASATCTVCQRPFPGEDIRADVMADRVPRCPVCTGVVKPDIVFFGEPLPQRFLLHVVDFPMADLLLILGTSLEVEPFASLTEAVRSSVPRLLINRDLVGPLAWHPRSRDVAQLGDVVHGVESLVELLGWTEEMRDLVQRETGKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Ex-527 Inhibits Sirtuins by Exploiting Their Unique Nad+-Dependent Deacetylation Mechanism
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/ligase
molecule keywords NAD-DEPENDENT PROTEIN DEACETYLASE SIRTUIN-3, MITOCHONDRIAL
total genus 91
structure length 274
sequence length 274
ec nomenclature
pdb deposition date 2013-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02146 SIR2 Sir2 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1600.10 Alpha Beta 2-Layer Sandwich SIR2/SIRT2 'Small Domain' SIR2/SIRT2 'Small Domain' 4bveA02
3.40.50.1220 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold TPP-binding domain 4bveA01
4BUZA 4GP9A 4ZZIA 1HZZC 3LQ1A 4BV2A 4BV3A 3CLTD 2OD2A 1OVMA 4K9NA 2H4JA 4V1CI 1S5PA 4V1CA 4R8MA 3D81A 2H59A 5FYQA 4MPRA 2OD7A 3ZGVA 4JUCA 5D7NA 1ICIA 2H2HA 3GLRA 1M2HA 4RMJA 1DJLA 4Y6LA 1MCZA 1T9AA 2A1TR 2WVAA 3EYAA 2FWNA 3FSJX 1PNOA 4K9KA 2VBFA 4BVFA 2UZ1B 5DGDA 1J8FA 1UPCA 3EY9A 4GG1A 4JU8A 4L2IA 3OE1A 4UTRA 4K9QA 4UTZA 2VBGA 3CF4G 3IAEA 1YI0A 1PO7A 4JUBA 1Y9DA 3K35A 3JR3A 2H2GA 2VBIA 4K9PA 5K6RA 1POXA 1MA3A 4JT9A 4RMIA 4FEGA 2QQFA 1EFVA 1V5EA 2A1UA 2OORC 1M2NA 4UTVA 2W93A 1EFPA 3IAFA 3F6EX 5EJMA 4F4UA 1UPBA 1NM5C 4D5GA 1E3TA 2Q27A 2JIBA 5IMSA 2V3WA 5BWOA 3HWWA 4UUBA 4O8ZA 2Q5OA 4Y6OA 2Q28A 1POWA 1U2GC 5AHKA 3ZG6A 1M2GA 4QQ8A 5DGTA 3FZNA 4X3PA 4HD8A 1JSCA 1YHZA 5BWNA 2OO5C 2PGOA 2VK1A 5MFPA 1YNOA 2H2IA 2EZ9A 3GLSA 4BVEA 3U3DA 1T9DA 4QELA 1YHYA 2DJIA 4GM0A 4JUFA 1PT9A 4JSRA 2Q5JA 2IHUA 2X7JA 3E9YA 2BRUC 1M2KA 3PDHA 1T9BA 5FEMA 4BVGA 1YC2A 2WVGA 5K6TA 1Q17A 2VK4A 2FRDC 2JI9A 2IHTA 4K9OA 4UU7A 4IF6A 4TWIA 4X3OA 2EZUA 2IHVA 4IG9A 4K9MA 5EJAA 3JWPA 3CLUD 4COKA 4RJIA 1U2DC 4JD5A 2EZ8A 5DEIA 3CLRD 4L3OA 4G1CA 3D7KA 4ZP1A 4QPZA 5K2OA 1YI1A 5EJ4A 1YTLA 4TWJA 4BN4A 1PTJC 2Q5LA 3EA4A 4UTNA 2WVHA 4J16C 2B4YA 4RJJA 1U28C 4KPUA 2JI7A 4HDAA 1PI3A 4KGDA 1SZCA 4MPPA 4RMHA 1QPBA 5MFZA 4Y6QA 3CLSD 3PKJA 1O96B 3RIYA 4BN5A 1Z8NA 1BFDA 4UUAA 4K9LA 2FR8C 1Q1AA 1PYDA 2AG0A 2JI6A 5EJ7A 2OD9A 3PKIA 1XLTC 4J1TC 1D4OA 1U31A 2NXWA 5K3SA 1PNQA 4I5IA 4IAOA 5MF6A 4MPJA 4C78A 4BVBA 4FZ3A 2JLAA 4UTXA 3GLUA 1V5FA 5EJ5A 4JU9A 1O97D 2FN3A 1OZFA 2AG1A 3F6BX 2Q29A 4GM4A 4JT8A 1YC5A 3FLMA 2C31A 3D4BA 5EJ6A 4MZXA 2EZ4A 2Q5QA 1M2JA 4GM1A 4UU8A 1PVDA 1UPAA 4C7BA 2UZ1A 4FVTA 1SZDA 1ZPDA 1Q14A 2VJYA 2EZTA 1V5GA 2H2FA 2JLCA 3ZGOA 4D5EA 4RJKA 2QQGA 1T9CA 1OZGA 3HWX1 3GLTA 4JUAA 4FEEA 4JUDX 4MQ5A 4BVHA 5EJ9A 4KXQA 2JI8A 5EJ8A 2HJHA 5MGNA 2PANA 4GPEA 2PGNA 2H4HA 1Q6ZA 1YBHA 1S7GA 2H4FA 2H2DA 2FSVC 5BWLA 1N0HA 1OZHA 4Q9DA 3RIGA 2VK8A 4V1CB 4RMGA 2NYRA 4F56A 3U31A
chains in the Genus database with same CATH superfamily
3C6KA 4IWXA 2PRIA 3JARA 1QNLA 4XCVA 1RMTA 3FTDA 4WXRA 1L7VC 4UHBA 1ARZA 2VOEA 2P2DA 2NUBA 4L5AA 3CWCA 1W4CA 4Y1RA 3MUOA 1EVIA 3GCWA 1ONBA 1TQDA 2RJNA 3EPPA 2E4YA 4CG1A 2ZI9A 4WK2B 1RABA 3QYAA 3BQNB 1J6UA 4MWCA 2OV1A 4NY1A 2UZ1B 5I7VA 2VYND 4F12A 1V7PC 4RXUA 3SQOA 4FE7A 4KK4A 1EJ6A 3M4YA 4RDIA 5U1PA 3ADOA 1DCMA 3AYXB 3EDOA 3NNNA 1BE0A 4JGIA 4ETIA 5KREA 1U80A 1N2ZA 1TZJA 1T6BY 3EDRA 1OA1A 4KIFA 4P81A 3OE7D 5T5QA 1RQPA 4LQCA 5EUCA 1XZEA 5ICEA 1XU7A 4QPPA 1NM5A 2B3DA 3IOMA 4RLHA 1PDWA 2A78A 4Q66C 5E4FA 1RLJA 3GNQA 3G7NA 3AVYA 5F76A 2IXDA 3GP5A 1IN8A 1BHJA 1XMIA 3B1FA 3R6LA 2YJGA 1DRVA 4HYQA 4PLTA 3Q7IA 3GCDA 2ZVJA 2FA9A 4DEVA 3ZV7A 2I3BA 3T7CA 2DUUA 1OXBB 1RVDA 4GOOD 2GBCA 3U3KA 4KQEA 2YMLA 1WX1A 3NFRA 1D4AA 1PZEA 1VIAA 2AFHE 3QU4A 4L9RA 3MWEB 5HBGA 1KDPA 3ABZA 3WK8A 3VMFA 4PE5B 4RKWA 1XCJA 2DH5A 4XFKA 1GNLA 4COKA 3DKRA 2ID7A 4H7PA 2OCXA 1YQDA 2WSYB 4PCLA 5CH3A 2BE7A 3DHYA 1Q77A 4BO2A 4HWSA 3T38A 2LKDA 4BASA 3HPRA 4CM9A 4G4SP 1G8JA 4MDEA 1JR6A 1U99A 2IITA 2MYUA 3K6SA 2FZGA 1S3FA 2JHGA 4KACA 4BBJA 5CFZA 3NM5A 4YACA 2Q45A 5FH9A 2BEKA 1KI1A 2F8MA 2HRZA 1UBSB 1NQVA 1DT5A 3HKCB 4F9EA 2VJDA 1JVNA 3AHIA 3TMKA 2Q7OE 2BCEA 1RXYA 1NUSA 2C29D 1U5BB 4L6AA 4Q4AB 3SQMA 4PBRA 2WUEA 5GONA 4B6SA 4M7OA 1R7RA 4CDMA 5IP5A 3UUGA 3WSVA 4KBYA 1GQFA 1MENA 4H0CA 5C7YA 1P5FA 2AXQA 3AI1A 3ZE7A 1UMKA 4RV4A 2BM8A 1T1GA 4E5MA 4PG6A 4XEUA 1CRLA 1SOWA 4AUMA 3E2PA 2POCA 4HXGA 4DANA 4MVJM 2XPCA 3T7JA 2PR2A 1BVUA 1CVRA 2Q5QA 2BJHA 5EJEA 3OESA 1X0VA 5IKPA 3CG4A 1UKAA 2XBUA 3K6KA 3S1SA 1HDRA 3RQSA 4GL2A 4DIKA 4MB6A 4WGFA 2JLXA 1J8MF 5IF3A 3HLKA 4MIKA 5I3ZA 2VCEA 4J0HA 4CQNA 3IS3A 3ROKA 1Q50A 1P33A 1RQLA 2CVQA 2JLBA 2RJ3A 1V39A 1BJKA 2OB1A 3GQBA 1JWBB 4D9HA 4OP3A 3GWZA 1FVXA 4RA9B 2XWJI 4G9EA 1TE2A 1SXIA 1DV2A 1A1SA 2AF4C 4OB7A 5JRZA 4X66B 1U63A 1GPWB 2JI4A 3H5VA 5KS2A 1MFPA 1YOVB 1YQWA 1JG1A 2O1EA 3H2SA 4MWZA 4BUZA 1Y34E 1L5FA 1F9EA 3DD5A 3EEIA 4FR2A 4KV9A 2M2IA 4RYLA 5EE5B 4L57A 5L45A 1I7QB 3GJYA 1AHHA 3HI4A 4F6CA 2UXDB 4CIAA 1YZNA 2WVJA 1PGPA 2QTCA 3PQEA 1OIVA 4L8VA 4LZWA 2Z1MA 3J81A 5C1IA 5FV7A 1EWVA 3F4LA 3NRJA 1GQRA 4JGBA 5BR4A 1OLXB 1FDIA 1JA0A 1ZGGA 4BFTA 1TK2A 1W73A 5TMEA 2GPAA 2VRBA 3C1AA 4F85A 1WOYA 1YJQA 