4BVKA

Structure of y190e mutant of phaz7 phb depolymerase
Total Genus 127
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
127
sequence length
344
structure length
341
Chain Sequence
LTCGTNSGFVCKGTQTQYAGGFAPGVGYGGFGGGSCTATKTPVIFIHGNGDNAISFDMPPGNVSGYGTPARSVYAELKARGYNDCEIFGVTYLSSSEQGSAQYNYHSSTKYAIIKTFIDKVKAYTGKSQVDIVAHSMGVSMSLATLQYYNNWTSVRKFINLAGGIRGLYSCYYTGYANAAAPTCGSQNYENSYTFGFFPEGWYYGVWVSNPWTGSGSTNSMRDMPAKRTAVSFYTLSAGFKDQVGCATASWAGCDSAAKFASTTSNVKAQINVGAGSNATQADYDWADGMPAGGGDTTNGVGHFRTKTNTGAIIQRMLLTTCTGLDCAAEYTTGPKAAYNQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Biochemical Analysis and Structure Determination of Paucimonas Lemoignei Poly(3-Hydroxybutyrate) (Phb) Depolymerase Phaz7 Muteins Reveal the Phb Binding Site and Details of Substrate-Enzyme Interactions.
pubmed doi rcsb
source organism Paucimonas lemoignei
molecule tags Hydrolase
molecule keywords PHB DEPOLYMERASE PHAZ7
total genus 127
structure length 341
sequence length 344
chains with identical sequence B
ec nomenclature ec 3.1.1.75: Poly(3-hydroxybutyrate) depolymerase.
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01674 Lipase_2 Lipase (class 2)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4bvkA00
3WL5A 5IVDA 3H19A 1R3DA 2VJDA 3LS2A 3W2TA 1S8OA 2EDAA 4PF1A 4BB0A 4QA9A 3BE8A 4XX1A 2G5TA 2EDCA 3WK4A 4Q34A 2XMCA 2XUDA 3C5VA 3QMWA 4FWBA 1VA5A 5AP9A 2J3DA 4Y2VA 3GUUA 1MTZA 2PBLA 3CXUA 2CZQA 1A7UA 3R3WA 4X6UA 1DT5A 5ALVA 4X6YA 4NS4A 5K3FB 4BC0A 3U0VA 1HQDA 2HM7A 3MGAA 4CG3A 5T4EA 4L72A 4MYSA 1LNSA 3DDUA 3F96A 3FWHA 3O95A 3DEAA 3HZOA 4HRYA 5AIBA 2AJ8A 4C87A 4HZGA 3KWJA 2AJCA 4UBJA 1USWA 1J2EA 4OPMA 1MNAA 3G9TA 3H18A 5AKHA 3O9MA 5BWBA 3DS8A 4X3CA 1JJBA 2YASA 4YK7A 2ZYRA 4WFIA 1X70A 2Y2VA 4BDTA 4JH0A 3WKEA 4UBMA 3QMMA 1RYYA 5JZBA 3JYHA 2ES4A 5E2IA 5IVIA 1IZ8A 4Y2JA 3E0XA 3C70A 4EZIA 2JGIA 4W1QA 3FOBA 1SC9A 4QDZA 4EHBA 3PE6A 2XLCA 1CQWA 4E15A 4KRYA 1PV1A 5AKYA 1I6WA 1MAHA 3WLAA 2IITA 2I3DA 5F4ZA 4IH1A 1R9MA 3C6XA 1VXRA 2XUAA 1W6RA 1ZOIA 2ACEA 1AGYA 3ESDA 3SK0A 2AXEA 3HYSA 4TPKA 2OCKA 5AJHA 1CUFA 4ZV9A 3M82A 1JJIA 2ZJFA 4AZ3A 4IQ4A 1CUDA 3K9BA 1HDEA 3RK4A 5AIAA 4BVLA 1DT3A 4RGYA 3SX4A 1B6GA 2XMGA 3H17A 2WFMA 3G8YA 5AI9A 5JAUA 4BCCA 5AI8A 3BXPA 4DGQA 4Y2XA 1ZIYA 1G5FA 5T4BA 4QNNA 5AK6A 3KD2A 1RWQA 3BF7A 3C6YA 1GKKA 2RAUA 3DOIA 2DQYA 3IBTA 3IB3A 5FV4A 3C87A 1E66A 5JD4A 4F21A 2V96A 4FOLA 4C88A 2XQGA 3G9ZA 3AFIA 1E5TA 1R4ZA 5E4TA 5LKRA 3BIXA 1JU4A 2XMDA 4U2FA 4H0CA 1CUWA 4AO8A 2QKYA 4ZWNA 1UFOA 1JJFA 1UKAA 4MWTA 4X00A 5AICA 4OCZA 4MEBA 1XZEA 3IIIA 5JD6A 1QIMA 2HA6A 3H0CA 1LPNA 1UK6A 2XQIA 3QPDA 1EVEA 1C7IA 2DHCA 4ROTA 4FMPA 5HCUA 4E11A 2J4CA 2WHPA 2VSQA 1G42A 2VQ6A 1L7AA 1XRMA 4J0DA 4BVJA 2WU3A 3A6ZA 4KEAA 5ALKA 1GQSA 3WA6A 4X85A 3LCRA 4DNQA 3IUNA 4FKBA 5AKZA 1IUNA 4J7AA 1GPNA 4B9AA 1VLQA 2VA9A 2WIKA 2HA5A 1XZKA 4JYMA 4EY7A 3R3UA 1EB9A 1P0MA 3HI4A 4X6XA 5HQ3B 3R40A 4K6HA 2XQJA 2Z3ZA 3BWXA 1CUHA 3M3DA 2OGSA 4G8BA 2WG0A 3AZPA 2FUKA 2H9YA 2QXTA 4PSUA 5DNUA 1XZFA 3KWFA 4FFWA 3GROA 3C8HA 2QZPA 2WSLA 4AMZA 4N5IX 1VA4A 2OG1A 5AKLA 3FLAA 3H2HA 5CBKA 2WHRA 5ALMA 2B61A 3K2IA 5JALA 5J3JA 1OILA 1UZAA 4B85A 5LIPA 5ALYA 1UK9A 1IUOA 4JYPA 1BEEA 1K8QA 4AN0A 4DNFA 4E14A 4H7JA 3PDCA 1YA4A 2HFKA 4KYVA 1P0QA 5ALDA 3DNMA 1Y37A 1AURA 1ZD4A 4AXBA 2G5PA 1QTRA 3F97A 3DL4A 1H2XA 2NW6A 4PW0A 1WB5A 4HS9A 1YAJA 5CMLA 4P08A 1MT3A 4UBNA 1TCCA 1T4MA 1W1IA 3PUIA 1ZD2P 4ITVA 1K6EA 1UOOA 1K5PA 3I6MA 3TJMA 2WG1A 1D07A 3FAKA 2WHPB 1DWPA 4C4ZA 5C81A 1K4YA 2BCEA 4MWSA 1HLGA 1YSCA 4Z49A 5LZ4A 3I6ZA 2DFPA 3D5EA 1XZCA 5I9IA 2FX5A 4B81A 2DCMA 2PUJA 4B0OA 4C4YA 3ICVA 3BF8A 5KWIA 2HA4A 5AK3A 2XUQA 1LPSA 5DWDA 1C4XA 5E4YA 1WB4A 3O0DA 3OOSA 4X71A 5K5EA 3WK8A 2XMBA 1XLUA 4B9EA 4EUSA 4F60A 2YYSA 4X92A 2R11A 5KBYA 3RARA 4WJLA 4G8CA 3OTQA 3GFFA 3HC7A 1G66A 2PM8A 4H7IA 2WQZA 4I4CA 4W63A 1BCRA 1HL7A 3OG9A 2PUHA 5JATA 2H7YA 5EHNA 2HIHA 2JEYA 4B84A 3TRDA 3RLIA 2ORYA 3L1IA 2WILA 3GZJA 1WHTA 5HF6A 3DL7A 3ESAA 1YA8A 1J07A 2CEKA 1DQYA 2QOEA 1QIGA 2HA7A 3ILSA 2H1IA 4KE6A 5AH0A 4J0GA 2Y6UA 3QM1A 1CR6A 1GQRA 5CW2A 5ALXA 1Q0ZA 5T4HA 1PFQA 4N8EA 1EDEA 4UHBA 1DWOA 4BCBA 3U1TA 2CMFA 5D3ZA 2RI6A 3LP5A 3P2MA 3TGLA 5FPPA 3IDAA 4ZXFA 1PJAA 3G9UA 3WL8A 1CIJA 2WIDA 2QXUA 2PU5A 1XZLA 1ACLA 1QIDA 1ZI6A 3H2IA 3VJKA 5DTJA 4UHFA 2P8SA 2I78A 3S8YA 2H7XA 1DX4A 2PVSA 1WPRA 2VT7A 3KSRA 5CTAA 4H18A 4A16A 4C89A 3EF3A 3CN7A 3STVA 3G0GA 2ZSHA 3FSGA 5DLPA 1SOMA 2CJPA 5FKJA 2QS9A 1JU3A 4U2EA 2WTNA 1EA5A 4V2IA 2UZ0A 5FPQA 2WHQA 5E4JA 2ZYHA 4UBIA 1JMKC 4J0JA 1BN7A 4Y9SA 2Z5GA 3DCNA 2WJ4A 2CKMA 5JZSA 4CCYA 2RONA 3L1HA 3PI6A 1P0IA 1HPLA 1MAAA 1XZHA 3QBJA 3H1BA 5ALNA 3OURA 4X90A 1TAHA 2WJ6A 2OCGA 3FVRA 4HXGA 3WZMA 3Q8WA 3C5WP 1YS2X 3LLCA 5JAPA 5JAHA 2BGNA 4X94A 3PUHA 4QEKA 1VKHA 4DNPA 4ARAA 1H22A 2WFZA 4X93A 3WK5A 5IKXA 5AM3A 4GLBA 3VJLA 1XZBA 1B41A 1RP1A 1FSSA 2O7VA 4KE8A 2QMQA 4G4IA 3O9VA 2Q0XA 5AM0A 4C4XA 4Q3OA 1QOZA 1MX1A 3ZLUA 1LZLA 2H7CA 5D3KA 1WM1A 5LLSA 1CQZA 1TIBA 2XT0A 3ZLTA 4H7DA 4H7FA 3O4IA 5A7GA 3B12A 1H2ZA 1XRPA 1W75A 1YR2A 1THGA 4FLMA 3ZPXA 3OPMA 3D0KA 1UKBA 4BE4A 1MNQA 2ZYIA 4D9JA 4QDOA 4BP9A 2CBGA 4ZRDA 