4BVPA

Legionella pneumophila ntpdase1 crystal form ii (closed) in complex with heptamolybdate and octamolybdate
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
365
structure length
365
Chain Sequence
NPCEKHSCIAVIDAGSTGSRLHIYSYDTDDTNTPIHIEEIWNKKIKPGFASIQPNSVTIDAYLTMLLADAPIHNIPVYFYATAGMRLLPQSQQKKYYDELDYWFRQQSQWQLVEAKTITGNDEALFDWLAVNYKLDTLKSVQNKSVGVMDMGGASVQIVFPMPKNAEISKHNQVELNIYGQNINLYVHSFLGLGQTEMSHQFLNSPSCFANDYPLPDGESGQGNAPSCKEEVTSLMNSVHKVNQQIQPLLALNPVNEWYSIGGISNLASSQLFHFENSELTNQSLLQQGDNQICHQQWDILNGQYPDDEYLYQYCLLSSYYYALMVDGYGINPNQTIHYIPPEQNLDWTIGVVLHRALEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of Legionella Pneumophila Ntpdase1 in Complex with Polyoxometallates.
pubmed doi rcsb
source organism Legionella pneumophila
molecule tags Hydrolase
molecule keywords ECTONUCLEOSIDE TRIPHOSPHATE DIPHOSPHOHYDROLASE I
total genus 124
structure length 365
sequence length 365
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-06-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01150 GDA1_CD39 GDA1/CD39 (nucleoside phosphatase) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4bvpA01
3.30.420.150 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Exopolyphosphatase. Domain 2 4bvpA02
2H3GX 1BUPA 4DHYA 3JS6A 3MMVA 4DB3A 4BG8A 1KAYA 3WQTA 4EHUA 1TUUA 1GLEG 2YI1A 3VGMA 1ATSA 3HSCA 4BRCA 4CZJA 3D7EO 3DXKA 4BREA 2BTFA 1GLBG 4A62A 2P9PB 5JICA 3WXJA 2ASOA 4BVPA 3BEXA 1WUAA 2QXLA 3HM8A 3D2EB 1WOQA 1BA1A 2NRHA 3SK3A 2A6AA 3F9MA 3KZBA 2A42A 3A5OC 5KQ8A 4DCHA 3M6GA 3QDKA 4BC3A 5KQDA 4IJNA 2FLOA 3EKSA 4BR4A 4EHTA 2BUPA 2W41A 3A5NC 5JLHA 3GOIA 4M7YA 1RFQA 4BQZA 2E2QA 1SAZA 1T44A 2QM1A 4BR5A 4FOIA 1QQNA 2Q97A 3DXKB 3W3DA 2HMPA 3R9PA 4PKIA 2D0PA 3EN9A 1GLFO 3WEEA 2E8AA 2KHOA 4FWSA 4B1WB 5F2RA 5ADXH 3CJ1A 3VF6A 3FZFA 2PBDA 2ASPA 3VESA 5AQXA 4XH4A 3ATVA 2GWKA 4CZGA 3I33A 3ID8A 1CZAN 2ZWHA 4BRKA 4WQ4A 3ENOA 5BRHA 3A5LC 1IG8A 3DXMA 4B1YB 4Y0WA 2P9PA 4BC5A 3FE1A 3TPQA 1JCEA 3VEXA 4EAHD 3BF1A 5AZJB 2OANA 3A5MC 4E1JA 2VCPA 3J8AA 5AQWA 4A61A 1GLLO 3O1WA 3ULEA 2Q31A 3H3OB 1V4TA 4FL9A 3CJBA 3H46O 5EOYA 4BRGA 1BO5O 3WEEB 5AQKA 3OHRA 4FO0A 3WXLA 4CZLA 4K41A 2D0OA 5I9EB 2E2NA 3W0LA 4PKGA 2NZTA 4MLHA 5AQPA 1HLUA 2YHXA 1TUYA 3H1QA 2F9WA 2D4WA 3UKUB 1BU6O 1JCFA 2P9SB 4LC9B 3IUCA 1NWKA 3UKRB 2AA4A 2CGJA 3C7NB 3D2FB 3WXKA 5BREA 2V7YA 2J4RA 2V51B 2Q2RA 5FPDA 4ISEA 1IJJA 4RWTA 4A2AA 5FPMA 3VENA 3MCPA 1NMDA 1XUPO 3IFRA 4FWMA 4B1ZA 1LOTB 2ZGZA 2VYPA 5AQMA 1QZ6A 1NGIA 5EX5A 4BRIA 3GDQA 4KBOA 2FF6A 4FPAA 1MWKA 2F9TA 5AQIA 3HBTA 3SMPA 3VEYA 4FPBA 2GTDA 4CZIA 4CZFA 2YHYA 1R59O 4HWIA 2FSKA 2EWSA 4FWKA 3LDPA 5AZIA 1SZ2A 4H0PA 4J8FA 5TKYA 3D2EA 3O4WA 4GY2B 3B8AX 1GLJO 1NGHA 2P9LA 2W40A 2QWRA 3HI0A 3U8XA 3MN6A 4CZEA 3MN7A 4XEIA 3LM9A 4I6MB 3O08A 4JHDA 3U4LA 1NGDA 4H5RA 4H5VA 2P9IB 2ZGYA 4FOEA 3MK6A 1ESVA 2E88A 2CH5A 3AARA 2Q0RA 4YDUA 5AQJA 4BGAA 5BPLA 1Q18A 3DJCA 3O8MA 1BG3A 1K8KB 1S3XA 5AQQA 3QICA 2ITMA 2D1KA 4I6MA 4EIAA 5AZJA 3HZ6A 4FWLA 3FLCO 4BR9A 5LY3A 4A2BA 2FF3B 2V7ZA 4L3QA 4BRHA 1C0GA 1NGBA 1NGFA 3LDNA 1ATRA 3HTVA 1KAXA 4BR7A 2Q0UA 2QWOA 1E4FT 2HOEA 1NGGA 3VEZA 3S41A 2CGKA 5AFUH 1HKBA 5AQLA 1X3MA 2HF3A 3M1FA 2P9IA 3EZWA 1Y64A 3I8BA 1BDGA 5AFUA 2CGLA 3IMXA 5EXWA 3BP8A 5AQUA 2E2PA 3FZMA 2IIRA 4FSVA 1OKJA 4CBXA 2E20A 5BRFA 3LM2A 4B1XB 3FZHA 2NLXA 4IO8A 5FPNA 3CI5A 3FZLA 4AM6A 4CBUA 4JD2A 2Q1NA 3C7NA 5F0XA 1QHAA 4BRQA 5AQGA 4BRAA 3VEVA 2P9SA 