4DV0B 3THRA 5E2AA 1X1EA 2YXPX 1KZ7B 2ECQA 2XCRB 2QTNA 3OE7A 5G3YA 5CW1A 4FMDB 4QUIA 4HT3B 3FFXA 5JQGA 4UW9A 1QP0A 3VR6A 2P8SA 4DLWA 1V5EA 2R4TA 2JVJA 1WF3A 3WSTA 2KWIA 4PLFA 3T54A 2FPOA 1J24A 3OA2A 3NAMA 2I3AA 1Z56C 2XI4A 1TD9A 2J9ZB 4CKCB 4QL3A 1RW4A 4OB8A 1BN7A 3I53A 3PFWO 3M9LA 2N1BA 1G1MA 4R05A 2I7VA 1D1QA 3NXSA 3TD2A 5JDCA 3WIDA 4PTZA 3MWEA 4FU0A 1EM8B 5G0WA 2M1XA 3QFSA 3DTNA 3TZLA 4E09A 2R8YA 1R88A 3UMYA 1DQYA 5ICMA 1YO6A 5A4JA 2BEVB 2C2KA 3PVSA 2VCHA 1OILA 1UT5A 5BQ3A 1H8EA 2B99A 1WV1A 2YVAA 4K9SA 2GK3A 5IC6A 3D3EA 2BDTA 2DQKA 1PJSA 2NSDA 1G0NA 2Z2IA 2ZI4A 3ZI7A 3RADC 3ZZ0A 1DS6A 4H0NA 2OXCA 2YC4C 2HO5A 3TAXA 2VDUE 5BSVA 3WA7A 5KNCH 1DJPA 4H4DA 4QQKA 1SBIA 4M87A 3F7NA 1OR8A 3STTA 4PFSA 2J9YB 5FBQB 1BFDA 1DAOA 2YIVX 4KO8A 3EAGA 3HZRA 4F5YA 2D5IA 2I4TA 5TB5A 1T13A 1VKHA 3B2QA 1JEQA 1NVAA 3GJRA 2QZ9A 3T3MB 1XNGA 2EL7A 3QU5A 4E51A 5JQWA 2QX7A 4YUXA 1EIWA 2P5SA 3H4TA 2JLWA 2R96A 1XFAA 4H35A 2R5WA 4FD3A 2E48A 3B1VA 3Q9NA 4C0HA 1TQHA 3H1GA 4RCYA 3ETCA 3FZQA 3QMMA 4DUGA 1ONOA 4I55A 1WHSB 4O1HA 3EODA 2IHBA 3HYRA 3ROQA 1FDOA 4ZU1X 3DDSA 5CA1F 3TOCA 3CX3A 3S2GA 1GFWA 2EARA 5EHGA 3H11A 4C6RA 4RA9A 3QU9A 3ZDQA 2ZKIA 1S6YA 4ZHQB 4NOMA 5CDUA 2F9LA 2JI8A 3SSOA 3QY0A 4AZ0A 4HDSB 2PXCA 4FLFA 1XQWA 4NZMA 4NG5A 1PL7A 2YIJA 4PRZA 2AN4A 4R1MA 1ZONA 4XX1A 3RI3A 5BYAA 1JFRA 4EZEA 1Z29A 1U5AA 1HORA 1E9CA 3I04M 1W4ZA 3UBMA 4I50F 4PYOA 1JILA 1TQ4A 2HFJA 5AJUA 1N78A 2HXGA 4D56A 5HQ3A 1RHMA 2QMQA 2ZJ4A 3PUIA 2FK7A 3B5EA 3O31A 5F12A 2ZI6A 5G2OA 5KVAA 1C9EA 1G60A 1NX6A 1NBME 1R0CA 2E5WA 2G07A 2YIDA 3EG9A 3IJRA 3P2IA 2IOQA 4RKFA 3UT5B 4V3BA 3UT0A 4P83A 5HMMA 3GLRA 3WQBA 3KPWA 3EZ9A 5DGDA 1KJWA 1WLSA 3T41A 3THWA 2EJWA 4AXBA 3PI6A 1ZXLA 4Q4AA 1NL3A 2JVKA 2WU1A 2XA1A 1ZI9A 3AOGA 1XDUA 3IV6A 2WP0A 2IV7A 1UKEA 2VZLA 4TTSA 4K0RA 3MTDA 3UA3A 4BQIA 3ELBA 5K20A 4KDRA 3BA1A 2EWMA 1FP4A 2BFEB 4LCBA 3IMEA 4YJFA 3UC9A 1YUBA 3CSSA 5A2QA 2RDMA 3L5OA 3BXHA 2QNRA 4D3XA 5F98A 1PFYA 1TQ8A 3KSAC 1CUXA 3ZEAA 2JJMA 2DLDA 3HJBA 1J09A 1EFRD 1CE8B 1DBWA 4HQRA 1NTRA 4EG5A 1DAFA 1RWXA 1VG8A 4BRWA 2VUHB 1P2UA 2WTEA 3JW8A 3OZAA 4L4UA 3QKTA 4YAGA 5FFMA 2XCSB 1IIBA 2XWQA 2YOHA 2HA3A 4E32A 4X62B 4YJDA 4CCSA 1Z4OA 2DJIA 2Y1OA 2F2TA 1BEUB 5IC4A 2GHIA 4DABA 1EGMB 2YHSA 1GCIA 3L7LA 5JFTA 1EFKA 3EXG1 1QG6A 1MORA 3H6GA 2O19A 3VZQA 1U8AA 1YZHA 3CG0A 3KD2A 1EK0A 3NCTA 5HE9A 5K3CA 1MVNA 2GO1A 3QI2A 1I36A 4F38A 1Y7HA 3F90A 1QTNA 3H5OA 4NU8X 3QKUA 1M2FA 4PNPA 4FKZA 2QIPA 2AZMA 3CZPA 5F5LA 2FQXA 1A88A 4ZT6A 3VAAA 5B4TA 1ZJYA 3HYLA 4HRVA 1NV8A 4MWDA 2RG1A 2HPZA 4Y6SA 1PJ3A 2LDXA 1KFEB 7MDHA 4EY7A 4JLDA 3AX6A 2A88A 4F7DA 2QWXA 3CLSD 1ID8A 1K7SN 1ZSVA 3DZJA 1K2VN 1TQ6A 1V7QA 4YXWA 2IUEA 2VUSA 1N6PA 1UOEA 1ZJ5A 3NEAA 1IPEA 3P0RA 4DMUB 1TM7E 3TKYA 3ANSA 5HILA 4DS3A 1UZUA 1D4FA 3TINA 4DJAA 5AW3A 2ZBPA 1WR8A 1JVSA 4RH3A 1B00A 4XX0B 1W88A 5DMXA 2IYPA 4H7IA 4NONA 4PLYA 4I5IA 5KSPA 3H65A 5A0VA 3O5AA 2RGUA 5B1YA 3TNYA 1UQTA 3GZ4A 2UYGA 5MN5A 2D0IA 2H1SA 3D1JA 3HVRA 2PZ8A 3FCAA 1D03A 5TLSA 2VZEA 2RD2A 3HGMA 1E9SA 4WFKA 2AA3A 5D51S 2RBKA 4MEJA 1PVDA 2YV1A 2JLZA 5DULA 2QN8A 2IUYA 1QHXA 2ZT8A 2YHIB 4FTWA 4UUNA 4DQ0A 2ODWA 1JLHA 2CCJA 1XEWY 2O06A 2R6AA 2WZBA 2XAAA 3FCYA 3FLAA 3H9UA 4Z5XA 2BZ0A 3EZ7A 3L92A 2K5UA 4PCVA 3ZWWA 2Q3HA 1VGVA 3UCEA 2XGGA 1MO3A 1X19A 3B36A 3VAYA 1NBMD 5DGXA 4CLHA 2WG2A 2CYAA 1Y9AA 3JRXA 4HDCA 4DV3B 4MQUA 4OMCA 1M1YA 2E4VA 2J3EA 3U7IA 2X14A 3JU3A 4RGVA 1BCSA 5HUHA 3O74A 2ZZKA 1JBKA 2OD2A 4RZIA 3KAKA 3RBVA 5JSKA 5AOCA 3MTGA 5C8ZA 5BVGB 4RD2A 1Z6TA 1RHKA 3FYUA 3BA6A 1XJWA 1I94B 4NDNE 1ZUWA 1N0IA 1U81A 1VE3A 3KJNA 1OT5A 4TRRA 3GUVA 4XIFA 3B1KA 3FLBA 1KRWA 5DCUA 3ZWPA 4R2XA 1IEXA 4BX3A 3MB8A 3HRIA 4CV3A 1FBTA 1JHDA 4IS2A 3S8MA 5JPDA 4DUZB 4KNWA 3DE6X 3QX9A 2E3JA 4EARA 1YS7A 5D01A 1YNSA 2VLIA 4HS9A 4ND7A 3QVJA 3UV7A 1D5CA 3BRWA 3L3BA 1LFAA 2OORC 3SBOA 3RRJA 1C1XB 4QGBA 2XXAA 1B8NA 4PXAA 1Y80A 1PEYA 2VJKA 4MAFA 3CN7A 4H6XA 1CR1A 1XZAA 1Z74A 4DAOA 2XD9A 1IRIA 3JWJA 3R0ZA 3WGKA 5B6PA 1Q91A 4NJOA 2ESRA 3M1YA 1XAJA 1P0IA 1UJCA 3AEZA 1U98A 3UJHA 1QG4A 3Q3GE 4PNHA 3L0OA 3E03A 1GIAA 4QO7A 5BSWA 3R6TA 1OVGA 1RBYA 2CJFA 5E1DA 4UQOA 3UJNA 2VJMA 4YPOA 1NQOA 1TAQA 1U7HA 2YIMA 3KAQA 2PLAA 3KUKA 3EUWA 1KI6A 3LQQA 1XZIA 2ZJ5A 3JQBA 1BFUA 5FHRA 1EXMA 1IZYA 1XTQA 3CCFA 2G25A 3ETJA 4OQQA 4C30A 1NJSA 1E8NA 1UF9A 1PUIA 2IHTA 2IUFA 1C3VA 1ZC4A 4NTZA 4EB3A 3R0XA 4R8VA 2X2OA 5TARA 4TTJA 3U4GA 5KQRA 1KIMA 2JIQA 2VPYA 4I4TF 1N8SA 4KFSA 3Q85A 3V1YA 3ZH2A 3NHJA 1JU3A 4JNCA 5CFMA 3INTA 4CLOA 4O63O 1ZH0A 2JEYA 3C16C 3DLIA 4O4HF 3IKTA 3OLQA 1AB6A 2FPWA 2UDPA 5G0TA 3F73A 1DZIA 4XYEA 4G36A 3HB7A 2GBPA 3SSAA 4ZCRA 4LZAA 2XNSA 4YMGA 2W6QA 4MKGA 5CBKA 3L0YA 3FYUC 1Y42X 5CCEA 2CUNA 5CB4A 3TTSA 3MS2A 4NABA 4ZVUA 4ZRDA 3BD8A 3RABA 4FCCA 1A8HA 2I9PA 4M0KA 3ZNQA 2GBLA 4DMLA 2OG2A 1ODFA 3M6WA 4WK6A 3ZHOA 5AJYA 3HCEA 2JDID 1PJTA 3V8MA 2C4HA 1CP3A 2NG1A 5E8RA 3VZPA 2FN3A 4CM3A 2OHFA 4LF4B 3F98A 4CMHA 5BMVA 1K5HA 2PG3A 2OCAA 3G02A 4X24A 1VCIA 2HA4A 1FDTA 4IHAA 4UPDA 5JYDA 4H7HA 1YDMA 3FNRA 2B94A 5GINE 1WW8A 1AU9A 2I99A 3WB2A 3N7UA 4ZEWA 1OZ0A 3RVLA 3KNZA 3DPIA 4JC0A 1H4TA 