2ONCA 5HZGA 4ZV7A 5IH7A 3FCXA 3V1LA 1MX9A 4QWMA 5AI4A 2HL6A 1Q83A 4UBOA 4XIIA 1BEZA 1YB7A 1FFDA 6YASA 2HA0A 1QIKA 4QDTA 4LYEA 5I8PA 1EK2A 4BAGA 2WG2A 5A7HA 4WFKA 1CUEA 1W4LA 2B20A 3VVLA 2PSJA 2BUAA 5CT5A 1M33A 4G9GA 1AQLA 1QIEA 5ALEA 3JWEA 4RNCA 4GBGA 3STWA 5C8XA 2X5XA 3QYJA 1Y7HA 3V9AA 1H2YA 3WKCA 4QLAA 4RE6A 3V1KA 2OLEA 4Y2SA 3WIOA 1CUZA 5K3EA 4UFPA 3G02A 3I2IA 4DMFA 1ISPA 2GBCA 4BTVA 3C45A 4H35A 1H2WA 4N8SA 1OCEA 1LPPA 2JGLA 3NUZA 1R9NA 1ZD5A 3AIKA 3QPAA 2ZJ7A 5ALHA 3IUMA 1ORWA 5CH3A 3BDVA 3ZI7A 5JZ9A 2Y6VA 4YASA 3BL8A 5ALUA 2XUFA 1QIFA 3WWDA 4X91A 3IULA 3STUA 1SCKA 2GBGA 5JASA 3A2NA 2OQIA 3PFCA 4HVTA 1LZKA 2C5FA 1OXMA 4DMHA 2XB6A 1EI9A 2G63A 2WUFA 4OB8A 2V97A 3G0BA 2HU8A 4X7BA 3WK9A 2ZVDA 4H7HA 4XVCA 2D0DA 3N2ZB 5C7YA 4WCVA 1EDDA 3WI7A 3MUNA 4UHCA 1U8EA 3I2JA 3WKDA 3G9XA 1QFSA 1XQVA 1FJ2A 2XUIA 2PKYX 4AN1A 2WKWA 3TEJA 3W9UA 1TKRA 4NMWA 2IIVA 1QLWA 2XLBA 5LZ2A 3STYA 3R3ZA 5AK5A 1FFCA 4QZVA 1F0NA 2Z8XA 4QWWA 3NOXA 5K3CA 3QZUA 4TGLA 1MJ5A 4N8DA 3AZQA 1VZ2A 4JNCA 3WIBA 1ZGBA 1UXOA 4Q3KA 3C6BA 2WIJA 2ECFA 1EVQA 4XWGA 5DYTA 5AM2A 2PPLA 4J03A 2Z3WA 5EGNA 4H77A 1KEZA 2BJHA 4G5XA 4UHEA 5IVHA 4M0FA 5AOAA 4FNMA 3A70A 4IH9A 2O2HA 1CVLA 1BS9A 1XZDA 3R3YA 1UKCA 3QH4A 2QT9A 3VXKA 5CT6A 1FFEA 2J3QA 3WYDA 4OYYA 1GGVA 4OU5A 2GZSA 5EHQA 1UOPA 4WDQA 3VISA 3D7RA 3F67A 2RGUA 2OCIA 1E89A 4RPCA 3WQHA 3UUEA 1ODTC 2YH2A 1LPMA 4W9RA 1ETHA 1JI3A 3C8DA 1CUCA 2EEPA 4G4JA 5HF8A 4U2BA 4U2DA 2HHAA 3C6ZA 4BC1A 1IUPA 1L7QA 1AZWA 4FLFA 1F0PA 4DSZA 5ALPA 2XDWA 5D6OA 1CLEA 4KR0A 3VVMA 4KE9A 5A6VA 1CFJA 4DYHA 5FP0A 3DD5A 1YAHA 4GWLA 1GPLA 1XZGA 3R41A 3QPCA 3D4LA 5HF9A 7YASA 2FJPA 3G0IA 4P9NA 4ETWA 3W05A 4MYDA 4ARBA 3PF8A 5LZ5A 4GEGA 4Y2YA 5FOQA 3E1GA 1LBTA 1ORVA 2IX9A 4UFNA 2ZSIA 3F98A 5K3FA 2XMZA 3ZV7A 1BU8A 2WUEA 1LPOA 2D5LA 3FYUC 2VTVA 2W22A 4KAFA 2HFJA 5CH5A 2XE4A 3F8SA 5LZ8A 4W1RA 1H23A 3QITA 4HRXA 1DINA 1QIIA 2GYUA 5JARA 2X8BA 2GYVA 5FRDA 1HKHA 1A88A 2GYWA 2QJRA 4WY8A 3I1YA 1BRTA 1Z68A 1GT6A 1DX6A 2WJ3A 3X3HA 3LIIA 3T52A 1QGED 2O7RA 1CEXA 4B0PA 1QONA 4M0EA 1MO2A 3WYNA 5HK8A 4K2AA 5AI6A 4AO7A 4FFVA 5AKGA 4B6GA 1E8MA 3FBWA 4B80A 4MXDA 1TRHA 4DNOA 5AKEA 4Q82A 3E4DA 4DMKA 1LPBB 2XMRA 3EIOA 1EXWA 1HBJA 1SFRA 2VAXA 2QVBA 3G7NA 2VJCA 3F9CA 1QO7A 3I28A 4PNZA 2HDWA 2OQVA 1N5RA 5K3BA 1EB8A 1UK7A 3H2JA 3PFBA 3ED1A 4ZREA 2HA3A 5DNVA 3O4GA 3IUJA 3M83A 4LXGA 5CT8A 3EQ9A 1E3QA 4AMYA 5JANA 3FLEA 3WL6A 3R3XA 1AMNA 1CUIA 2OAEA 2OAGA 5JAOA 2VT6A 3HXKA 2E3JA 4GDMA 3HLKA 4Q05A 4FNGA 1CRLA 2B4KA 4WFJA 4BAUA 5LYYA 2VJBA 2XQFA 3AIMA 4BZZA 2R8BA 2C5GA 1ACJA 5ALFA 4AX4A 2ZJ6A 4UUQA 1KU0A 3ZLVA 1EK1A 3A2LA 1XKTA 5AKXA 2WFLB 1W52X 5AM4A 3G0DA 2XMSA 2JBWA 3I6YA 4YPVA 5A62A 5EHXA 5LZ7A 2WU4A 5K3DA 3MVEA 3ESBA 4GXNA 4C6HA 1XRQA 4CIBA 4DLNA 3DYVA 3M81A 3WK7A 4G9EA 3I1IA 1XZAA 3OC0A 4J0HA 2C58A 1XQWA 1YS1X 2WUGA 3STXA 1ZJ4A 3GELA 3DOHA 4UBLA 4KAAA 5EI5A 5H3HA 1XROA 2WM2A 4CCYB 4FHZA 3BDIA 2HA2A 2JGEA 3NGMA 5EIHA 3WJ1A 2VF2A 2QTBA 4J0CA 1QZ3A 5A2GA 3ZWQA 1EX9A 3ANTA 3E3AA 5A7FA 1VJ5A 4AB1A 1MPXA 5AI5A 4OUKX 5HF5A 4BAZA 2GZRA 3H2KA 1CUVA 2BAGA 1WPXA 4UBKA 5LP1A 2VAVA 3HSSA 1FFBA 4BYMA 2I03A 1JFRA 4A5SA 3WKAA 1K63A 1C7JA 5HFAA 5KREA 4M0MA 3V48A 4EB0A 4X97A 4I19A 4CG2A 3DJYA 2WIGA 2WTMA 5AO9A 1U65A 4P92A 4ZGBA 3EBLA 1FFAA 2BKLA 4G4GA 5ALZA 4IO0A 4DIUA 3T4UA 4LIPD 2RIPA 1WHSA 4OB6A 4G1FA 1SCIA 2BUCA 4XJVA 3BIWA 5KWJA 2CB9A 4E46A 4EY5A 1NU6A 3AINA 5CH8A 5FXMA 1TCBA 4Y2TA 4PSDA 2HU7A 3NWOA 4LXHA 4EBBA 1CUAA 4B83A 5BV7A 3D59A 1UWCA 3FYTA 4BCDA 3DKKA 1R1DA 2DQZA 3WWEA 5D7BA 3L1JA 2PL5A 1O6GA 1UK8A 4W1PA 4KJXA 1CUXA 4Y7DA 1A8UA 1E8DA 4S0XA 4JUIA 3BJMA 1XRRA 3KOOA 1AUOA 5JD5A 4O08A 3CCCA 5EHZA 4UHHA 2HRQA 2XUKA 2AJDA 2QM0A 2GBIA 3PF9A 5SYNA 5JIBA 4PV7A 5CURA 1CUJA 1A8SA 2JGFA 5ALGA 3KXPA 3HRHA 3JW8A 3H04A 4K5QA 1X2EA 4HXFB 5LZ9A 4QLOA 1CUUA 4LXIA 3H1AA 2J4FA 2ACKA 4UHDA 3VDXA 1BCSA 4X95A 5JADA 5DYWA 5T4FA 2Z8ZA 2ZYSA 3H2GA 3QMVA 1VE7A 4UPDA 1ZD3A 3RM3A 3IURA 2YXPX 1XFDA 5CT9A 2PSHA 2BGRA 5CXUA 4CI9A 2G4LA 2JGKA 4HTAA 4DTCA 1LGYA 1ZGCA 3W04A 1ZI9A 2OCLA 1YCDA 3V1MA 3KDAA 2O2IA 5HFNA 1R50A 2VJAA 2GBFA 3ICWA 5AM5A 4GI1A 3AUKA 3IVMA 4H7EA 5AKKA 5ALOA 4ZI5A 4BE9A 3SC2A 3R3VA 4J3JA 3WJ2A 2DHDA 3G0CA 1U4NA 4CCWA 1ZJ5A 1BN6A 3K6KA 2OXEA 1XZIA 4RE5A 5A71A 5BWCA 4TVKA 3RKSA 4MQLA 5EFZA 3WZLA 1VZ3A 1QFMA 3O4HA 4KRXA 1ZI8A 4BBZA 1IZ7A 4FBMA 4BVKA 3Q0TA 1TCAA 1XQXA 3D2BA 1DTEA 4PSCA 1W76A 5LKAA 5CRIA 1AX9A 1QE3A 1UOQA 5ALRA 4UFOA 1VOTA 2XI4A 5K3AA 3FVTA 3D2AA 5I7UA 3ANSA 1X2BA 1DWQA 1L7RA 1Q84A 4LKOA 2OPHA 3WKBA 4KACA 4J0IA 2DHEA 3OM8A 2Y1KA 4C01A 5BOVA 1Y7IA 2HRRA 2C0PA 2QUBA 2PSDA 4LYDA 2O2GA 3QVMA 2BUBA 2V9ZA 1GXSA 1Q0RA 4QDXA 4OB7A 4U2GA 5DTIA 2DSNA 3BJRA 3A2MA 4YX9A 1VE6A 1MX5A 2W6CX 3W9BA 1ZIXA 5AOCA 4AQDA 1E8NA 1QIHA 5CT4A 4L9AA 1MN6A 4KE7A 1G4HA 4Q3LA 1IMJA 4FBLA 5ALQA 2K2QB 1WOMA 2WFLA 3W06A 4EA6A 1XKLA 2JGMA 1GKLA 4WY5A 2C0QA 3B3QA 3N0TA 4EY8A 3FYUB 3CN9A 2HU5A 1XLWA 4Q1VA 3AIOA 1AKNA 4G8DA 5HQ3A 4IH4A 3C43A 5AOBA 3FNBA 2OGTA 5DNWA 1JT2A 2DR0A 1SCQA 4CG1A 2JEZA 1XZMA 1GZ7A 2QRUA 2JIDA 3VKFA 5ISMA 3WL7A 4N5HX 3EQ7A 1CV2A 1T2NA 3IUQA 1F8UA 4PO3X 1J1IA 4MEAA 1QTIA 3FCYA 2ROQA 3WWOA 4K6KA 