4BVHA

Crystal structure of human sirt3 in complex with the inhibitor ex-527 and 2'-o-acetyl-adp-ribose
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
272
structure length
272
Chain Sequence
GKLSLQDVAELIRARACQRVVVMVGAGISTPSGIPDFRSPGSGLYSNLQQYDLPYPEAIFELPFFFHNPKPFFTLAKELYPGNYKPNVTHYFLRLLHDKGLLLRLYTQNIDGLERVSGIPASKLVEAHGTFASATCTVCQRPFPGEDIRADVMADRVPRCPVCTGVVKPDIVFFGEPLPQRFLLHVVDFPMADLLLILGTSLEVEPFASLTEAVRSSVPRLLINRDLVGPLAWHPRSRDVAQLGDVVHGVESLVELLGWTEEMRDLVQRETG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NAD-DEPENDENT PROTEIN DEACETYLASE SIRTUIN-3, MITOCHONDRIAL
publication title Ex-527 Inhibits Sirtuins by Exploiting Their Unique Nad+-Dependent Deacetylation Mechanism
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 93
structure length 272
sequence length 272
chains with identical sequence B, C
ec nomenclature ec 3.5.1.-:
pdb deposition date 2013-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02146 SIR2 Sir2 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1600.10 Alpha Beta 2-Layer Sandwich SIR2/SIRT2 'Small Domain' SIR2/SIRT2 'Small Domain' 4bvhA02
3.40.50.1220 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold TPP-binding domain 4bvhA01
3F6EX 2OD7A 1PO7A 4QELA 2OD9A 4FEEA 1OZHA 2PGOA 5AHKA 2H59A 1PVDA 3CLUD 2WVGA 3K35A 2JI6A 3CLRD 1E3TA 5BWOA 4BVHA 2EZ8A 4BN4A 5EJ6A 1V5GA 4GM4A 2B4YA 4MQ5A 1O97D 4ZZIA 5BWLA 1Y9DA 2VBGA 2H2FA 5MFZA 2X7JA 2AG1A 1T9BA 2VK4A 1MA3A 3GLUA 4I5IA 4BVEA 4UU8A 3RIYA 4UUAA 3D81A 5EJAA 2Q27A 2FR8C 4UTXA 2VK1A 4BN5A 3CF4G 4UTVA 4JUCA 5IMSA 2FRDC 4L3OA 1DJLA 4TWJA 1M2KA 1PI3A 1YHZA 2Q29A 3CLSD 2H2IA 2OO5C 1T9CA 4BV3A 3U31A 5K2OA 4D5EA 5EJ9A 4BVBA 4TWIA 4HD8A 2EZ9A 2HJHA 4L2IA 4Y6QA 3PKIA 4F4UA 3ZGVA 2EZUA 3ZG6A 1EFPA 4G1CA 2A1TR 2Q5JA 3OE1A 4BV2A 1ZPDA 3JR3A 1NM5C 4KGDA 1YTLA 4JT9A 1ICIA 4MPPA 4J1TC 4KXQA 1Q6ZA 1U2GC 5MFPA 4IAOA 3CLTD 2QQFA 4RJJA 2FWNA 2UZ1B 4JUBA 3LQ1A 4BUZA 4RMHA 1Q17A 1J8FA 1UPCA 4RJKA 4JT8A 4JU9A 3FLMA 5K6TA 4RMGA 1U2DC 3PKJA 3FZNA 2H4JA 3E9YA 5DGTA 2VBFA 2Q28A 1OZFA 2H2DA 2JI8A 2V3WA 3ZGOA 2UZ1A 1BFDA 4JSRA 5EJ7A 2OD2A 5FEMA 1U28C 5EJ8A 4V1CB 4HDAA 4GP9A 3IAEA 1UPBA 4K9PA 5EJ5A 2BRUC 1SZDA 4UU7A 4K9NA 3JWPA 3U3DA 2Q5QA 5DGDA 4BVFA 2IHVA 1M2NA 1YI0A 4V1CA 2OORC 4RMJA 4UTZA 1PTJC 2FN3A 2Q5OA 2H2GA 3HWWA 3FSJX 1YNOA 1PT9A 2VJYA 5EJ4A 4MPJA 1S7GA 2IHTA 4IG9A 4FZ3A 1U31A 5FYQA 4JUFA 1D4OA 2Q5LA 5K3SA 1OVMA 4GG1A 4K9QA 2VK8A 1PNOA 3GLRA 2H4FA 2PGNA 4X3OA 4Y6LA 4K9MA 1QPBA 4KPUA 1POXA 4Y6OA 4K9OA 4V1CI 1T9AA 2H4HA 3RIGA 1MCZA 1PNQA 4F56A 2JI9A 1V5EA 3EY9A 1M2JA 4RJIA 4RMIA 4JU8A 1M2HA 1N0HA 4K9KA 1T9DA 4BVGA 2QQGA 4IF6A 2W93A 1HZZC 3D4BA 1S5PA 4X3PA 4C7BA 1PYDA 2A1UA 3HWX1 4FVTA 2H2HA 5BWNA 4UUBA 1YHYA 3EYAA 2EZTA 5MGNA 1YC5A 1SZCA 1XLTC 1Q1AA 4QPZA 2DJIA 4GM1A 1YC2A 4ZP1A 3EA4A 5MF6A 3GLSA 4COKA 2WVAA 4MZXA 2JI7A 4GPEA 1YI1A 2PANA 5K6RA 2JIBA 2NXWA 1UPAA 1Z8NA 4UTNA 2JLAA 4D5GA 2AG0A 2WVHA 3PDHA 4K9LA 5DEIA 2NYRA 2C31A 4QQ8A 1V5FA 4C78A 2VBIA 4MPRA 1EFVA 1Q14A 2EZ4A 5EJMA 2IHUA 3GLTA 4R8MA 3F6BX 1YBHA 4JD5A 1OZGA 4UTRA 4GM0A 5D7NA 4O8ZA 2JLCA 4FEGA 1M2GA 4JUAA 1POWA 4J16C 1JSCA 1O96B 4Q9DA 3IAFA 3D7KA 4JUDX 2FSVC
chains in the Genus database with same CATH superfamily
2Q21A 3EZNA 1HLPA 3I05A 2W2LA 3ROEA 3ZPXA 1FB5A 2JGNA 3ZBPA 2XYRA 2DKOA 3FPSA 4X1YB 1I3MA 3HDJA 1P8JA 2VHEA 1Y9JA 5LJLA 3Q1LA 2R5NA 2QNIA 3OZBA 1MJFA 4OQ4A 4QEZA 5C3UA 5LXTA 2GD6A 2QQEA 1CHDA 3EW7A 2JLRA 1E7WA 3ZW9A 4Y0NA 3F8SA 4EB8A 3IERA 3GR6A 3OUTA 4N0MA 2HPAA 1Y4UA 4W99A 3DHVA 1MVNA 1NE2A 4IJ5A 2KMLA 2L18A 2ZJ3A 3IIJA 1KO1A 3DMRA 4KAJA 1W4ZA 2K2QB 4DWVA 4GGPA 4H3HB 1CZLA 1GTL1 3KU4A 4G85A 4JOBA 1HTBA 4G3XA 2I0FA 1NSYA 1W5EA 2VDVE 3TSAA 1G5FA 3CPJB 2F1OA 5HDQA 2RHGB 3BMOA 1U3DA 2RAPA 3BXZA 4LGCA 3TVTA 2WYUA 2F64A 2AV6A 1RWKA 2G5GX 4DSAA 1UBMS 1GM5A 1PG2A 2AN5A 3L3BA 2K5UA 2Y0DA 3GZJA 4OHWA 3SZ3A 1A4XA 2FEPA 4HO1X 4K03A 4OBWA 2MHCA 1CEXA 5K4GA 4Q1VA 1C9NA 2EKBA 4AK9A 2YNMD 1ZIOA 2PGLA 4N0DA 3U9LA 4CV3A 6AT1A 1Y33E 1DZIA 3ZE6A 1N6IA 3A6HA 1AY0A 1SXPA 3GK3A 4BGUA 4NV1A 5BSFA 3GLUA 1I33A 4I5IA 1IC6A 2O5VA 4U2DA 4IIEA 3UW1A 5JW6A 1YBMA 1XYVA 2XNKA 4G0WA 1PHRA 4EHKA 4F5EA 3THYB 2FW6A 4Q7KA 5EQTA 9MHTA 3QXCA 2YC4C 4D9CA 4G8DA 4XPIB 2GAAA 2HSGA 2O3SA 4LJAA 4QRIA 4PYJA 5ADHA 2B7CA 2PH3A 1TIKA 3OSZA 4QO7A 1PWYE 4RWEA 3RVSA 2Y67A 4FGJA 2WUVA 4QA9A 3MJFA 1A82A 4ZV7A 5A02A 1MJHA 3H9JA 3OCUA 1DKPA 2CCKA 3LDGA 2F3RA 3KKPA 4YJ2B 5AVUA 1E2KA 4OQQA 1P75A 1XEFA 2UVPB 3QPCA 4YP0A 7REQA 2IYLD 5JMWA 4JUCA 1YAJA 3NHAA 4AU1A 2VXYA 4RKWA 4W9MC 4CF4A 3CNHA 4Q7QA 1D2MA 2I2DA 3TVYA 1RYNA 4BB5A 2Y1OA 1V8PA 2RK4A 3ZDXB 4EUNA 2YIDA 3NRCA 2I6XA 3IURA 1AO3A 3TIFA 2RCNA 1YJAA 2C04A 2E4YA 4L5AA 4ZD6A 4GXQA 3HEBA 1AO0A 5H16A 5I47A 3R0QA 2X6QA 3PCTA 4C87A 2PVPA 3EXG1 4R8LA 2ZKLA 2P6RA 5I6DA 1Y0BA 3P0HA 5GOTA 2ZTSA 3K0CC 1SU8A 4TVOA 1MV5A 2PV7A 3QY0A 2P4HX 1CZUA 3OM8A 1XYYA 221PA 2X15A 3U7QA 3IPCA 3LX5A 1C7IA 4K8RB 4K7JA 1XMXA 5K3OA 2Q3CA 1HRDA 4L15A 1DINA 4M7PA 4QWMA 5JSQA 1PVOA 2NP6A 1FYXA 2WOOA 3UT5A 3PCRB 1KS2A 1L7EA 1TVCA 2CN1A 2ZIGA 1HNXB 2FWJA 2LPMA 2JDID 1JU9A 3OPYB 4QFMA 2QD1A 1LI7A 2BFDA 2C7GA 