1U1DA 3KFXA 5BRAA 4M36A 1CB0A 4C4YA 4WNAA 2PAAA 3WLFA 5HRUA 5AKXA 2XA9A 3OJCA 1Y3BE 1BROA 3ZKAA 1AHIA 1LV8A 1E5TA 1Q11A 1NXVA 1YI8A 1IK4A 1KXJA 1M1YB 3B8HA 4EHJA 4MYUA 5I5GA 1I2MA 1A97A 1F2DA 1FRFS 1TUBA 2XYHA 3H11B 3QVKA 5JLAA 2CZQA 4LSMA 4BLRA 1TAUA 1L5RA 3TF5A 1F1JA 4RMGA 3E22A 3EEYA 3U26A 3AR7A 2X5NA 4LOKA 3DLBA 1YS4A 3QA3E 4UHEA 3QOYA 3K0AA 1IUOA 5FBVB 2FW9A 2DHDA 3THWB 5CIQA 3DBLB 3M4ZA 3DTVB 2ZS9A 2EHJA 5C32A 1DRWA 3KJQA 4O2BB 1SK9A 4M22A 1V41E 1EVKA 1MB4A 4OAQA 4MAAA 4L16A 3X1XA 1G38A 3K8ZA 1NHGA 3HU2A 3KXPA 4J1TA 4F8JA 4CV0A 1PLJA 4BNDB 4CZ2A 3OAAA 5J2UB 3WGUA 3TNFA 1T2DA 4DIEA 4EUFA 2XNJA 1JLKA 2VHUA 3L1UA 4H1HA 1QIKA 5J5CA 2G5TA 1Z3CA 4BFUA 2P5UA 5LLDA 2Y1WA 3I0ZA 1GPYA 4IILA 1ZD9A 1EDEA 3ZHBA 3W2HA 5CBPB 1GAEO 1E9DA 2V65A 2VPWA 3TR6A 1RYMA 3D6VA 1YWGO 4Q1VA 1HFJA 1NUQA 4FYYA 1Z39A 4CKZA 1KI6B 3FPKA 1RWVA 2QRLA 2BKVA 3T4XA 1EX6A 3WL3A 1MKYA 1V16B 1YS2X 3KKOA 4DCUA 4DDMA 4URXR 4YJ3F 1E5VA 2X7JA 1CE8A 1WDKA 1NYLA 3PKZA 4NF2A 3BZBA 3V1LA 2GEDA 2JLUA 3ENNA 3F49S 3RUEA 3QWIA 5BR7A 3DDZX 3B6EA 4DSTA 3GW8A 1JIKA 4IGIA 4MITA 4Z54A 1ECGA 5JMOA 1PEKE 1Q7EA 3BWCA 1M0EA 1KOJA 1BOFA 1OLUB 4JKYA 1OI3A 5LXTF 3YASA 3P2YA 5GWXA 4B7CA 1KFKB 1CQIA 2D5LA 4TYPA 4ZAZA 3NQ41 2R62A 3G23A 2V0CA 2C7VA 5FULA 5HFJA 4BMZA 1JEOA 3QG1A 3DOHA 1XHFA 1SCAA 4L73A 1OBVA 1H0RA 1XYYA 3IIJA 5BQXA 4M55A 3C0KA 1KAQA 1UJBA 4QDKA 4PS1A 2X8BA 1K92A 4G5RA 4POAA 3IVRA 4B47A 3IB6A 1NOIA 2BEJA 2OHIA 4ZWNA 3SLRA 2OP1A 4F2GA 2Z09A 3R4CA 2HV8A 2JHAA 2XRFA 5HOQA 3INNA 4KLZA 1Z4QA 2QPAA 4W6ZA 3GA5A 3I2KA 3FYHA 4CV2A 4AZVA 3ZCTA 1B0ZA 4C78A 2F1RA 1J07A 2GEFA 5H70A 4A36A 4L85A 3ZW9A 3ZNPA 2W2OA 1GTZA 5KEIA 3FKJA 3WLEA 3ZDYB 3QVVA 3RDPA 1IN7A 4JT8A 3CX7A 5AVUA 4YCCA 4OUDB 1GZDA 1OUMA 2C31A 4HDMB 4HGOA 4QICA 5SY6A 4DQXA 4EHFA 4ER0A 1ZIPA 4IGFA 5BUSA 2QTWB 1J2EA 2GAIA 1I3CA 1SUBA 4D97A 2CHVA 3D59A 1MRNA 1ZHHA 2NU7A 3L8FA 2HRDA 1CRQA 1FNBA 1NATA 3NBAA 2C7PA 4C88A 4Q37A 1M5RA 3OD5A 2XIJA 2P3SA 1QTIA 4DSOA 1TKAA 2HD4A 3O1IC 1A76A 3F5QA 3PJFA 2A30A 1X9GA 3K7EA 4HUQA 4NZZA 5L4NA 1BH2A 3R44A 3K2IA 5C0OE 2Z1NA 2F67A 4ZVQA 3L7OA 3LT1A 2Y0BA 3LX5A 5KYVA 5C5CA 2CYCA 4G8JA 1XF1A 4N47A 3OEHA 3SD7A 1SELA 5GVSA 3OZDA 4PSDA 4M99A 1KARA 3FPEA 5BWBA 4K9NA 4H1UA 4IV0A 1ZWLA 4K1XA 1V9LA 2XTMA 1NAIA 1LDYA 2C8KA 3WMRA 2OFWA 2JFHA 5KYWA 2JD2A 3NOVA 1G2QA 2JATA 4FC7A 2X1HA 1XC7A 3PFHA 1GZUA 2V7WA 4EHKA 2HADA 1NI5A 1YDFA 3EYAA 4GI3A 4BNYA 1VI2A 1XTIA 1ZGAA 4J9UE 3RSFA 2GA9A 3AHFA 2MWMA 4HWKA 1I5EA 3AINA 3O8OA 4XCQA 3TCKA 2A9KA 4MK4A 2JGNA 4KMSA 3K35A 3TW6A 4YV7A 1GVNB 1O1YA 4D98A 5B6JA 2HRRA 3IR5A 2HIGA 3BH7A 4U2EA 1O94A 3FVTA 1KPGA 1LZLA 1QHYA 2JKZA 1KQFA 3H86A 3LW8A 3EPLA 3I1FA 5CJPA 4I1YA 4OY3A 1T5SA 4LGCA 3LCCA 4EW1A 3SEFA 1V6AA 3B3QA 2KBFA 4L72A 3G0BA 4EA7A 4FHGA 1XDDA 4XB2A 4TZ0A 2CXOA 2E18A 2XCQA 1Q2XA 4ZOCA 4D0GA 2BFCB 1TZCA 3O8NA 4KR6A 4JLPA 3UXEA 1PG2A 2WSBA 4G8DA 5AM3A 4YBRA 1OAAA 2YQ5A 1XAHA 5LP6A 5MDHA 2QI9F 2ZBUA 3EZFA 5KSYA 1SHTX 1ZI6A 1NSFA 2FRDC 3KPJA 1O95A 1RYBA 1JDJA 4HRYA 4MINA 5JAHA 3AV0B 1A8IA 3W79A 5LJIA 3W2GA 4LXIA 2BMDA 2VH1A 4M49A 3TTVA 2ZOSA 4RU1A 4UMVA 4EB6B 4H0FA 3ZY6A 1YI1A 3DF7A 1JKJA 2GPBA 3PBKA 4OQFA 4EJ0A 1U0SY 3RS4A 1T9ZA 1U28C 2ZT6A 3F9IA 3PC6A 4D8UA 1UBGA 1JHRA 4ISBA 2X5KO 5J40A 2NUAB 3ZVRA 1U9JA 1PJ8A 3ASVA 1YFZA 3ZGYA 1M8JA 2PJRA 5DM0A 3RIYA 2Q2OA 2D2XA 5AK4A 1HQCA 3KQOA 4EUKA 1NU6A 2ZWMA 1RJ9A 1MAHA 1YAHA 2ZS8A 1R5BA 2CLIB 4RHXA 1QP8A 2OYCA 3SE7A 4BKPA 3AR5A 4R3WA 4A9AA 3PTLA 1J1UA 1Z8HA 3FDXA 3J80A 5DI9A 5KTSA 4B87A 1QR2A 4XRRA 4YR7A 5AVZA 2W6PA 3EVTA 4JXXA 3EVZA 5LMNB 3N7TA 1XMQB 1IZ8A 2G08A 2YS7A 2AHOA 2FWBA 1L4GA 3Q0IA 4JT4A 3CEMA 4PO9A 2YYAA 4R84A 5JMPA 1SQSA 2ZUDA 2SNIE 5J4VA 3V97A 2J5KA 1FNCA 2PL5A 1Q14A 1IXZA 5D5PA 3ZU3A 1A9ZA 3FJOA 1Q0RA 4CM9D 1LSSA 4HCJA 3T12A 1RPAA 1KY5A 3FZEA 3KT8A 3QFHA 4HDNA 2WWWA 2FF5A 3EQ6A 4D45A 5IJAA 4E4TA 5CVTA 2XE8A 3RLFA 3K5HA 3KOYA 4G8BA 2ZE6A 4Z4CA 5IXJA 4F9GA 5KYGA 1C0KA 3IVXA 3HU3A 3NRCA 3OPYI 2FGJA 1AXEA 1DFGA 1S1CA 2O1WA 3JZMA 3G1TA 3PQ7A 4MVCA 3TI9A 2W42A 1VJDA 3G2LA 3LQRA 3QUQA 1C3OB 1N3LA 4ALLA 3PEYA 4RSMA 4QUBA 1JFFA 2H9AA 3DZGA 1CX9B 3WGHA 1J20A 3IUMA 6REQB 3EDCA 3JTMA 3F5FA 3MUFA 2WF5A 1L0BA 3CLRC 3ZWDA 3M1LA 4EPTA 2HIHA 5ES4B 1V8FA 5FNVA 2MIIA 1Q44A 3AR6A 4JUCA 2GTHA 2RARA 3COVA 5JI2E 3MCWA 3T5DA 3KOWA 3IODA 2CVFA 2Z9DA 2G8NA 4MW0A 1JLSA 5AICA 1FUIA 4TXMA 3MB5A 5I8WA 5I7HA 2BR3A 2VH5R 2XQJA 4F2DA 2ZJBA 5EKSA 3A4VA 1FJHA 1P3JA 2P69A 5JS7A 1L1EA 5ECDA 2OENG 1D2GA 2XCOA 2H2GA 1ZM7A 2IOFK 1E2MA 4Q1AA 1V1RB 3HUFA 3DOOA 3MXTA 2AVNA 2HRQA 2OC9A 2YHAA 3QELA 3WS7A 3WO1A 1L9XA 2KE5A 3HCDA 1VMEA 3Q11A 2G28A 3OZWA 1KETA 1NW3A 3O3NB 5K8TA 3B20A 3ZDAA 4YRCA 3WWCA 2Q41A 5DTQA 2NSJA 1X39A 3KUDA 4Q9AA 5MHTA 2QRHA 3WIOA 1WB4A 2VO1A 1ODIA 3IV7A 1MLDA 1FTGA 3OUZA 2CFRA 4MVJH 3BMQB 4OXXA 4X1IA 1OV6A 4BNTA 1L4YA 3MJVA 2B6HA 2CLDX 3JQGA 5L3QB 4FW9A 1PF7E 1EWKA 4HUQB 2XDWA 1AKTA 3KKMA 4DV2B 1QOPB 1Y3IA 1CDZA 1E2KA 1MU0A 2AXPA 4LRTB 4KAXA 5JMWA 2X22A 4KRGA 1NF9A 3W1WA 5H1YA 2PKWA 3BXOA 3HB1A 1HE8B 3LTEA 2IY8A 3MT0A 4BEWA 1GCAA 1X38A 3ID6C 3VO2A 2CHGA 3AM5A 2NACA 4ZT3A 