4PL7A 4ISGA 3UKRA 3CIPA 4FWQA 1KXPA 3ZX0A 1Z6RA 4CI6A 4CD1A 5ADXA 3VEWA 4XH1A 3FZKA 3G25A 3ZX2A 4WQ4C 2QWMA 2E1ZA 3CJ7A 1RGIA 3ATUA 3ZETB 3O1BA 4Z94A 3IDHA 5KPRA 1H1VA 5F1XA 1QQOA 3C0BA 2P9KA 5BPMA 4H0XB 3H6EA 2A3ZA 3CJCA 1HJOA 2IVOA 2YCHA 2ZF5O 3DAWA 1ZC6A 5AQOA 3BUZB 3R8EA 4BRLA 4BGBA 3BF3A 1NGEA 3ULEB 1EQYA 2WUSA 3GG4A 1BWFO 3GE1A 2P9NA 4RTFD 1GLDG 3VEOA 1ZBSA 3EO3A 4QS8A 4BRMA 4MLEA 1DKGD 2A41A 2IVNA 4QS7A 2UYTA 1T6DA 3AAPA 3RSEB 1NLVA 1K8KA 4BC2A 3VF4A 3QMLA 5AZIB 5JMVA 4JAXA 2YJEA 3UE5A 1T6CA 4JD2B 2AP1A 3H3NO 1SQKA 1JCGA 2ASMA 3CETA 4O5FA 4IXCA 1C0FA 4F9OA 2P9KB 3ZX3A 4O8KA 5AQYA 5AQSA 3GL1A 4K43A 5LJVA 1HKGA 3QFPA 4EFHA 4B1UB 4H0TB 1RDWX 2DPNA 4BG9A 4CBWA 4FWPA 4BRNA 4BQLA 3H1VX 2E2OA 4B1VA 1S22A 4H0VB 3L0QA 4CZMA 3O80A 5AQTA 1MDUB 5KPZA 5LJWA 4RCHA 3KVGA 4HTLA 2GELA 4H0YB 3P4IA 2GUPA 4MO5A 3JXUA 1NBWA 2IVPA 4MO4A 3VF2A 3A0IX 3UB5A 4BRPA 5E26A 2P9UB 3ENHA 4K42A 4IZ9A 4M63C 4PKHA 4NO7A 4WQ5C 1KAZA 1QZ5A 4QS9A 4M7XA 4YDUC 3M3ZA 5BPNA 3CQXA 1BOTO 3VGLA 5E84A 4BR0A 3LDQA 3LDLA 3QBWA 1YUWA 3UKUA 3FFKB 3MN9A 5AQRA 1G99A 3SJHA 4JHDB 2QWPA 3TU5A 3L6QA 4H03B 3O6WA 3VETA 4NB4A 5BR9A 3AAQA 5B8HA 4H0OA 5JLFA 2P9LB 3CJAA 1BA0A 3CERA 1HX1A 3QBXA 2E1YA 1YXQA 3SLCA 4XH5A 3LL3A 3SMSA 3R6MA 3VERA 3MDQA 1NGCA 1E4GT 2GWJA 3MN5A 5AR0A 3ZEUB 3VPZA 1X9JA 4ISFA 4IWVA 4JN4A 5BRDA 2P9UA 1P8ZA 2FXUA 5FPEA 2GEMA 3DXMB 1MWMA 3KHYA 1ATNA 3U9ZA 3FR0A 2HF4A 2QWQA 3EL2A 5AQZA 3U9DA 3EKUA 1J6ZA 4BC4A 4C23A 1TYQA 5EVZA 4CD3A 1NGAA 3LDOA 3CJ9A 3QB0A 4DQ8A 5EY4A 1DEJA 3AY9A 1U2VA 4IJAA 1HUXA 2A40A 1LCUA 1YVNA 3DWLA 3CHWA 1YAGA 1U2VB 1XQSC 2I7PA 4WYBA 5AQNA 1GLAG 3QFUA 3RSEA 2YHWA 1V4SA 3CQYA 1GLCG 2QWNA 4JNEA 3VOVA 3WUHA 2I7NA 2Q36A 1ZXOA 4B9QA 2VWBA 4WQ5A 4BRFA 4H5NA 1D4XA 1HPMA 4FWRA 4H5TA 5ELZA 1QQMA 3WXIA 1Z05A 1X3NA 4K25A 4BROA 2QWLA 4FWOA 4AM7A 3H45C 5BN9A 4BRDA 4CZHA 1XC3A 5AQVA 5CE3A 4CJ7A 2FSJA 2V52B 2YJFA 3WQUA 1U6ZA 3D2FA 1MA9B 1TYQB 5AQHA 3L4IA 3VGKA 1NGJA 2QW9A 3O5BA 1NM1A 2A5XA 4BVOA 3A8YA 4H5WA 2CH6A 4FWNA 3ZETA 5KPTA 2P9NB 3WT0A 4PL8A 4BR2A 3FGUA 1HKCA 4GNIA 5AQFA 5BN8A 4CZKA 3GBTA 3ZEUA 2PAVA 1DGKN 2FSNA
chains in the Genus database with same CATH superfamily
1BUPA 1TL3A 1S6QA 3AVCA 1SUQA 2O8BA 1OVYA 4E7IA 1TUUA 5FRNA 1QVFM 3HSCA 3SUOA 4BRCA 3SPYA 2BE2A 3OYEA 3AO5A 3DXKA 4BREA 4J2BA 5JICA 3THXB 3WXJA 4BVPA 1WUAA 1WOQA 5FLXO 1RILA 1SKRA 2NUBA 2A6AA 3LZJA 3F9MA 2UUAK 4CF1A 3HRGA 1Q9YA 3M6GA 4XIUA 2FLOA 5SWMA 4C8KA 4DTUA 1TVRA 4M7YA 1Q82O 3D45A 2RE2A 4CK2A 1SAZA 3NH1A 2QM1A 3SYZA 1QQNA 3W3DA 2HMPA 4DV3K 1S1WA 1LW2A 3NBPA 3R9PA 5HRRA 3KJVA 1NJWA 3RRHA 1HNVA 3K5NA 1K73O 3OTOK 1ASUA 3WEEA 3VQEA 5JS1A 5T7BA 2E4LA 3SCXA 1VQLN 4B8AB 1IKVA 1B9DA 4H4OA 3VESA 5AQXA 1VRUA 3BDPA 1BIZA 4CZGA 3ID8A 1CZAN 3AV9A 4WQ4A 4CJRA 3HXMA 1IG8A 3KK1A 4RW8A 3TAPA 2DFEA 4FJ9A 3FE1A 3SBGA 3O3HA 3BF1A 3SAHA 2OANA 4G1QA 2KFZA 4E1JA 3LWMA 4KHWA 3O1WA 2W6LA 2Q31A 5H1SQ 4NCBA 2YX6A 4FL9A 3H46O 1DTTA 3L3VA 3VMFB 4DV5K 3OVNA 5CR4A 4K8XA 3BY5A 4FO0A 3QEIA 1VSLA 4CFBA 2D0OA 3MEDA 3W0LA 3EEQA 4E7LA 3ZSQA 2X74A 4MLHA 4ICLA 3VA3A 1HLUA 4DV7K 2YHAA 3H1QA 2P5OA 2F9WA 4N47A 5K14A 1JCFA 2RF2A 3L2RA 1XNRK 4EP5A 2AA4A 2CGJA 3O9SA 3WXKA 1L5UA 3VTIA 4G9ZA 3KLFA 3DLKA 3THYA 4FLWA 1KVAA 4BACA 4YHHK 1IJJA 5FPMA 3VENA 1Q7YO 3V1OA 3CFPA 4FWMA 4B1ZA 1LOTB 2B6AA 4CEDA 2VYPA 5EX5A 3ZSOA 2G8HA 1RT6A 3GDQA 3PUFA 4BRIA 5HOOA 2QEXN 3SPZA 3OYIA 3LP1A 3VEYA 4FPBA 2GTDA 4O8UA 1C1AA 4KFBA 