2OK8A 2E4UA 3LKDA 3RIXA 1P7ZA 3BZWA 3C6BA 1UDWA 3ZWKA 3FFBA 3IEXA 4FZJA 2HI0A 3HFSA 3V34A 5EE1A 4DPKA 4B6JA 3FLAA 4AIRA 4D26A 5D3QA 2WYWA 4EO7A 3ELWA 1TKAA 3COPA 1J1UA 1OF1A 1XTQA 3VSBA 1JHDA 2WNSA 3OIWA 5IRCD 1W2HA 2JIPA 1VJ1A 1OLSB 2C5BA 4D6PA 4FEAA 4DIDA 3OQMA 4UDOA 1C3OB 2PX5A 3R5SA 1OGYA 4KLNA 4NYJQ 4AJNA 4PN3A 3PFHA 3NBYC 3O82A 3A4YA 3ONNA 3PIRA 2BJVA 3KT8A 4KLAA 4PX3A 5K3AA 1T1SA 3LM8A 1QF7A 2YBDA 4X44A 3EG5A 4WY2A 4DV2B 4S1WA 2OLEA 3H8WA 2FFHA 3HXOA 3OJXA 5BV8A 3UJAA 5HBRA 4OLJA 5HOQA 3RS0A 3DUWA 3N87A 4PZYA 4X54A 4PYOA 4PNPA 3SLGA 5BMVB 2OP1A 2RHHA 3G9XA 3G6KA 3IP1A 2AGVA 1U2GC 5MFPA 1GEEA 1NVUQ 2RH9B 3BIWA 3N8DA 1FP6A 1I2AA 2OV3A 3BTVA 5IC4A 2YW9A 4V3CA 2ZB4A 1OHHA 4MHSA 4A91A 3C85A 4MMXB 1MJ5A 4O5AA 1R66A 3N2KA 3P9CA 5DBOA 1P80A 2YOHA 4WCFA 3ZJ4A 2IITA 1E8DA 4M7RA 1JU4A 4NU5A 2PD6A 3MJRA 2GUGA 4M1ZA 4C0KA 4QUBA 4IHQA 2W58A 2QNRA 1XZKA 3NAMA 3V8BA 4WUTA 1QCYA 5CDFE 1CYEA 2VVTA 3KB2A 5SZKB 4RELA 1OW3B 1OT3A 2PWBA 4CKBB 1U2DC 2XDQA 3WK9A 2BTQB 4GICA 2WIBA 4MV0A 3E9YA 4US1R 3TSYA 2BKLA 2R7AA 5HSGA 3AJAA 4RZHA 4X1KB 3HHPA 1DX9A 2Q28A 2C0QA 2YWFA 4DQ0A 1EK0A 2A7QA 3OE7A 1L5NA 1CDZA 1RQLA 2H2DA 3K92A 1DOHA 1EU1A 4TQAA 5DZSA 3EWAA 4AZSA 4BVLA 2ERCA 5DMXA 2W2PA 3GJYA 5GVRA 2C29D 4YUXA 1E69A 5JRJA 1TNDA 1QGOA 2CD7A 2ODPA 4F4DA 4PX2A 2I67A 1FDOA 1A5BB 2IWRA 3B6IA 4ZVKA 3MMNA 2C00A 3NBQA 2J3KA 1Z4PX 2NN3C 2JLZA 2BGNA 5TJ9A 4RD4A 1AURA 1XK7A 1F7VA 3RRZA 5BSMA 3IAEA 4F8JA 3E2MA 3HCFA 2A3RA 1RJ9A 3R4CA 4GSLA 3WAJA 2HA3A 1KJ8A 4HRYA 1NXSA 4E2ZA 3EAQA 4DR5B 4FMCF 3H0KA 3TBHA 2DUMA 3AL3A 4L0DA 1AHNA 2X9QA 3WLFA 2FPPA 5DOVA 4CTMA 1L7MA 1X3SA 2GI4A 2VT7A 4NG5A 3A4LA 1TPYA 4WKBA 1G9TA 5E0OA 3F6PA 5GV7A 2Z83A 4G9BA 2JL1A 3HFGA 4FFBA 4I1IA 1XQYA 2VCHA 4ROTA 3LUBA 1V1MA 2F2TA 4RETA 4Z4QA 1G20B 1UM9A 4TQUS 3H65A 4FZRA 1EUZA 2Q3DA 5JS1A 4BAZA 2DTEA 1YI0A 4IJKA 5BSTA 4JWKA 4UTOA 5IG2A 1U9IC 2IK8A 1S0UA 3O9ZA 1KSHA 1NI4B 4RV5A 3A37A 4TTIA 3VSCA 1EVZA 5C5DA 2AE1A 4JJKA 1U5CA 4XQ0A 5A0TA 2XKAA 3OLZA 4YMHA 3FNEA 2C0CA 4RK1A 4MUAA 1F6WA 1GT91 5JHGB 5FV4A 1U8UA 4UM9B 5I3ZA 3USCS 4DLUA 4IMPA 4UM5A 3BYZA 4KRFA 1M7GA 4RD6A 4Y2SA 4Y1RB 3A1VA 2VHZA 2JAXA 3EXIA 5IN4A 1FTYA 4GBED 4KX5A 4M87A 1NT4A 4H7PA 1EFAA 2A1TS 4FNMA 1BCRB 1E77A 2GCEA 1ZS9A 4JJ7A 2D59A 2KSQA 5HJEA 2CSXA 1O97C 4BKRA 1Q1ZA 4HWTA 4DYHA 1SKMA 7GPBA 3AEQB 2VP4A 4ZJUA 4PLVA 1T1JA 1J00A 1HEYA 6REQA 5K3SA 4CKZA 4UAVA 2ZEJA 2D3TA 2R751 4D3ZA 4GXTA 3IEKA 5E2IA 5LL6P 1KZGB 5FPHA 2O14A 3MTEA 2Z2KA 3PX2A 4P4LA 1AOXA 4MKIA 1DDIA 4YNBA 3MWDA 2X0RA 4Z9BA 1K8YB 1Y8ZA 2ZR9A 5B7NA 2XCRB 1P29A 1M6VA 2ISQA 2QRVA 3F1KA 4PXSA 3HU5A 1E5LA 3EOAI 4TKUA 2JGFA 4KPUA 3NM6B 2XODA 4Q47A 4YRSA 5GADl 3PNPA 3WQSB 2WV7A 1JR3E 1CY4A 1YQEA 5JROA 2QRMA 1XHFA 2ON6A 4UNNA 3UGQA 3H6KA 1W59A 3SS7X 4K9OA 3UK0A 1E7YA 2GCPA 4RAOA 5JQGF 1OLUA 2L2QA 1S2DA 4TYPA 4RDHA 2XHEA 5JD4A 3OTGA 1J09A 4O4IF 4EI2A 5EXPA 4BNMA 5C4MA 1UAYA 1BXRA 1AS2A 4A03A 4XDZA 2YQZA 1YZ3A 4N82A 1JU3A 4F56A 4GVXA 4FSDA 5H5JA 1V5EA 2W83A 1N2IA 3PJGA 4YIHA 1HX7A 2P2SA 3F0TA 1AQIA 3KELA 2QN2A 2AR0A 3R3YA 4UXIA 4FI3F 1PIWA 2FPKA 3LCCA 5BSEA 4IP0A 4MB6A 3TS1A 2OUKA 1F1JA 2D8MA 3O90A 4QTXA 3W8RA 2P2DA 2VAMA 2DHQA 1HE4A 3AHGA 1M2VB 3PTLA 5AJTA 3OJOA 5HR5A 3A6PC 1GHTA 4J8PA 1WZNA 5DWDA 1DPGA 1LLDA 1UEJA 1JLMA 3AI2A 4LISA 4IQGA 1WSWA 3H9EO 1DQNA 3M1IA 2HW8A 4PAMA 3NTXA 4GLJA 3ADBA 4TTJA 4QBIA 1U2RA 3V8MA 4DCSA 1ECCA 1G42A 4U2FA 3L49A 2C59A 1KYZA 4RLQA 3VJKA 2R8OA 3DZCA 3LLCA 1WQ4A 4IEFB 3K72B 2CXXA 4YIKA 2J31A 3ODPA 2QQ5A 2XBLA 3QMVA 3OPYI 5HZHA 5LLDA 4K9SA 2FDRA 5CT5A 1AUXA 1UANA 5ICGA 4DMUB 1VB5A 2X8BA 4IIFA 2OBXA 5C80A 5AESA 2C83A 1NJ8A 4RLHA 5FYDA 1JSLA 1W85A 2QMZA 3F2IA 3P5BA 1RIFA 2GJ4A 2IYVA 4BAGA 3AZPA 2ZIZA 3OY2A 1C3EA 2WT8A 4RGBA 2F67A 4HZUA 2PX2A 3GRFA 4YH1A 2GF9A 2P5UA 4H7KA 3TQRA 4D4IA 5M34A 3BCUA 5EY5B 5EYPB 3DLPX 5ES3A 3FNFA 3MMXA 3HDTA 4L5CA 3R09A 4AO8A 3ZHZA 3C3MA 4M1EA 4F5YA 4AZTA 5H83A 4M1MA 1TCUA 1HKHA 3HZZA 2G4CA 2CLMB 1EHIA 4BMXA 4AUMA 5TVKA 4C6TB 1K5DA 1T34A 3LC1O 1XCPA 5CB0A 4ZQEA 3SHVA 2Y0EA 2XMRA 3NHPA 3N70A 4G1MB 3VISA 2ZUCA 1RXCA 4M6WA 5CCEA 5LOVF 4W5HA 3EJ6A 3WQBA 1EXWA 4U5XA 1OYWA 2QUBA 4MQ6A 5FQOA 2ADFA 1F8XA 1SHLA 1ISPA 3GRVA 3SSNA 1W35A 4JP5A 3FYUA 5G0TA 4I5DA 1QF6A 1O9HA 1YU6A 4CL2A 1I80A 1GQRA 3BFJA 1YD7A 3K0HA 2QVBA 5B2FA 1ZW1A 2AW3A 2FPUA 1EFVB 1WO8A 5E9WA 5B3LA 3ZE0B 5L51A 3ZKAA 3UJBA 3L40A 4OFWA 5AJYA 3TUZC 5KMGB 1PV4A 4NE7A 2ZAYA 3B5EA 3C3BA 4UQOA 1BWSA 2P65A 3IB6A 4N1AA 1GUDA 1BKSB 1IUPA 1XF9A 1GTZA 1TRKA 1VG8A 3LV8A 4FR5A 4P32A 3VMMA 2Y68A 1JP7A 2HMYB 4CQLA 5JH7A 1EAYA 1ZU4A 4JJGA 3L8YA 1O95D 4QQKA 4EDHA 1X9GA 4IDGA 5LP6C 3MQ4A 1YBVA 4K9LA 2VQFB 1G3QA 4L28A 4XZ3A 2Q4TA 5IJAA 1PSZA 1KI2A 3CWCA 1II8A 3OZTA 3GELA 1DARA 5JV5A 1JKIA 3GEGA 4QTUB 3U62A 4HY3A 4ZCTA 1DKNA 2YVUA 4PR0A 2BONA 2YCBA 4DWOA 1VYHA 2AJ8A 2CSUA 5IANA 1NFRA 2VSOA 4GR4A 3JTEA 2X77A 1YBHA 4QU0A 3N7AA 4D9MA 3WLHA 1PD0A 1DUIA 1QHSA 3RVLA 1F8FA 4CCAA 3UIEA 4KO4S 4J0HA 1DHTA 2CE7A 4EYQA 1J7KA 1EG7A 1DG9A 2JVJA 3LW7A 4EJFA 5KHOC 2FH5B 4CEHB 5IVIA 3GIDA 4IYRA 5CLGA 5DGCA 5FJJA 5TMBA 4D8TA 1Z3IX 4J0JA 1JAIA 2ECKA 4CGZA 4ENWA 1WJGA 2GJAA 4IY1A 