1VRWA 1M8PA 3EA4A 3LP5A 5ALGA 4MW6A 3WGVA 5KUTA 3U16A 3ZJUA 2VQ6A 4Q4CA 1O6FA 5HX7A 3L1IA 3O4IA 2ISQA 2ZRBA 3LRTA 2YWRA 5IS2A 3PX2A 3L4EA 3R7FA 3U3MA 2Z2XA 1OGIA 3AF3A 2QTFA 1EUZA 2MSCB 4MJLA 3T0IA 3W3AH 4E1BA 5IYZB 4J03A 2AC7A 4F2HA 1UAGA 4JJ6A 3ZWBA 3FWHA 2O3TA 3H19A 3BMNB 4V0MA 2GUWA 5FUWA 4TUYF 1M2OB 3DDOA 3AEUA 1P3Y1 3PV0A 2YJZA 1YKSA 4OHFA 4PX2A 3UHJA 2KBEA 5J2TB 4B3TB 3BXXA 5DP1A 1MQSA 1Z75A 2J6IA 1L5NA 1ZXXA 3GCGA 2XZOA 1F17A 1D4ZA 1VKOA 3N2ZB 3FF1A 3O1HB 4GZ3A 4KRYA 3U3JA 1RZVA 4PG8A 2R3SA 5FLYA 2ADMA 1R4ZA 3CF4A 3IPXA 2AF3C 3O8QB 3STHA 1R4MB 4LF5B 4E4YA 3GU3A 1NVKA 4FDLA 4AAYA 4BWVA 4NBVA 5KTRA 3MFQA 2B8TA 4JMPA 2HF8A 4GPD1 4MW9A 5AW0A 1AM4D 3EDYA 3DCIA 4D82A 4GDFA 2XEDA 3BDAA 2WZDA 4B9EA 1X77A 1LK7A 4DBLE 4UCQA 1WBJB 5HIMA 2GEUA 2IVFA 4Z0PA 1ITZA 1ZN2A 2FPGA 3LJKA 3ZDCA 2DPYA 1V95A 3GJ0A 4M0UA 2OE2A 3RAPR 2GZ3A 2XMPA 2GAFA 1PFWA 3VR1A 3M5PA 3QLTA 2Q50A 4LVUA 3EZNA 2H48A 5HCIA 2HPAA 3T1VA 3WNDA 3K71B 2OAP1 1HDCA 3GDWA 3RKRA 2BGIA 3F5DA 3D7SA 1LI7A 2O23A 2QXYA 3PT9A 4BMNA 4UDYX 1NY6A 2CV2A 3A1VA 1AT1A 1Z7BA 1TJ3A 3AIOA 1FX0A 1GNRA 1WD5A 1P2GA 4BLOA 3W2EA 2NTYC 1NQXA 1QGZA 3P20A 1KU0A 1GTVA 1O54A 3RYCA 4G86A 2QAGB 4QJIA 5ERXA 2X0JA 1JW9B 4LCJA 4GI1A 1Y7PA 3CKMA 4LTNA 2VKTA 1NAHA 4A8TA 1F7UA 3NDJA 3RVJA 1C30B 1SBNE 2I66A 3MELA 1YV9A 2ZP1A 2PKRA 4N3GA 3VYTB 2YHBA 2FFJA 4P0QB 1JL3A 2P6PA 2QLNA 4FP9A 5TC4A 4XOIA 3O8DA 1CUZA 3F47A 2DWOA 1H69A 1MO5A 2UUAB 1VBKA 1KAGA 1H0HA 1T8PA 5DN6A 3LRXA 4KO3S 1KQOA 3CM0A 2NO4A 4ZO6A 4X1IB 3OQJA 4BPBA 1G20B 2OGZA 2AG5A 5HF9A 3LBAA 4D25A 4RM3A 2Z2YA 4NZ9A 3SZLA 1L7NA 4KQ9A 4YONB 3D4IA 3ZBUA 1G6Q1 3VC3A 1THGA 5THXA 1GM5A 2UAGA 5IDQA 2ZRPA 3GMTA 3PFFA 4L51A 4Q7EA 4FUQA 3E9QA 3SC3A 1N2CE 3K09C 3KQMA 3W7BA 3V2GA 1YS1X 1E9AA 4BGDA 1EUDB 4LDPA 3H2BA 2YKGA 3HRHA 4CM5A 1VCNA 1MO4A 4ER7A 4OYRA 4U7FA 3RC9A 1MF7A 2Q62A 1BVYF 2V55B 3GJTA 2I1LA 2YY5A 3RRYA 4YV1A 3FUUA 1LB1B 2DF8A 3IIEA 4HDAA 2QD5A 1UKYA 3NORA 1GEGA 3OPMA 1K4MA 3T9CA 3A6EA 3NEYA 4JP2A 2KX7A 4ZO9A 5DBEX 1LPNA 3LQFA 1E0JA 1GKUB 5HYVA 3PF8A 4N1AA 4F5DA 1Y4DE 4J49A 5C35A 4X6XA 4W9MC 1U5CA 1UBLS 2F3QA 3CNLA 3IPRA 4GI5A 4MV9A 3R8FA 1PYDA 3AK4A 2X0RA 3K94A 5H80A 2QRVB 2FFAA 4QDOA 4JLKA 2EP8A 4WFJA 1NG9A 1LF0A 3FD8A 4NU6A 3HKCA 5DXAA 4Z0NA 1E66A 4B6GA 2EYQA 2HJWA 1BSVA 3JWHA 2O5VA 2XDQB 1PGQA 1YVDA 5FR2A 1XZKA 3DXZA 3JAWB 5DW0A 1MJFA 4GMDA 2NU8A 5AI4A 2PYIA 3FMOB 1IK6A 2HY7A 3O2QB 4G0YA 3SJCA 1L5HA 3GVXA 2P9ZA 1LUAA 4GMKA 1Q1EA 3CZRA 3OAAD 5AI8A 2GK7A 2O7VA 4EENA 4XRGA 3LO8A 2O0MA 3LH5A 3TJMA 2H4ZA 2WTXA 5FUMA 1MAAA 1ZOPA 5GMOA 4B3HA 5GJBA 2CXRA 3G0CA 3EZLA 5NULA 3F67A 4F04A 3CUWA 2OUKA 3ILYA 3KKLA 3OKCA 4D2IA 4U8HA 5L3QA 1J0AA 1KOGA 1E4EA 2PGNA 3O90A 5AM1A 4O4JA 1COZA 3NHKA 1RLTA 2RGGA 1NLUA 2KS6A 5BNIA 1QYRA 4XWYA 4RUKA 2IODA 4AY5A 1YVRA 1RZRA 4ZOLB 2PUVA 1OVMA 1G3QA 2DQ4A 2PKCA 2QLFA 4JJ4A 4PXSA 3W6UA 3ZY3A 1X15A 3MS7A 3N87A 5LJLA 1SKMA 4W5HA 5HKKD 2B7BA 3JQRA 1T9KA 3EDQA 1CZLA 3D2LA 2HXSA 1OBOA 5HJEA 3RAEC 3RB8A 1WV0A 1DIOB 2JFVA 1ZAKA 4TS1A 3UMSA 3VI4B 4E22A 2BCGY 1I7SB 4YV0A 3W8DA 4BO1A 1F06A 3GJZA 4JFAA 4ARZA 3VNBA 2WTNA 3L0CA 3P0EA 3WLQA 4H9GA 1Y33E 4K86A 4TWAA 3TR5A 2HM7A 1JX6A 1JALA 4BLVA 3I28A 3BTVA 4YP7A 4BO6A 3K9GA 3LPMA 1TMYA 1E6LA 2GVDC 2J9FA 3VR6D 1I01A 5HP4A 1UFRA 3CVJA 2GZSA 5A4IS 1WDTA 1EGAA 4FJ2A 3S2ZA 4H3SA 1CUBA 1DTWB 1U0EA 1DEHA 2JAPA 3CUYA 3J7TA 4BNZA 2ZRAA 2GHRA 4NYIR 3H9BA 4WKCA 4CG0A 3UEOA 3I30X 1XLVA 5ADUS 3GZNA 1E0DA 1VBFA 3DDHA 4DR1B 8OHMA 2I6FA 3HDQA 4EAQA 1CR0A 1QE0A 3DAOA 1S2IA 2OM2A 3LKBA 4JFRA 4LJRA 3C2QA 2BVNA 2XCLA 4YJ3A 3TN7A 3H9JA 1PV1A 2G63A 2ZCVA 3CFYA 2ZRGA 1CNFA 5JXJA 5TPWA 4A2CA 3SP1A 1B2RA 5KB3A 2JFXA 3P9ZA 3S7TA 3T5AA 1A9SA 4D02A 1LH0A 5GADl 4M89A 4EHIA 1FJXA 4DCPA 5I3CA 3RYTC 3NHAA 2OVBA 1P0MA 4GVXA 3MJEA 4NE9A 3OLCX 2C4VA 5DFAA 1KKUA 4QFMA 5C7LO 3QTLA 3P7MA 1Z82A 5DASA 1CYEA 3DULA 2D0DA 4CL2A 4X1YA 3ZOKA 3ICEA 1ZSNA 3RYCB 1CIPA 4BNWA 4F93B 4LY3A 4G5GA 3I9MA 5E0KB 3K9FC 2EFDB 1AXRA 2GXSA 4N4AA 4YTEA 3OCUA 1D4OA 1EJBA 1T6NA 2AD5A 3HJTA 3P2MA 4UE3S 2WQ7A 3IUSA 2H08A 4B3GA 2V3VA 3IR6A 2EEZA 2KHZA 3BERA 3BFKA 1ACLA 4ADSG 1IXYA 1J2TA 4OX9B 6LDHA 1S02A 2X42A 4RESA 2YN4A 1ORVA 2F64A 1C9MA 5C4IA 5CA0F 1OBCA 1US8B 2GYUA 1EG7A 4J6FA 2P78A 3LDGA 3X1YA 2OC4A 4AUNA 3LU1A 4DJTA 4ZIRB 1KMHA 4TTPA 4JOSA 4NPAA 5DTMA 2NP7A 5FQOA 4RJKA 3QLUA 2W6ID 2FFHA 5EPUA 3AJEA 4F3NA 1J00A 4IDPA 3ZHTA 5ADVA 2FUG1 1IHDA 1QWOA 1KEVA 1XHEA 2O3UA 3CPSA 3L6OO 3MMPA 2MJLA 4MQMA 4MKIA 4U7WA 1TT5B 4J0KA 1FTYA 4V0SA 3TSAA 1FFBA 2ODEA 3M6XA 2IP1A 3KSMA 4QTXA 2GD2A 4KVZA 4LE0A 2AHRA 5DTRA 3DMYA 2X0NA 2BI8A 2SICE 5GTDA 1GV0A 2E55A 1TRHA 4M0FA 4MX8A 2AG6A 4A8JC 3A4MA 3F3MA 3BWEA 4FBGA 2CL5A 4G0MA 2Y1GA 1R3DA 3JWGA 1W47A 4QDTA 4WZBA 5H82A 3LWBA 4K2AA 4MLCA 4PAGA 3GYGA 4ZOAA 1G21A 5JNUA 4B79A 4TT3D 2BFAA 5HVNA 4B46A 2E89A 4MGIR 1T5HX 2E5FA 4TS4A 3DW1X 5IM4F 4GKKB 3SZGA 2A9OA 2VSYA 3MBOA 4D4HA 4DRXA 1Z33A 3GRUA 3BHMA 4PQFA 3RFCA 4HUTA 2W5UA 4UCWA 4M76B 3M8KA 4Y6RA 4JYMA 4C03A 4FFSA 1YACA 2GLTA 4JXJA 4GZLA 1WU7A 3I76A 4FEGA 4XGIA 1XKXA 2J9GA 4TTVA 3SC4A 3A2KA 2A3NA 3RBAA 4XKJA 4BMPB 