1CUBA 2XQKA 1NX9A 4OU4A 4L3WA 4MJ3A 4B7ZA 3GBSA 3UUFA 2C4HA 2I3ZA 1ODCA 4K6GA 5AKJA 1ZICA 1QJ4A 1XZJA 2CUTA 1DU4A 4FLEA 4A23A 3AILA 5FLKA 4Y2PA 2XUGA 2WUDA 1XQYA 2WLSA 1R88A 3FSGD 1N5MA 4LHEA 1LPAB 3HJUA 4GECA 4MQMA 3O4JA 2XUOA 5ALSA 2RHWA 4BTLA 1N8SA 4OD0A 2JGJA 1IVYA 1CUGA 2JF0A 1O6FA 2PSEA 1WCYA 1TQHA 4EY4A 3GA7A 4H7KA 4PQEA 2AJBA 4BRSA 4FDMA 3I2HA 3YASA 1P0PA 3IA2A 3D2CA 3FYUA 5AHXA 2AJLI 3V1NA 4P93A 4HXEB 5HK9A 5ALTA 4WDRA 2VATA 4F5ZA 3PICA 2PU7A 4DM7A 4BRZA 4OSEA 1CUSA 5YASA 2OGZA 4CFSA 1CUYA 5C8ZA 2HADA 4AZ0A 5JYCA 3WMRA 3AJAA 5HKAA 3D3NA 5AM1A 3UMJA 3I2FA 1UT6A 2PSFA 4DMCA 4AO6A 1QO9A 4FTWA 3WWCA 2PX6A 1XRNA 4JEIA 1CPYA 3HABA 1A8QA 3WWPA 3FLBA 3CCBA 3VJMA 4CIAA 3ESCA 4KAJA 5AKIA 4HAIA 2BFNA 2X76A 1EDBA 3WK6A 1MU0A 4QE3A 5ALWA 4NZZA 3I2KA 2LIPA 5DJ5A 4EY6A 4L0CA 4B82A 4DSAA 4J0KA 1ODSA 5IVKA 4QDUA 4Y2QA 1U2EA 1LLFA 1JKMA 2XUPA 1THTA 2VEOA 5ALIA 1EHYA 2V98A 5EIEA 2Y2UA 1NU8A 2B9VA 3R0VA 1N1MA 2RHTA 3B5EA 4BATA 2FJ0A 2XUJA 1TK3A 1EH5A 1EINA 3DQZA 1GPKA 3DKRA 2C7BA 4U2CA 5ALJA 3DLTA 3LIPA 3AZOA 5FUMA 4IHAA 1DQZA 2XMQA 4I3FA 4BZWA 1VXOA 5SYMA 4GW3A 1JMYA 3MUOA 4NVRA 4OYLA 5HKBA 3HACA 2XUHA 5ESRA 5FDFA 5ALLA 5AI0A 1XLVA 3STTA 1WB6A 4BDSA 1F6WA 1YB6A 1BE0A 2QJWA 5CXXA 5EIAA 1KU6A 4F0JA 1LBSA 3EQ8A 1BROA 1XRLA 5DYYA 2WIFA 3I2GA 4INZA 3S2ZA 1AC5A 1YASA 5AK4A 4Y2RA 3HEAA 3SWWA 3DYIA 1J06A 4BP8A 5C8VA 1QIJA 2QUAA 4GHWA 4Y2UA 3WA7A 4W1SA 2QR5A
chains in the Genus database with same CATH superfamily
1QG4A 1R8XA 4QOJA 2HUPA 1ECJA 1E5VA 2V7PA 1NSYA 3I6BA 4XA8A 2B2XA 1NFFA 2CKDA 3EH1A 3I9JA 3T61A 1H65A 1OZFA 4HEJA 4JB3A 1M0EA 4YAGA 4RTMA 1KS2A 3BMCB 3KB1A 4ESHA 1YQ9A 2LIVA 2VJDA 3A8TA 3BXFA 3CT6A 4EW3A 2R1VB 3HJRA 3FF1A 2UYCA 4KR2A 1ICEA 5KTSA 2EDAA 2A2ZA 4PF1A 4ZIRB 3A2KA 1HQCA 3WL3A 5G0TA 1O57A 3UJ8A 3QY9A 2CN1A 1OFHA 1Q44A 3FTPA 1GLNA 3IB6A 2BHSA 1PS0A 1X8XA 2XHEA 3ETHA 4GR9A 5CNIA 2Z04A 3DDSA 1E9CA 4WZ6A 4FSHA 1FCJA 2VNSA 3DMPA 4Y2VA 3SZUA 4BNKA 3OSUA 4C2AA 5EZYA 5JS2A 3EIFA 1MTZA 2P9QA 2Z95A 4Y6PA 2FRXA 1PL8A 3C2QA 5DGTA 3R0QA 1I1NA 2BH9A 4ZOAA 1N36B 2PANA 3ND6A 1AGNA 3CVOA 3H1PA 1Y33E 3L8ZA 3DW3X 2O6HA 2BGIA 1C3OB 3GP5A 5DISB 5E0KB 5FOVA 1JJ7A 2ZUTA 2QU7A 3QE9Y 4X6YA 1W85A 3C3DA 4H17A 4YEDA 5AQ1A 5HR5A 2O2XA 5KU1A 3LT4A 2W0SA 2FMUA 3ZIUA 1ML3A 5HMLA 2ZXFA 5A02A 4BNJA 1A95A 4V0NA 3W6PA 3LAWA 2Q07A 4RH0A 5E4FA 2RH8A 2Z8YA 3VPCA 4CG3A 4WQMA 3LUGA 4NK5A 3FZEA 4JLWA 5E2BA 3WV4A 1MRZA 4MITA 3KELA 3SKXA 1FYEA 4I8DA 3ZDBA 1OBCA 1XTJA 1YULA 3ZGZA 3QXCA 3P5BA 2VZEA 2EBWA 3D4BA 1LSJA 3M3HA 1KZ1A 3QW4B 2PRJA 3RS9A 4Y9RA 2VBCA 4X1YB 3SYRA 1I7DA 3F96A 1YQXA 2PMWB 1T9ZA 2PHZA 3O95A 3H2YA 2AL7A 1K7SN 4TTSA 2DPYA 2D7DA 3DV0B 1VRVA 4MRMB 3B3AA 3FTNA 2PS1A 1A5BB 4U2KA 3NBKA 4WNAA 3ZIAD 3A4NA 4R1OA 2BGTA 4I08A 1I33A 1KSFX 2BEUA 4AN4A 2VG8A 2NXEA 5G0VA 4IDEA 2UUAB 3U7JA 2VPYA 2C2XA 4OIMA 4E1VA 4IJMA 1L5WA 3SE7A 3HCAA 2M6SA 1NXWA 2ATVA 4YMWA 2E18A 3M4NA 2HHJA 3OX4A 3ZU4A 3HV0A 4ZV4A 2Z43A 3H18A 1YMUA 4LDPA 3PG5A 1T5DX 2C4KA 3QHPA 4K87A 4Q4LA 2VSXA 4V0RA 3FPGA 4GLOA 3GGCA 5LJIA 1CZRA 1PZMA 1GPBA 1G8FA 1J49A 2AOWA 2IZ1A 2PA0A 1WW8A 1LLUA 1MHPA 1RLOA 3K0HA 4DEVA 1LX6A 4PX3A 4AMBA 1TT7A 2DT5A 3CHYA 4X3CA 5KAMA 3OZAA 1KFBB 3R4VA 5KPDA 4HSEA 1J25A 4C21A 2O7NA 3KV1A 4PQGA 5F7OA 4KG7A 2OESA 2XKAA 4YK7A 2ILVA 5FPHA 5TF0A 2AX4A 4BL5A 1KZ7B 2W6ZA 5LWQA 2WR8A 2Y2VA 4BDTA 3Q8MA 3W2GA 3CIFA 5JO0A 2FKNA 5L95A 1JHVA 2ZTVA 2NSHA 2FQYA 2C5EA 3P9ZA 1QPGA 4RFSA 3BM5A 3C4VA 1UPTA 2OHHA 1J8FA 2VTEA 3E2MA 3JYHA 3RVKA 4BLRA 4GUAA 3LGSA 2ES4A 3CISA 4OVKA 5EVCA 3TE6A 4KUGA 5A0TA 3L0SA 3ZQKA 3GF4A 5E2IA 2FW8A 4R5MA 4XPZA 4XYGA 3LC1O 2QN3A 3HEMA 5L51A 1QRTA 1KI4A 3ZK8A 3LF1A 4Y2JA 3TR0A 3SQXA 5ER9A 1SA0A 3C70A 2QE6A 5GQSA 2NTEA 2GLUA 2IYXA 5EJAA 4BFTA 3EFBA 1P39A 3F71A 4EQZA 1EXVA 1EFTA 2GTIA 1SC9A 2ZU6A 3SIRA 3HKCB 3OJFA 1CJSA 4D9EA 5HZHA 5BQ5A 4KH0A 4KKVA 1TL7C 3DFZA 3EIWA 3PE6A 5EUMA 3THOA 4HDRB 4COOA 5CFRA 2F8TA 1CQWA 1W1WA 1B1CA 1R00A 3FI0A 2RBGA 3GCDA 3GJTA 5LP6B 3LCMA 3KT3A 3KRTA 1M7HA 2DXIA 3RS2A 2FU5C 4W5TA 2I6UA 3HFGA 3DZBA 3MGCA 1M74A 3C6XA 3GRRA 1XYVA 4W8HA 4GP9A 1VXRA 4YMIA 3HNOA 3HBNA 5I3ZA 3PVSA 4NR0A 2BYTA 3G5UA 4MR9B 4KGDA 1RLTA 2AXEA 3L79A 4AM8A 4GX2A 2DWUA 2OCKA 3AXTA 4ZD6A 3T38A 2X58A 5AJHA 2AOTA 3AHJA 4AUKA 3W6NA 1BQ4A 4ZV9A 5HUJA 3J81k 3NWPA 1RHKA 1XQ9A 3CJRA 3H5NA 4ROSA 3OIWA 4AZ3A 4KN9S 4E4TA 3H42B 5D51S 4RF2A 4JROA 3IP7A 3M1IA 2AR7A 1CJKC 1DBSA 3UWMA 4ZEVA 5B4VA 4ACBA 5AIAA 4FGUA 4E3WA 5IBQA 4ILEA 1U2RA 1DT3A 4ZYYA 1GUYA 1Y80A 3DAHA 4R05A 2YVLA 2O8DA 3N28A 4ONEA 3L4BC 4BMCA 3O8QA 2CLSA 3ET5A 2QA5A 2XMGA 4OGFA 2O8CA 4LTDA 5AVWA 3H17A 3A27A 1FS4A 2W2XA 3TCNA 3MERA 4MI1A 1NMEA 4MWEA 2DLNA 2J32A 2B9EA 2IYSA 2J3MA 2VHWA 3BXPA 4PHGA 3MOGA 4ZVUA 1KNXA 1OPXA 4L4XA 1N2CE 4PCUA 2J5BA 5TLSA 1Z06A 4QNNA 4KDFA 5AK6A 4CM1A 3GCZA 3RSSA 4WX2B 1NNUA 4H1HA 3BF7A 1OJ7A 3C6YA 4C7BA 1GKKA 5E6UB 3DOIA 3B89A 4KXQA 1E5DA 1QCYA 3SR0A 3R7FA 1LDMA 1NLFA 2CUKA 3CVJA 1GGHA 2QAGC 3LWZA 4M7OA 1WTAA 4RJKA 3M6AA 4GMGA 4IDHA 4UUPA 2AKEA 4IDBA 3X1WA 4O4HB 1Y42X 3BHIA 1ZLXA 1SXJA 2BFWA 4LE0A 5E0OA 2ID8A 2NVBA 3P9QA 4LCBA 3SHQA 4C43A 4EPWA 4F21A 1SBYA 4OA8A 4AZWA 4FOLA 