4FEGA 2EHDA 3CX3A 4H3KB 4RL6A 2Q62A 2ZYIA 1KKLA 4YCNA 3LWBA 1F6DA 4FXPA 3ZCPA 2AR7A 2V3CC 1CG6A 3N7TA 2PUEA 3F3KA 4LOHA 4TUYB 4Q4AB 4LJLA 4LFCB 2OAGA 1XD9A 5HF8A 3BHIA 1O5IA 1YR3A 4HJRA 4HP8A 4LY0A 1P33A 1FDVA 1VCHA 1PG0A 3AF1A 2IYQA 1NVDA 2HT6A 1WP9A 2Z2ZA 1NRJB 2ZRBA 3ORSA 4W1SA 2NAFA 3UAXA 1X6VA 3NR2A 1GNLA 3LCMA 3PQ5A 3RAGA 1J70A 1D1QA 3U61B 3RWOA 1ULSA 3WLLA 1SIBE 2OGTA 4XWAA 4MQUA 1E79A 4JB0A 1WXXA 3SYTA 4UFPA 3W5AA 1QAOA 4CEIB 1M2FA 4F92B 2QUHA 5F21A 2QUKA 2VT6A 1L7RA 4GX1A 3I30X 3TAXA 4GKKB 1YNSA 3A4TA 1FNDA 4LRQA 1TMYA 1HDIA 3LTEA 4N4AA 4BEWA 1FSPA 2PY6A 2CEAA 4AP6A 4BQFA 2B5WA 3VZBA 3DBIA 1XPJA 2WPNA 4GOKA 2JLQA 4INPA 2XUGA 2BBSA 2DHCA 5ETJA 1PHPA 2D62A 1HYBA 4MITA 4RQTA 4Z3DA 2OBFA 1JAXA 4FOPA 5AI5A 2NV0A 4WRRA 4BBAA 1QMPA 4X95A 2C5FA 4RENA 2YQ4A 3OLYA 3RFVA 2B35A 2HA0A 1ODKA 2GHTA 1PS0A 1TF2A 1GPAA 1YQWA 4JI7B 3CRVA 3H97A 4MVJF 4BMNA 3VPDA 1APBA 1RLJA 1U1DA 1UK7A 2IELA 4KNVA 3TZEA 1GFZA 4D99A 2HKIA 4BB0A 4NZMA 2JGRA 4EUFA 3S8MA 1RYMA 1UBNA 3GP8A 2ACKA 4GOOD 3O4RA 3TQIA 1T5DX 3ICVA 2WJHA 2JZOA 1JDVA 1Z68A 1WKBA 5K6AA 3IUJA 2D4HA 4ZTZB 4NJOA 5A3QA 4ETMA 5LA6F 4RHEA 2ZRDA 2PVCA 2QJRA 5IARA 4ZVSA 5EMLA 2QD4A 3WIOA 4OJTA 4TYMA 3JQCA 1I0LA 1EGVB 3V1MA 4JC8A 4MUYA 4DYVA 2Q27A 1IWOA 2NLOA 3K1AB 4HB2A 4BNDB 2O7RA 2FR1A 3AY7A 3RS3A 4TTSA 1I1HA 2VP5A 4WBNB 4ZVUA 3GT4A 2HFKA 3VH2A 1MVOA 5KPDA 4AJHA 3IKTA 3AR2A 1DAOA 3KPJA 4DKXA 1E5VA 3U4QB 4WZAE 3NYIA 4RVSA 3LPMA 3ZU5A 3EF0A 3FNHA 4UBLA 5DNUA 3K0AA 1SIUA 3QE9Y 1E3DA 4KQWA 2FR0A 3UHAA 2ZU6A 3WYEA 4ZDJA 4W5WA 3AF6A 4YACA 1J2YA 1MEJA 2O7QA 2AUMA 1YHZA 2VPXA 3WHKA 4RSRA 1GZUA 4NXMB 1ZMOA 5SYAA 4JHXA 4E4TA 3W4KA 1JH9A 1E32A 1PKXA 2Q3HA 2H2IA 1KEEB 2Y3IA 3BH6A 1QH0A 3PQ8A 1ZRNA 1CS4C 1PFYA 1LH0A 5CX1A 4F3NA 2FWAA 1CS0A 2HU7A 5EJ9A 4CT0A 1ZSVA 3IP5A 1N2HA 3AJDA 3DQPA 5AR1A 1NXTA 5GJVC 1TQ2A 1Y6JA 1HL3A 1SPXA 1C0PA 3OEED 5K03A 3RVBA 3AR6A 2X19A 3BEDA 4G97A 1QIJA 4AUKA 2XTAA 3PTZA 5AOBA 3O7WA 1WE2A 3UH0A 2J48A 3E1GA 1AGXA 3C6KA 5HBGA 1IJFA 1W36C 3B7GA 4ZPXA 1E20A 1Z5UA 4DCTA 1ISJA 1QTQA 1F0NA 3WOHA 1OC4A 3BQ9A 1OA0A 3CCBA 3IKMB 4FBLA 4OATA 3BS4A 3CW8X 4I1OA 3P0IA 1C4OA 2XNHA 4Q12A 2Q5FA 1BHO1 1M76A 2RHBA 5C1BA 3NBUA 3K5PA 2RKOA 3G85A 2J6BA 3QE4A 4HDOB 3KXLA 5CIYA 1XXLA 3LXMA 1ZUNB 5FOSA 1Z4OA 4KV9A 4OHUA 2C5GA 4CKEA 5L3SA 1MG0A 3AGQA 3KVVA 3IUPA 3TL3A 2ZRIA 3IOCA 1EXDA 1ZICA 4R41A 2BP7A 3UJNA 4UU0A 3A1TA 4RTQA 1ZGBA 2Z2YA 4OXXA 2WHPA 3EC1A 1PT8A 1ARZA 4K9RA 2A5YB 1ZL2A 1D07A 2YV4A 2J7PA 1NM5C 3O31A 3RRMA 4ZOAA 4B5LA 3ON5A 1T0JB 3AHHA 4IMRA 2GSWA 2GETA 4NAHA 4Q15A 4NV3A 4M4SA 3RYIA 4YHBA 3WIDA 2O8CB 3CUSA 2ISSD 1W6UA 2ODWA 4OFZA 1XWIA 2QIPA 2VZEA 3QVUA 2FUG1 1KZ4A 3QWHA 4QQRA 3NVMB 4IFEA 1TCVA 2DPGA 3F71A 4LKRA 4FYHA 4QECA 3Q3IA 3KYJB 5EAIA 3IAXA 2GEVA 4QL3A 3NCHA 4MLPA 1FMTA 5TRTA 2J5QA 3THOA 4FFVA 3W2IA 4YV2A 4YPOA 3AUUA 3L0ZA 2B1GA 1Y7PA 1M1NB 3C7TA 4CWAA 3ZE2B 5FWYA 1JTVA 3ASYA 4Y6RA 1Z56C 5FOQA 3JPYA 5J3JA 3EZ2A 3P96A 1D2EA 3ELUA 2JCYA 1IEWA 4YAFA 4PU0A 1Q17A 3JVIA 1XZQA 1XEAA 1LW6E 3K9QO 4GL2A 4BP8A 3I04M 4LMPA 2YZNA 2PGIA 5TQ2A 4J43A 2CFIA 4EG0A 3GAZA 5K6TA 3KQQA 5T41A 2GF2A 2I3ZA 4AKSA 4N54A 2N42A 3OU2A 3HXQA 2OP0A 2XXAA 1IOZA 2I99A 3EVDA 3QWIA 3SF0A 2Y9PB 3CR8A 1V11B 4GPZA 1RRPA 4MWEA 5EMMA 4H60A 3ZGOA 1WB6A 1RHJA 2IDKA 3DM5A 5A3VA 3NT5A 4B44A 4AAYA 1S8FA 1XRMA 2QAGC 4V2UA 4PBRA 4Y2JA 5K0CA 3LNTA 1UCFA 2OD2A 2A9OA 1X1BA 1VRCA 3DEIA 5KHLB 1ORVA 3KEQA 5I4IA 4EY5A 1S02A 1Q0RA 1VYUA 3ZNPA 1XZNA 1GITA 1G6Q1 3DV9A 4BNJA 1M1YA 2AQKA 2MYNA 5BN5A 1DQPA 1KBOA 4KRXA 5JJ5A 4S3MA 3SP1A 4DV3B 1Z26A 3C8HA 1EP2B 3GLVA 1LWNA 3DZFA 4XTCS 4LDRA 1Q2UA 1JQDA 2OAQ1 4B0PA 1R6UA 3GPLA 3QX9A 3QNUA 3EIHA 2XB2A 4H35A 1UZLA 1BO6A 2OZLA 1B8OA 4CV0A 4EKEA 5H80A 2AN9A 4L74A 4AIIA 5L7WA 5CM2Z 1HQCA 2ZSKA 3A9CA 3IUNA 4R2KA 5LU9A 3EF1A 4AO6A 3SMQA 4BASA 2AVDA 2BFDB 1T5BA 2CDCA 2XW6A 2ZWPA 3A9VA 3MB8A 3ND5A 1N92A 2G6TA 3AKDA 4KQEA 6NULA 4GRAA 4BLSA 1NMYA 1RI1A 2D0IA 4TVKA 4L4YA 1DBSA 3DEFA 5CVDA 4L85A 1J6UA 3AG6A 2PZFA 4U7JA 2OVFA 3ENWA 5KVQA 5K0SA 2WWHA 3H5IA 3HYLA 3RAPR 3E27A 1XZCA 3KJEA 1KDYA 1MAVA 3GGSA 4ZMRA 3MYYA 5KDOA 1Z18A 3BORA 4YJGB 2D0DA 3ECAA 1L5MA 1A9SA 1CRLA 1EUDB 3T3EA 2AUNA 5ALSA 4DQLA 2W43A 1C7RA 1R3DA 4F86A 3TZLA 1N2EA 1L8LA 4B6RA 5C0OE 5JI2E 2F3QA 4BNXA 4URVR 1A71A 3UOGA 3COJA 1I0ZA 1X7ZB 1Z7BA 2GBGA 3K94A 5FJIA 5J1SB 2RI1A 1JA9A 1FFWA 2RKWA 2C7BA 3M2PA 2C95A 5KINB 2VWQA 3ACDA 2V7QA 4XM0A 3PIIA 4YJ3B 4N7MA 2C8LA 3IEVA 4AJOA 2EEZA 4RIFA 3QQ5A 2Q2QA 5K0NA 4FB4A 2F9MA 1GXSB 3M81A 1YQUA 1B42A 4B6FA 4ZARA 1UWKA 3ILYA 5H1YA 1WF6A 2ZCVA 3ZY4A 3P2YA 4WLEA 3PXUA 1NR1A 5TX7A 1I3NA 4O2LA 5FPSA 1PR1A 3W77A 5K8VA 3T5PA 4WE3A 5L7TA 1E3WA 3AYXB 4LRXA 3R7FA 3EVFA 4QYIA 1MW9X 2GR9A 2W0MA 4JFAA 3RK4A 3MVEA 1S3FA 4EG4A 5KSZA 4OHMA 1NNLA 4XJSA 3RC7A 3ESRA 2FW9A 4JXJA 1BCSA 3BDAA 4RVGA 5IFLA 4KYUA 1SA0A 1N5DA 1YB2A 3OT1A 3T1NA 4KWHA 1YCHA 1SY7A 4YT2A 1N36B 3Q8WA 2RAVA 4A16A 2WHQA 5EKUA 1HO3A 4MW4A 4P98A 4CHTA 2XDQB 1BJKA 3DFUA 3ZGZA 4CFZA 2P0EA 2GVDC 4UDNA 4UOZA 3PGVA 1XZMA 2EGGA 2YJ6A 3FIUA 2B5VA 4MKXA 4UCFA 3F2VA 3Q4GA 3RT1A 3ZU2A 4HXEB 1CD5A 2MINA 4LJ4A 2PBLA 1LBIA 1QKJA 3B7WA 4D4HA 2NXEA 