3T69A 3O3FA 2PZSA 2YHYA 4HWIA 4CIGA 1J54A 2WONA 4FWKA 1UWBA 2WBNA 1SZ2A 4H0PA 4C8NA 3P38A 3O4WA 1GLJO 2OA8A 2KFNA 5C15A 1VQON 4KHNA 4IFEA 2P9LA 4IG0A 4Y1CA 3U8XA 3MN6A 3LM9A 4I6MB 3O08A 3U4LA 4H5RA 1SV5A 4DU4A 4FOEA 2O8BB 3DMJA 3DJCA 3CFOA 4YOTA 1WN7A 1ZBHA 3O8MA 1RBVA 5AQQA 3MWPA 4I6MA 4DMNA 3HP9A 3RTVA 4EIAA 5AZJA 4NYFA 4FWLA 3HT3A 2FF3B 4L3QA 1NGBA 5GAGP 3NH0A 1NGFA 1MU2A 3MAQA 3P1GA 3HTVA 4CGHA 4FJGA 4BR7A 4E1NA 4PUOA 1E4FT 1JJ2M 1J53A 3VEZA 4BE0A 1VQKN 1HKBA 5AQLA 1X3MA 2FC0A 3L3UA 4HCCA 3HPHA 3I8BA 2CGLA 4BE2A 5DMRA 5EXWA 3BP8A 1G15A 2E2PA 1HNXK 3FZMA 3NFAA 4FSVA 5BRFA 5CZ1A 2NLXA 4CEFA 1N6QA 4BY9C 3FZLA 4AM6A 4CBUA 5M1OA 1IKYA 2Q1NA 4JD2A 4BRQA 1RTHA 4O4GA 3ENBA 4PL7A 1ZBLA 1QS4A 3KLGA 1KXPA 5HRPA 5IT9O 4KH4A 3G25A 1LWEA 3KWIA 2F7TA 2QWMA 4ELUA 5HLFA 4ZHRA 3ATUA 1BIUA 4FJNA 5M1KA 3SQ4A 4DUZK 4Z94A 3IDHA 5KPRA 1H1VA 2D5RA 5F1XA 3K2PA 4OJRA 4DV6K 4KTWA 4HUFA 3S3NA 3OYGA 3KIOA 3CMAN 5HRNA 1ZC6A 1ASVA 4BGBA 4F8RA 3F2KA 4DS4A 2WUSA 4OO1J 3VQDA 1S1UA 4CJVA 1GLDG 1SKWA 1VQMN 1ZBSA 3EO3A 4KV8A 3LAMA 1SL0A 2A41A 3C6UA 1KRPA 2O4IA 4DQPA 5KTQA 5CYQA 4KHSA 4CCHA 4IBNA 4BC2A 2VQFK 5JMVA 3CM5A 3UE5A 5GADP 1VHXA 4CEBA 4Z4IA 4JD2B 1D9FA 2GV9A 4CK1A 4DF4A 3CC7N 2ASMA 5IWAK 4OPJA 3TANA 4IEIA 2G8FA 3I0SA 2HB5A 4CJ4A 3GL1A 5BR8K 3AVJA 3TSUA 2XY8A 3QINA 4BG9A 1KVCA 4Q5VA 4FWPA 3H1VX 4FLTA 1KVBA 4YOUA 1A5WA 4A59A 4FJXA 3O80A 5AJ3K 4B3MK 4DR4K 5KPZA 4B9LA 3KVGA 4HTLA 4B08A 1BQNA 3AO4A 4LF7K 3T1AA 4CGGA 2GUPA 4MO5A 5D3GA 3MCAB 3JXUA 4MO4A 2NNWA 1HQEA 3RVCA 4BRPA 1KQSM 1S1XA 2G8WA 5E26A 2P9UB 5GIPA 4K42A 4M7XA 5BPNA 4YORA 2RPIA 1VSDA 4X66K 1WSJA 3VGLA 1C1BA 3LDQA 1NNEA 3LDLA 1VAZA 3LPUA 1ZBFA 3MN9A 3CCLN 4WFNL 1G99A 3VQCA 4FLUA 3TU5A 4B9UA 4ILHA 1TL1A 1WBBA 5B8HA 4H0OA 4HVJA 1WLJA 3CJAA 4IOAL 4I2PA 4QOZB 1HX1A 3U3GA 4CFCA 3N4PA 4AHRA 4CJUA 4WFBL 3CCQN 4E7JA 5HROA 1VQ9N 4CVNE 3E66A 3HSTB 4O0JA 1NK7A 4GV6A 3THVA 3SMSA 4C8MA 1E4GT 4CHPA 1X9JA 3KD1E 2P9UA 3CMEN 1T05A 1YVUA 1U48A 1MWMA 2OPSA 3U9ZA 3FR0A 3E9PA 2HF4A 4CESA 2QWQA 3EL2A 2QI2A 3EKUA 1J6ZA 2OPQA 4BDYA 4DTXA 3OA9A 4YY3K 1NOYA 3QB0A 4RW6A 4ZTJA 2Z1IA 3ZLJA 4KHYA 2ZQBA 4N5SA 4CHZA 1YVNA 2ZJRL 4FM0A 4FVMA 2A1RA 1YAGA 1U2VB 1XQSC 4OKKA 3EY1A 4IOCL 3RMCA 1GLAG 1VSKA 3MX5A 2YHWA 3EE9A 1ZXOA 1HRHA 4H5NA 2HHHK 1QQMA 4JRQA 3LP3A 1Z05A 4FZXC 1EWRA 4K25A 4BROA 2QWLA 4FWOA 4AM7A 3H45C 4N56A 4AILC 2DFHA 1NMNA 1S5JA 3OYHA 2YJFA 1NK8A 4JLHA 4DR6K 3THWB 3KLEA 3K57A 4CHYA 1MA9B 2O8EA 1RNHA 3VGKA 4FCYA 4B8CA 2A5XA 4BVOA 3V9ZA 2WC9A 3A8YA 4JKDA 1QQCA 1RBUA 1C1CA 3HP6A 4HHTA 1WAFA 2P9NB 5GIOA 4BR2A 3AVIA 5AQFA 3TTFA 3O9TA 4NXMK 1BL3A 1D9DA 2FSNA 4Z4FA 1KCFA 2P51A 1GOAA 4IDHA 3ZT0A 4DHYA 4DQIA 3O9QA 1N33K 3MMVA 1JLQA 3E1YA 3F5TA 4EHUA 2YI1A 4CJ5A 2OTJN 5EU7A 3VQ8A 3QERA 3NCIA 4CZJA 5HL7L 2BTFA 1JL2A 4JKGA 1VSEA 2QXLA 3EYZA 4JI6K 3D2EB 4NCGA 1BA1A 2NRHA 3SQ2A 4RW4A 1IBKK 4DTJA 3A5OC 4BC3A 4BR4A 3IKMA 4EHTA 1TK0A 2BUPA 1EXQA 2Q3SA 1FXXA 5A2QO 1NK5A 4BQZA 2WTUA 4PHTX 4CJWA 4E7KA 4IG3A 3DXKB 5M1PA 3QNNA 1S6PA 4JKBA 4LFAK 4KB0A 1W0HA 2D0PA 2VWKA 4B3OA 2F4VK 3ASMA 3EN9A 1LV5A 1KSPA 4F2RA 1KC8O 2KHOA 5ADXH 5F2RA 1L3UA 4C1NK 1FJGK 3FZFA 2PBDA 4B3SK 3CCEN 1U49A 3ATVA 4E3SA 4V19S 4IEEA 4DLGA 4KHPK 4U67L 2ZWHA 1JLCA 3ENOA 1BCOA 4B1YB 3NAEA 2PYJA 1VSHA 5J2MA 3AVAA 3VEXA 4EAHD 5C42A 4DSFA 3J7ZO 3I56N 5DM7L 4O0IA 2VCPA 4W5NA 3J8AA 5AQWA 4OLBA 3ULEA 3CCUN 3TABA 2ZJPL 5J2PA 4TSXA 1V4TA 4DS5A 4N76A 4NXNK 4DTPA 4CZLA 