5B4UA 3HFJA 3WMFA 1G2OA 2R8BA 1BHO1 3BGVA 4QAQA 4TKZA 3AZOA 3AVWA 2AJ8A 3R5FA 1OGJA 5G02A 1RJFA 1KBZA 4BMXA 1S89A 1BWPA 3JQDA 1NUAA 2Q1WA 4L75A 2AFVA 3ZJVA 1ODSA 2NO9A 4DHEA 2VJQA 4ZAXA 4FS3A 1PJQA 1QV9A 2B5VA 5I9LA 2DH6A 4LEIA 4YQYA 3U17A 1SG6A 3U9LA 3VZCA 3W6NA 2WZQA 4NOKA 4ZQHA 1Q22A 4HH3C 1QQ7A 2OHJA 3MNFA 4D3SA 3VR5H 5FORA 5EJFA 2HT1A 1QDUA 2WYVA 1YQXA 2Q5LA 1CS0A 1MIOA 1OFHA 5FFNA 5H7XA 1S01A 4D9BA 1CY8A 1CPYA 1JXQA 3EXIA 1IQ0A 1PG0A 3PC8A 4C29A 5A3QA 4JBXA 5CFNA 3IP3A 1VOTA 2RHDA 1SUSA 2BFDB 1W5FA 1X14A 3HABA 3I6MA 5ETJA 4CRWB 5L6MB 3S0JA 1MRZA 1T2EA 3HKEA 2E1RA 5G4KB 3UAXA 1PNVA 2IH2A 1X1BA 1YQGA 1YB2A 1P9RA 5CD1A 1DPGA 4D0RA 2QBYA 2ATEA 4TVKA 1ORWA 2X0DA 1RQRA 2X41A 3DMGA 4NV0A 2EFHB 4I14A 3EXFA 3HXMA 1XDGA 3BDIA 2OV2A 1C8KA 1C0EA 3I92A 1B41A 1NJ5A 2VYQA 3FN4A 4L7QA 5EMNA 1SQGA 5CXUA 2PH5A 3LT4A 5K3DA 2OCKA 2J6CA 2FMXA 2J9FB 1X94A 4L9SA 2PX8A 1UC9A 3KJFA 4S2UA 4NPHA 3OHMA 3KQNA 4UAGA 3RTAA 1F2TA 2EGHA 2WD8A 1V2GA 3T7RA 2K87A 4PN7A 4LJLA 4YP6A 2ZTMA 5IHPA 2FW0A 3E1GA 1RKBA 3PEUA 4NESA 2AFHA 1QE5A 1FUEA 4MQLA 2QQGA 4REOA 1R4NB 3IBYA 1KDOA 1MN6A 4IH9A 4JUDX 2JAQA 5CP8A 5ITZA 2K2WA 3V1UA 5KWSA 3A11A 4GE0A 4GX5A 4KREA 4HLQB 3M4JA 1GZ7A 4DA6A 1K7YA 2CF6A 4RA6B 2R68A 1GZ3A 3I2FA 4G6ZA 4ZCIA 4BZQA 2JBAB 1FYEA 1IYZA 3ONFA 3GQVA 1QRTA 4JELA 3EVAA 5J4HA 3E27A 3OFVA 3MCAA 4A0HA 4GR4A 4BCDA 3H8SA 4JL8A 3OICA 1NIJA 1OI7A 2HMWA 3GCZA 3PQ2A 2WUDA 4W5QA 3HCOA 1GRNA 1XVVA 1U9IC 4PZAA 3QUCA 4KQIA 5KQPA 1Q1BA 3EVBA 1PZGA 2J9XB 2RCYA 4JC8A 2HMSA 4QWWA 3L2OB 2QZSA 4M0EA 5BNFA 5JAQA 4UDOA 4UTRA 5DLEA 2YW2A 4DZTA 1TIBA 4MR8B 4PO8A 4UE6A 5HUQA 4Y1EA 3MC1A 3ITDA 3M81A 2O3QA 2RE8A 2XTZA 2H7XA 2QU8A 3F8WA 3UO8B 2FJUA 2AI2A 4NCHA 4B6JA 2NMVA 2VDMB 1RR6A 1RU3A 1MA0A 3G9UA 4U2CA 5DWVA 5AHKA 1U6KA 3FCOA 5KOHA 2AC2A 5KMGA 3UKJA 4YJGA 1U0GA 2H2IA 4URUR 4NCNA 3RTCA 4Z9BA 1HV8A 5A7FA 2MSKA 2ZSAA 4HNHA 3W34A 3FHCB 1EX7A 3F74A 2V7QA 5D6OA 3W2FA 1H5NA 5JCPA 1W88B 3ABRB 3LC2O 1IEQA 3DO8A 2QN2A 3D7NA 3CRRA 4PV7A 4CT0A 1I5OA 2PUHA 9ABPA 3E1KA 1FQJA 1Z0FA 4XD7A 3OZVA 4PSUA 2IYEA 3RUCA 4C5BA 1HSOA 4KR7A 5LBUA 1D2NA 1TO2E 4IIYA 1QIDA 4IS3A 1BTOA 4ZHQF 3L8DA 5PNTA 1NXPA 1R0SA 2PX5A 1YTLA 1IHOA 1RDFA 5LCXA 1R8QA 2BHNA 3OIYA 4JA0A 4IICA 4PU0A 2TRSB 1EXVA 1N36B 1IWBB 2A0FA 1N4AA 4U6NA 1XA3A 4O4HA 1JXMA 4N39A 2IW1A 3CJRA 2H2AA 1TMGE 2KLBA 1V37A 1KI8A 2QMZA 2XJ4A 2Z30A 3EGVA 3EXFB 2WNHA 3QPUA 4YMUA 3R09A 4AD8A 2JNWA 2FPKA 1KJYA 1Z22A 2VAVA 4PG7A 1TJPB 1VXRA 2QD1A 4Q3BA 4AU1A 4CQLA 2BPOA 2WY2D 1YFLA 3WBFA 4Q03A 2I33A 3HUEA 3DBHA 3AIKA 4C14A 2XQKA 3EA5A 1KH1A 4TXHA 1TVKA 2RFLA 3SQDA 1EA5A 2DJ5A 3KD3A 1AKQA 1SOVA 3KC2A 5EVCA 4CEJB 3PXAA 2WUVA 4I55F 4CBVA 4OOFA 2OOKA 4QO8A 4O2BF 3PPIA 4HDSA 3RAGA 1KP3A 1XKTA 5DP2A 3K0BA 3LPAA 2UVPA 2XOEA 1TIKA 4X64B 2QMOA 5FWYA 3N8KA 2I62A 2VDNB 1RAIA 4PPNA 2X4LA 2HLPA 4I5GA 2OK8A 1AKEA 1DNPA 3CB4A 3LO5A 3NONA 4V2UA 3SIWA 4Z2AA 5GAJA 1OU0A 4MV5A 4MI3A 4G0OA 6AT1A 1KGDA 2WG1A 1XELA 1S2OA 3R3ZA 5DM2A 1XZJA 1KMHB 5MN6A 1U7TA 1N3IA 1WRBA 2FJ0A 4DR2B 4UBIA 2QVYX 5CX1A 5CG1A 2ZTUA 3WWYA 3BGSA 5HTOA 2V58A 1NVXQ 4UAVA 2A0WA 3PICA 4ER6A 2CNWD 2IHNA 4BV3A 2PCLA 1CZNA 4IIEA 1RMQA 2GJ9A 2HDNB 3DTVD 1YZQA 3QEMA 1Q7CA 2CHUA 1L8QA 3MTJA 5FWDA 4U8GA 3WK7A 3ZQUA 4D9KA 3HB9A 1TUBB 2AOUB 1K97A 2LWIA 2YDYA 2PVPA 3ANXA 1JLLA 2JEZA 3CH7A 2QUBA 3IELA 4Q3LA 3AF2A 3G85A 3CX6A 4BN0A 2JGRA 5FHQA 1L7QA 3LVBA 3ED5A 4IZOA 3JQFC 2ZE8A 4ID9A 1ZUHA 2H00A 3AFIA 4IJQA 1FFHA 4JJGA 1PCXA 2D4HA 2C7GA 2J5BA 1FFXA 4H77A 1RS0A 4TQGA 3MJDA 3GJ4A 2LW7A 2GM5A 3EG5A 4TZKA 1DAIA 5HFAA 3G59A 4LE1A 4N0DA 4R41A 1KY4A 1J0XO 1T5BA 1Y8AA 2JFBA 3O4HA 3OM0A 4IDQA 4PWZA 1N75A 2ZWAA 2DLNA 1T2UA 4NAVA 4N8EA 4EUHA 2DOKA 3PJGA 3PFKA 3DJYA 1RWBA 5EP4A 4OXIA 3OTGA 1H6CA 1FIUA 1X7ZB 4GMFA 4R2LA 1SU6A 4X3PA 5CDSA 4JP1A 4QOJA 2Q9BA 4XAQA 2E9SA 3LXUX 4RULA 2C88A 4AL4A 5TS3A 3HVIA 4EY6A 2ZRHA 4RF5A 2ZAYA 2OFOA 4LECA 3DLTA 1XYGA 4C0WA 2GF2A 3INRA 1Z0JA 4V0OA 4YCAA 5FTNA 3DMDA 3G2QA 3HUTA 5A6SA 1MUUA 5ECWA 3RT9A 5CVEA 3IEIA 3IOCA 4F72A 1IG0A 1GAWA 1SHKA 4R1PA 4K8RB 4UBNA 3I5AA 1CC1S 2P9EA 4X54A 3TXYA 1I7DA 4BGIA 1YZYA 3ESRA 5CB0A 2WJZB 1MEEA 3UAGA 3Q88A 1Y5IA 1MOPA 2KW5A 1M9NA 2E4ZA 5G0VA 4Q05A 5FADA 4KXFB 1ZQ1A 2WU3A 1QP7A 1QPBA 3JZAA 1W0CA 1PTKA 1BDJA 1B6GA 1WVMA 4JT2A 5ALUA 3DP7A 4AYXA 4MUIA 5J5VA 1QIMA 1QVAA 1GFZA 1QMGA 3C4QA 1GRCA 3QMWA 4ZZ2A 4QFBA 1WCWA 1RM0A 5L8VA 3GRRA 1F4PA 3IMCA 2OHXA 1QHHB 1TPYA 2VPIA 3PKIA 4E15A 2C5LA 4M6WA 2ZSFA 4IY1A 1RCUA 1UT6A 1PZMA 1W87A 2PWYA 2RAUA 3C3YA 3F97A 4N5LA 1KDYA 3W5HA 4ZOLF 1UDBA 1W44A 4GZMA 3PQ8A 1VLHA 2W6ZA 4J0JA 3TRJA 2OEPA 3OJXA 4NYMQ 4FJ0A 1WDWB 2QPLA 4EFMA 1NXOA 3UN1A 4TV9B 4R4JA 1AZTA 4PZDA 4X20A 3DEYX 4FYKA 1OQAA 3HBMA 4D4GA 4YCNA 2XQGA 1KPIA 4LQ4A 2I7TA 1UODA 2YZ2A 4WY8A 5GVRA 4UHKA 1VL0A 5A7GA 3GLTA 1N9GB 1XEWX 2G6BA 5L3RA 3PFGA 1J9EA 1QLJA 2VBCA 4JDPA 2UZIR 2FE4A 2X7XA 1DKMA 1L3BA 3CURA 3EQ2A 4PSVA 3DB1A 5I4CA 4NNPA 3ELDA 3AOEA 2Q9CA 2HIAA 3I6IA 4FCWA 1C9YA 3AXTA 1SC1A 3SC2B 2PJZA 4R8RA 2W00A 3BIWA 4Z6KA 3E3OA 2IEDA 1J21A 3VO8A 2HLDA 2EKBA 3QY9A 3BTSA 3GGDA 3N53A 4IIGA 4LPKA 3GDGA 1OFIA 