3G9ZA 1N6NA 4JODA 3KJGA 4QFCA 4TRRA 2Z57A 3FSGD 4UZEA 5FXMA 5TQJA 1YQDA 4BZQA 1E1KA 4Z49A 5C37A 3JAMA 3HPRA 5EP2A 4BMCA 4EQ6B 2CFTA 1LS6A 3S5UA 2FG6C 3DAHA 3FDIA 2QXYA 3HABA 3KBOA 4J90A 4XH9B 3K0SA 1BYUA 1I4EB 3FZYA 4U7DA 1RJ9B 3OM9A 3CNEA 1E1LA 3F5QA 2YJZA 2W00A 3FUUA 2BJWA 1M54A 3ZDCA 2I8AA 4P3NA 2FDXA 1VM6A 5U1PA 1DKMA 3JVEA 1IN7A 2O52A 3FWKA 5FL7A 2JIRA 4X85A 3WLSA 5HVNA 1IVSA 4K0KB 3K09A 3T6KA 1ISMA 3I52A 5A5FA 5KTMA 5DTIA 2IXEA 1K7XB 1UFOA 4J03A 5EIOA 1R0WA 1KO7A 2NO7A 4HX5A 5K1ZA 1SWWA 4A7PA 2WKPA 2AFIA 2XUPA 4FDVA 1XMOB 5C8VA 2MSNA 3RV3A 2GRUA 5DTEA 5FBZA 3BCSA 5IAJA 3STXA 3PSHA 1H8ED 3FPAA 4R8VA 4HB3A 4K0RA 5LQNA 2ZVQX 5TSDA 3NPAA 4TROA 5BOSB 1WY7A 1H6CA 2HQBA 2IT1A 2QYSA 3B9PA 3IDZA 3IRUA 3RSCA 3RAEC 1A9XB 4HWOA 2V9PA 3F4KA 4M54A 1DEAA 3AY6A 3QX7A 4LGMA 1ZXXA 2ZSDA 3Q10A 1FS6A 1IZ7A 2ZUWA 1RT9A 4LSWA 2VYND 3WC4A 4ZCQA 3R3WA 5HIJA 3ZE8A 2GFIA 1E2MA 2A1UA 1AQLA 1ZK1A 3GUVA 1XB2A 1XPUA 4DTCA 3KEFA 2V5UA 1BQEA 4R2XA 3IXLA 3HKDB 3U60B 2BSQA 3DCYA 4PC1A 2IV3A 3JQRA 3QJGA 1HDXA 4EX6A 5CG1A 1J33A 1ECJA 3H18A 1G98A 3TL2A 2I65A 2KBFA 5H9WA 1GZSA 4NCHA 5IAAA 5M7EA 1JEYA 2VDKB 4K1XA 3RLIA 5CYOA 2C3PA 2QAGB 4WL0A 1K6JA 5AH0A 4E5NA 1J90A 4EO9A 2R11A 2HGZA 3V1LA 4FHCA 1NNI1 4QM7A 1V37A 3JXEA 1DLJA 1TUIA 4PPQA 4C0HA 4TKUB 3NDBB 1YR9A 1U4OA 1CR0A 2G6BA 4R0VA 4RE6A 5E1OA 4CDNA 3H11A 3SZMA 4ETIA 4EUKA 4V0MA 2EQBA 4CNBA 5MF6A 1RQ7A 4Q1EA 1YZNA 1H0RA 4GZ5A 3QXSA 3T3IA 2PLWA 4G1VA 3KVNA 1OLUB 1TJPB 1U1CA 2GJSA 4G2NA 5J9FA 4AF7A 2EBWA 3DVRX 3HK2A 3BTSA 3DEHA 1NI3A 5E0KB 3ZHTA 2O2SA 3LC7O 4ZI2A 2ONCA 4RLSA 3KQVA 1H4TA 4S2UA 2ORYA 1Z8NA 1XNQB 1CERA 4YY3B 3I8SA 3KZMA 1NU6A 1R3UA 1NUAA 2XCOA 3UAZA 3PZRA 5EIWA 1FFXB 1ZNZA 4AMVA 3OSUA 4R1MA 1KH1A 1L5OA 4N0QA 1X7DA 2DQZA 2W6QA 2YY6A 1XMQB 2X5OA 5DI3A 2C31A 1MUUA 3NTLA 5L7YA 4QQ8A 3PFNA 4AMBA 3M4YA 3NOXA 2MU1A 4RVHA 5C8DA 3ZIAA 4AJKA 1QVAA 2XCSB 7YASA 3K53A 5FNZA 3LGSA 4NZNA 4Q4LA 2K7ZA 5EJMA 3NPMA 1Q77A 2W6JA 1NMZA 1QGZA 2I9PA 1FRZA 3E70C 3L8DA 3O94A 4L6CA 4OLFA 3VO1A 4ER7A 3UAOA 1A72A 1TZBA 4CLDA 5LN1A 1Z22A 1A9QA 1H9AA 1SC4A 3DE3X 5K3CA 3TH5A 1O6FA 2F90A 2H51A 4GM0A 4ZI7A 4HC4A 4R31A 5ITZA 5BNWA 2Z9BA 3QVOA 1TDJA 3G2NA 4LPSA 4XOIA 3UHFA 5G4LA 1P9RA 5KJ6A 1XLVA 1ADCA 3K0CA 5KYUA 3HN7A 4UZSA 3WGKA 4KR0A 5ELLA 4DLYA 1T25A 3ZK7A 4Q9DA 2MIIA 2V6MA 2XNDA 2EGHA 1R10A 3PXXA 1BKDR 3IV9A 4IINA 3I9KA 4UUOA 1KFKB 3NHZA 4XR9A 4W5NA 1T5IA 4A27A 3U44A 1WCWA 3VC1A 2OD7A 3P1JA 1RKVA 1HYEA 1VSVA 3RSHA 3TD6A 1KARA 1NXVA 1W4BA 1ORRA 2AFHE 3Q9SA 3UQYS 1P3Y1 5D6NA 1CR4A 1CRWG 2VPTA 3B6ZA 4ZQGA 1U1FA 1I6LA 5J23A 4Q7MB 1DV1A 5DLPA 4D7AA 2QVZX 2YV5A 2RG1A 2R8PA 4G26A 3HKEB 1FYWA 3E8MA 2ZANA 3R41A 1IRIA 1RCFA 1ZNQO 3LQQA 4DM7A 4RH3A 3D0QA 4WNYA 1IZYA 5CP8A 4OIFA 3DPSA 1C4XA 2P30A 2O50A 4JYCA 3DEYX 4ZGGA 2EBFX 3WZ2A 1J4AA 5AK0A 4BNKA 2HMUA 1OSNA 1Z82A 3NW9A 4NBLA 2EZ8A 3ZTYA 5BQ3A 3PTAA 1FF9A 3BE5A 3LSTA 3RU3A 2GK6A 4EHBA 2CLSA 4IIGA 1BJRE 3Q88A 4TLLB 4RUKA 1QIKA 4RY9A 4C76A 4CKXA 1CR2A 2CJPA 4OH1A 3KOYA 4K2AA 3ASZA 5E6SA 3JWJA 3QMMA 4MCAA 5HDBB 4FN5A 3RT9A 1K5PA 4EHJA 2D1RA 1NY6A 4R3NA 3QFRA 1Q5PA 3A3KA 2VHXA 4ZVMA 1E4OA 1GYRA 1G0NA 2ZLBA 3C3WA 2YWJA 3FUTA 5BNFA 1VI5A 4YJFA 5LMUB 2YRXA 4KH0A 1BRTA 1BOFA 2W48A 3B6KA 3MTQA 4FN4A 1U2GA 1BGVA 1LTHR 4II7A 3VBEA 3VI3B 1HR0B 3LW8A 3GUCA 1SUIA 5EJAA 4A2PA 1Z5GA 1BS9A 4PRLA 3KETA 2W8BA 5G2OA 5FFNA 1LF0A 1H94A 1SRRA 2DT8A 3BGIA 3I0NA 4YV7A 1QHYA 1RM4A 1Z5NA 4M9RA 4BNGA 3HNOA 4BRUA 3SPXA 1U8TA 2OYSA 2PGAA 3AIMA 4HAOA 4L57A 4RHXA 3WMRA 4B6PA 4HVCA 5KVVA 1CNEA 2I4LA 4OJKA 3WAGA 3R5FA 2ZSJA 4Z9AA 2O57A 1E18A 3IT1A 2Q5EA 3N0XA 4W7IA 5D2CA 3MINA 1II8B 4ECAA 2JGDA 3NHWA 4C08A 2DETA 4P81A 3Q3CA 1ORDA 5F4ZA 1U2DA 2NYAA 3STWA 1E2QA 2HPHA 2VHWA 3CWQA 4BO5A 1CC1S 1CFZA 1P0FA 3Q12A 1G7TA 2JS7A 3S1AA 1U2PA 2IOFK 5CYGA 3JZIA 4YP1A 1E3EA 3KL2A 5I8PA 2UYQA 3R6LA 4OGLA 1N5MA 2IV7A 2VSQA 1KFBB 1UODA 4TKZA 4QX6A 1RADA 2V98A 3RHSA 4LTDA 5IHXA 1EBFA 3T9DA 3VR2D 4KSBA 2QLLA 1HSOA 1TVKB 1WZCA 2DFDA 2GN2A 1RWXA 3ABSB 2GAJA 3A9SA 4JIMA 4K46A 4KVZA 3R4VA 4Y2PA 1SXHA 3ZY2A 1DSSG 4EGFA 4CLOA 5J4YA 2JCVA 2P9EA 3QEMB 4JROA 5FOVA 4K8OA 1DELA 3RYFA 3EUFA 2VEOA 3GGOA 3PD7A 3O1LA 1NMEA 3VQTA 3ZLJA 2GA8A 1IU9A 2CUTA 2IOQA 4D80A 4ESHA 2C20A 5TF4A 3TTXA 1GDHA 3EOZA 4J29A 4XYBA 3RS2A 3FKJA 1QWSA 2PMWB 3ZG6A 3Q7RA 2HLDD 2XMZA 2HTFA 4HL6A 4LYDA 3ROPA 4B80A 1D7AA 3GJ7A 1I14A 3SQMA 2CBGA 3GAFA 4J2HA 4E94A 1RC8A 3SZGA 3BD7A 1VBMA 1PYOA 3K4QA 5JXGA 1CUYA 4EZIA 2CLEB 3MJSA 4HK4A 5EHXA 4TS3A 4DWWA 3SDBA 4EY6A 3OE1A 3T34A 3TSCA 3IQXA 2GFHA 3L05A 4COOA 3ZW7A 1P1IA 3OQIA 3RAJA 1UOPA 3BMXA 4D8VA 1MOZA 4UHHA 3UWOA 1U9IA 3ETGA 3VPHA 2VP9A 2UAGA 1TEXA 3GVXA 5FF9A 4F46A 3ESDA 3G59A 2WKQA 1A8PA 3L41A 3L7CA 2JRLA 2ZCUA 3HKBB 4ISCA 3I09A 5U4XA 5CJ2A 4BE9A 2G3YA 1W2GA 2CNLA 2YIJA 1P6UA 1R8JA 4HWPA 1T6ZA 1KYQA 5TV2A 4RTKA 4ENPA 1OH6A 1IFXA 1VOTA 2QRJA 2QTGA 2WTEA 1KHHA 4F7WA 1B16A 5CFZA 3I2HA 3EG9A 1GQQA 5L4LA 4KSCA 2EW8A 3TM5A 2WF6A 5IS2A 3IR6A 2J30A 1QLWA 3IIIA 2WFZA 3WGHA 2C1EA 2G67A 5I51A 3A06A 1TIBA 4AMZA 1Y48E 5EMNA 3EYWA 1DI0A 2ZS7A 1G3IA 4KK3A 4RJJA 3IOBA 4X6YA 2P9JA 5IKMA 3RARA 1MENA 4URYR 3TCNA 5JWOA 1Y6FA 