1FKPA 1YJ9N 5I9EB 1VK0A 4PKGA 5C12A 3D0PA 4J2AA 3VQ7A 4BWJA 1TAUA 2O8CA 1GOBA 3J81O 3TTCA 2D4WA 4LC9B 2P9SB 1HMVA 3D6RA 3UKRB 2ZD1A 2YNGA 2J4RA 2V51B 4DV2K 4FJIA 4Q0BA 2Q2RA 1YITN 5C10A 3OYLA 1NJZA 3VQAA 1XUPO 1BGXT 4DG1A 1D5AA 4C1NI 3DOKA 1NGIA 1Q9XA 4FPAA 2F9TA 5AQIA 3HBTA 3WNHA 3SMPA 1M90O 3OYFA 3DRRA 4FK4A 1R59O 1WSHA 2FSKA 4WE1A 4CJQA 1NJYA 3LDPA 4FLYA 4J8FA 3D2EA 3B8AX 1NGHA 3PV8A 2GBZA 3HOTA 4CZEA 2DTUA 1B92A 1NGDA 4H5VA 3ZSRA 3L2UA 3DLLL 3AVGA 4B9SA 3MK6A 1YJNN 4H8KA 1VQPN 3QO9A 3HL8A 1BG3A 1K8KB 4LSNA 1QVGM 4GKKK 1S1TA 3QICA 1UA0A 4HCBA 3FLCO 4BR9A 5LY3A 1BI4B 3V9WA 4Y1DA 2IOCA 1TV6A 4FLZA 4JI8K 2Z1JA 1YTUA 4CIEA 1NJXA 1KAXA 1J5OA 4DV0K 4GKJK 2QWOA 3P83D 4CEZA 1S9EA 2CGKA 1KFDA 4FJHA 2XO7A 2E5LK 4MFBA 4M3ZA 3AVMA 3KK7A 4H4MA 3O9RA 4K0KK 1IH7A 2BH1A 5AQUA 4DR5K 1F21A 4LFCK 4HUGA 1NU0A 2FBVA 1TKTA 2E20A 4B1XB 3HPOA 3LP0A 5FPNA 4DR2K 3C7NA 1QHAA 4FK2A 2BGGA 5AQGA 3P5JA 1ZBUA 3KK3A 3CIPA 4FWQA 4DFJA 4OX9K 4XH1A 1NK4A 4WQ4C 1YI2N 1Y97A 3AO2A 5KGWA 3CJ7A 1LWCA 4CHQA 4GV3A 4CJPA 1YJWN 3KKRA 4Z4GA 3O4NA 2A1SA 2DY4A 3IG1A 1HJOA 3ZSXA 2YCHA 2FBXA 2HVHA 3KLIA 1RT5A 3M8QA 4PWDA 4QCLA 1BWFO 3GE1A 2P9NA 4FVUA 3QESA 3CCSN 5JVGL 1DKGD 4FJLA 2IVNA 3OS2A 4J2DA 4CF8A 3VQ6A 2HNYA 2QKKA 3AAPA 1NLVA 1K8KA 1Q81O 3VF4A 3P31A 3QMLA 5AZIB 1FW6A 4DSEA 2YJEA 1SS6A 2WFBA 3JSMA 3TARA 3L4QA 1T6CA 1RTDA 2AP1A 3H3NO 3K9KA 4CECA 4HUEA 1VQ6N 2P9KB 4DTOA 1BHLA 3OW2M 4C8LA 4O8KA 4KPYA 4K43A 3QFPA 4EFHA 3ZSWA 3E01A 1NK9A 2HBJA 1UOCA 2DPNA 5FROA 4CERA 1R0AA 4W5QA 4DSIA 1KLMA 4NLBA 5LJWA 4E1MA 2YKNA 4RCHA 2O4GA 2GELA 5M1NA 2D0AA 4JS5A 3AGKA 4A5BA 1NBWA 2IVPA 3PO5A 4OGEA 2XHBA 5J2NA 4DSLA 3UB5A 3LPTA 3AO3A 4M63C 4NO7A 4WQ5C 1K9MO 1QZ5A 3TAFA 1OH8A 4IFYA 4QS9A 3PX6A 1U45A 1KTQA 2X6SA 3AGRA 5KGXA 3UKUA 1YUWA 4W5TA 2VQEK 3FFKB 3SJHA 1RT2A 4JHDB 4FJJA 4H03B 1S9GA 3VETA 1QSLA 3OS1A 5CHIA 2HVIA 4JI1K 4I9QA 5JLFA 3CPEA 2VG7A 4JK9A 4M41A 3KTQA 3V1RA 1L3SA 1RT1A 3QBXA 2E1YA 1OH7A 1CXQA 1XWLA 2W42A 1VQ7N 4XH5A 1BISA 4LH5A 4JI0K 2IGIA 3R6MA 1N32K 3VERA 2GWJA 5AR0A 1HR0K 4DFPA 4IWVA 4CEQA 4YOXA 1VRTA 5KI6A 1P8ZA 2FXUA 2VGNA 3DXMB 3KHYA 1DT9A 1J9AA 3H08A 1C6VA 5AQZA 3O4QA 3U9DA 2HBKA 4BC4A 4C23A 5EVZA 1JLFA 1NGAA 3LDOA 4AHSA 1U2VA 1K8AO 4PA1A 1HUXA 1NKBA 2XY7A 3CCRN 4JYAK 3IS9A 2XY5A 4DSKA 4M3YA 3RRGA 3SQ0A 5AQNA 2UUBK 1CZBA 1BCMA 1TAQA 1V4SA 1LW0A 3WUHA 3OBYA 3DLBA 2D0BA 4B9QA 4WQ5A 4B9MA 1XHZA 1WSGA 3CQ8A 2JWLA 1HPMA 4FWRA 4OPKA 3WXIA 1JL1A 1X3NA 5KRTA 3HOSA 3LALA 4ILJA 3M8SA 1XC3A 5E41A 4CJ7A 2F96A 3D2FA 3LP2A 4CF9A 4IOXA 1TYQB 1RBRA 3C6AA 3DLHA 3ITHA 1NM1A 1WSFA 3TAMA 3VTHA 4FWNA 1YTAA 3ZETA 5KPTA 3WT0A 5BN8A 4CZKA 4ELTA 4AHVA 2JLEA 4CJSA 3THWA 4F3TA 4LH4A 5M1QA 2H3GX 3JS6A 1ZBIA 3CG7A 4DB3A 5KRSA 4BG8A 4FM2A 1KAYA 2YV0X 1VQ4N 4B9NA 3NF7A 3VGMA 3L2QA 2FBTA 1ATSA 4DFMA 3D7EO 1RDDA 3SQ1A 4CJ3A 1C0UA 4E89A 1NOZA 3BEXA 2HBLA 1RT4A 4ID5A 3HM8A 2HHQA 3THYB 4FW2A 4DCHA 4JK8A 3CFRA 3PIOL 4B9VA 5KQDA 3EKSA 1QTMA 5CY4A 3A5NC 2YNHA 5JLHA 1RFQA 1N34K 2E2QA 3CCMN 2Q97A 4JI2K 3LDSA 3AVNA 4BDPA 3G10A 1NJIO 2E8AA 1BQMA 4B1WB 3CJ1A 2G8UA 2HHUA 2O8FB 4KH6A 5JVHL 2ASPA 3AVLA 1JLBA 1Z25A 2Z1HA 3DOLA 4LFBK 1UA1A 4CEEA 3P39A 3Q7BA 4JV5K 3I33A 1JXEA 4DTSA 4FZZA 3AVFA 1JLAA 1NG9A 4BRKA 1I3AA 3U6FA 4YNQA 1OH6A 3DXMA 4Y0WA 2P9PA 3TPQA 1REVA 5AZJB 4CGIA 2OZMA 4NCAA 3TAGA 1IBMK 3T3FA 3H3OB 3NF6A 3OYCA 2IAJA 2NRWA 4AQYK 2HMIA 5EOYA 3WEEB 5AQKA 4C8OA 4EP4A 3L8BA 1O1WA 3WXLA 3PIPL 4DTNA 