1GG9A 1S2MA 1X8KA 2QE7A 2WA1A 3W3AA 4EG0A 3K1JA 2B5OA 3A1UA 3G1UA 3FUXA 2ZRDA 4ZCTA 4G1VA 4Q21A 4P4TA 2HREA 3C85A 3BVPA 2ID4A 4A5SA 2O3JA 3KPUA 2ZBFA 1D1SA 3R4VA 3RTEA 1U9CA 5KNCA 3K0KA 4KKXB 5JUWA 5KKCA 1RYYA 4Z9XA 5HS4A 4H1WA 4OPMA 4TMYA 4BDSA 1ORDA 2R1ZA 5DEOA 5KQGA 1G9TA 1F8UA 4Q3OA 1JQKA 1QAOA 5KYWB 4QDZA 3DL4A 5IVPA 3DL2A 4ZAVA 3CNQS 3H4MA 2HDWA 1NVVQ 3NZEA 5KDDA 1KEKA 3U6BA 1VP3A 4YXWD 2EKQA 1Z8DA 1AS3A 4NYIQ 2CBZA 1POWA 1TOAA 1KOFA 2FKAA 2Q3CA 2ZYAA 2QUHA 1FFGA 1YOVA 4HAOA 4W1RA 2PL3A 2YJ3A 2I2XB 3QKSA 4EQZA 2A94A 4HMOA 3KCNA 3KB6A 5HOEA 4GLBA 4LXGA 4NMWA 5CLGA 2FUNB 4G0XA 2O3SA 4IQGA 5JJCA 1QMPA 3QVUA 5EHXA 4CLOB 2YV2A 2OAQ1 3R7WA 1DEOA 3X1MA 4NLLA 3JD2A 2RH9B 3E3LA 3HA5A 3P9QA 4FFNA 5FWXA 4KPYA 2K7FA 4AX4A 1HXHA 2B1IA 5DM4A 2GX6A 3DZDA 4US2R 1OGYA 4L8GA 4B71A 1ND5A 4DCVA 3VDRA 2PMBA 2H8KA 3N39C 2RAPA 5CT9A 1UK9A 5K0SA 3UHOA 4G4JA 4IUBS 5JTUA 1AZSC 2HI0A 2TYSB 4G4SO 4X6YA 1SXJE 5EYPA 4C08A 3K0SA 4R2MA 4RY8A 3R3WA 3WA6A 4B85A 2YS6A 5B6IA 5ERYA 5IWAB 4LUCA 2FMKA 1EXNA 3CONA 4B3XA 2P77A 1XRNA 5K4GA 4AWAA 2WDPA 3KZCA 4F0JA 1PP4A 2D62A 2Z9BA 3KCQA 3L7CA 3PKJA 1EDDA 1TTPB 4XARA 2EV9A 3NDBB 4KK3A 3IT2A 2VTBB 3LFUA 5AW9A 5FBZA 4NCXA 2O2ZA 5G4LA 1KYXA 2OD9A 4DSUA 3MT8A 3L7BA 3CEJA 1DCFA 5JSQA 3OY2A 2FNAA 1BGWA 1GUFA 1LPPA 5ALHA 4DQVA 9MHTA 3LDHA 4E30A 5EKUA 1UBHS 1O97C 3CWZA 1EDBA 3DCNA 4O0MA 1RRCA 2B78A 5B3JC 4B3SB 4KRFA 2PBRA 1VSTA 1DB3A 1XL0A 4RDHA 2IPXA 2WKQA 2ZR8A 3EC2A 5DYYA 3UG7A 1N9GA 2NZXA 2P11A 3FWPA 4HLUA 1TCAA 5LUAA 4GRAA 1NONA 1W6RA 1CV2A 2ZYRA 1K98A 4S0ZA 5LQJA 4OLBA 3W9BA 1VIYA 1E96A 5B36A 2QSYA 1K8YB 3Q40A 1E64A 3U40A 1IH8A 1BXRB 2AGVA 3U5ZB 2RGCA 1DOZA 3HKDB 2IOHA 2A9RA 2RONA 1ODJA 2W6OA 3CGGA 4NYMR 5TF0A 3UJDA 5DNWA 4DLKA 4J0IA 2FEKA 3C7DB 4HXFB 4YJFB 1EDOA 2I2CA 2YYYA 3CXRA 3FROA 4L3VA 1V71A 1SVUA 3ILVA 3GOHA 4GP9A 3VC1A 2ZR9A 2HBYA 4FI3C 1HH4A 2OQIA 2NIPA 4OUDA 3Q41A 3SNKA 4ARIA 4D4IA 4XM0A 4E88A 1NXSA 1QGOA 2BFWA 3H87A 4GRDA 2PT7A 3VV2A 5I8PA 3MHTA 2PZJA 1KQPA 4NMLA 4OX9Y 4HFMA 1WHSA 5JQGF 3PXDA 4LGVA 3FBGA 3OOEA 1AF7A 2BSAA 1PX0A 3NRBA 1SB8A 1O8BA 4H7FA 4KFRA 1HM5A 4RMIA 1WMSA 3AJ8A 3KXIA 2HKIA 1EVZA 2ZBVA 3F5SA 3I9OA 4GVLA 3V1MA 1MAVA 3C14C 3H8VA 3VM6A 4BZWA 1ADCA 3KYIB 3ZXXA 1PUJA 3COWA 4LOJA 4PTLA 2NZVG 4GNKA 3UHPA 1F2UA 2MYTA 4R1LA 5C7OO 3HDJA 2YTZA 5JSZB 4C87A 4EJ2A 4P4LA 5BVHA 4HD8A 3WDMA 1YGPA 3R3VA 3WZLA 2AUTA 3E7XA 1Z68A 3HB5X 4DLUA 3SQWA 4WGGA 4DR3B 4MB2A 5H4GA 3RBZA 2VCYA 2UXCB 4CMAA 4ASUD 3OQVA 3BGDA 1NBAA 5T3YA 1RAGA 3CY6A 4OD0A 4AZ3A 3AR4A 2CDNA 1NQ5A 4JLWA 4EBFA 4GX1A 1XVUA 3D7LA 3LUGA 3DFFA 3FI0A 4GO1A 4U6QA 1G5IA 1QZUA 1RFLA 4FOSA 4BV8A 1Y1PA 2BRUA 1FZTA 3PLNA 4BLQA 5BN5A 3NH6A 5T4FA 1YR3A 2PWPA 5JW6A 2P8JA 1NVTA 1GZSA 3BQMB 1MAWA 3VHQA 4F84A 4RTQA 4HZIA 2G80A 4REMA 1NLYA 3OOWA 1CLUA 3WQHA 5HKBA 3NT5A 3GIDA 4RTSA 1GSHA 1NUUA 2ZYDA 2R85A 3KT3A 3Q3VA 1EESA 1USVA 1ZD5A 2CMFA 4BN5A 1E7WA 3BREA 4ZN6A 2BGWA 3UHFA 2YOGA 3PRJA 1Y0BA 1ZZEA 2FR8C 3P0IA 4R9SA 4OI4A 1OMOA 2Z5VA 2QTRA 4IHJB 3T1TA 4Q9JA 2GPWA 3JR7A 4Z0TA 4BRUA 3OOHA 2JVIA 4I9FA 1KI7A 2JLAA 3MGKA 4KXMA 3Q3EA 4CLXA 5AVYA 2P41A 1N2EA 4QQFA 2PSJA 3LT5A 4F4IA 4NCAA 5BSHA 1FLVA 2VJBA 3QFTA 4BLSA 4D9IA 2OV8A 4YAIA 2IJGX 1N6RA 2DG2A 2Q4TA 4J4TA 2GS9A 3E0QA 4J4BA 2HDHA 5K0GA 3FTQA 1M2OA 2J59A 3V2HA 5JBIA 2CDBA 5DBOA 2AC4A 4Q6BA 3IL2A 1EFCA 4UCXA 3T1QA 3PNPA 4YP9A 1KORA 4YJKA 1BXGA 1T10A 4YBZA 4UDXX 1R27A 3QXXA 3H17A 4HN4B 3FNFA 4MQ5A 5IYZF 3S27A 2ZJOA 4WNYA 1W2GA 3BGIA 1JDBB 4J0EA 4YRKA 1XUOA 1G7CA 1QU3A 4R69A 1JQAA 1EMDA 1U3TA 4R0VA 1E1CA 4WT7A 3ZQKA 2H2DA 1A7JA 5EIBD 3PTAA 4Q02A 3NALA 2FQQA 3ZXYA 4NU5A 2ZAMA 1NV9A 5AW1A 2AOXA 5K6TA 4L95C 2ADFA 2YN0A 1QRRA 4MRPA 1WBBA 5TE9A 3R9XB 1Z62A 1BD4A 2FPGB 2PIDA 1YE8A 1S5PA 3NVDA 3KKZA 4LAFA 1ULHA 4WK4B 1R9MA 4LZNA 2XY4A 3D7RA 2LIPA 2H1FA 3I01M 3K53A 3NHYA 1RHUA 4QPNA 3EGEA 4W8GA 1AMNA 3V8QA 5JZMA 2H4WA 1CK4A 4ZMRA 3KAPA 1APBA 3MLEA 5HRCA 3VOTA 3MG9A 3GL9A 4UFPA 3KLMX 5B2FA 2RHBA 3Q87B 1RYHA 4CMJA 4ZHSA 1E3LA 3T9FA 3DQZA 3I5XA 3S40A 3C45A 1L5KA 3GPDG 4EHLA 1KP2A 1Z2EA 2VA8A 1FDVA 2O20A 3KP1A 4FUTA 4JJEA 1F2UB 4R1SA 4IJUA 4XTCS 4WD3A 3ZUPA 5IXYA 3NDRA 3EISA 4OHZA 5J4LA 1NXTA 2FN4A 1X70A 2ORED 1E6MA 2II6A 3FM9A 4GYWA 4UFOA 3RO7A 3AFOA 3I05A 3DXFA 4OI2A 4FXPA 5B55A 1RM5A 2O6HA 3WYGA 2ZJ6A 2DBQA 3EWIA 3F7TA 3REQA 2GD6A 5JAUA 1U8TA 1QX4A 3FVQA 2VT2A 3GNTA 2TS1A 1EFTA 1EQUA 4Q19A 3S99A 3V33A 5K0BA 3VR5A 5JAIA 4P93A 3TXAA 3MWFA 3USCS 4DCCA 5JAOA 1X8XA 3B1JA 3NWOA 1ISFA 1ULBA 4BB0A 4GPBA 1ODTC 2B7CA 3R7WB 1OD6A 2AYXA 3ZIUA 5CEFA 1SBCA 2C2WA 3R3JA 2QJOA 4J16C 2O8CB 3BE5A 1YAJA 3AM4A 1ZD4A 5COQA 2UZ4A 1UCFA 4KQ2A 5A4DA 2E0IA 3W4KA 1PR6A 2EL9A 4EGJA 2AKYA 4RVHA 1NNEA 4LYGA 3UJ8A 3WRVA 5IZ4A 1PBTA 3DH0A 1JT9A 1QOQB 2VQDA 1JZTA 4ND8B 1WXWA 4Y30A 5K3SA 2Q2VA 2QJWA 3QX8A 4DE5A 3FG9A 1X13A 2GAAA 4KJXA 2XVAA 1PK7A 2A1UB 2VYNA 4OAOA 4PR0A 2RGYA 4R51A 2GXQA 5DN9A 3RBXA 4E2FA 4EJ6A 3RSGA 2DR3A 3D8TA 2NTEA 4FFRA 5A03A 3BXZA 2QW0X 4CKXA 4KG7A 2J6BA 2P1ZA 3E81A 3PIDA 4QPCA 3R40A 1RAEA 2GN9A 5SZJA 3QRWA 1ZJ4A 4O2BA 4GKBA 3LRPA 4B7XA 1G0OA 1HETA 5IKMA 5CYPA 1PKEA 