1B23P 1NW6A 1ZD5A 4O3FA 1SOWA 4EGQA 4B3DA 5F2NA 4GPAA 1FQJA 3HVJA 1KTVA 1PBNA 5B37A 5DWVA 4DUZB 1E3LA 3R7LA 1O1YA 3EIQA 4CM6A 4XIJA 2Y2UA 1J8FA 3OTWA 2HMSA 3II6X 1RAGA 1W46A 1X94A 2G1PA 1OAOC 3KM0A 2IDZA 1HDCA 1AGPA 1G5RA 1ZW6A 2PKWA 2XEXA 3KB8A 3SICE 4OJNA 4HLUC 4EJMA 2Z1DA 3QA9A 5FL3A 1C9DB 4YJHB 1Q12A 3I9NA 4CU2A 3C8MA 4DAOA 1LK5A 2QW8A 3ASVA 4OX9B 1C9KA 3AYZB 4DV0B 3A05A 1J21A 3Q9UA 2E55A 3UMFA 4HGRA 4L4XA 1TW2A 2F4VB 1NNSA 2QLNA 3AEXA 1DG3A 4KRGA 2V3WA 2GARA 4CKWA 5KSOA 1UPUA 4PN7A 3KJFA 3WB0A 2P8JA 2YWCA 4BO2A 5EE0A 2Q50A 1CWUA 3QJYA 1KP2A 5FBLB 5EJ7A 1BU5A 3K0AB 4L07A 5HUHA 3LECA 4LVNA 4NIMA 4MYUA 1KPHA 2BN4A 3CSSA 3V1UA 2IPXA 4P5PA 4NICA 2WM3A 1VLQA 2G8NA 3GGCA 4H0FA 4Q7EA 1J99A 1UR5A 1QF9A 3H0EA 4B8WA 1QOPB 4FOTA 3U0BA 4IF4A 4PNHA 1BZYA 2G82A 2GK7A 2JJMA 3I76A 2WB4A 3BWEA 2D1YA 3MT9A 4U2EA 2XWPA 1EFUA 3P2EA 3Q3JB 4NESA 2X0EA 1R00A 3ABRB 1Y1RA 2ONJA 1DTWA 2GXQA 4HJXA 2XTNA 4R1NA 3TRIA 4MGKR 3ZTWA 5L8VA 1MOPA 2B8NA 3AMVA 3R2JA 1OTXA 5DHQA 5AM1A 3TJRA 1E6MA 3GZNA 4ITUA 4TVSA 5KQMA 1PG5A 3SI7A 3G8AA 4JH0A 4EEKA 5M29A 3U3DA 3F7NA 3PPXA 1BFUA 4OGKA 4XJXA 2A0YA 4M8IA 3L1UA 1Z2NX 2UZ3A 8ATCA 1EDOA 2IHVA 3HRKA 3GL9A 3RVMA 3F49S 2P68A 3GXOA 3NS7A 3HXPA 5ED4A 4W5QA 1QBGA 5AD1A 1ZESA 1K98A 2IEIA 2FY8A 4DB4A 3EXHC 2VHJA 1D4FA 1G5QA 1PTJC 3WDLA 2Q5OA 3K9BA 2OHIA 2JFFA 4LZNA 4ND3A 3ICOA 3ZDFA 3JAWA 4ARIA 1FQKA 3AVPA 4OKNA 5L3SB 1FMCA 1ATZA 2F3UA 3BXHA 5IYZF 3U19A 1PR9A 1RYDA 4GI5A 4OY3A 5K51A 1N6OA 2LZ0A 3UKOA 4BCBA 1GGNA 2IE0A 2NXJA 2V4UA 4WA8A 4D6XA 4E2FA 8LDHA 4MPJA 1RPTA 4PG5A 3SVTA 4EZBA 2ZTHA 2J59A 2IHTA 2WHPB 2X2OA 3QEOA 4FI3C 4Q1AA 5E9QA 5FA5A 2ZR0A 1ZAKA 2B3TA 4UUMA 2FPRA 5KNDA 1G8KA 2YS7A 3QBTA 4RZ2A 3FPHA 5I7AA 1EX6A 1VIAA 2ENUA 3MBKA 3VR5A 4A5SA 3CJRA 2OMEA 3WMGA 3ITEA 4E70A 1ZJ4A 1VL6A 1NVMB 4AZ0B 1Y1LA 1JMVA 1Y7IA 5AI9A 2BDEA 3OTHA 3W7AA 5T3UA 4TLMB 4QJ5A 2H4FA 4LWZA 2MMCA 3ZNNA 3TB4A 4HRXA 1HG0A 1V3QE 1Q22A 2EVWX 1Q6YA 2FFJA 2J9RA 1BX3A 3QOFA 1WG8A 4OUDA 5KYNA 3K9HA 2ZB2A 4D4KA 2E87A 1E9DA 1ENPA 3IHTA 5DT9A 2LDBA 2ZAOA 1RWMA 3PGKA 3ZUPA 5LQRA 1WA5A 3JASA 4ZK2A 1PZHA 4HAXA 3V1KA 3V4LA 5DNAA 5DM0A 3FDXA 5B30A 2EF0A 1TRHA 1XAGA 4HWKA 4BO0A 1SB8A 2YIVX 4QAJA 2IOYA 1LDMA 2R1TB 2H08A 4P8RA 2IUFA 1KETA 3I9JA 3K96A 3PXAA 2GN0A 3A7DA 3SKYA 1TGVA 3TIXB 4ZAVA 4URFA 4MUJA 4BHTA 3FBGA 2ZR8A 1O08A 3N5CA 2SBTA 3AESA 1L7BA 4ZU1X 3ZX5A 2XXAB 4MB2A 2H48A 2JFUA 2MR6A 3HR4A 3K32A 2CK3D 2ONZA 3OESA 5KNBA 3B6MA 2WTBA 1FBTA 5JE8A 4ON9A 2FNAA 1Z83A 5C5CA 3ER6A 4G65A 4NEQA 3TM4A 2RHWA 3LGAA 4OU4A 2FZGA 1SG0A 1EFHA 3D0OA 1SHZA 3QITA 4ZALA 3C3AA 2ILTA 4PGAA 1Z06A 4JGBA 2UVDA 1XHLA 2CLCX 2W4IA 2HO4A 5DLYA 5JZBA 1NRIA 1R4NB 2SCUB 2VJBA 3NHFA 5LP6A 1VFPA 5HWSA 4LCBA 4FFRA 1QHNA 3IEUA 5JPIA 5IBQA 1QTRA 3HHEA 4O4LF 1ZK3A 2OGUA 4P5EA 4G9GA 1QHIA 1FFYA 1XLWA 1OVGA 2O8FB 3CO0S 3RS7A 2OXRA 4H7DA 3BRSA 4JR1A 1P39A 2BGMA 3U4MA 1Y3BE 2BKUA 2OOKA 3IDOA 3ZJTA 5B3AA 1XDGA 1XKLA 5T6MA 1ICEA 3I01M 4ND8B 2P6MA 2OZLB 3SG0A 1AZSC 3U7JA 3ZUGA 4TYNA 1RMQA 1M1UA 3RF6A 1SBCA 3C5WP 3PF9A 4UJ5A 4B09A 2Q6VA 4MS4A 1I36A 2Q0QA 1WCYA 2GERA 2RGYA 5B1HA 1JDBB 4XGKA 4RKYA 2RK3A 3OT4A 1JEOA 1SRQA 5EIAA 1ETUA 1TZKA 3JCZA 3QI2A 1H3NA 3SY8A 5AM4A 1SBNE 2PUGA 1HZZC 4CM9D 4AJLA 2WZCA 3E7FA 3GUUA 4Q48A 5DTJA 3DTVA 3U7GA 4QUAA 3NVKI 1VPVA 2IVZA 5ECGC 2C8VA 3RNOA 1OWMA 1UOOA 2X23A 4IZOA 4YP6A 4IDFA 3NZEA 4YC7A 3IPXA 4ND7A 4FS3A 5CEEA 1LV7A 1FVXA 3LFTA 4UMDA 4W5TA 4Y67A 1DBPA 3DMDA 1T5TA 3H86A 3CXUA 1XU9A 4NFSA 4P83A 2AZXA 1MZPA 2QZ4A 4MW2A 2IOHA 3GAMA 4MUMA 2H9YA 2HHCA 1GQSA 1Y8QA 2E6KA 4P2BA 2VF5X 2JCSA 2VQDA 1RWOA 2ENWA 1NUQA 3O03A 1PBTA 1VYVA 2E82A 4WKCA 4PPYA 3ZNQA 3BA6A 4JJZA 4KQ6A 4QICA 1W88A 1Y3DE 2P11A 1YBAA 3IXMA 3ONFA 4DA4A 2BM9A 2PZGA 4D8UA 1VE3A 3PUYA 5ES4B 3UMCA 2AI1A 3K9WA 3WWOA 3DFFA 5J4LA 4QYIB 2EW1A 4CQMA 3FUWA 5KZMB 3ZDBA 4C2BA 4P0TA 1Q20A 4HAYA 5BV1A 1AT1A 2EAUA 2TRSB 3BDIA 4M0KA 2NSJA 3AZOA 1CEYA 3Q40A 1ZVVA 3R6WA 2ZRFA 3T3HA 4PFKA 1YI1A 1KI6A 5I7HA 2GM4A 1JDSA 2FW7A 2UYYA 4J3NA 5K6RA 3S8YA 1E1CB 1GTJ1 1SUWA 5KS2A 2B61A 3QUQA 3EASA 3LK7A 1NNEA 2FVXA 1TKBA 3H4TA 5JU6A 5EZ5A 4POOA 4JQYA 2RCYA 3VR0A 4TXMA 3DT9A 3NUZA 5L45A 5B1EA 1GVHA 3PGXA 3ZLVA 3WVNA 2XOKD 1NLYA 2ZRLA 1Q2XA 3MOIA 4OJYA 3WZMA 4ASUA 2X0NA 3CNOA 5JQGB 2JVKA 4NOJA 2BEWA 1RQPA 4HLCA 1R6XA 4O4IB 3SXUB 2G0TA 4C0SA 2JPDA 4RNDB 2AOTB 5EESA 4UHJA 4NYIR 2VNSA 2WYVA 1Y1PA 4LDQA 4LVCA 3CNQS 5AWFC 4QHSA 2QGNA 4YRPA 2PUDA 4KE7A 1EM8A 1LSSA 4O25A 4TWBA 2I3AA 1EI9A 1P77A 4AYTA 4F71A 3UUGA 3ZQ4A 2G0AA 3MT7A 1PDOA 3O8OB 4JASB 1EM6A 1XJ0A 2OCIA 3UCEA 5B5SA 3OI7A 5ICSA 3M9LA 2VDOB 4P31A 3GY0A 1OBOA 4GXRA 4WJLA 5IH3A 1CTQA 1AS3A 1LTKA 1QRDA 3IEIA 1G66A 3VDMA 2IIPA 4GE3A 4UE2A 3SKVA 3GLIE 5F7XA 2WYIA 4K28A 4GZ3A 4TYYA 4KO2S 3QE0A 3EFOA 1R0RE 4GOND 2K87A 3ORHA 3DL4A 5CXQA 2G70A 3A14A 1DAEA 4KQIA 4DC0A 4K40A 4I6JA 5IMBA 1CF4A 4B3MB 1ZRHA 2BY4A 1TL7C 1VBKA 1SUSA 1UC8A 3SDZA 1U3VA 3P27A 1OFTA 5EWLB 3OLWA 2HMAA 3NRBA 2Y2VA 3RSZA 3KSZO 1L5KA 3QFCA 4EGCB 4HKTA 4ZCSA 2GWHA 3F3YA 1QBKC 1H6BA 2F1JA 2G25A 3I1FA 5B36A 4ZC8A 2C2WA 3CRMA 4YQEA 4FW9A 3TPFA 4YFYA 5DN6A 2ZJ0A 1SB9A 3KSUA 1WD5A 3X43A 2OD9A 3IMFA 3KCNA 