3SI6A 4K41A 4I9LA 4X62K 2QK9A 1HPZA 5AQPA 3TTDA 2YHXA 3VQBA 4OPAA 3EZ5A 1KLNA 3V6DA 4CGJA 3UKUB 1XMQK 1GOCA 3IRXA 3IUCA 3NF8A 4CHNA 1NWKA 4FM1A 3J7YP 4KH5A 3D2FB 4OVLA 1Q8IA 3PLAA 1ITGA 3C6TA 4E7HA 4ISEA 4OLAA 4KRFA 2W6KA 3T7ZA 4IKFA 4NYNA 1NMDA 4DV1K 3M5RA 2ZGZA 5AQMA 1SL2A 2EHGA 3ZT4A 4DQSA 3SV4A 3ZT3A 5CZ2A 4CZIA 4CZFA 3RMBA 2O8DB 3LWLA 1T7PA 1S1VA 5TKYA 2HHXA 2QWRA 3HI0A 3MN7A 2JWKA 4JHDA 4DF8A 4CK3A 4CFDA 2CH5A 2Q0RA 1WB9A 1Q18A 3CD6N 2RN2A 3MXMA 2LSNA 1S3XA 3AA2A 4MDAA 2D1KA 1DLOA 4FW1A 3HZ6A 3SBTA 5GINA 5LL6Z 1C0GA 3AVHA 3DM2A 3LDNA 1CZ9A 1ATRA 3B6PA 5MLCQ 1RT3A 3QNOA 4ID1A 2Q0UA 4DTMA 4WFAL 2XY6A 4JKCA 5C0YA 1TKXA 3S41A 5AFUH 5C2DA 3M1FA 4I7FA 3K5MA 1W7AA 2P9IA 1JKHA 4M45A 4LF6K 1BDGA 3RWUA 3LZIA 5FDLA 3IMXA 1RDAA 3TSQA 5I42A 1RT7A 2IIRA 3MX2A 4W5OA 1OKJA 4CBXA 2G8KA 1HYSA 2ZE2A 4DU3A 3DI6A 3LM2A 3FZHA 4MDBA 3SJJA 1D8YA 2WOMA 2ZJQL 3CI5A 2ITGA 1X9MA 1QSSA 2P9SA 3DLGA 4ISGA 4WF9L 1NK0A 3UKRA 3PO4A 1XNQK 1TKDA 4CI6A 5ADXA 4CD1A 2QKBA 3R3LA 3ZX2A 4E19A 2E1ZA 3OS0A 4LD0A 4KHUA 1EP4A 1RGIA 3AA3A 3BGRA 3ZETB 2X78A 4UY8O 3CM6A 4AHCA 4B3TK 5DK5A 1EO1A 1W97L 1QQOA 5BPMA 1Z26A 2Z1GA 3CJCA 2G8VA 3KK2A 5AQOA 2Y1IA 4BRLA 4AF1A 3BF3A 3ULEB 3NDKA 3I55N 2HHWA 1HJRA 4RTFD 3TWHA 4QS8A 4BRMA 1BI4A 1I94K 1K6YA 4KO0A 1TK8A 4QS7A 1EETA 3K59A 1T6DA 1IO2A 3C95A 3V9SA 1HNZK 3TAEA 1XHXA 1T3VA 1XMOK 2NRVA 1LWFA 1IKWA 1JCGA 3CETA 4IXCA 4F9OA 3OYNA 4FJ7A 4LF9K 3BZCA 4MQ3A 4F3OA 3QLHA 2UXBK 5AQYA 5AQSA 2VG5A 4O55A 3MECA 4CF0A 5J2QA 2UUCK 4B1UB 3G71N 4H0TB 1RDWX 5GAHP 4CBWA 4CJEA 4BQLA 2E2OA 4B1VA 1S22A 3QETA 4H0VB 2O8FA 3V1QA 1MDUB 4FK0A 1ILYA 4H0YB 3J80O 3U3YA 4YOYA 1XC9A 3VF2A 3SUNA 3THXA 1P90A 4M3UA 4JEPA 3ENHA 3DRPA 4IZ9A 2QXFA 2PYLA 4DR7K 1KAZA 4JK7A 3SUPA 2IC3A 4QAGA 4X65K 3MEEA 4BR0A 3MXJA 3ZSYA 3DLEA 4F4KA 2HHSA 2OPRA 3SUQA 5AQRA 1HNWK 4N41A 2QWPA 3L6QA 2XRIA 3O9UA 4DUYK 3OYKA 3V4IA 4NB4A 4M3XA 1X9WA 4FJMA 2KW4A 1BA0A 3CERA 4BWMA 4PQUA 3KKSA 5SZTA 4DWIA 4YOVA 2HNZA 1YXQA 3SLCA 4DTRA 4LF4K 3SNNA 2PY5A 4OGCA 2B5JA 3PX4A 3ZEUB 3KLHA 1YIJN 4JKAA 4ISFA 1NK6A 1T8EA 1IBLK 3L2VA 2YNFA 3NH2A 5FPEA 3QIOA 4A57A 3CF5L 3QEVA 1ATNA 2E6MA 3NE6A 2I5JA 5FRMA 3AVKA 3NVMA 4RW9A 1RBSA 4CD3A 3I8DA 3CJ9A 1C0MA 4DU1A 3TAQA 3NGIA 5EY4A 3HPGA 3AY9A 4FJKA 4IJAA 3K0SA 1LCUA 4CJKA 2GUIA 3KWGA 4WYBA 2YHBA 4KTQA 4KHQA 1LAWA 3VOVA 3K9JA 2I7NA 2Q36A 2RKIA 1JLEA 3DYAA 2KQ2A 4LF5K 3HJFA 1HQUA 2HW3A 1I39A 3LANA 1B9FA 2AJQA 4BRDA 3MEGA 3L2WA 5CE3A 2FSJA 2QA4N 2V52B 1U6ZA 3FFIA 4FXDA 5AQHA 4Z4CA 4B3RK 5LMUK 1NGJA 2QW9A 3IAYA 2O8CB 4DSJA 2ETJA 2CH6A 4JS4A 4PL8A 3F9KA 3FGUA 1HKCA 4GNIA 3GBTA 3ZYYX 3ZEUA 3CYMA 2HBMA 1DGKN 1CLQA 1A5VA 4X64K 3HVRA 2O8DA 3S3MA 2YNIA 3MWTA 4KI6A 3WQTA 1FKOA 4KB1A 3OY9A 1GLEG 2KZZA 3TR8A 4AHUA 3BZKA 4RG8A 1IV0A 2P5GA 1GLBG 2HSTA 4CIFA 1VSFA 4GW6A 4A62A 2P9PB 4JI7K 2ASOA 3ZT2A 4I2QA 1KFSA 2P1JA 2HHTA 3SK3A 3QIPA 3KZBA 2A42A 5KQ8A 3QDKA 4EZ6A 4IJNA 2NRTA 2W41A 2VWJA 3GOIA 3OYMA 2HHVA 1N36K 2R7YA 4CEAA 1T44A 1A5XA 4BR5A 3OYDA 4FOIA 1C0TA 4PKIA 1RTIA 1WBDA 5I3UA 4L8RB 1RBTA 4OKJA 1GLFO 3NF9A 2FBYA 3SAFA 4FWSA 4CGDA 3K5LA 4M3WA 3VF6A 1VSJA 4R79A 4XH4A 1HYZA 4CE9A 1XI1A 4PY5A 2GWKA 1HNIA 1FK9A 5BRHA 3A5LC 4CJFA 4JI3K 4BC5A 5HBMA 3VQ4A 3ZSVA 1JCEA 1VQNN 3KD5E 3G6EN 2O8EB 3A5MC 1HYVA 3HO1A 4A61A 3TSPA 3PY8A 1GLLO 1QHTA 4Z0UA 3OJSA 3T1HK 1ZYQA 1W9HA 4Z4EA 4LSLA 4GV9A 4BDZA 4RW7A 4M42A 3CJBA 4JRPA 3PX0A 4BRGA 1BO5O 1TGOA 3OHRA 3F73A 3ID6A 4FYDA 2E2NA 