5CGZA 2V6BA 2VDVE 4DGQA 3U4MA 2X40A 1BHSA 2DFKB 2ZANA 2BOVA 3HWX1 2H3EA 2R5NA 3KWFA 7GPBA 5LZ9A 1QHIA 3EOAI 3QVWA 3VPDA 4ENWA 1OREA 1S3GA 3WC4A 2CV0A 1UPFA 1AO3A 1SBHA 1QYDA 3JS5A 3JVUA 1J1IA 2GDJA 5AXDA 1SXPA 3CH4B 3A6ZA 1H4VB 3AU8A 3WGNA 4N0MA 3X3HA 4C4RA 2YW9A 4ZAGA 4E5NA 4BCBA 5FT9A 4YRGA 2DPHA 2XW6A 4PZLA 3ZBPA 2PNJA 1WBDA 1RXVA 2XGOA 2VHVA 3OJWA 2P6MA 5K8JB 1J8VA 1TM4E 2NO6A 4CFZA 1EVLA 3A3OA 2AX3A 5C5IA 4TMVA 3C7CB 4YDRA 2B9EA 1P3DA 2Z3ZA 2CVHA 2UXBB 1MW8X 1D3AA 4FFBB 4KPUB 1JAZA 2BFFB 2VDKB 4LJ9A 4UBOA 4OHRA 3LCMA 3LE8A 3AL2A 4S12A 3IILA 2XECA 2I8LA 1R00A 4QQRA 3R9IA 3ZH9B 4DIMA 4A0RA 1WQ4A 3CBQA 3K2BA 1DUSA 3TWOA 1RFGE 4AK9A 5ALWA 3OM9A 4ND5A 1BQEA 1H0KA 2GEKA 4WTOA 2WWVD 1RMYA 2XT9A 3LSYA 5F3DA 1RXUA 4G26A 2QQFA 2O50A 2QTVA 4DMFA 1W5TA 2WABA 3LG2A 3H5AA 2F00A 1QXSA 3ABOB 3GP3A 1HE1C 5K3FB 3LLUA 5KJFA 1CULC 3HWWA 1ETUA 2IPNA 1C0LA 4V39A 1KY3A 1GRRA 2WKPA 5DGTA 2PD4A 1EWTA 3E58A 1Z38A 1QGUB 3EMVA 3NIGB 1AUPA 2XX3A 4RSGA 1T9DA 1TKBA 2W98A 2CLSA 2WSIA 1YHNA 3FCEA 3DBRB 3KSDO 5AM4A 1UKBA 2P40A 4IQ8A 1M54A 2PU5A 3FNHA 4D8WA 1XQXA 3OPVA 1S3IA 4PLCA 5EE9A 3SEZA 1G16A 4KFUA 3I04A 2VK4A 3IP7A 1WZCA 2Y1XA 2JIPA 3LQ4A 2PT5A 4FI3F 4KQJA 3N0TA 2YWCA 2R97A 2ZJ0A 3FYSA 1Q0LA 4BC1A 1Q12A 4I1RA 2F90A 4RTPA 1KO5A 1J0BA 1BS9A 3IVCA 4EHBA 3FMGA 4LY6A 4DSZA 4YAUA 3RUPA 4UTNA 2B4RO 5HZMA 4TPKA 3HBFA 3I4LA 3KYDB 2J9RA 3ZI0A 2IBSA 3DMNA 5JECA 2J7KA 3IVAA 1PDVA 3K0FB 3MN1A 4IOKA 1KZHA 5KJCA 4FYMA 3INGA 1A8QA 4DY4A 1FNDA 1L7XA 1V8BA 5CNJA 2JH3A 4OQMA 4MV7A 1Z8FA 5FO1A 4ZICA 5FPPA 1SCIA 1GT91 4I08A 2JI6A 2ZJ8A 3PZBA 4YRSA 2HC9A 4IDHA 1DQPA 3UK2A 3REGA 1RZ3A 1CDDA 2PH1A 3E7FA 2E5LB 2Y2VA 3OLWA 1FQKA 3EEFA 2JAUA 3RM3A 4JI0B 1KYVA 3E7PA 3AL3A 4CKEB 2HGZA 3QVMA 4LX0A 4PYKA 3AR3A 2FEMA 2ZBDA 4IIFA 3OX1A 1OXTA 1NI4B 2Y77A 4OVKA 5CD9A 4CF7A 5D85A 3E8SA 4RF3A 5IJ9B 1Z12A 4FM9A 4XEHA 1OLUA 3B6MA 3EPJA 1URPA 1GKKA 2C77A 1B8OA 4ITUA 4B2LA 3TZ6A 4IIJF 1U9ZA 3EF3A 3R3UA 4C7VA 4D1YA 3ZGOA 2JK1A 4Q15A 4MCJA 1SXHA 2MINA 5JO9A 3HSSA 4C7XA 4DQUA 2FYTA 3LUDA 4PC1A 3UPTA 3NHLA 3HM2A 1NI3A 1BNCA 5JOQA 1TF5A 1U0OC 4IR7A 4OJYA 3QWFA 4QPJC 4EM6A 1T9GS 4NFYA 1EUYA 4RKYA 3IHWA 3RQIA 1L7EA 1T6XA 4RANA 3EBOA 2VYVD 3KYJB 3FCXA 3ZCVA 5IASA 2REQB 3R5TA 2FSVA 3LUFA 3CNBA 4CNQA 2GGSA 2H7YA 3T3DA 3N0WA 2HQ1A 4E14A 2WK1A 4N0EA 5IT9A 4QUDA 5JJKA 2D5CA 3SHVA 5A3JA 2X9GA 2CNNA 2IZ0A 3MWJA 3WISA 3FOEC 1UC4B 2NM0A 3MRSA 3IRVA 4LSGA 4DMGA 5LIPA 2EJCA 3BE6A 3JQ8A 5D7NA 3PUYA 1LK0A 1L7MA 1Z4PX 3JAKB 3JVVA 2HH9A 1TKRA 3QBTA 2FXVA 5ALYA 5JZOA 4A15A 2O8EB 3BJZA 1CYDA 3QM1A 4UOEA 1NUPA 1UOQA 4D9EA 5LP6B 3Q10A 2JHCA 3RS2A 1JI0A 5EVJA 3LUCA 2CXTA 3A2MA 3TSWA 4H7JA 4OFXA 4DDUA 2BKLA 2W8ZA 3WKCA 1ESCA 1WY5A 2JBWA 3JQ9C 4NNJA 3U39A 1Y5RA 4QZVA 1Z0UA 3AJRA 4KWHA 1NG1A 4WKPA 3ADPA 1EEHA 2VJPA 4EPWA 1J5PA 3C5CA 2DPLA 3HCBA 1NXWA 4MHOA 4XI9A 2BBTA 1COWD 1SQ6A 3C4VA 3CV3A 3GUYA 4MV4A 2ON6A 2VHQA 4BXOA 3K4PA 5B4VA 1UK8A 1VPTA 3PE3A 1KQ3A 1EU1A 2VAMA 1CUDA 2X3YA 3DUFA 3N70A 4DIDA 5JNVA 2H07A 3NYWA 3E9YA 2AIRA 5LMZA 2Q1UA 1J4AA 3T0GA 1N6LA 5I7OA 4GD3Q 3RS3A 1O6BA 1U04A 1MRSA 3KYCA 2ZUSA 4L74A 2H52A 4LXYA 4EY8A 5LOVB 5G1PA 4BNUA 2R6HA 5BN3A 4XWKA 2OY0A 1GN9A 5DEIA 4F6RB 1DAEA 3CNNA 3FSGA 3QI7A 1LPMA 4DLRA 2CJYA 4XUEA 2QPOA 3KVYA 1X7WA 2UZ0A 1XE3A 3TLEA 1C80A 3HEBA 1U2DA 7REQA 2IYLD 2G9ZA 5T7BA 3HHPA 5LB2A 1SIOA 2FX5A 4OQNA 4PANA 3FFBA 1A72A 2EBHX 1QE3A 1LDBA 1NMQA 2ILVA 3C3JA 1BJTA 4R2JA 4AVYA 1ABEA 8ATCA 3TG2A 3HO6A 5HBRA 3NJ8A 4UUPA 5TIIA 2O8CA 2C57A 2KM1A 4FFWA 4RKRA 4RZXA 4JCCA 4PAOA 4BP1A 1R10A 4CKEA 3PUHA 4KX3A 1NKTA 1V25A 2ZIXA 1TIPA 4HB4A 2UYHA 5HM8A 1OWMA 2R48A 4LWPA 1BCRA 2BCJQ 4JQZA 1L5YA 3JALA 5EERA 3A32A 5DN6D 3AT1A 5EJ5A 5JZSA 1EUQA 1GUBA 3K8QA 2HZBA 1VB3A 3HCCA 5I9SA 2VDRB 1G21B 4G84A 2E1PA 2VJAA 3QKRA 3OJOA 4TS3A 2DAPA 2NNWB 3IAM1 3MUNA 6REQA 2P6OA 1Z3IX 3OF3A 5C4MA 2Q1XA 5DNDA 4GOLD 4I1OA 3B5JA 3KWMA 1A7UA 3DZCA 3AZPA 2QN7A 1A50B 2OGTA 1YF3A 2I71A 1CNMA 4J1SA 2W6MA 3KXKA 2VF7A 2OXEA 2HJHA 2YYSA 3ZK9A 2C7QA 2P35A 2CVPA 1D8AA 3VX4A 1AURA 1L8OA 4QT4A 1I7LA 1XTSA 1GZHB 5DCWA 1Y98A 3PHBE 5GV8A 3ZJYA 3A3PA 2CHQA 2WYOA 3VNSA 4D3ZA 2O54A 3NWBA 3OKAA 1U7PA 1KFCB 4RBNA 5BR1A 4BO3A 2VI5A 1MNAA 1FMLA 3U31A 3W04A 4AJJA 4KAJA 5IAGA 1RJEA 3WFIA 2JDIA 3QNWA 1SUAA 1Z9BA 3D3NA 3EVGA 5LYJB 2AYZA 4FR0A 1XQYA 2HIMA 3BMCB 1KKLA 3ORQA 4BNKA 1IC6A 5A4FS 1U2PA 4LJ6A 4TUYB 3VR4D 4WV3A 2PUBA 4N54A 3IKMB 3IQEA 3VX3A 3I4CA 3K9LA 5GOTA 1IXSB 2BMWA 3GT7A 1H2FA 5FWAA 1NX9A 1VFNA 5TSDA 2WE7A 1EZ1A 4IDEA 1E20A 1Z6AA 3ND6A 3ONVA 1C7JA 1HF3A 1JTEA 1SD2A 2A6PA 1OAOA 1NRIA 1I4TD 1YL5A 2ACWA 4HPWA 1XTUA 2GA8A 3AXSA 3D6HA 4COOA 4EF6A 1UJ5A 3I8OA 2XCTB 2CT8A 2Y2UA 4G23A 5DW3A 3TGWA 4P5EA 3FIUA 2C3PA 3ZJTA 4PVDA 4ZEVA 4WEOA 2Q7DA 2NUPA 3V6LA 4QSMA 1ECJA 3AVVA 1OC2A 1RC0A 2Y1LA 3KLOA 3MHPA 2RGNA 2D7DA 3SJ7A 1A2KC 1Q0PA 1XNJA 2CC2A 1YHYA 1WM1A 3JD0A 1C1YA 2IYSA 4DC1A 3BMNA 2AL7A 2OZLB 2QNIA 3IBTA 1MO2A 1Q15A 2W4IA 2G77B 4IWNA 3WBBA 3ZU6A 2Z6VA 4QXPA 4JJZA 4I99A 1VJCA 1OOEA 4PYIA 1F6WA 2G0NA 3RUAA 4EI2A 4YJGB 3RYIB 3DAYA 1BDIA 1HYGA 2AT1A 4ZVRA 4OK6A 4PGFA 3SX4A 1XEXB 