1HWYA 4ZOLA 5LDDC 3ADOA 3HN2A 2F62A 2Y4OA 4IWXA 4DLXA 3D4IA 5A03A 1BH6A 2CV0A 4L4UA 2PGOA 2Q0SA 2GM3A 5TPZD 2P9GA 2E3JA 5JR3A 2II6A 2O9JA 2FRVA 3C3PA 4NMXB 1Z62A 1Z25A 1JQ3A 1R6TA 1HEUA 1PJAA 4JVLA 2E1RA 3M82A 4JN6B 4JEHA 2ZIWB 4MUXA 5DX8A 5T64A 3O73A 4TV8A 5DV9A 5ALQA 4DEVA 3CLRD 3QEKA 1X7HA 1JF8A 3TXYA 1GRNA 2XA1A 5H82A 1KOLA 2VAVA 1L1EA 3L6DA 4BN4A 1SCQA 3LLMA 1HK7A 4G23A 1FTNA 4MIOA 1AKMA 4M46A 4OHBA 1NY5A 2NV6A 1NM5A 4G56A 4KAXA 5TARA 3V2GA 5BWLA 1RI5A 1DFIA 3DLBA 1CDOA 1PD1A 3D3WB 3NC1C 3OEWA 1WB4A 1G2IA 1Y5MA 2DY0A 3B9RA 5SYNA 1OROA 2AG1A 2CNWD 3EXFB 4W9NC 5LUBA 2COEA 5IAKA 1QK5A 4F6RB 4KO1S 2O2ZA 4L72A 2NO5A 3WLEA 2ZAIA 1Z2AA 2QPLA 3TLCA 5DM4A 3AFMA 1KQFA 1QVVA 1TTQB 2YDYA 5BUQA 2HN9A 1ZGGA 3OOEA 4PSVA 3T54A 2PU7A 1P5JA 4JP2A 1X80B 1QQBA 2QPAA 4A10A 5EUCA 1R0LA 2WSSA 2PMFA 4G4SP 4KVGA 3LDUA 3DXXA 1FU7A 1VSQA 3OC6A 4QDJA 1BYIA 1FU4A 2WUDA 4E30A 2IHNA 3HB4X 3ZOKA 4KQJA 2IEAA 3STYA 5J2UA 5HKKA 4OQDA 1Z88A 2DFTA 4BEJA 4DQXA 4HEHA 4LC0A 1QO0A 4OK5A 2PD4A 5DI3B 4CMIB 1GIAA 2A0FA 2VYVD 5BURA 5K05A 2P5YA 3T1VA 1UWLA 1J0AA 4UOEA 3DCIA 3JR7A 5LC1A 4FTWA 5JNUA 3BF8A 3F90A 4MTLA 3QSYA 2CCGA 1CUCA 3C6YA 4GSYA 3LMKA 2W6OA 3URMA 4CNQA 3GFTA 1KXZA 2P2YA 1YQ9A 2OPBA 4QO8A 1FP7A 3L8MA 3FDFA 3U1BA 2PUCA 1ODCA 2WF5A 4M83A 1PUJA 2CFRA 4ILEA 5ALXA 2CHQA 2V6IA 4HB4A 4JQCA 5ALUA 3FHTA 4Q9AA 4AFNA 4RW0A 1ZM3A 2QXTA 4XI9A 4CE6A 3GJ8A 4HDRB 4OFXA 3V3KA 1I9CA 1SCBA 4KO3S 4Q03A 3BH7A 2DPMA 2VJOA 4DPMA 4A6EA 4ZI7B 1P9WA 4MR8A 4B4KA 1G16A 3JQAB 4DIKA 5CLQA 2IZ5A 3IMKA 3LIPA 2P9ZA 2A5DA 2OFOA 1CB7A 1U2EA 1V0JA 2ZYUX 1C7ZA 2HMVA 3ETLA 5BYBA 3U48A 2OHXA 3PF8A 1A5ZA 4IUCS 4MRNA 5C34B 1QH1A 5KHAA 1O89A 1TQ4A 2PRKA 4Y6SA 3EWSA 4HNRA 1WMFA 4LQLA 1SCUA 4BWGA 3S5JA 4CM4B 1MRZA 4M9SA 5T4HA 5ARDA 3UJDA 1VECA 3FTPA 5CIQA 1NL3A 1WHTA 2P2CA 2HCJB 1K3TA 2PZMA 3MCUA 4AJJA 1ISSA 1H0HA 1X8LA 3E4DA 3HJNA 1EGAA 4B45A 4BMOB 5CW1A 3EEYA 3HPQA 1PN3A 4CL0A 2NNLD 3PC4A 4FOSA 1NRXA 1JJFA 1AKWA 2YX1A 2OXCA 3QUTA 2QD3A 1EDBA 1P2VA 4U3JB 5K3EA 1PNTA 3M70A 4KI7A 4YRLA 3EC2A 4OREX 5F23A 2YFKA 3C4JA 4FNOA 4D9FA 3LQFA 2RGBA 1RZRA 1V3TA 2RBEA 4EZEA 2Y1WA 1ODIA 5LIRA 3PWKA 2Q4DA 2PE5A 4GD3Q 1FCJA 4P33A 4DCMA 3T7IA 4PCAA 1FBNA 3FNBA 4FUTA 5SICE 4AWBA 1L1RA 2ZVPX 3KCQA 3UFXA 5CDFA 5IAEA 1NF2A 4B2PA 3M9XA 3QEBZ 2ZS9A 3QFSA 3S99A 1XDDA 3QU4A 4DE5A 1COWA 1NF8A 3NHSA 1CY0A 3LY7A 4FDTA 4JL5A 3TB6A 1ZL0A 2GHIA 1KSGA 4E15A 1E7SA 3JQ8A 1ULBA 1ZRSA 3BPSA 4GECA 4J1TC 3KVYA 4V0NA 1M3SA 1V48A 4G41A 2L42A 4QBGB 5EHIA 3CLTD 5A04A 3RFCA 5CVUA 4CTOA 1ZKDA 1KIFA 4DFDA 1AZTA 3TLZA 1Z0IA 3C48A 3K9CA 2HWYA 4JUBA 2QKYA 5G3ZA 4HPWA 4XVHA 4ZMSA 5BUZA 2ZSAA 1SVSA 1NMQA 4MUHA 4NENA 4FFMA 5BPHA 5K0GA 4LHWA 2WJAA 4ABTA 3ELYA 5DGXA 4YV0A 4BXOA 3GOQA 3CW2A 2XRYA 3L7IA 2O7SA 3SE7A 2Y71A 6YASA 4GMGA 5DBGA 4DV6B 3DE1X 3I12A 4JU9A 5K0FA 2FEOA 4L5IA 4TRNA 5JAPA 3TDKA 2FSGA 2DXIA 2BMAA 4RMGA 1L3BA 1X9IA 2Z3WA 4DCCA 3B89A 2P3OA 1LVGA 2MSLA 3DL2A 2H4JA 1N0IA 2BFMA 4DXHA 3KLBA 4DT1A 1VE6A 2NZUG 3ZWPA 5FWNA 5LA6B 5LR6A 5IBCA 1FNSA 4X92A 5EKXA 2JGDB 2GNOA 4PLTA 3DEZA 5FTKA 2XGJA 2R65A 1ZLXA 4RA9B 3DJFA 3OCJA 5FEMA 3PBKA 4OI1A 5ALHA 4KE6A 5EFOA 4URUR 3PPIA 1Z28A 3NUGA 5DCUA 3ROFA 2H85A 3OCXA 4FGWA 1KE2A 1RCUA 4O33A 3CVXA 2GO7A 2V4MA 3BK2A 4TRMA 4YCDA 4KUEA 1V35A 1GGJA 3BFPA 2IOFA 2HRDA 3WRVA 1IWBB 1RW4A 4B6SA 3PDCA 1WETA 4EVRA 4I3GA 5F1YA 1FFDA 1CNMA 1KEVA 1QTIA 1H22A 1YFZA 2ID8A 4TS1A 3T3GA 4ZEVA 2FN8A 4BMPB 1FDWA 3WGZA 3N75A 1VLZA 4P36A 4LSGA 5B3JA 2OBMA 4K2HA 4I81A 1NJFA 3CEJA 4RABA 3NATA 4QJBA 3V7FA 3VR4A 2UZ4A 2C61A 2FWRA 1VPDA 1KAGA 4MEBA 1NAHA 1DZ3A 2W6ZA 2WJVA 1WZEA 4I6EA 4E07A 5IWAB 1OFVA 4OB8A 3L7AA 3T7CA 5L9AA 4LHEA 3DNFA 2UXCB 1WXFA 5F5XA 4UTZA 1ETHA 1ML4A 2XECA 3RG2A 3KQNA 4BNVA 1ENZA 1G3RA 4MWTA 4EA6A 5IASA 1G9SA 2CB0A 4XUDA 1SR8A 1SU6A 3A0RB 5TJHA 2G36A 3TZKA 4Q4HA 5JNWA 9GPBA 1XQWA 2XNSA 1UZMA 5CB8A 3OQIB 3ZQKA 3UHJA 2BFOA 1A50B 4ILKA 1JR3A 2PZLA 1H0SA 3I6BA 3FN4A 4LYFA 5A6SB 3INTA 2Q4OA 1AB6A 3NFYA 3ZCXA 2EP5A 1KZYC 2Z43A 1WS6A 2PXAA 1SBQA 4JI2B 2WD9A 3AKCA 1P18A 3QTTA 4Y9DA 4G36A 5JAUA 4C4ZA 2VATA 1XTKA 1RRCA 4EUSA 1QB8A 2NAPA 3P7MA 2IV2X 1YA6A 4MQEA 5CYFA 2CDRA 5DU2A 1KQGA 1DRVA 2AD5A 3T3PB 3EG9B 2V9CA 2ZUDA 3B82A 4C4PA 3F3MA 1MDBA 1F5NA 3RANA 3RRBA 2WRZA 1OD6A 3LL4A 4FOOA 4FSXA 2NTNA 4M88A 2B6NA 4Z0HO 3T5DA 2DBQA 3EBPA 3V55A 1Z17A 3F74A 4Y6LA 3A58B 4ERXA 5IXSA 4K9MA 3GUHA 2FFBA 1GQ2A 3ADDA 1QPBA 2C2BA 2EJWA 1JIJA 3C4QA 1L5LA 2FCRA 4E1VA 2AI2A 3FNQA 3I4FA 1C0EA 1C8LA 4OHVA 3R7DA 2I78A 1G8YA 2BR4A 1KIMA 2QD5A 4I08A 4I19A 2F3TA 1SU7A 3LXRA 4DCGA 1JBEA 2Z2XA 2BMVA 3DG9A 4MYDA 1W9HA 3BERA 4HNVA 2O8DB 1FNBA 1DUSA 1E9BA 4D44A 5JZSA 1JHVA 2OHVA 1NW3A 2BJHA 4XSHA 1HE5A 4MR9B 4YN3A 1R8SA 3ENKA 1CUZA 1CUAA 2O0LA 2P9QA 4UXHA 4CM3A 3UPTA 1Y34E 5DIZA 3CG0A 3UAVA 3ZVNA 1NJ2A 2KJQA 2FRDA 2WT9A 1GG5A 4LF5B 1TO6A 2BBWA 4S35A 1B93A 2JFXA 1T2DA 2EJUA 2XA9A 1XK6A 4M3NA 3TNYA 4CMHA 2UXDB 2CUNA 1EHCA 4GLFA 4MIKA 3SN6A 2WQ6A 3QELA 4CKWB 1QQTA 3TD2A 2AMFA 3UYKA 2PIAA 4FKBA 2PJDA 3KYIB 1XKXA 3BCHA 3L4EA 3FMVA 3NAGA 1ZBDA 3HNPA 3OZRA 4MVCA 3VFDA 5B4UA 2BVNA 2CW5A 2P3QA 1YDMA 5KPJA 1V39A 2HA7A 3H5OA 2RJ3A 