1EX4A 1QE1A 2NZTA 4GVEA 1J5EK 2F8TA 1TUYA 1U04A 1TKZA 1L3VA 4AH9A 4DR3K 4WCEL 3OYAA 1BU6O 4CJTA 1T03A 3QEXA 3C7NB 5BREA 2V7YA 5M1FA 3HYFA 5DM6L 2BDPA 1OVQA 1JLGA 5FPDA 2F8SA 5HRSA 4FZYA 4RWTA 4A2AA 2DFFA 4IFVA 3MCPA 1VQ8N 3IFRA 2UU9K 1O13A 3M8PA 1TK5A 1QZ6A 4KBOA 2FF6A 1MWKA 2B4JA 4BE1A 4M3TA 4JKEA 3T19A 2EWSA 5AZIA 4CF2A 3NHGA 4GY2B 1EWQA 2W40A 1X9SA 4XEIA 2BANA 2P9IB 2ZGYA 3EE8A 3PSIA 1ESVA 2E88A 4YDUA 3AARA 4BGAA 5AQJA 5BPLA 4CFAA 3NMUA 3CCVN 2ITMA 4E0DA 5C25A 4F2SA 1EKEA 1WSEA 4A2BA 2V7ZA 4BRHA 3CC2N 2NRXA 1U47A 2PFUA 3V9XA 3E9OA 2ZM6K 1SL1A 4CHOA 3WNGA 2HOEA 1NGGA 5C2FA 5LMNK 2HF3A 1WAJA 4OKEA 3ZSZA 4IDKA 3NGYA 3EZWA 1Y64A 2NRZA 5AFUA 2VGMA 4JI5K 3CC4N 1VQ5N 4OPHA 2IDOA 4DR1K 5GAEP 4IO8A 3VQPA 5F0XA 4IO9L 3RMDA 4BRAA 3ZT1A 1Q86O 3VEVA 3CCJN 2RHKA 3CPWM 1VSIA 3ZX0A 1Z6RA 3ZCMA 3OYBA 1UAXA 3VEWA 3FZKA 4GVMA 4FLVA 1RDUA 1KD1O 1DTQA 4UQGA 4CEOA 3O1BA 4FLXA 3JAMO 4ELVA 3J7AP 3O3GA 3C0BA 3G0ZA 2P9KA 4JI4K 4H0XB 3H6EA 2A3ZA 4LF8K 1IKXA 3I0RA 2IVOA 2ZF5O 3V81A 3DAWA 3BUZB 5CYMA 3R8EA 3VQ5A 1QSYA 3ISNC 1NGEA 1OH5A 1EQYA 3GG4A 3VQQA 2NRRA 4FJ5A 3VEOA 3M8RA 3DLRA 4MLEA 3N4QA 3B6OA 4KI4A 2VG6A 1RTJA 2UYTA 3K58A 3AA4A 1U4BA 3RSEB 3TI0A 2OYQA 1IG9A 4JAXA 3C6HA 4CJLA 3S3OA 3C65A 1SQKA 2UXDK 4O5FA 3QEPA 1C0FA 4ILGB 1ASWA 4CW7B 4DQRA 2IS3A 2GX9A 3ZX3A 3OBWA 3AA5X 1HKGA 5LJVA 3RMAA 2X6NA 3CXCM 3AVBA 4DLEA 4BRNA 3A2FA 3VQ9A 1X1PA 1S72N 2QTDA 3L0QA 3PSFA 4CZMA 4YFUA 5AQTA 2HNDA 2OTLN 3HVTA 4ZTFA 1NKCA 5HP1A 1JXBA 3P4IA 4JKGB 2OZSA 4CGFA 3A0IX 3AO1A 4LY7A 4PKHA 3T1YK 1N8RO 4JKHA 1VSMA 4YDUC 3M3ZA 3ULDA 3CQXA 3E9LA 1BOTO 3VA0A 2OPPA 3K5OA 5E84A 2UXCK 3QBWA 4KAZA 2ATQA 3O6WA 1M1KO 2KZMA 5BR9A 3AAQA 4KREA 3OYJA 4GMJB 3RR7A 4FJ8A 1E3MA 2P9LB 3NGZA 4U7BA 4K8ZA 3ALYA 5TKWA 2JGUA 3LL3A 2Y1JA 3MDQA 1NGCA 3SZ2A 3MN5A 4W5RA 3VPZA 4NLCA 4JN4A 4A5AA 5BRDA 1WSIA 1RDCA 1CXUA 3UIQA 1YT3A 3C94A 1WNSA 2GEMA 2D0CA 3Q7CA 4M3RA 3QEWA 1NKEA 4HTUA 3SV3A 2KTQA 1LAVA 5J1EA 3V9UA 3G4SN 1TYQA 4O5BA 5C24A 4DQ8A 1RDBA 2OCEA 1W2BM 1DEJA 2G8IA 3WNFA 2A40A 2KLAA 3R1XA 3DWLA 3CHWA 4O44A 2I7PA 2EX3A 3QFUA 4JKFA 3RSEA 3CQYA 1GLCG 2QWNA 4JNEA 4J2EA 4DKWA 5JS2A 3VN5A 2VWBA 4BRFA 3S9HA 1D4XA 4Z4HA 1SKSA 4DV4K 4H5TA 5ELZA 4DFKA 4AHTA 3JYTA 1YF5L 5BN9A 3WXMB 3MXIA 4CZHA 5AQVA 3NVKA 4KTZA 3WQUA 4R5PA 4B9TA 4KKOA 1L3TA 3HM9A 2YKMA 3L4IA 3OJUA 2E6LA 3HK2A 3LAKA 4EZ9A 3O5BA 3RR8A 3WNEA 4H5WA 1RCHA 3SAGA 1YHQN 1N5YA 4YOWA 2KKZA 3DRSA 2PAVA 4DQQA
chains in the Genus database with same CATH topology
2H3GX 1BUPA 4IDHA 4DHYA 3JS6A 3O9QA 3MMVA 4DB3A 4BG8A 1OVYA 3MWTA 3E1YA 1KAYA 3WQTA 3F5TA 1TUUA 4EHUA 1VQ4N 1GLEG 2YI1A 3VGMA 1QVFM 1ATSA 3HSCA 2OTJN 4BRCA 4CZJA 3D7EO 3DXKA 4BREA 5HL7L 2BTFA 1GLBG 2HSTA 4A62A 2P9PB 5JICA 4JKGA 3WXJA 2ASOA 4BVPA 3BEXA 1WUAA 2HBLA 2QXLA 3HM8A 3D2EB 1WOQA 1BA1A 2NRHA 3SK3A 2A6AA 3F9MA 3KZBA 2A42A 3A5OC 5KQ8A 3HRGA 4JK8A 4DCHA 3PIOL 3M6GA 3QDKA 4BC3A 5KQDA 4IJNA 2FLOA 3EKSA 4BR4A 3IKMA 2NRTA 4EHTA 2BUPA 2W41A 3A5NC 5JLHA 3GOIA 4M7YA 1Q82O 1RFQA 2RE2A 4BQZA 2E2QA 4PHTX 1SAZA 1T44A 3CCMN 2QM1A 4BR5A 4FOIA 1QQNA 2Q97A 3DXKB 5M1PA 3W3DA 2HMPA 4JKBA 3R9PA 4PKIA 2D0PA 3EN9A 1K73O 1GLFO 3WEEA 1NJIO 1KC8O 3SAFA 2E8AA 2KHOA 4FWSA 4B1WB 5F2RA 5ADXH 3CJ1A 3VF6A 4C1NK 3FZFA 2PBDA 4KH6A 5JVHL 2ASPA 4R79A 1VQLN 3VESA 5AQXA 4XH4A 3CCEN 3ATVA 2GWKA 3P39A 3Q7BA 4IEEA 4CZGA 3I33A 3ID8A 1CZAN 2ZWHA 4U67L 4BRKA 4WQ4A 3ENOA 5BRHA 3A5LC 1IG8A 3DXMA 4B1YB 4Y0WA 2P9PA 