3QE3A 1O94A 4FFBB 4WXMA 1U3FA 2WWXA 2II6A 2ZIVB 3FPHA 4M1TA 1R4ZA 1ZINA 5E4TA 2QL6A 4XQCA 1HOXA 2WTAA 1LTKA 4O2AB 3K1ZA 4UCFA 4EB6A 3BIXA 5JPCA 2B6HA 4FZJA 5LKRA 3EHEA 3DG9A 2CB0A 4KK3A 3WMXA 3VKHA 2XMDA 4RD3A 2XE7A 3DMTA 3QG5A 4KRGA 3O8RA 2PKQP 2ZFUA 3F3KA 3QU5A 4B6EA 2GA8A 2DUWA 4WIAA 1EX6A 1PG5A 3HO8A 1WX1A 1E1CA 4MWTA 4EGSA 1P5JA 2QORA 3IAS1 3ORQA 3AVYA 2X41A 2BD0A 2ZWOA 1QIMA 2C2GA 5F1PA 2YY6A 4JEMA 1OI2A 3QUCA 4HFRA 1WIWA 1UK6A 1SRRA 1P7YA 1TIKA 5JRJA 3D6UA 4AL4A 4K0KB 2ZYUX 1SB9A 4Y67A 3TL6A 3Q1KA 3CONA 3QFHA 2FWRA 3AM3A 4GC5A 1C7IA 4J16A 1UBSB 1S2DA 3VTAA 1G18A 4G0ZA 2DHCA 2Q28A 4GM4A 4ROTA 3JASB 4BFWA 2GO7A 3IBYA 5IAGA 3AWIA 1P9OA 1IXKA 2R1UA 3AEKA 4P5DA 4ZPXA 3UATA 4JC5A 1USIA 2QSYA 2RBEA 2VXOA 3B48A 1R0WA 5HCUA 2BL4A 1X9GA 4E11A 3AYXB 2EZ9A 3DUFA 3S81A 3AEQA 2EQAA 3BFXA 4EZEA 4ENQA 4OHZA 3L0CA 3KAKA 1IRXA 3DZKA 2WHPA 1RHUA 1LW6E 2PUFA 2P2GA 3WS7A 1MCZA 5JSQA 2HJVA 4H3VA 3UO8B 3OOEA 3TQSA 3I9KA 2VQ6A 3NFYA 5DHAA 2PJUA 3ZV3A 2FN9A 2C9CA 3IJPA 1XRMA 4BHTA 1D6NA 4UARA 4R40A 5J4HA 3CZRA 4R2JA 2Z2JA 4RY0A 2IGTA 4G01B 3BMCA 2MSDB 3WA6A 1G291 2HWKA 1T0BA 2ZSKA 5B1YA 5TJHA 1BTOA 5AJVB 3TUZC 3BRWD 4FCCA 4DCSA 3LXXA 3UF0A 3EC1A 4ABTA 2PQ6A 4HLCA 3IUNA 2FE1A 4JEUA 4H6WA 3RU3A 4PINA 4UU8A 4J7AA 2H31A 2O1XA 3MW8A 4URUR 1K66A 3P9IA 4LZNA 4RVSA 3K2EA 5BVHB 2R6GA 1MOZA 4MVXA 3ZGYA 1ES9A 1MKYA 2QD4A 5AXAA 3I0MA 1YJBA 2HA5A 4IDNA 5DYNA 3ZDFA 4RQBA 2J08A 4JQOA 1W34A 1YJAA 2GFQA 5T3YA 3P2YA 1E79A 3H3JA 3Q72A 1OHHD 3W3ZB 1ZSVA 4TL9A 2REOA 2UUBB 1C30A 4P58A 1CUHA 3WJ7A 2WKSA 1IY1A 1L3IA 4EYSA 4C5AA 1EGHA 2OGSA 1YRHA 3UKDA 3FOWA 3IAEA 4ARVA 1VKNA 2YJ4A 1T4BA 3G3EA 1JXMA 4IGKA 1MGOA 1II9A 2AZMA 1NXXA 3KQYA 1G5QA 2YYAA 2BWJA 4FFWA 4NABA 3CUYA 3CX7A 3ZTYA 3OJ0A 4CDRA 3QEMB 2ODTX 3PP8A 1LEHA 2MT9A 4MYRA 1CVRA 3L8EA 2J31A 4D26A 1GPDG 4MIYA 3G2PA 3REQA 2G1UA 1YBAA 4QRDA 4EYGA 1PTJC 1N4AA 3P7MA 1NYTA 3A3PA 1UBEA 2CLKB 1RS0A 2GX6A 4JR1A 4CM9A 5JLJA 4NCAA 5ALMA 5ETJA 4CEHB 1SKMA 2RH4A 4I9NA 3AR7A 2GCNA 1J20A 2PX2A 2O07A 5AHWA 5KI6A 2E4WA 1G20E 3TLMA 4YUYA 1NW6A 1W46A 3NEAA 1L7OA 2HQOA 3WLKX 1BFDA 2BT4A 1BAPA 2OFPA 4IXTA 1X14A 5LP6C 1UK9A 4BEBA 1Y3BE 2X3YA 4I50A 4D9CA 6CHYA 2CCGA 4JYPA 4F6RA 3SFVA 4FP9A 3CLSD 4XIFA 3VRHA 3LK6A 3GFVA 4N5LA 5ERYA 4H7JA 4G5GA 2X9NA 4OJMX 3LW8A 5A5EA 3KHTA 2GXQA 3AKDA 1NWHA 4KYVA 1C1XA 2R6DA 4HK4A 2R86A 1Y37A 3QPWA 3C3YA 1CP2A 2PNFA 1E69A 3MM4A 4GP6A 4MO9A 4AXBA 2G5PA 1NA5A 1RWBA 4C0KA 3U4MA 4M0DA 1JDZA 3JYOA 3TN7A 5BPHA 1ZN9A 3DL4A 5D6NA 4BGEA 4R1MA 4A8JC 1C9EA 2W9XA 1QK3A 4L0MA 2OBYA 5EN4A 3L07A 3MWEA 3OZEA 2I5PO 4UE3S 3UH1A 3E7XA 5I7FA 1YAJA 1SHUX 2WICA 1E9SA 5I9BA 1L4MA 1Z33A 5CMLA 2VHVA 5KO2A 1H4VB 1XELA 1ZAKA 4P08A 4BNZA 3HTXA 2J30A 3CRRA 2NSLA 2Q6TA 1O95A 3AU8A 3FMOB 4G1BA 2XBUA 4KLZA 4Y1EA 4DIOA 3RVDA 5IJ0A 3D8SA 1IM8A 2OUKA 1ZD2P 4X20A 1CZLA 2JJMA 4WW0A 1W4RA 2PY6A 3KEMA 1EFLA 2PS0A 2TMDA 1D0SA 1NDUA 5H9WA 1RIIA 3JV7A 3DPSA 1RVV1 1EP2B 5HJ5A 1Y0BA 3TRJA 1L5SA 3ZHTA 3EDOA 4FFDA 4XWAA 4R1UA 1BCRB 3FMGA 3FGZA 4EL5A 1K6IA 1R74A 4H08A 3CRMA 5DK6A 3A1FA 3GRKA 4D2IA 1NVVQ 1C8VB 1ZCAA 1RE0A 4RS4A 1HLGA 4Z49A 5CCEA 5I6DA 2VXCA 5LZ4A 3R6DA 3FCCA 2QMEA 1YU6A 4M21A 5AW5A 1LSOA 2DFPA 3D5EA 3SZLA 4CQLA 1M2FA 2B30A 3JCZA 2D1RA 3PGA1 1V3UA 2P69A 3KB6A 4BJ1A 2CYBA 2DSTA 1QCDA 3CXRA 4OATA 4P81A 3ET4A 2CXTA 2JPDA 2HREA 1FU8A 1IB0A 1UJ4A 2CMKA 3BF8A 4FCWA 3IRUA 3GNLA 1C29B 4AY4A 1N5DA 4JUBA 1XXHA 3V7WA 5AK3A 2PFGA 5A6SB 3A05A 3C39A 3UTDA 1JIIA 4QQFA 5E4YA 3IO5A 1OTHA 4GPD1 3AR8A 3A32A 4X71A 1OW3B 4KMRA 1DDOA 4NONA 1DV2A 3T7CA 3FHJA 1KJIA 2P9BA 1IJFA 2XADA 1GSAA 1EGAA 1DQNA 1AK1A 2D2XA 2WPDD 2YYSA 3SXJA 4EB3A 4EUSA 3GLFE 1U7TA 5H68A 2C0CA 1DIOB 1GARA 3CEAA 3PPYA 5I47A 1XJQA 3RARA 3ADPA 5AUPB 1SG6A 3D0OA 1J0XO 4WJLA 1SNYA 1DC5A 3IA7A 3PNQA 1ORTA 4KLRA 2O4CA 4L1KA 1ZHOA 3QWBA 2HY7A 2PZMA 4ZYXA 2J45A 2D7JA 2QXYA 4G8CA 5HM6A 3L7IA 3LRTA 1AKVA 3OTQA 4OFZA 4QGAA 4H1VA 1ZNYA 1S02A 1SXHA 3EOAI 1NM5C 1P9LA 3HC7A 1MFPA 4PANA 2DTXA 4XFJA 3QMPA 5T6MA 1V26A 3RC7A 3T1HB 4FZRA 1SVLA 4R7TA 4BO0A 2F6RA 1I3MA 5TR9A 4FW8A 1WEHA 1A8HA 4R71A 2VWPA 3I83A 2HSEA 4TN1A 1L4NA 2H4FA 2I9KA 1DO8A 4RELA 5IG2A 1ZPDA 1FFHA 3REOA 1Z73A 3CO5A 3L0ZA 2IYVA 4DYVA 1AF4A 4HDKB 1W49A 2B8TA 4WK6A 1LRJA 4JLNA 1EP1B 3OM9A 4A2CA 4ZMSA 4P0QB 2WILA 1EM6A 1S3FA 4NE7A 3GZJA 3BJIC 4HNSA 1Z3CA 2PZKA 4L2IA 2HMWA 3HYNA 5IM4A 4PX9A 1U3DA 4GM1A 5IUJC 2C4MA 4D74A 1J07A 1JLLB 1NYRA 2CEKA 2HMAA 5JMTA 1YV9A 3IS3A 4TSKA 3L8GA 4WNIA 1MQ9A 4KE6A 3DKPA 3D9QX 5FBQB 5AH0A 2FLVA 2JH3A 1TU3A 1GGEA 3OSZA 2R8XA 3D6FA 4MS3A 3QM1A 5JSYA 3HY4A 3QQPA 3QWFA 1GGFA 1YR3A 5CW2A 5ALXA 3D8NA 3RVOA 4ZN6A 1FSPA 5I45A 1E9RA 4XM1A 5T4HA 4AWXA 4LF9B 1P7WA 1L7BA 1R0SA 2BBOA 2R44A 3D8BA 2R60A 1FJGB 3MJFA 1TXGA 4HX5A 4YCDA 1KDOA 3D7KA 4YRLA 4F9FA 3T5PA 1RE1A 5HCIA 2A88A 3K16A 3UWOA 1U80A 3CSDA 5D3ZA 1N75A 1XJWA 1BNCA 3UXYA 1E3TA 2EX4A 3LP5A 4LMRA 4Z8YA 4L75A 3I61A 1E9VA 2D2FA 2X8WA 4B4KA 3IUSA 1OX4A 4AJPA 2QRKA 4P5PA 3P9SA 4LYHA 3RHTA 4BMVA 2X9VA 3WL8A 2A30A 4IJVA 5DHFA 3UMCA 3KOZA 1WS6A 3KTFA 2QXUA 2YQ4A 3JQ7B 2A3NA 3M7IA 5EERA 1UEJA 5G40A 4ZVPA 3EC7A 1QMGA 1TZBA 1L5GB 2FDXA 3GLGE 1Q15A 4BLQA 