2WLSA 3LIIA 2XVMA 2QS9A 2YWDA 2HY7A 1CY1A 5C4GB 5B6PA 2XWSA 1UIMA 1A8UA 4RY0A 3HWSA 2VJQA 1E0DA 1K66A 2NOAA 4LHXA 3X1KA 4IS2A 4IDDA 1R0KA 1ELOA 1GUBA 4GIBA 4EKGA 1GQYA 4PSDA 1THGA 1H8HA 2ZSUA 1DTWB 1XCOA 4BTLA 2W70A 1ADGA 2WWIA 4MJ3A 4QU9A 3G0BA 4GDFA 3LFHA 1I13A 5BV0A 3LBFA 1V71A 3LHKA 1N5KA 3KAPA 1P31A 3GLFE 4PS0A 4YWJA 4MUEA 4KODA 3W5DA 3PYMA 1G55A 1JT9A 2BFPA 4K9KA 3VKGA 4LDZA 1JT2A 1ZXLA 2FV8A 4BV9A 3H2JA 5CJJA 5E6UB 2ZIXA 3ZQUA 4AP5A 3TDNA 1Y5IA 3U56A 1FJGB 3KKZA 1P0CA 2O5RA 4FCVA 1RQGA 4HHEA 4K05A 1O6CA 2W2LD 3H9CA 5FNVF 5KU1A 1MABA 4IJQA 2XAUA 3OM1A 3EZXA 3AETA 3WY9A 1FX0A 3OJFA 2RD2A 1FSFA 4G37A 4BFYA 1E6KA 3N7UA 3MRTA 2I4NA 3VYVA 4ED9A 3LC0A 4I3HA 3OG9A 1ECGA 2W2QA 2BZGA 1V95A 1X9HA 4IXMA 2ZAMA 4GGOA 1NWCA 3H5AA 1OU0A 3MM4A 5FO0A 4A2WA 1R5OA 2CVOA 2FEWB 2IYFA 4JLOA 1EJ0A 3L7DA 5L3QB 4PV7A 4FQ7A 4B47A 2R8BA 3EMBA 1NQWA 1H4VB 2CMDA 1QQ7A 3VSDA 4C07A 1ECLA 3FSEA 2Q7XA 1HFEL 4ZIRA 1SEVA 4LY6A 5FI0B 4NZYA 2AMLA 1NJ1A 2QSJA 4O0MA 4P6VF 2Z56A 5KQGA 3MRSA 4M98A 1L7QA 2HBYA 3A1WA 3LBHA 4ZT7A 1UMBB 4E5UA 5DGHA 3IL2A 3RC8A 2OPHA 2OV2A 5KAMA 4A0GA 1JG7A 3DQQA 3NT4A 1XNRB 4EFNA 5TS3A 1N2BA 3I64A 1KMCA 4IOJA 4CM8A 3T8YA 1MJNA 2N75A 3FD8A 4ARCA 2DJIA 3S2IA 1QZXA 1QE0A 3PGMA 4DQUA 4H6PA 2JGLA 4OXRA 5CJPA 2KI5A 3LBIA 3QW2A 4COKA 3AFGA 3NEAA 1YFJA 3OPNA 5JSFA 1N8KA 5D00A 4E2XA 2HXYA 4MVJI 4N3NA 3VTAA 3WLIA 3MFYA 1UBHS 2OHHA 3CXRA 4WJKB 3T7RA 4D9KA 7AT1A 1GN8A 1L5ZA 4WQMA 2Q07A 1HNZB 4F5DA 1ZK4A 5IJWA 2EKDA 5J47A 3I42A 3C8UA 5K99A 2Z0MA 4JX9A 2IVFA 1Q92A 1P0PA 1NQAO 1YDGA 3EIOA 4RA6A 3ZZ1A 2ZJBA 1TAHA 1XCJA 4R1OA 3KZ1E 4JBNA 3V4OA 4WOPA 4YGXB 1KBQA 1II9A 3ZD8A 4CT4B 2G71A 4LTNA 2GBLA 4E2WA 4IPTA 1FFAA 5CG2A 1FTSA 1CZRA 4ZZ1A 4IKEA 1RSZA 4A15A 4DIOA 4C01A 4CJXA 3NHUA 3RHTA 4KYIB 4LDAA 2WA1A 3DT8A 3CYFA 2Z08A 3L8FA 3ZWBA 4B6EA 2JLXA 1K5HA 2FW8A 2C42A 4ITVA 3D3QA 5J1TB 4ZK6A 2HHAA 1WUHS 6Q21A 2R48A 1A5SB 1KIAA 2C54A 3HYNA 3I5MA 4JD5A 4D9JA 1XI2A 3PEYA 1PJ8A 1RP7A 3PC3A 4E09A 3X3HA 3GRKA 3U3RA 1JB9A 4UTRA 1ONPA 3SIPA 2TMYA 5AKZA 1Z2PX 3M6LA 1OXKB 4OMUA 3TW8B 2AMVA 2H3EA 1PJSA 4TZ0A 1UDCA 5AHWA 1VDZA 1GO2A 2J5XA 3ANMA 4Y1FA 4RCYA 4AKIA 1WEKA 2HV8A 1EVIA 2OESA 3HP4A 1CIVA 3W1VA 2X0KA 4KFSA 4U8HA 4J7XA 2V7GA 3REQB 2AW5A 3FPGA 4FYMA 3FPBA 1JVNA 1XXHA 2V65A 3T94A 1V3VA 2YZKA 3IVAA 4RGVA 1Q1BA 3B3GA 1CULC 3FFTA 5KTPA 4HNQA 2B4RO 4AY5A 4ENUA 1ENOA 2EJVA 3F6EX 2RGNA 2FOLA 4L6IA 2CFOA 2WLTA 4MP3A 4PGGA 3KTDA 3LUCA 3RTCA 5HIKA 1OB2A 1CVIA 3H9BA 4FFLA 2FGJA 1U0FA 2A8YA 2YVKA 4WZZA 5FV7A 5B4VA 5JXJA 2WA2A 1ZHHA 3OOYA 1XQ6A 2ORWA 4UULA 4C4XA 3F96A 1ZSNA 1L4HA 1P4GA 3FMIA 3FPCA 4ZO8A 4B3FX 4G67A 4CF6A 3E8SA 1LJ8A 3W8DA 1ZXBA 4Q9KA 3SK0A 1CUXA 1MB3A 3GLFB 3DR3A 1M34B 3JVVA 4II3A 5CEFA 2GVZC 3VZSA 3ND6A 5BMOA 2WTXA 2ECQA 4E3ZA 1S7CA 1RC0A 3PJFA 5A4MS 1GSIA 2R87A 4B46A 1XVVA 1F12A 3AG5A 3HRIA 3RRYA 2ZRPA 3I83A 1P7PA 4R40A 3VDNB 4PIMA 1RI4A 4XQEA 3ZBQA 1TYCA 1R0CA 2XMSA 1KJQA 4Z3KA 1CQZA 2PKRA 1F8YA 4I46A 4BLOA 3DE4X 3DTTA 1W88B 1ODJA 3QVLA 2WY2D 4DJDC 5JSZA 3LJKA 4WINA 4MQ5A 5JS2A 2C7QA 4QT0A 4NXNB 4BWVA 4MX8A 4XKJA 4AL4A 4CI9A 1TUGA 4Y2HA 1OHHD 1V4VA 3CTMA 1I4OA 1XMJA 4HH3C 5F33A 3W4JA 4CQMB 1ZI6A 2CXRA 2HCRA 3EDRA 3N8GA 4MRPA 5CDGA 5JTUA 3MTAA 2ZTVA 2A2ZA 4OF4A 3RUHA 5TT1A 2BLLA 3VKHA 2V0NA 1VLLA 4MW5A 4DY4A 3A6DA 3ANYB 4HQKA 3NVAA 4U8GA 1I32A 3VOTA 1UADA 4OK6A 1OPXA 5BSKA 3BC1A 1ZM4A 1M1XB 1YT5A 3V42A 3IBYA 1B3RA 3P2MA 3MWLA 1HFJA 5FPYA 3CCFA 5I7RA 1JQLB 3C3JA 4EW1A 3AILA 1IOLA 3LT0A 2QRQA 5KYVA 4C88A 1TLTA 2EWMA 3WGGA 3LCUA 4A8TA 4GKAA 2HAEA 3HVRA 2OCXA 4QG7A 1GPBA 3CUVA 1U6JA 2G5PA 3G5AA 3OE7D 1E0KA 4ZA2A 3SOPA 4PTYA 2BEWB 3K1TA 4ZCLA 1MO2A 1OAOA 2FX3A 5D8DA 4F21A 4JI5B 5EJ2A 2P35A 3H9QA 3R3HA 1N2JA 1KMHB 1PDVA 1X77A 4MA5A 5AI6A 5THKA 1D2NA 1TT5A 4IDNA 4N65A 2J3HA 2Z6QA 4KE9A 1P1FA 1E3SA 2VJDA 3OQPA 2V8OA 1JQKA 2BSAA 2FSUA 3VZRA 1DDOA 4JQSA 2NZWA 3ICWA 4O4HF 1TM7E 3GZ4A 1XAIA 1R0ZA 4MR7B 4QPPA 4ALMA 3AXSA 4BX9A 1VKRA 1YB1A 4PZCA 5ALNA 2FN9A 1T2NA 1WW2A 1C0LA 4BV3A 2N3ZA 2J85A 2XUJA 3M3PA 4U2GA 2F8TA 3FGNA 3U3MA 3K30A 3H87A 3PIDA 5KKAA 4ZKDA 4X66B 2OHGA 1ZD2P 3DVAA 2BKVA 1CDEA 4KNWA 1TCBA 3DBHB 4I2VA 2Q9BA 3ZVMA 3EULA 2HJVA 2ORED 4P2GA 1JXOA 3LUKA 2IZ7A 4BO3A 5I7EA 1NXOA 3IAS1 1XV5A 4IIHA 4PHHA 3O91A 4HZGA 4XSGA 3GFQA 2WJJA 3JSXA 4Y6QA 3G5TA 4R3WA 4RESA 1Q15A 4XIIA 5DEOA 3NDPA 1FYDA 4CUKA 4BY9E 3KQYA 2PMKA 1Q16A 4RVUA 2BKAA 3CPEA 3WGMA 5KWSA 1ZYUA 3HO6A 1E1DA 1T35A 5C8YB 2AJBA 2IIBA 1I94B 3GJ6A 4Z4CA 2EARA 2YVAA 2LD4A 1KVSA 2QLMA 2WU3A 4XB2A 3E1SA 2HA4A 4D2IA 3O8CA 5EFZA 1BE6A 2RB4A 3OLXA 2QU7A 3ZTTA 3UMJA 4X7RA 4K6GA 1Z7GA 4AM8A 4CCYB 4JYAB 5D1HA 1CQJB 3ZE9A 3Q7QA 3SC2B 1R0YA 3GVPA 5A5DA 1D1TA 4F96A 1AQJA 1J0XO 3KAKA 1Z07A 3DVSX 4ZYVA 3V32A 2WZBA 1RQXA 2VOJA 4WN3A 5I9MA 3RI3A 3CU5A 5A4FS 4V38A 2NT3A 4PX5A 4PCUA 5F5LA 4F0JA 4KJXA 3EXHA 4PCLA 2HYIC 2WP0A 5CFLA 4EYOA 1PTJA 2ZKIA 4IFIA 3W4IA 1ZIDA 1GDDA 2XWBF 3W3AA 3IUMA 3ZR4B 3WSTA 3FCAA 5IZCC 1UK8A 3MMPA 4G86A 5DKFA 2BFBA 5HGJA 1N2SA 3E9NA 1HMPA 3F6SA 3A1CA 5DYTA 2WHRA 1TTTA 1Z75A 2JAPA 4B82A 4I50B 3IR7A 1EDZA 5ALRA 4BIIA 1DKUA 1S01A 4Q66C 3ZIDA 4L3WA 2QJWA 1CXZA 5G4KB 4CMGA 1K08A 