4BC5A 3FE1A 3SBGA 3TPQA 1JCEA 1VQNN 3VEXA 4EAHD 3BF1A 5AZJB 3SAHA 3J7ZO 3G6EN 2OANA 3I56N 3A5MC 5M1QA 4E1JA 5DM7L 2VCPA 3J8AA 5AQWA 4A61A 3TSPA 1GLLO 3O1WA 3ULEA 2Q31A 5H1SQ 3CCUN 2ZJPL 4GV9A 3H3OB 1V4TA 2YX6A 4FL9A 2NRWA 3CJBA 3H46O 5EOYA 4BRGA 3VMFB 1BO5O 3WEEB 5AQKA 5CR4A 3OHRA 4FO0A 3ID6A 3WXLA 4CZLA 3PIPL 4K41A 2D0OA 1YJ9N 5I9EB 2E2NA 3W0LA 5C12A 4PKGA 2NZTA 4MLHA 5AQPA 4GVEA 3TTDA 1HLUA 2YHXA 1TUYA 4OPAA 3H1QA 3TTCA 2F9WA 2D4WA 4WCEL 3UKUB 1BU6O 1JCFA 2P9SB 4LC9B 3D6RA 3IUCA 1NWKA 3UKRB 2AA4A 2CGJA 3O9SA 4KH5A 3C7NB 3D2FB 3WXKA 5BREA 2V7YA 3VTIA 5M1FA 4G9ZA 2J4RA 2V51B 5DM6L 2Q2RA 3PLAA 1YITN 5C10A 5FPDA 4ISEA 1IJJA 4RWTA 4A2AA 3T7ZA 5FPMA 3VENA 3MCPA 1NMDA 1XUPO 1Q7YO 3IFRA 1VQ8N 1O13A 4FWMA 4B1ZA 1LOTB 3M5RA 4C1NI 2ZGZA 2VYPA 5AQMA 1QZ6A 1NGIA 5EX5A 4BRIA 3GDQA 4KBOA 5HOOA 2FF6A 4FPAA 2QEXN 1MWKA 2F9TA 5AQIA 3HBTA 3SMPA 3VEYA 4FPBA 2GTDA 4O8UA 4CZIA 4CZFA 1M90O 3T69A 4JKEA 2YHYA 1R59O 4HWIA 2FSKA 2EWSA 4FWKA 3LDPA 5AZIA 2WBNA 1SZ2A 4H0PA 4J8FA 3P38A 5TKYA 3D2EA 3O4WA 4GY2B 3B8AX 1GLJO 1NGHA 5C15A 1VQON 4IFEA 2P9LA 2W40A 2QWRA 3HI0A 3U8XA 3HOTA 3MN6A 4CZEA 3MN7A 4XEIA 3LM9A 2JWKA 4I6MB 3O08A 4JHDA 3U4LA 1NGDA 4H5RA 4H5VA 3DLLL 2P9IB 2ZGYA 3EE8A 4FOEA 3MK6A 1YJNN 1ESVA 2E88A 2CH5A 3AARA 2Q0RA 4YDUA 5AQJA 4BGAA 5BPLA 1VQPN 1Q18A 3DJCA 3CD6N 4YOTA 3NMUA 3O8MA 1BG3A 3CCVN 1K8KB 1S3XA 1QVGM 5AQQA 3QICA 4MDAA 2ITMA 2D1KA 3MWPA 4I6MA 4EIAA 5AZJA 3HZ6A 3SBTA 4FWLA 5GINA 3FLCO 4BR9A 5LY3A 4A2BA 2FF3B 2V7ZA 4L3QA 4BRHA 1C0GA 3CC2N 1NGBA 2NRXA 5GAGP 2PFUA 1NGFA 3LDNA 1ATRA 5MLCQ 3HTVA 3E9OA 1KAXA 4BR7A 2Q0UA 2QWOA 1E4FT 4WFAL 1JJ2M 2HOEA 4JKCA 1NGGA 5C2FA 5C0YA 3VEZA 3S41A 2CGKA 5AFUH 1HKBA 5AQLA 5C2DA 1X3MA 2HF3A 1VQKN 3M1FA 2P9IA 3EZWA 1Y64A 2NRZA 3I8BA 1BDGA 5AFUA 2CGLA 3KK7A 2VGMA 3O9RA 3IMXA 5EXWA 3CC4N 3BP8A 2BH1A 5AQUA 3TSQA 2E2PA 1VQ5N 3FZMA 2IIRA 4OPHA 4FSVA 3MX2A 1OKJA 4CBXA 2E20A 5GAEP 5BRFA 3LM2A 4MDBA 3FZHA 4B1XB 2NLXA 4IO8A 5FPNA 3CI5A 3FZLA 4AM6A 2ZJQL 4CBUA 5M1OA 4JD2A 2Q1NA 4BY9C 3C7NA 5F0XA 1QHAA 4IO9L 4BRQA 5AQGA 4BRAA 1Q86O 3VEVA 2P9SA 3ENBA 3CCJN 4PL7A 4ISGA 2RHKA 4WF9L 3CPWM 3UKRA 3CIPA 4FWQA 1KXPA 3ZX0A 1Z6RA 4CI6A 4CD1A 5ADXA 3VEWA 4KH4A 3R3LA 4XH1A 3FZKA 3G25A 3ZX2A 3KWIA 4WQ4C 2F7TA 1YI2N 1RDUA 2QWMA 2E1ZA 1KD1O 3CJ7A 1RGIA 3ATUA 4GV3A 3ZETB 5M1KA 4UY8O 3O1BA 4Z94A 3IDHA 5KPRA 1YJWN 1H1VA 1EO1A 1W97L 5F1XA 1QQOA 3C0BA 2P9KA 5BPMA 4H0XB 3H6EA 2A3ZA 3CJCA 3CMAN 1HJOA 2IVOA 2YCHA 2ZF5O 3DAWA 1ZC6A 5AQOA 3BUZB 3R8EA 4BRLA 4BGBA 4AF1A 3BF3A 1NGEA 3F2KA 1EQYA 3ULEB 3I55N 2WUSA 4OO1J 3GG4A 1BWFO 2NRRA 2P9NA 3GE1A 1GLDG 4RTFD 3VEOA 4FVUA 1VQMN 3CCSN 1ZBSA 3EO3A 4QS8A 4BRMA 4MLEA 3N4QA 5JVGL 1DKGD 2A41A 2IVNA 4QS7A 2UYTA 1T6DA 3AAPA 3RSEB 1NLVA 1K8KA 4BC2A 1Q81O 3VF4A 3P31A 3QMLA 5AZIB 5JMVA 4JAXA 2YJEA 3UE5A 1T3VA 1SS6A 5GADP 2WFBA 2NRVA 3C6HA 3L4QA 1T6CA 4JD2B 3CC7N 2AP1A 3H3NO 3C65A 1SQKA 3K9KA 1JCGA 2ASMA 3CETA 4O5FA 4IXCA 1C0FA 4F9OA 1VQ6N 2P9KB 4ILGB 4IEIA 3OW2M 3ZX3A 2GX9A 4O8KA 5AQYA 3OBWA 5AQSA 3GL1A 4K43A 5LJVA 1HKGA 3QFPA 4EFHA 3CXCM 4B1UB 3TSUA 3G71N 2HBJA 1RDWX 2DPNA 4H0TB 4BG9A 5GAHP 4NLBA 4CBWA 4FWPA 4BRNA 4BQLA 3H1VX 1S72N 2E2OA 4B1VA 1S22A 4H0VB 4YOUA 2QTDA 3L0QA 4A59A 4CZMA 3O80A 5AQTA 1MDUB 2OTLN 5KPZA 5LJWA 4RCHA 3KVGA 4HTLA 2GELA 5M1NA 1ILYA 4H0YB 3P4IA 2GUPA 4JKGB 3AGKA 4MO5A 4A5BA 3MCAB 3JXUA 1NBWA 2IVPA 4MO4A 4YOYA 2NNWA 3VF2A 3A0IX 3UB5A 3RVCA 1P90A 4BRPA 1KQSM 4JEPA 5E26A 2P9UB 