3BGSA 2N46A 3B2NA 4LRXA 5DF1A 3AUJB 5LXTA 3H84A 4GOXA 3VJKA 1B4DA 4Q4AB 3AHHA 4YJ2F 2GEBA 3IP1A 3VVCA 3G49A 5K0ZA 1JIJA 1ZL2A 4UHFA 3TSAA 1ZMRA 4DJFC 3S8YA 4JK3A 1CSEE 2BKUA 2G0NA 1ZM7A 4HH1A 2PYDA 3VHRA 1EFPA 2SKCA 3LVQE 2H1SA 4C0SA 5KC8A 4QNRA 4TL7A 2QAGA 5K6AC 3DT6A 2QBYA 1JR4A 3ZY5A 1JFFB 4JB2A 4K88A 3HCCA 3STVA 2VHXA 4R41A 2QY6A 3IEKA 3OIDA 4R9UC 4HTFA 1FNBA 5C7IO 3ZC3A 1WKCA 2ZANA 4OHXA 1QLHA 2R85A 4B47A 1QKKA 1KPGA 5DLPA 3B1FA 3OOYA 2GXUA 3K0CA 3QKSA 5MF6A 1J0EA 3T7SA 3ZU5A 1CF2O 2IXBA 2VKQA 4O5OA 3WGLA 5JDCA 2C78A 3FN4A 4HL6A 2ZYTX 2YWGA 3ICEA 4FYMA 3OJCA 2Y05A 1DBVO 4V2IA 1P44A 2WTNA 4U2EA 3TQIA 3KR0A 4M99A 2BGLA 4Q4HB 4AY6A 2X0EA 1NXOA 3I4LA 2FMIA 1U3CA 1I6MA 1EK5A 5TRTA 4QVIA 4CTMA 1RI4A 4P98A 4J0JA 3DUFB 3DHNA 4LYYA 1G1AA 1UP6A 3DVAB 4LVUA 2RAPA 4S2EA 5CDSA 4W5WA 3VHQA 5G4KA 1BW9A 1ZJWA 1Y8AA 4UJ3A 2JKZA 2P2NA 1I8TA 3LX6A 2V3CC 3HKDA 2DP4E 3FCAA 4ZAYA 2Q5QA 1HOTA 3QIVA 1DBPA 2OB2A 5DCUA 4CMHA 1WWKA 4CLDA 2ONZA 4L8VA 3AR9A 2IY7A 2O5VA 4PYKA 1SVNA 3H97A 3SI7A 4EG0A 3RBVA 3ZNQA 1KHTA 5E9QA 3RYTC 4DOMA 4I99A 2GNPA 2NYAA 4CKWA 4V0QA 3B6JA 3DVQX 3W9YA 2I6QA 3OO0A 4F3CA 5LP6F 1G19A 1L2TA 1FYWA 2GJ4A 4H3SA 3OFND 2WJ6A 3A6HA 1M73E 3FVRA 5EXDA 4Y6QA 4D0GA 3O1JC 4YDQA 3U44B 4TN5A 3GZNA 4R3WA 3EGEA 4XB6B 1JG1A 2V0NA 1XMIA 1YS2X 2D62A 2JFUA 1YQUA 1ZOLA 2XITA 2ZS8A 3LDHA 3O74A 3WQQA 1IWPB 3LLCA 3GEDA 2D1FA 4BNVA 5IS2A 1E1QD 1I94B 3OCCA 1Z4JA 2VPXA 2WTBA 3CE9A 2JBHA 3O8DA 4X7RA 5FUBA 1PR9A 1LWOA 3AONB 4CM7A 1Q7EA 1U9JA 4J7UA 3URMA 4JY7A 5D1HA 4PAWA 4QXQA 1NF8A 3NM4A 1TUGA 3E5HA 2PXCA 4NCIA 4QTTB 5G0UA 5ILQA 1N25A 1QDUA 5DM4A 1LQUA 3WHLA 3VYTB 2JKVA 1IK6A 1W1UA 3QF7A 4ZCPA 5HDBB 4X93A 1YL7A 3VPFA 4BASA 5K8TA 2W4IA 6Q21A 1K8YB 2HTEA 3EG9B 4YRGA 1A4RA 5K8LA 2MSLA 4FGLA 3VJLA 1AB6A 1K8ZB 2PFSA 3AJDA 3IAFA 2NMVA 4UU0A 1DUVG 1PDVA 2O7VA 4ZT2A 4A8JA 1JR6A 3HCNA 3FE2A 2XXAB 2QMQA 4P53A 1ULSA 3BMNA 4GL2A 5JFTA 2BP7A 3QU2A 4I5DA 5DHPA 5G2OA 3RG2A 4U9HS 4RFLA 3RPEA 4YUAA 1K3TA 4CL2A 2P4EA 4GP7A 5FL3A 3RF7A 3VR6D 3I01A 3OUTA 2CHVA 1FDIA 2HJWA 1P0FA 4Y9UA 1CRQA 3ASUA 4JU8A 5BMVB 1NV8A 1QQAA 4XUGB 3N8IA 3QF4B 3M6IA 4IIGA 5LLSA 1TIBA 3L84A 1DC7A 4O4HF 4OXRA 3RANA 3BQNB 2ZRCA 3I04M 2OV2A 4LSZA 2HW8A 4YO7A 5A7GA 1BMFD 1FTYA 3MMXA 3I39X 1XRPA 2EZ8A 1V48A 1DFHA 1JAHA 3EQZA 3M6VA 3NWJA 2HJRA 5TMBA 1XA0A 1YR2A 5IUNC 1NQXA 2D0PB 1N2SA 2I1WA 4RCZA 4MQUA 4PAGA 4FLMA 3DWFA 4HX9A 1ZGAA 3H2BA 3KSUA 4JAVC 4Q1BA 4NU6A 5L4NA 2J4DA 4U0KA 3WAJA 2C2KA 3AWDA 1WXEA 3M4XA 4MROA 3RUDA 3E48A 1MNQA 3JARB 3VV2A 2GBLA 4D9JA 4REQA 1IIRA 3EMDA 1L5MA 1ULZA 3R6TA 2FV8A 4NCHA 4WOJA 5FTWA 1A9PA 4B8WA 3TO5A 4BP9A 1ZHHA 4RHTA 2P9ZA 5CP8A 4JXKA 3D6NB 1XLTC 2AN5A 3BRQA 2BONA 4Q3EA 4MUIA 1YVDA 4XCQA 1HT1E 5IH7A 1Y1SA 2VUTA 4ON9A 1MX9A 1SD5A 1ZJJA 3PGXA 4A6XA 1LVUA 3WB1A 4AG5A 1IXZA 4QWMA 2CV1A 5AI4A 2O8NA 1KYYA 2HHCA 4KTTE 1Q83A 3TZQA 1FUUA 1ONNA 1RAIA 5IXYA 4DTIA 1YB7A 2MDTA 1A9RA 4AAYA 3WLRA 4M9ZA 2HA0A 3PEVA 1Q7GA 4HPWA 1NUAA 3T1TA 1US8A 1DTSA 2QRPA 1Z5UA 2V6FA 4LYEA 5I8PA 1DLIA 1VRCA 3KO8A 2QDXA 3T3IA 4MVJF 1JSLA 1O77A 1WMAA 3GN2A 3A31A 1VPWA 4ZI7B 1W87A 2KE5A 4D56A 2Q1WA 4CKEB 4CLRB 4KBFA 2B20A 4NBTA 2BKEA 3OKPA 2F00A 4QEDA 1YMVA 3VVLA 4E5NA 2OM2A 1I3CA 1E58A 1E2PA 1NN5A 2WYHA 4GMDA 4TSRA 2AZXA 3BEDA 5KKNB 4CNQA 1AQLA 2PKRA 3OT4A 3T9BA 1M2WA 2ATXA 4P4GA 5LSAA 4REOA 1G21E 2M2IA 2O3TA 2ERYA 1SQGA 5C8XA 1RQRA 2X5XA 3CURA 4RZIA 1Y7HA 2UYHA 4V0MA 1G7TA 4DW8A 4GYWA 3V9AA 3WKCA 2BGMA 1HMPA 2OLKA 3DDHA 1KR2A 1JEOA 2AH5A 2QB5A 4IVPA 1K89A 1O3YA 2R79A 1USGA 2FZ4A 5TS3A 5C18A 5J43A 1V1MA 3X1KA 1U9IC 4Y2SA 4DQDA 3R7NA 1AO0A 4EZBA 2AXPA 2YHAA 1T5IA 1Y4ZA 4E6PA 1LRKA 3GAAA 2D5IA 4OBEA 5EE9A 3C45A 3HWSA 1A3CA 3VDRA 3NH6A 5I9LA 1V7CA 4MARA 2RI1A 5KNBH 4FNOA 1SVMA 1A77A 1LPPA 1MQSA 3OJEA 1Q0PA 5KYWB 6REQB 3MGBA 4R7GA 3EPJA 5KYKA 2PE5A 3GGJA 4OK3A 1VLJA 3JD2A 3AIKA 4TT8A 5FWAA 2NV2B 3CYFA 3QYPA 4IIBA 4TWAA 4KOEC 4EUEA 4N82A 2V7TA 1XTIA 1BDJA 3GOQA 4N65A 4DCNA 5JSHA 1TA0A 2DF8A 4G5FA 5KJCA 5FNVA 4E51A 1OV6A 3TIGA 2ZJ7A 1PYOA 4OHWA 4BB5A 5CA1B 2P9GA 3A3OA 3ASZA 2IHZA 2XZTA 2UZ1B 5CH3A 4UZSA 3GZNB 4Y9DA 3WGVA 5JZ9A 3H3FA 4D6XA 4P4TA 2P4SA 5CW1A 5ALUA 1LNZA 3MQ4A 2B82A 1TM7E 3KVOA 4BMSA 5DM70 1U7UA 1ZM3A 4OBXA 4OQ4A 3A37A 3F7MA 4WUTA 4FQ8A 1GQ2A 4BWFB 2JLWA 1KKLA 3LCCA 3PFCA 1UKVY 2OZKA 2Q46A 3PC4A 4H59A 4HVTA 4CU5A 3HL4A 1EAMA 1XU9A 4KVFA 3J7AC 1CW2B 1OXMA 1CK4A 2WVAA 3GCXA 1ISJA 2GRAA 2QTHA 4LBWA 4LC9A 4I3HA 1HO3A 3KKLA 4ED9A 2NUPB 4V1CB 5JJCA 2WUFA 1JG4A 5L7YA 3X1JA 2VP4A 1BDMA 2N47A 2YYYA 5E7JA 3ZD6A 2INGX 3THWB 1F9AA 3MZ0A 4YP0A 1YZLA 2D8AA 2R2AA 3E8MA 4ZU3A 2HU8A 3NO4A 3WLEA 4DLUA 1UQTA 5T67A 1FNSA 2EATA 4IILA 2ZVDA 1GZ4A 3NORA 1V6AA 4G5OA 4CM3A 4IQGA 2QUZA 3LXRA 3RR2A 4CEJA 3GGGA 4WLFA 2EZTA 2A9OA 3DBHA 3BXXA 5E9WA 4OIFA 4ZOCA 1ZHFA 5C7YA 1TAQA 2OD9A 5A0VA 1KY4A 2Y3IA 3OKCA 4MUAA 5FUQA 3WI7A 2DJIA 3HYTA 1FTGA 2D2IA 3TIXB 1YUBA 4UHCA 3ED5A 3KE8A 3DV0A 1WMEA 1XMSA 2Q3HA 3A7EA 3MAJA 3ZU3A 4WFQA 3K9WA 5IBCA 4MNTA 4OY3A 4WUVA 3ZNPA 4RIIA 2HQSA 2PH1A 3G9XA 1NZFA 4J6EA 1V1RA 4BWYA 5AVZA 9LDTA 2ETVA 4RDXA 4XFDA 4YAFA 1V3TA 5AMXA 5FWNA 5COBA 1K9SA 3ME5A 2RGXA 2I6TA 3ETDA 1WEKA 3U6BA 