2XGOA 2WSBA 3EB9A 1ZUWA 1IPHA 1GAWA 2QMUA 1HTWA 3GDWA 1M2OA 4DNXA 5IJ9B 5CTJA 5BPFA 5AW9A 2IX3A 4PGFA 3WB2A 3R6TA 3ENQA 3AFIA 5REQB 3JYQA 1N33B 5AVVA 1EZ4A 3VJMA 1R64A 1V26A 3ZX4A 1IL0A 1P17A 4RMHA 2HL6A 4DRXA 4RPHA 5KB3A 1CRPA 5AOCA 1UPCA 1RXEA 2DF8A 3O8QB 2R5WA 2GN4A 1QC5B 4S1PA 3CR3C 3ZKWB 3BKWA 1GP2A 1GZHB 3S28A 5KVCA 3DO8A 2AOUB 2NU6A 2PS3A 1HLDA 1RTTA 1N2GA 2P1DA 3B52X 5DTMA 1A4IA 1D6SA 2PFKA 4LKOA 1UJBA 2QN9A 2G07A 3OD5A 2QT0A 2IUSA 1EA5A 3G02A 1GFSA 4WY8A 1C7EA 5D5PA 3KXKA 3MOGA 3UJ3X 5COBA 4NNOA 3IBCA 5FOWA 1I5OA 3SKXA 2YHAA 1BROA 4PHCA 2VH5R 1ADJA 3ZV6A 2AN4A 1DMSA 1WSBA 2P91A 5CLLA 3TR6A 1XZFA 4DADA 1D6NA 2ADMA 2PQ6A 2REBA 4W6QA 1QRSA 5JOQA 1JDNA 4H1VA 2J09A 1DGQA 4QDXA 2V7BA 1U0HC 1XEXB 1ZIXA 1GRRA 1SBIA 2J3EA 4G8CA 4BU1A 2HO5A 1C1XA 1TMOA 4UHDA 4NOKA 3KXPA 3STTA 2PMCA 1F4PA 2W8ZA 4WUVA 2JFQA 4OI0A 2ZPAA 2DPYA 3ETNA 3G2KA 3QMPA 4OSEA 4DDTA 2RGWA 3GARA 3QRWA 4NS4A 3T4EA 2AN3A 2FP3A 4FCWA 4FHEA 4EVIA 1LDEA 5ADUS 2A35A 4WW0A 1X1CA 1RD4A 1SCIA 5TQ0A 1U0SY 3M8KA 3PJDA 3R6GA 4UNSA 4OHZA 3EQ2A 3AZQA 4JGGA 3VDQA 3FB1A 4R2LA 3EXG2 3H5WA 3LPNA 3QMWA 1QH1B 4WDRA 2ZRGA 4B79A 2HSJA 4YBZA 4N5NA 2QEQA 5CFRA 5DRTA 2C7VA 5LOVA 5DGDA 4PLPA 3MWEA 5ALFA 3SD7A 2G7ZA 1QAMA 4U6QA 2VNKA 4GX5A 4B4WA 5HRUA 1QYWA 4GPTA 2HNKA 4LYJA 5EIBC 3BGOS 1U3GA 4A8JA 3O4VA 4YB8A 4Q24A 2AE2A 2X4DA 4GBGA 5E38A 3ZEIA 3CUWA 5M04A 3AB7A 3ES9A 4LMBA 3LUDA 4NCJA 3IOYA 4U2CA 1BMQA 4ZU3A 3UHOA 3ZGNA 5HM6A 3B78A 5F7OA 5HPYB 4C5CA 4EHDA 2MT9A 1RKUA 4WK6A 5LKRA 1NLUA 1SUEA 1YRBA 2J07A 5BYJA 5JISA 2JEYA 4O4JA 3MMZA 4BQIA 3NWOA 1Q0SA 5LQUA 2VL7A 3GW8A 2QE7A 4MH0R 1RKBA 2J5BA 3OECA 5K01A 1HZZA 1XWWA 2QD2A 1IXSB 1X1AA 3FPJA 4YJ2F 3H3FA 5BQPA 1T15A 4OLAA 5FYQA 3GJ5A 2JD1A 3E9ZA 4X45A 4LUCA 4ZQCB 3UY4A 5HTOA 3OA2A 4P4SA 4B83A 4CFSA 3P19A 3RRFA 1G6KA 3COZA 4AX4A 1Y82A 4P5DA 1UBCA 3ZCRA 2O07A 2X58A 4MP8A 5DK4A 2VK8A 2QR2A 3PGA1 2IUYA 3TRHA 2QSUA 5JMOA 1Z5WA 5CVEA 1QKIA 5DULA 4X20A 5FORA 3K6SB 1JQBA 1W34A 2KE5A 1DX4A 4QUGA 2D5BA 2VUIB 2H5JA 2OTCA 2QPOA 4RHYA 3E5HA 4QGFA 1M83A 2FR8A 2R7MA 2JAUA 3NRJA 5C81A 2R25B 4N76A 2C84A 3MLBA 4BB9A 5LJIA 2LP4Y 4GC5A 3WGTA 3L18A 3WKDA 2D1QA 1ZH0A 1DEKA 2IZZA 2ZDGA 2XLCA 3MNFA 1G8JA 1Y6ZA 2XVZA 3MXOA 4U9IS 3RAFC 1PX0A 1XVTA 3JSAA 3ANTA 2HADA 3KE8A 2NWQA 4X97A 1D3AA 1FL9A 3W3ZB 4JJFA 3BMCA 3PHCA 3G5MA 4B71A 1SUBA 4HNSA 1PCXA 1EWKA 5JQWA 2BH9A 1TTPB 1MP0A 3JYPA 1MZVA 3IAAA 5IVPA 1Q7BA 5FWDA 1B1AA 2NO6A 1RRMA 3UB2A 3IE1A 2FPMA 3MT0A 1E5QA 1JILA 3G9UA 4QVGA 3OEHA 3I6QA 3G79A 3VPGA 4D3YA 1VHJA 1US8A 2LV8A 1KSFX 2HQOA 3CVJA 2RONA 3KZXA 3R23A 3E05A 5IBRA 5J63A 4BNYA 5I9TA 4YT8A 1T0HB 5FIUA 1T9HA 3HCNA 3COYA 1FQOA 3HCOA 4NEGA 4Q3EA 3C4VA 1KQOA 4WNAA 2HHHB 1VIVA 5I7VA 4EPYA 5C7IO 3WLAA 4UHFA 1FEZA 3E22A 1UKYA 4Z2YA 3QF4B 2VJCA 4RD2A 3AU9A 4LJYA 3W1EA 1MBZA 4UUNA 1FYFA 5HFJA 5A7HA 3TVDA 3M33A 4PIVA 3WGOA 4CLXA 5E2AA 4F3TA 5G41A 3SQOA 5DLEA 1SVMA 3PX3A 3D6UA 4M60A 1F4LA 1JNXX 3UFBA 2OXIA 2CC2A 3OKFA 3ID6C 4WOBA 1DV2A 5J5CA 1LQUA 1Z47A 1N2OA 2BMDA 4ETNA 1Z6QA 4AP9A 1BNCA 4MWSA 4PC6A 2FQWA 2PUWA 3KFXA 3K0BA 1KI7A 3PK0A 4ZV9A 3TNFA 3NWEA 1HL7A 2IGBA 3T9CA 1YMUA 2REQA 2IZ6A 2ORIA 2O2CA 2AHRA 1VGQA 1DB3A 2HA5A 2ODQA 2QGFA 3C8DA 4D3SA 5B1IA 4CCSA 3CISA 2WPDA 3L84A 4OLBA 3JARA 2I33A 1E79D 3T3OA 2POQX 4PG6A 1L5VA 2QLTA 2QZZA 3GCWA 3NLLA 4NBWA 1ZMRA 5TGZA 1WBBA 3HA7A 4OQEA 1P5FA 3NC0C 2VJKA 3TBKA 2XIQA 3BE6A 4EA8A 4J2OA 1D9XA 4J0CA 3UV7A 1VLHA 4RPJA 3ZLUA 4AB1A 4FVTA 2M2IA 1MC1A 2FG5A 2O1WA 2H2HA 2Q6OA 3GNSA 4D6YA 2JASA 3IUSA 2ZWOA 1MB4A 2Q5HA 3LPDA 1VJ0A 1VJ5A 2XADA 1Z33A 1IBCA 4MOWA 5AKHA 1XDUA 4RPLA 4CT5A 5EVCA 4ZAYA 4F7DA 3PNMA 5DMHA 3CH5A 4I66A 2RHMA 4CHGA 1U2ZA 1WSAA 4HEA1 1U4NA 3OP4A 1T3GA 3ESXA 3GA5A 5G02A 3HSKA 2YFYA 1H6DA 3MLAA 5EXEA 5ITSA 1PW5A 3QPAA 3W9BA 1OLXB 3EQ9A 5FBKA 1E9AA 1EP3B 3FTNA 3JATA 5SZJA 3T7TA 2HDNB 1K9SA 3PL1A 2CD9A 3P20A 3OPMA 4MZXA 4BQQA 3VR3D 1IBMB 4KWCA 1C1DB 2G9UA 1YZHA 1JLLA 1CUSA 1NRWA 4EELA 4CTJA 1WXHA 4DNPA 1F17A 2QUZA 2NXWA 3UXMA 2ZPUA 2QTVA 2VNAA 1J0BA 2RGDA 4W9NA 4ARZA 1XZJA 2ZSFA 4ZVNA 2FMTA 5C35A 3RFUA 3Q5GA 4KN8A 1IZ9A 1I7DA 1DOAA 1KDRA 2OG1A 3TLXA 5JC8A 4LI3X 3TRDA 1S2IA 4EB3A 2YXNA 2PNFA 2NU8B 1IHYA 4EMUA 5GZ6A 5IK2A 2JJ1D 2ZRQA 4FWBA 1GPJA 3RQIA 1WAMA 3VTZA 2CXUA 3P0RA 2HEGA 2GEBA 5FT9A 1WPXA 3IVRA 4H15A 1L8XA 3DVQX 3EPRA 2GDZA 5H0IA 4DUGA 1P7VA 1ZK0A 4C6RA 1E8MA 3FBTA 5INTA 4PZDA 4RV9A 3E0QA 3RVPA 1V9CA 1E2NA 3FA2A 2JB9A 2ZK7A 2FA9A 3RVRA 2OFWA 1LRLA 4KEAA 4LK3A 1F6BA 3V4FA 2WJ6A 3JALA 4XD2A 3UAGA 5HP4A 2UZAA 2Z4RA 3JVUA 2XZOA 2FOXA 2B1QA 4WJZA 2QM8A 4NYIQ 4XGIA 5A05A 1KY4A 4ZJZA 3V8PA 3L4SO 2X5NA 1VSBA 4EW2A 1GWNA 4KO8A 4DF3A 2R8ZA 3OFNA 1JHAA 3LG2A 1N4DA 1D5CA 2H4ZA 4JR0A 4OD0A 1L3IA 4WIAA 3UAWA 3L7LA 5FLXA 2NZ2A 1JKMA 4PC7A 1Q1QA 1W19A 2DH5A 1OMOA 5AUOB 1V6AA 4JV5B 1YR2A 1JE1A 3E9RA 2DECA 2Y1XA 4J2TA 5AKGA 1JSCA 4ID9A 2P4SA 1CQIA 5KTRA 5EPUA 1MX9A 4HS9A 5IDVA 3DTYA 4MCHA 1N0VC 3B20A 1V8OA 1GV1A 1QOQB 1XLUA 1JYEA 4JUDX 4LSZA 5C5EA 2M1ZA 3O84A 2QX8A 3DWIA 1SWVA 1J1ZA 4IZ6A 2J8ZA 4PQGA 4U2KA 1H4QA 4C7OA 1PAUA 1CRZA 1AE1A 2HRCA 3ROGA 1RYYA 2ZIAA 4PYRA 3DCNA 2PAFA 2X8LA 4KXLA 4N9QA 2H1FA 3TLBA