4FYXA 2B4KA 5EMHA 4URZR 1E59A 4YMSA 4KN6A 2CWDA 4CF6A 4DXHA 4JI7B 2ERYA 3AFGA 4GUAA 4ZI7B 2I34A 1N2HA 2QIOA 4PR3A 4PYRA 5LDDC 4W8OA 4BJ5A 4RXMA 1QS0A 1HEUA 1OHHD 1PW5A 2HL6A 2BV3A 4PFKA 4BBPA 5HR5A 5ITSA 3WL5A 1KI2A 1J0EA 4LRSB 5DV9A 3O3OB 1CFZA 2V6IA 4KDFA 4CUJA 3IB3A 4M1WA 4DCMA 1CJVC 2CK3A 2Q99A 4MMXB 3L7DA 5DZSA 4BJHB 5LMCA 4HQFA 5TNXA 1S2NA 2DFTA 3UTDA 4IO1A 2QVGA 2C1EA 2QROA 4MUBA 1PS0A 2FX3A 3SGLA 3NLLA 2VPQA 1YE5A 1QG0A 4PFQA 1I4DD 2EJTA 1O8CA 4FCTA 3GLUA 4MVXA 5ELXA 1OU4A 1T3SA 4XUCA 1ZISA 2QTAA 2ZR0A 1PGOA 3R6GA 3ZIAD 3JQBC 1JHXA 2PS1A 1MT3A 4WUVA 3QV2A 3VNAA 1W94A 4OBBA 2G5CA 1PEAA 4NATA 1XMXA 4QLAA 3WQQA 2XE4A 3DR3A 1SUCA 4PC3A 2EERA 2OBYA 4Q4JB 1JJ7A 3VPXA 2WZCA 1E9FA 3VZRA 1Y8QA 5C8VA 3A3KA 2OYRA 4MR8A 2E82A 3SN6A 3C8HA 5FCDA 4JB3A 3R9KA 3PFCA 3BL8A 5DF1A 1GQOA 1XD2A 1E2UA 1YJ8A 4MW7A 3T06B 3PR1A 4XVCA 2GRUA 3E8MA 4ARUA 5IYZA 5KQSA 3BD7A 1JFLA 2P7IA 4GLOA 3IEXA 3STWA 3UKDA 1N0HA 4AJLA 4D7AA 3CIFA 4ZQFA 3DEHA 5LOVA 1MC8A 3SF0A 4RQUA 3AETB 5I47A 3OP4A 1G8PA 2ZETA 5KHOC 1XAGA 1XVTA 1TYBE 1JGTA 5EP1A 1IAQA 4X61A 1RYDA 5JY6A 4HNUA 1HDEA 3R7DA 4JZKA 2UYYA 4MGEA 2H17A 1SU4A 4MPRA 3RK4A 3VHLB 1D6MA 1AKYA 4Q3EA 4AC9A 3ANMA 2ZQYA 2IU3A 3CH5A 2QOEA 4GXNA 1T3LA 3A4NA 3TW0A 1LCIA 3WLIA 1ORRA 2FWNA 3C1UA 3KVVA 2VBFA 4OHYA 4G25A 1R6DA 4C4TA 1HLDA 1ZH4A 2ZSUA 3PP8A 4DG5A 3BB4A 4YMVA 4B17A 2HAEA 2Z4TA 5ITZB 3G2OA 1FNNA 2L2QA 3LXRA 5FJJA 3SYTA 4IV8A 3P96A 1JLLB 3KAJA 2CSXA 1DG1G 3MW8A 1N6OA 1YR1A 4PS0A 2IS1A 2IZ5A 1ZRHA 3DEJA 2ASEA 4DQLA 2J3KA 3QKRB 3IP1A 4ZARA 3B52X 5FOSA 1G3IA 4Q0MA 3QEAZ 1USUA 3VTZA 4WAUA 1E58A 4IZ6A 1QIGA 2XUGA 1P9NA 1QIJA 2XMRA 4QQ8A 2C82A 5JS2A 1LQ2A 3DE2X 1F6BA 2ISCA 1Q7RA 4OLJA 4DLTA 3OPXA 1EK2A 1IAVA 1VGRA 3EJ6A 3KHUA 1N4DA 5C53B 3PD7A 1W4LA 2WM9B 1NN3A 4F5WA 4XVUA 1C9DB 5IKEA 3ZK7A 4HEHA 1XVAA 2C4WA 5AW2A 5BYJA 1G8MA 1FVHA 2B20A 5BVHB 1KBQA 3VNRA 4FYVA 2ECKA 2X7HA 4MS3A 2FSUA 4NBNA 3NC4A 5K2OA 3JRWA 2R6FA 3A6LA 3N58A 1TGYA 2GKOA 2JJYA 3LC1O 4FMCB 4OG2A 1UDCA 1YR6A 4GLLA 2Y3IA 1V8ZA 4IVNA 5DHRA 3RWMB 1DQRA 3L6RA 4J6EA 1MB3A 4XQ0A 5A1JA 3RS5A 1OX6A 5TT1A 2YRFA 5BN3B 5LC1A 1M34B 1NOJA 2QD4A 2XF8A 1DKUA 3UTCA 2MSNA 4TUYA 4L07A 2ONZA 5TMBA 1GNPA 3SICE 4GKVA 4JI5B 3DOUA 3QHPA 1E94E 3AM3A 1FFEA 1N5RA 1FPQA 3D4OA 1Z2AA 3ZGNA 3PC3A 3KQTA 2BDEA 1CUIA 4MUFA 3MEQA 2G1JA 2OAGA 4BFLA 3AF5A 1Q0UA 3F6BX 1G2PA 2CD9A 2V98A 3GFTA 2G70A 4G3XA 3D4BA 3ZVKA 1SVNA 1PZXA 1PT5A 3PUXA 1EDZA 4OXYA 1V8DA 1N2GA 2WJ4A 3R3HA 4FVTA 4NFSA 4TV8F 4ZDWA 4TYQA 3SOZA 4EQ6B 5JJ5A 3MMZA 2W6CX 3U61B 4EG1A 3VJMA 4HNQA 2CMKA 4HMPA 1E4OA 1ZKMA 4WJZA 3BZUA 1ADFA 4GC9A 5AMXA 1CUWA 1TJNA 4LQDA 3OY7A 4ZZ0A 4QM6A 4P6VF 1X6VA 2EATA 4G5OA 5K6AC 4G0ZA 1I1HA 4XSHA 4Z4FA 2JPDA 3D5TA 3V8EA 2P6RA 2OMKA 4HATA 1SPBS 3L41A 5ICSA 1Q0TA 3VPSA 5F1KA 1J25A 4P7JA 4Y8VA 1JAXA 1E1YA 3PGXA 5DYGA 2HUPA 3HFRA 3TE7A 2DECA 4D4MA 9GPBA 1Q0SA 1AUOA 4KVGA 4P7KA 3WHPA 4ZOBA 3UQYS 1MP0A 3D6JA 2H4JA 4O6VA 4JHXA 1BEZA 5F3RA 2QVXX 4QOEA 3DE3X 1E18A 3QH4A 4ZK6A 4JC5A 3WB1A 4IQFA 2HK6A 3ENWA 4FFMA 4IFTA 2XQVA 3MBIA 4MWOA 4MW4A 5E4YA 3BT7A 1RLMA 2D7JA 2HCBA 1FP2A 4W5RA 3AUKA 2VNKA 4IEIA 4YWHA 4B3FX 3B6JA 4BGUA 1E89A 3C8MA 2RI0A 5IF9A 1FNSA 3AO0B 3B3AA 4RPIA 3OA0A 3KQHA 3AERA 221PA 2X15A 2DE0X 4HOYA 1I2ZA 3QG5A 4CQMD 1N2XA 1PL6A 1EWRA 4H1TA 4QTZA 4EDHA 2CXNA 5KC9A 1WZIA 1W4RA 1GGNA 4HI0E 5L9AA 4N3NA 4PF1A 3VSEA 1YBMA 3DT6A 1W581 3WE7A 5EMJA 2VF5X 2WLTA 4YQFA 3S2EA 2AJCA 2O7QA 3FUCA 3MRVA 2XYVA 4D0LB 1QFYA 1FOEB 4N3CA 2O48X 3MJSA 3C15C 3W1EA 4MA4A 3KQQA 2P68A 3K9QO 3OPNA 3BAZA 2WWGA 1TCBA 4KLNA 3BH6A 4BX8A 1PE0A 3QE9Y 3UMFA 2XT6A 2E21A 3A26A 3OM1A 1J2YA 4K8OA 3TLXA 4AG6A 1IL0A 1FMJA 5EXEA 3SG0A 4ZK2A 2ODPA 5AW7A 4O4HB 1E79A 3WWDA 3RAJA 2JF0A 4TMZA 4OHKA 3SNHA 1L7PA 4GOKA 4M1QA 4M8IA 2JANA 3JQFA 4ARZB 5BYKA 2FPLA 2V7PA 3OPYB 2RBGA 4FD2A 1GARA 3DZKA 5KYKA 1E7MA 4OBEA 2X8LA 4P32A 3I2JA 4JI2B 1QTQA 4QKQA 2YVLA 4FDTA 4ACBA 1AQJA 4TSFD 1UP6A 3I1IA 5MFZA 3A6DA 3H75A 4ZQGA 5F2KA 3FMFA 3RW9A 3A2NA 4YAFA 3KB8A 1ADJA 4P84A 1AGXA 2CXHA 4ZMBA 5B3AA 3BORA 1EX1A 4KQXA 2PUJA 1K7CA 2CNOA 2AJLI 1EXDA 5D5HA 5E6UB 1R5JA 5EZYF 3OTIA 4Y9RA 2OBLA 2OYSA 3OX4A 1Y9ZA 3PWSA 4YCSA 1P4RA 1RI4A 3TRKA 4B3JA 2RGBA 5F1PA 4MW2A 3C6ZA 5K4AA 1IFXA 5FWYB 2G0AA 5A6SB 3E5MA 3TMYA 1MO6A 3DWFA 2H18A 5AOVA 2QZZA 4YRTA 3TUJC 4OQPA 5JALA 3QUAA 1IHXA 1TI7A 1EPUA 1ZOOA 2VAPA 2XKAA 3MSCA 3EZYA 4FGKA 4HAUA 2JCSA 4H59A 3LSTA 1CQWA 5CURA 3LXMA 4QBKA 3IKLA 4IWYA 3PL1A 1AGRA 2P2GA 1Z83A 3FE2A 4KDEA 4ETMA 5EIOA 5JO0A 3U3ZA 3R75A 1LRLA 1QFZA 1SUIA 4XGQA 4MPTA 1U8UA 1O87A 1U7WA 1O0SA 4QU0A 1T6ZA 2R7KA 4FBLA 4WY5A 3R7AA 4K28A 5FRDA 3LM8A 1TC2A 4YRFA 1E2NA 3PHHA 3IMGA 4P53A 3FUWA 5K0CA 4DT1B 1YZLA 3DL0A 3GGGA 1RVV1 1N0UA 4J0QA 4MS3B 2HU5A 4F56A 4RMNA 5SZKB 5K03A 4AZ0B 4QYMA 3IRUA 4CIXA 2LRHA 3KVNA 3QXJA 4LDAA 2W70A 4AJ4A 3QBDA 2FDRA 2BGKA 2QRJA 3JD4A 4JLVA 4K7JA 3ISJA 2XGMA 4Y6PA 3TFWA 3ZLBA 5KOJA 1U0TA 4YLGA 3QVLA 5E3HA 2YN2A 4V3CA 3TM4A 1M34A 3FNEA 2IXAA 2PMKA 4QUJA 1N1GA 2HV9A 4K9KA 1KJJA 4ZYZA 2OHGA 2PU7A 3LPLA 2FFBA 1ZW6A 3GOQA 3SM9A 1YI0A 1NLFA 1O6CA 5H5JA 1BX3A 3F4KA 3RFFA