1T15A 3MOIA 4D3SA 3CO0S 1GN8A 1WUHS 3NR2A 3UWKA 2YJNA 3LFHA 1I1HA 1T0UA 5CXSA 1T29A 2P77A 3AHCA 1C50A 2BHLA 3BERA 3GARA 4LYJA 2YDYA 1TKRA 3VNUA 1GPH1 2KW5A 1BG6A 1JN0A 4NMLA 1F7VA 1TK9A 2XB2A 1ZVQA 1Y48E 1RI2A 1SBTA 2QTGA 1C0PA 5AK5A 1Z6AA 1WZEA 4CMEC 2CEAA 1XL1A 2XMPA 4GI2A 4F7WA 5DOVA 2IWRA 1OA1A 3G88A 4IRMA 3QK7A 3NOXA 4EYQA 2J3KA 3UVEA 3OF3A 3MBOA 3R9WA 5BW6B 2ZT7A 3EUFA 1DEOA 5BYBA 1MJ5A 5COQA 2VQDA 1NL3A 3ZHXA 1UCFA 8AT1A 1XWFA 3UWSA 1ZK0A 4JNCA 4MUBA 4QSMA 4CM8B 4D3XA 5JV5A 4BMYA 1O97D 5DU2A 3W1VA 1S8FA 1YT5A 2IP4A 3V4ZA 4K9OA 4KNWA 3WLTA 2JCSA 4YDRA 2JK0A 3AX6A 4JODA 2I4LA 1C3XA 4FZVA 3ZE7A 1VSQA 2WIJA 2V6BA 5SICE 1NQOA 3A6FA 2HIGA 1KAHA 1U4OA 4FJ1A 5DYTA 2YVKA 1T5BA 3RODA 1YOBA 2C8JA 1XFAA 4XJSA 2RGEA 1L7DA 4AUNA 1Q0QA 2CF5A 2Q41A 3HU3A 3DEZA 4HDQB 1KEZA 2OC4A 1P7VA 1NC3A 3K15A 3HFRA 1TQ8A 3QBEA 3GJRA 4KWEA 1PEAA 1GG5A 3GT4A 4G86A 4L74A 5IVHA 4QOHA 3A70A 5AOAA 4N41A 3AEXA 1W59A 4EI8A 1XZDA 1QHSA 1KSJA 1PHPA 4RHYA 3V8MA 1T6BY 3QH4A 4BO7A 5J2UA 1PHRA 2WHYA 4KTVE 1YRLA 1PF7E 3SBOA 3NHRA 3COJA 1FFEA 3O93A 1V39A 3UV6A 3HBLA 2J3QA 1UDBA 3QF4A 1OTXA 4K9RA 1GRRA 1U2PA 4OU5A 3RAGA 4WZAA 1HDYA 4I6GA 3CLVA 1LI5A 2GZSA 3OD5A 1ZUD1 2AN1A 5EHQA 2XH8A 3BIOA 4WDQA 3D7RA 3WK9A 2PH5A 4EGFA 3RJ5A 2BTQB 1NXTA 3OIGA 4DHEA 2FP3A 3UHJA 2WAYA 4P1ZA 2OCIA 4N0EA 4BMXA 1KO1A 1E89A 3G59A 2XGMA 3WQHA 4E4YA 5LP6A 4FI3C 1U2DC 1NPTO 2ZRFA 3X1XA 5IHPA 3NBFA 1LPMA 5TT1A 4RKRA 4W9RA 3LQKA 2G88A 3KB2A 2QNBA 3TCKA 2NOAA 2ZAOA 3BCHA 4G09A 3RKRA 3FB1A 1CUCA 2EEPA 3FFAA 5HF8A 1E1KA 2WSIA 3QNMA 3FDZA 3RV4A 4MP6A 1JHUA 4RLSA 4I5FA 1P7PA 4U2DA 3TTSA 4BLTA 4F71A 1PT9A 4ISBA 3HGQA 3AR4A 3AF4A 1AZWA 2Y92A 2ZYAA 3NDJA 1JMVA 4JZKA 4ZRNA 4YV2A 1N2HA 2FPGA 3R77A 4KDCA 2LCQA 2LP4Y 4IWNA 4DSZA 4G56A 3B85A 2FEMA 2ZBDA 4XDHA 2H00A 3GMTA 2RC5A 4FDUA 3ETCA 1FL9A 3NZEA 4YONB 1CLEA 5LMUB 2VJLA 3DOEA 2ZXEA 4OXXA 4WBXC 1YL6A 4GRDA 3AI1A 1CR1A 5H59A 4YECA 3O8QB 1ZH8A 3NI2A 5D01A 4RFSB 3PQ4A 4DPLA 1TE2A 2DGDA 1OA0A 1YAHA 3S1LA 5B30A 3G2MA 1X7ZA 1YQTA 2XDYA 5HKOA 1IBSA 3ABZA 3VH3A 3MB8A 1QRSA 1OAOC 3KYBA 3O91A 4YMSA 3D4LA 1C3EA 3VMFA 1YS7A 4S12A 2RKBA 3KV3O 4EAAA 5KCZA 2C5BA 1AMOA 1HT3A 3S2EA 1DCFA 2GEKA 5TC4A 1F3LA 3VU0A 3ZLBA 2FA9A 1JAXA 4N0DA 3KZ1E 5F1KA 4DHWA 5KQLA 3BHMA 1ZNZA 4KGZA 5FHQA 4F92B 3GY0A 2PTGA 4ETWA 2CHUA 2R62A 3NHJA 3T95A 4ZQIA 4LFCB 5BV8A 4PXYA 3OQ1A 3TVDA 3VNRA 3C4JA 3WBBA 3QTLA 3JD3A 4KPUB 1THZA 2W2TA 1NRWA 3CNOA 3PX7A 4EKEA 3DA8A 3D4PA 1HDRA 5CR9A 5EXEA 3SCZA 3IQIX 4XQEA 4C3OB 4BE7B 5LQAA 1OI7A 4M1EA 1MO5A 4FB5A 3UMMA 4COKA 4X1YA 2R7NA 1KY3A 3LX4A 5DBFA 4Z0PA 1BU8A 2WUEA 4FMCB 4X3PA 4CIDA 2OUIA 4PFJA 1SZJG 3GVPA 2JFHA 3FPBA 1A5AB 1UPCA 3H86A 1ZCBA 2D3TA 2W22A 3LKVA 3MJEA 3QFSA 4KAFA 3U4DA 3ZZTA 3M6UA 3S2FA 5C80A 2O5RA 4NDZA 1RFGE 3QE4A 5CH5A 1RIFA 5TVGA 4DABA 5J4VA 3KJXA 5IMBA 3F8SA 4RJTA 2FG7C 1NVBA 2IOFK 4L78A 2WABA 3EOBI 1SBZA 1IMOA 3D54D 3R7WA 4WRRA 4F9TA 6REQA 3F73A 1MABB 1NAIA 1H23A 1VMKA 2J7PD 2GYUA 2XCSB 4JITA 1UFQA 3LQ1A 5L45A 1EQUA 5TIIA 1HKHA 1A88A 4LOHA 5DLDA 5EL0A 3I1YA 4UU1A 1YBMA 1Q0SA 4E0BA 5I7EA 3V9PA 1SQSA 1WHSB 3EW9A 5I5GA 1AA9A 3MD0A 4HH3C 3CH6A 1SU6A 2WJ3A 1BKYA 3X3HA 3LIIA 1QGYA 1R0LA 4QTUB 1R10A 1QGED 3BREA 3I32A 4YC7A 1NIPA 4B0PA 9ATCA 3QVVA 2OBNA 3KQOA 2L18A 4EF4A 1KRWA 2G83A 3LUAA 3RUCA 4LX8A 3GQBB 1TAGA 3FDJA 4H31A 3F6BX 2G9UA 2AUMA 2OL4A 1R6UA 5HK8A 2CSUA 3CRZA 3SU8A 4FHEA 5AI6A 4FFVA 4LGMA 3DEKA 1H2FA 4AO7A 5K4AA 3MQFA 3MB5A 3X1ZA 5JH7F 4PPYA 3GD5A 4UCXA 2B5VA 8ADHA 4R8MA 4DS3A 1CDOA 1SUBA 2W2PA 3HB7A 2W2LA 4FGKA 3L1KA 4O8CA 1FFSA 2Q2QA 3ASYA 3DQPA 1TRHA 3GN1A 4WWHA 4AJLA 4DNOA 4DG9A 3F3MA 1DAGA 1N5OX 3IESA 3JZFA 3LSYA 1LPBB 1CR0A 4M9SA 1PVOA 1P4HA 3EIOA 1EXWA 4IDQA 3TTWA 4RA6A 3PNPA 1MZVA 2REQA 4IGAA 1QC5A 4N4AA 3OQNA 3NDBB 4DJDC 2QGFA 4CEJB 3P19A 4CHGA 3EGIA 2VJCA 1XRSB 2Y77A 4LOIA 3I34X 1NP7A 2Q4OA 2WA2A 3K0AA 1Q0UA 3I28A 2HDWA 5F52A 5AT1A 3TKAA 5DDIP 4XSGA 4CR8A 1WMFA 5KYWA 4I5EA 1EUDA 1I4TD 2I1VB 1DADA 4KZPA 5NLLA 3W34A 4OHOA 2A33A 3HO6A 2ZRGA 1JA0A 3DGFC 3KSMA 1NNEA 2PD3A 2FE4A 4EMBA 5AVVA 1HL3A 1HQKA 2XZDA 2WNHA 3VR4A 5K09A 1ONBA 3H2JA 2Y67A 1P62B 3A14A 3JQAB 2Q21A 4M1KA 1TEHA 1YOVB 2BI4A 4GZ6A 1ILEA 4MOWA 1Z36A 3RWBA 1ZS9A 3GH3A 1RRMA 3IBGA 4BBAA 1IEQA 2GJ9A 4LXGA 4QASA 2NU8A 4MKRA 5CVUA 1INLA 1CY4A 3OPXA 4JHLA 5JANA 2NU6B 3KR1A 4FFNA 3ZD8A 4JGIA 2WF9A 1JBEA 4YJFA 3W5IA 3WL6A 3PA8A 5ILOA 2VA8A 1RXUA 3AP1A 4PZEA 4ZMBA 4HS4A 4MYTA 2WWRA 2OAEA 1T9CA 4WAUA 1Y8ZA 1SZDA 3NKFA 2WSSA 1DRWA 4MMYB 3TNDA 2CXXA 2A67A 4CLXA 2OD7A 4WT7A 1FU4A 1Z38A 1G1MA 3RD5A 2HWUA 1PT5A 3D1LA 2P1DA 2G9ZA 3HLKA 1KYZA 3H65A 3DEFA 4Q05A 2BCJQ 4X0EA 2VDWB 3AKYA 4FNGA 1OXTA 5FOUA 3MC1A 4C2BA 4WFJA 3NVKI 2Q0QA 2VJBA 4YWJA 2GPJA 4WMLA 1SHTX 2HV8A 1NUPA 4KUHA 4RGVA 3WGYA 1G6OA 1FRZA 3AIMA 4WZBB 5AHOA 1ESNA 3OQVA 5EYPB 1IBCA 2KMLA 2R8BA 1FDWA 4UNQA 3V4SA 4LZWA 2BF7A 1DO0A 2Q2NA 2GTHA 2GUGA 1KYTA 3PUYA 4EHNA 1QFXA 1TGVA 3P5SA 1XKTA 5AKXA 2FZVA 2WFLB 5BNWA 2DCUA 3HBAA 5AM4A 1YJXA 4ML3A 4ZOBA 2ZE5A 3F2VA 1RWXA 1BE6A 3V8PA 2JBWA 4F06A 2J7PA 2D4AA 3OZFA 3VR4D 4MVJE 3IBSA 3TUIC 1EPUA 4FDTA 3FRJA 4X1IB 2XWSA 4X1KB 1N3IA 1CEQA 5A62A 3JPWA 4HVCA 3OFSA 4LG1A 3KXLA 3STHA 1XZQA 1T36A 1KK3A 2WU4A 4WXRA 5K3DA 3WNZA 3E6AA 3MVEA 1H0HA 5EJFA 4B17A 2AYXA 3ESBA 4FFLA 3LXMA 1KDVA 2JG3A 3PXBA 4ACAA 4CIBA 2VK1A 4MJLA 4BIMA 2GILA 1K3UB 2IBTA 2P6NA 4J3NA 4UTNA 3EYAA 2OPBA 3WK7A 1TA9A 5IKOA 2F43B 2ZCJA 1BWRA 3OC0A 3JR7A 2H4JA 3GNTA 1T5TA 2Y1OA 1NBEA 3H2ZA 3P2JA 2IEGA 3KEOA 1XQWA 2GZHA 3TFWA 3SEZA 4QEZA 3UJHA 1CDEA 3L2OB 3GELA 4LS3A 3DOHA 4WNCA 4KAAA 3EVNA 3KJQA 4YCCA 4XXHA 1WMBA 2FVXA 3EA5A 4CCYB 4TYNA 4EHFA 1APBA 4FHZA 1N2GA 2HA2A 2CK3D 1L5VA 1BXKA 3LUHA 1QVWA 3QYAA 5DT9A 3W6ZA 5FPKA 1O1YA 3TM4A 3QEBZ 4BUCA 1AG9A 3U7IA 1Z4QA 2XD4A 3G2HA 5EIHA 4EMTA 4HYQA 1DXYA 1OC2A 3SBEA 2EWMA 3V7NA 4V3BA 1N2OA 4PLZA 4LJ9A 1T8SA 3NHWA 3QUTA 1YWGO 4KOAA 3E3AA 3CCFA 3PNOA 3BMQB 3OQIA 3CEMA 3QVGB 3LKDA 3TJZA 3C3EA 3I92A 4O2RA 2D4HA 4D3YA 2OBBA 2A1UB 4Y1GA 1E2LA 2WTEA 3L8MA 3JRXA 4BB6A 5CFQA 4RZ3A 2ZRAA 3H2KA 2P7HA 1WCV1 2RB4A 3LQ2A 5C5EA 2FR8C 2QNIA 1DJOA 4NQZA 3T9EA 1QRUA 4JP2A 3RSGA 3BN3A 3HSSA 3AI3A 1FFBA 2ZIUB 4BYMA 1WXGA 1XCBA 1YQWA 1PL7A 2ONYA 2VDRB 3C6MA 3WB9A 1GGKA 3FR7A 1KMHB 1EFRA 2CLCX 4X1OA 2VJKA 4YP6A 1XTZA 4UATA 3A11A 3VVBA 3H8WA 5T3UA 3RRJA 4MKXA 2QK4A 1DBQA 2YNMC 3MCTA 2BN4A 5KREA 4B7UA 2PUBA 3K09A 5DRTA 1Z5ZA 1FXWF 5A1JA 3S7TA 7MDHA 3HVHA 1IQ0A 4B33A 5LC1A 4EB0A 4QKQA 1XL0A 4X97A 4LK3A 3KZKA 2CLDX 2WOOA 4I19A 3DJYA 3HPRA 3TW8A 2WIGA 1PEKE 5EMJA 1JWLA 4F1KA 3T9FA 2RIRA 3DP7A 2ZQ5A 3ESYA 5K9ZA 3T4XA 3PGMA 4Y1RB 4EMUA 2G07A 3TDMA 1FFAA 3SXUB 1RPNA 1XCLA 1JHQA 1SCAA 2QQFA 2QP3A 2R6CA 3LE8A 3TD6A 2XWBF 3U4AA 5LYJB 2B35A 1U0LA 2FFBA 4GQBA 3ZVRA 1M34B 4DLPA 4G1FA 4WEQA 2W90A 2OOSA 4XSHA 1SCIA 3QXSA 5J40A 1T26A 4PYRA 4LNAA 1JS1X 1REQB 2BUCA 2RK3A 4LOLA 3BIWA 1DMRA 1CZUA 1KQ3A 3N2NA 5TS2A 2I1LA 3SMQA 4EY3A 5CBPB 1PR5A 5FBVB 1MDFA 1U2GC 1N0WA 4E46A 4PAQA 2GM5A 1HSZA 3EH2A 2FZWA 4BFZA 4EY5A 3WHIA 2WDZA 2E82A 2EC5A 4UQLA 3AINA 1EE9A 2RAVA 3TRKA 4B2IA 4URFA 1HE3A 5EQJB 5AXDA 1ACMA 2WMDA 3WQSB 1SUDA 3OU6A 1NNLA 1Y3IA 5BN5A 1D1QA 2V7XA 2IUEA 4L02A 1J2JA 2ZQYA 3A1EA 3MS4A 4LE2A 4PSKA 1VDMA 2GCEA 3FOAA 1CUAA 1LKZA 2X6RA 5LOVF 1PDOA 4NTZA 1ODIA 3SSAA 3LFUA 2AVDA 3ZWDA 3KZOA 1SUAA 1U3GA 2FSSA 4MPTA 4HWTA 5HGJA 3OVMA 3K71B 5K0GA 4EA7A 3WWEA 3C3CA 1ZK1A 3EK2A 4A82A 4KREA 1I2MA 2OBLA 1L4EA 3BRSA 3L1JA 3OPQA 4AMUA 5JJIA 1H6DA 1J2YA 4W7IA 6AT1A 3BXEA 3ND5A 3P4YA 3E8XA 5K6TA 1F6BA 1KNQA 4Q3AA 3OPVA 1SCNE 4RGQA 5ERGB 1O6GA 2OOKA 1UK8A 2NTYC 4RJJA 4WK0B 4W1PA 1ZW1A 4F04A 3L41A 1F2UB 1LK0A 2ZXUA 8GPBA 4KJXA 3LHKA 3KKNA 4JR0A 2CLOB 5DN6D 2ZVJA 3S2IA 5BV1A 1E8DA 4DUGD 2X8JB 4S0XA 3FCUB 2E48A 2Y4NA 3INRA 3UCEA 1P73A 3I6QA 4ZEWA 1XRRA 3JWJA 4DG5A 4TQAA 2PRZA 1FW8A 1QCZA 5KJEA 5ADVA 5IF3A 1DOHA 3H9QA 4N3BA 4O08A 4XIYA 1XVTA 2GEVA 3FZGA 3QU7A 3UYLA 3ZKAA 1B00A 4H2DA 2ODPA 1P18A 2ODNA 3G0HA 1ZH4A 2A9KA 2IE8A 5JROA 2AG1A 4QQKA 4EPXA 2I8AA 2HRQA 3GP3A 3M6XA 4ZO9A 1E98A 3O73A 1FP6A 2DQSA 5JS8A 4KFCA 3OJLA 4DDWA 1GNLA 2FPRA 3MUEA 4TV8F 1T6YA 3U7GA 3IEVA 1CY2A 2JFPA 5LA6F 2HEGA 3E9RA 3OY7A 5LVAA 1CUJA 2W00A 4GE0A 4JYAB 2X0JA 3ONWA 4Z0TA 1C2TA 2E6KA 2QLBA 4JV5B 1K98A 4DC0A 3WO0A 2BZ0A 3ZHQA 4TUYF 4I7EA 1F0YA 1NQWA 4K5QA 3UBMA 2IXFA 3OQJA 4LHYA 4KITB 3N07A 4IXNA 1X42A 1B8VA 1K2VN 1E96A 4QLOA 4RETA 4BQOA 1JA1A 4EJMA 2DY0A 1Y5LA 2ZUDA 3NU1A 2YIMA 1YH3A 4GXQA 5GOTA 5SZJA 2VYFA 3DKIA 4URHA 2V7BA 5JADA 1GYRA 1JSXA 2C83A 3O2SB 2ZYSA 3CX6A 1VIVA 3H2GA 1N5JA 1PJ8A 2DC1A 2W37A 4UPDA 2JAHA 1L7XA 4R1QA 4NENB 4E31A 1PN3A 3DXZA 2NZ8A 3A3YA 4K1LA 2GN9A 1P6UA 5LXTB 4HN9A 3EGCA 1OH7A 5JH7A 1UMCA 2G4LA 3H1FA 2X23A 3IBCA 3NW9A 4B3BA 3IQGX 2JGKA 2XA2A 3PITA 4YRKA 1I0ZA 1LGYA 1S96A 1ULHA 2DT8A 3COWA 1IY9A 3GVHA 3DP9A 1VE1A 2QN2A 3UMBA 4OQZA 4F46A 1MVLA 1YCDA 2CDRA 4HQNA 3OT1A 5B6IA 3QJYA 1C9NA 1P1FA 2PCJA 2GN8A 4CGYA 3KDAA 4R2WA 2Q3MA 2WIAA 5H81A 4DL9A 4OLJA 5KNBD 3IH5A 3KU4A 4XD2A 1CJUC 2VJAA 3VAYA 1K7EB 3EXIB 3S1SA 2AE1A 3ICWA 2GXAA 2TECE 3NDPA 4Z3OA 4NPCA 5C5DA 3KBOA 3L7CA 4B75A 4FEYA 1BMFA 1QV7A 1ULUA 5GJBA 4L9SA 2V7WA 5HKKD 5ALOA 4QXRA 4ZI5A 3W8DA 1SB8A 4I1SA 5HEKA 4YJDA 3T7IA 3BXGA 5TPZD 3DR3A 2W6JA 3DTVD 2XD9A 4EYKA 4YAWA 4OOFA 4CCWA 3D3KA 5A9RA 3A1UA 3G8AA 1SQ6A 2JEOA 2XZPA 4M0UA 1JJVA 4RE5A 5I4IA 3BTUA 3K8QA 1FXUA 1U1EA 3HY3A 4Z9BA 5HMMA 5A71A 3ZWXA 5BWCA 1ZK2A 1TJNA 3W6UA 2RH5A 3PC8C 1GUZA 5BNTA 4EYEA 3GFSA 4AZTA 4M53A 4MKFA 4BNDA 1QTQA 5T64A 1JEQA 2IW1A 3O4HA 4X3OA 3S4YA 2BM8A 3EIQA 3EX7C 1XAHA 1JFSA 1F2VA 4DMLA 2QQGA 3EUAA 1R3UA 4U00A 3DAOA 5G53C 1Q57A 2JBAB 4C06A 2HQRA 2AZ4A 3U7QB 1J1UA 1ZMBA 1C4OA 2EG5A 3QVWA 2OGWA 5A06A 4KQCA 3X43A 4FKZA 4DBLE 5JXIA 2CCKA 3IUEA 3OJWA 5EZSA 1TCAA 4W9NA 1XQXA 2YFKA 4PGFA 4ETIA 2V7QD 4TLBA 4N0PA 2JRLA 2CMGA 5BT9A 1W76A 3ZOZA 2GN1A 3CG0A 1FP1D 4K28A 5EXSA 3U48A 4F8EA 1TW3A 1BE8A 1AX9A 1V8DA 2OM6A 3CLUC 3GX1A 3GXOA 3NT2A 4A92A 2K7FA 3GO4A 3FWNA 3PEFA 1UOQA 4V39A 4UFOA 3SX2A 2XI4A 5K3AA 3ZNOA 2ID7A 1F6DA 1ZWKA 2OGUA 3ODGA 3ANNA 4PR0A 3OEHA 3GFTA 4FCVA 5I7UA 2FOIA 3NBXX 2I3GA 1GHTA 2Q3CA 2QGZA 2FCAA 5LDGA 1V3QE 5HOEA 1YJ5A 3UYKA 4N3NA 3AI7A 5IEBA 4CUZA 1G8GA 1XRJA 2CFIA 4KACA 4A15A 4M1SA 2K4MA 2QYSA 4M22A 3DH0A 3C1UA 1P1BA 1DIBA 4BP3A 1PJRA 1NMYA 3PFNA 3LCUA 1ZXBA 4IHJF 1Q3KA 2Q8QA 3GMIA 4C01A 2F3TA 5BOVA 1Y7IA 4W6QA 2OO7A 2VDWA 2ZPTX 1NV9A 4LYDA 1NPDA 3V33A 4TZ0A 1PZHA 2P5UA 4QULA 4WADA 4FHDA 1SOWA 5ESDA 3GRVA 2RGWA 2NO4A 4Q9DA 2PXHA 1Z2NX 3MJSA 3BRCA 3G85A 3K2BA 2XOKD 1Z0FA 4U2GA 5B64A 1PI3A 3NM6B 1VMAA 4LV8B 4R2XA 1SO8A 3PTZA 2EGHA 1RJFA 2VVTA 1PWZA 4TL6A 1ILWA 3PUVA 4FYKA 1VE6A 5I9TA 5SY6A 1AH2A 1KH3A 2IU6A 4J07A 3AHGA 2J0UB 2GDZA 5HQJA 1HYHA 2NACA 5LCXA 3RRYA 3HRKA 3WB2A 1C1YA 2WPNA 1ZIXA 2RFLA 5AOCA 1D2MA 4YUXA 1E8NA 1XUOA 2P30A 3VBCA 4KE7A 4ARSA 3WOHA 4BKRA 3FIUA 5EY5B 4CWAA 3K0KA 4UPEA 1KO8A 5CA0B 1YU9A 1NDHA 1RBMA 4ER3A 2IYYA 3AJEA 4UUMA 1PJZA 4M2LA 2Q62A 5K2MA 5LYJA 4DIKA 1CE8B 1EX1A 1OFUX 1XDZA 2FXIA 3UY4A 3PFHA 1V3VA 1V16B 3QHAA 1DKRA 1Z5WA 3JAKB 3W06A 1ESEA 3GWZA 2PR7A 3PJEA 1QVVA 1RMQA 1RQGA 3ZY4A 2BKAA 1D4AA 1CD5A 2PZJA 2X14A 1GKLA 1N32B 4ATNA 2Q6KA 1JKIA 3IJEB 4FXOA 4B6FA 3TG8A 4Q37A 2HOQA 2C0QA 1D2GA 2IXEA 2PXAA 3AEYA 3N0TA 3DULA 4KQ6A 4YBRA 1YBFA 4AZSA 4Q3BA 4EY8A 2IKQA 1HSOA 4NCXA 3WIDA 3QLJA 3CN9A 1KRXA 3KOUA 1KIFA 2YWJA 3VX4A 1UJ2A 1PT7A 5K2OA 2FPOA 3E27A 4QTXA 5CGZA 4KYTA 3C97A 4RVHA 5DN9A 1TTHA 3C43A 3V8BA 3ORFA 4XJXA 5A4MS 3F6RA 2FSHA 4U8GA 3RK1A 5JBNA 2OGTA 1M6VA 5DNWA 4RVUA 4DLLA 1XP8A 1M2HA 2DR0A 4LXYA 1KVQA 1OVGA 1EUZA 1F9EA 1Y5IA 2VDQB 2QPAA 3CX4A 2VJNA 1Y4UA 1G8YA 1T2FA 1XKXA 3H87A 5B7NA 2DVMA 4X65B 4DQ0A 4D8YA 1I4LD 3DO8A 1ZRHA 3AMVA 3N2KB 4BX2A 4N01A 4EOGA 4O63O 2ILTA 3CW9A 3MCAA 5ECYA 1NW4A 2J6CA 4YAKA 1P2SA 3BK1A 2FN3A 3EQ7A 4N5HX 4C4RA 4QG7A 1T2NA 2WMNB 4LDZA 3IUQA 4C20A 1F8UA 1RJ9A 1O9BA 5AVSA 3TECE 2KBFA 3A4YA 4C4TA 4P54A 5LQNA 4ETNA 1RXIA 4MULA 4BLVA 1JZSA 2IYNA 5DP2A 5IDYA 8ATCA 1C30B 4MEAA 1M6WA 1ISHA 5AVUA 5JZOA 4TS4A 4Z2YA 2QQ0A 1CZKA 1CUBA 1VJGA 5LQCA 4RPKA 2XQKA 1NX9A 5CB6A 3WGOA 4HYEA 5JCZA 1NSFA 4P3NA 2H2GA 3QRWA 3PXCX 1O08A 3CTMA 5REQB 1DKNA 3UUFA 2H1OA 1AB5A 4DC9A 4GYJA 5EC8A 1L8AA 3DGEC 4LTNA 4QBKA 2O8BA 4BVHA 1ODCA 4G1CA 2FN4A 1U98A 2BFDA 5AKJA 1QJ4A 1J22A 4IIVA 4G5QA 1L8LA 4L5AA 1VLZA 2A35A 4YRTA 4A23A 3CKKA 5FLKA 4BO4A 1YFKA 3TWOA 4PG5A 3BOSA 3FPSA 2R1TB 4IOKA 1I7PA 1XQYA 4PTYA 4WKNA 4V38A 5A03A 1SKYB 3WGJA 4WBNF 3V8QA 5DM1A 1LB1B 1OLXB 5JMOA 1IOWA 1EEHA 2C54A 1LPAB 3GJXC 4YREA 3I9V6 3IRVA 5AVOA 2FHPA 3AYZB 3IPCA 1BZYA 2YOGA 3PNLA 3QUAA 4GECA 2WWWA 1XA4A 4IHKA 2VK2A 4D02A 5BUZA 5IHXA 2RHWA 2JIPA 2VRCD 5FOSA 5L6LB 3C14C 1V6SA 4PGAA 4ZQCB 1KEWA 4ZOLA 4QUIA 3ZHBA 1QZZA 1YI0A 1K1EA 3UOGA 4K81B 1AQIA 5KEIA 1X8KA 3OJOA 2Z56A 2ONKA 1R8SA 3W5HA 4CV2A 1QCCA 3TGWA 2PSEA 3EB9A 4RLFA 3P2OA 1A69A 1TQHA 2C03A 3EGDA 4AQYB 4H7KA 3FHTA 2R1ZA 4HJXA 4FOPA 2OO5C 3GVCA 3NXSA 2O8FA 5DTQA 1NX6A 3TEMA 2FWBA 2ZJ8A 4QGSA 4MS1B 2FPUA 4WA7A 4ZOLF 1IBMB 3UNXA 5LB2A 1ZOOA 3MOSA 2NPFA 2C3PA 4ZI7A 5JRZA 3I2HA 1WSAA 3WLPA 1GV0A 4QO8A 3YASA 4Z4GA 1P0PA 2YBEA 1T3GA 3QPVA 5IPFA 1E1RD 1S3IA 2BFFA 3FYUA 1U3VA 1S0UA 2GHRA 5F3DA 1XD2A 3UPTA 1FQJA 1W4CA 2AJLI 1SCDA 2QMUA 3E9QA 1Y9AA 4P93A 3V1NA 2YXLA 2EARA 2B94A 5H8WA 3U40A 1EVZA 1UZUA 1D4FA 2C9ZA 2IWHA 2IHNA 1BX0A 1NR7A 1KVSA 2NO7A 2OHOA 4WDRA 2FPWA 3C8ZA 4X7PA 5K0EA 3DBIA 3H8JA 1T0HB 3GFPA 2VQEB 5MHTA 2NUTA 4JB8A 1JLKA 5HTOA 2IPLA 2UVPA 3G6WA 4ME6A 4R2MA 3AL3A 3EIXA 4K8RB 4BRZA 1TJ5A 1U9YA 3AVTA 1ND5A 1W0KD 3EHDA 4CFSA 2VDKB 2HADA 4FJ2A 4AZ0A 1AZSC 2NVWA 2GYYA 5HKAA 3PEYA 1JTFA 4C7XA 1P2GA 3ANXA 4RKEA 4PYIA 1T9AA 2NXJA 2OD2A 1Z4IA 1D7OA 4I1IA 2R00C 4TXHA 3SLRA 3V8NA 4RXUA 5KSOA 2PSFA 1JDBC 1YVRA 3T9AA 4AO6A 4P3YA 4DMCA 1QO9A 4YR7A 5EIFA 3QJ5A 3WWCA 3N59A 4ZVMA 1BGVA 1MB0A 2YN4A 4M76B 2ZSAA 3ENVA 4TXMA 3SM3A 1XRNA 4RSHA 3RYHB 1ADFA 1X9IA 4QNMA 3U9LA 1JYFA 3AUSA 4NK4A 4AMVA 2Y8EA 3WISA 3U81A 4BZPA 5T8KC 3QEAZ 3Q6MA 3FLBA 3ORHA 3NP7A 3VJMA 2P9YA 4KAJA 5AKIA 2JKYA 4HAIA 2YS6A 4MLCA 1HT0A 3NTOA 1EDBA 2FEOA 1PNOA 3QXXA 3RT1A 4AFNA 3L01A 3WK6A 1XMQB 1YJCA 4KYIB 4QE3A 2IDKA 4FWIB 2LKCA 1QQBA 2BTQA 4CIVA 1N6OA 1POXA 1ZVJA 1KJ8A 2UYGA 2YY7A 2ZKIA 2OKCA 2SICE 3HYCA 1SU7A 2OT3B 2IXDA 3S55A 4BTEA 2YJZA 2F3SA 1UBUS 2WWVD 3AY6A 3HADA 2QRLA 3IP5A 4Y2QA 5BSMA 1U2EA 2WQ7A 1JZQA 1T8TA 2P5YA 1D6SA 3NCTA 1PZGA 2HPAA 3PGLA 4D44A 2AEFA 2XUPA 2CXNA 2GJKA 1B7GO 1IIBA 4AF6A 2BZGA 1THTA 4X41A 2GPWA 2J0SA 1EWYA 1QB8A 2BIFA 3TI9A 3F5FA 4X8OA 5FR1A 4DADA 1VIYA 5A4JA 5J4LA 1N78A 4BQQA 1L1RA 2V98A 4RGBA 1KYXA 1Q6ZA 1CLUA 1YR7A 3LGAA 4LWZA 4RIGA 3RQIA 4B31A 4BFCA 2F17A 5F9FA 3TZKA 1N1MA 5KVAA 2D59A 5FEUA 3B5EA 4UAVA 2FJ0A 4JOBA 3SDSA 3V8RA 1DAOA 4AP9A 3MTDA 1A9XB 3V6MA 2QTRA 3OX1A 1G4UR 1D1SA 1U2TA 1W2GA 1XTUA 2YHSA 4LHZA 5UKDA 3VPDA 3D81A 4DEYA 2CFSA 1GPKA 3BJEA 3DKRA 2GI4A 3PNBA 4RVGA 2C7BA 1ZK4A 3ACBA 4BWGA 4D8UA 2BGGA 5JAQA 3AZOA 4NARA 1DBWA 2Q3DA 3EXIA 4CU2A 2PUEA 2DBZA 4DC1A 4IHAA 4BIIA 2ZBQA 4EI9A 4C7OA 4F96A 4GLLA 1PVVA 3KZCA 5DCYA 1N8TA 4G6ZA 4LF4B 3LZDA 2XODA 4R8LA 1XF1A 3MUOA 5F23A 1CC1S 1CVIA 2JCYA 4GNKA 2JLUA 5FTMA 2AG0A 3TB6A 3ROFA 3HV2A 4YLYA 1IM5A 3GNSA 3B1XA 1IRIA 5B1IA 2F8SA 3F0TA 5B3JC 3UBTA 1KI2A 3GEEA 4R3UC 1KFKB 1R5NA 5FDFA 3RSHA 3HL0A 2OLJA 1Q21A 2N9UA 1XLVA 2OEPA 5AI0A 3Q10A 1WB6A 3SZ3A 1SXJC 4TMXA 3GJ8A 3BH7A 3G9QA 3SYTA 3C0KA 3WMGA 1F6WA 1L6RA 2O05A 5CEEA 2I7CA 1BE0A 3RU9A 5KNBA 1DKLA 2ZZNA 3EMVA 1E7RA 2QPTA 4GR4A 5CXXA 5EE5B 1BX3A