3ENHA 5GIPA 4K42A 4IZ9A 4M63C 4PKHA 4NO7A 1N8RO 4WQ5C 1KAZA 1QZ5A 4JK7A 1K9MO 4JKHA 4QS9A 4M7XA 4YDUC 3M3ZA 5BPNA 4YORA 3CQXA 3AGRA 3E9LA 1BOTO 3VGLA 5E84A 4BR0A 3LDQA 3LDLA 3QBWA 1YUWA 1VAZA 3UKUA 3CCLN 3FFKB 3MN9A 5AQRA 4WFNL 1G99A 3SJHA 4JHDB 2QWPA 3TU5A 3L6QA 3O9UA 4H03B 4ILHA 3O6WA 3VETA 4NB4A 1M1KO 5BR9A 3AAQA 5B8HA 5CHIA 4H0OA 5JLFA 3CPEA 2P9LB 3CJAA 1BA0A 4JK9A 4IOAL 3CERA 4U7BA 1HX1A 3QBXA 3CCQN 3N4PA 4YOVA 2E1YA 4WFBL 1VQ9N 1YXQA 3E66A 3SLCA 5TKWA 1VQ7N 4XH5A 4GV6A 3LL3A 3SMSA 3R6MA 3VERA 3MDQA 1NGCA 1E4GT 2GWJA 3MN5A 5AR0A 1DGKN 1YIJN 3ZEUB 4JKAA 3VPZA 1X9JA 4ISFA 4IWVA 4JN4A 4NLCA 4A5AA 5BRDA 2P9UA 3CMEN 4YOXA 1P8ZA 2FXUA 3Q7CA 2GEMA 5FPEA 4A57A 2VGNA 3CF5L 3DXMB 1MWMA 3KHYA 1ATNA 3U9ZA 3FR0A 1DT9A 2HF4A 2QWQA 3E9PA 3EL2A 5AQZA 3U9DA 2QI2A 3EKUA 1J6ZA 2HBKA 3NVMA 4BC4A 4C23A 3G4SN 1TYQA 5EVZA 3OA9A 4CD3A 1NGAA 3LDOA 3CJ9A 3QB0A 4DQ8A 5EY4A 1W2BM 1DEJA 3AY9A 1U2VA 4IJAA 1K8AO 1HUXA 2A40A 3CCRN 1LCUA 1YVNA 2KLAA 3R1XA 3DWLA 2ZJRL 3CHWA 1YAGA 1U2VB 3KWGA 1XQSC 2I7PA 4WYBA 5AQNA 4IOCL 1GLAG 3QFUA 4JKFA 3RSEA 3MX5A 2YHWA 1V4SA 3CQYA 1GLCG 2QWNA 3OBYA 4JNEA 3EE9A 3K9JA 3VOVA 3WUHA 4DKWA 2I7NA 2Q36A 1ZXOA 4B9QA 2VWBA 4WQ5A 4BRFA 4H5NA 1D4XA 2JWLA 1HPMA 4FWRA 4H5TA 5ELZA 1QQMA 3WXIA 1Z05A 1X3NA 4K25A 4BROA 2QWLA 4FWOA 4AM7A 3HOSA 3H45C 1YF5L 5BN9A 3WXMB 4ILJA 4BRDA 4CZHA 1XC3A 5AQVA 5CE3A 4CJ7A 2FSJA 2QA4N 3NVKA 2V52B 2YJFA 3WQUA 1U6ZA 3D2FA 4IOXA 1MA9B 1TYQB 3C6AA 5AQHA 3L4IA 3VGKA 1NGJA 2QW9A 3O5BA 1NM1A 2A5XA 4BVOA 2WC9A 3A8YA 4JKDA 4H5WA 3VTHA 3SAGA 2CH6A 4FWNA 3ZETA 5KPTA 1YHQN 2P9NB 5GIOA 3WT0A 4PL8A 4BR2A 3FGUA 1HKCA 4GNIA 5AQFA 3TTFA 4CZKA 5BN8A 4YOWA 3O9TA 2KKZA 3GBTA 3ZYYX 3ZEUA 2PAVA 2HBMA 2FSNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2H3G X;  1BUP A;  4DHY A;  3JS6 A;  3MMV A;  4DB3 A;  4BG8 A;  1KAY A;  3WQT A;  4EHU A;  1TUU A;  1GLE G;  2YI1 A;  3VGM A;  1ATS A;  3HSC A;  4BRC A;  4CZJ A;  3D7E O;  3DXK A;  4BRE A;  2BTF A;  1GLB G;  4A62 A;  2P9P B;  5JIC A;  3WXJ A;  2ASO A;  4BVP A;  3BEX A;  1WUA A;  2QXL A;  3HM8 A;  3D2E B;  1WOQ A;  1BA1 A;  2NRH A;  3SK3 A;  2A6A A;  3F9M A;  3KZB A;  2A42 A;  3A5O C;  5KQ8 A;  4DCH A;  3M6G A;  3QDK A;  4BC3 A;  5KQD A;  4IJN A;  2FLO A;  3EKS A;  4BR4 A;  4EHT A;  2BUP A;  2W41 A;  3A5N C;  5JLH A;  3GOI A;  4M7Y A;  1RFQ A;  4BQZ A;  2E2Q A;  1SAZ A;  1T44 A;  2QM1 A;  4BR5 A;  4FOI A;  1QQN A;  2Q97 A;  3DXK B;  3W3D A;  2HMP A;  3R9P A;  4PKI A;  2D0P A;  3EN9 A;  1GLF O;  3WEE A;  2E8A A;  2KHO A;  4FWS A;  4B1W B;  5F2R A;  5ADX H;  3CJ1 A;  3VF6 A;  3FZF A;  2PBD A;  2ASP A;  3VES A;  5AQX A;  4XH4 A;  3ATV A;  2GWK A;  4CZG A;  3I33 A;  3ID8 A;  1CZA N;  2ZWH A;  4BRK A;  4WQ4 A;  3ENO A;  5BRH A;  3A5L C;  1IG8 A;  3DXM A;  4B1Y B;  4Y0W A;  2P9P A;  4BC5 A;  3FE1 A;  3TPQ A;  1JCE A;  3VEX A;  4EAH D;  3BF1 A;  5AZJ B;  2OAN A;  3A5M C;  4E1J A;  2VCP A;  3J8A A;  5AQW A;  4A61 A;  1GLL O;  3O1W A;  3ULE A;  2Q31 A;  3H3O B;  1V4T A;  4FL9 A;  3CJB A;  3H46 O;  5EOY A;  4BRG A;  1BO5 O;  3WEE B;  5AQK A;  3OHR A;  4FO0 A;  3WXL A;  4CZL A;  4K41 A;  2D0O A;  5I9E B;  2E2N A;  3W0L A;  4PKG A;  2NZT A;  4MLH A;  5AQP A;  1HLU A;  2YHX A;  1TUY A;  3H1Q A;  2F9W A;  2D4W A;  3UKU B;  1BU6 O;  1JCF A;  2P9S B;  4LC9 B;  3IUC A;  1NWK A;  3UKR B;  2AA4 A;  2CGJ A;  3C7N B;  3D2F B;  3WXK A;  5BRE A;  2V7Y A;  2J4R A;  2V51 B;  2Q2R A;  5FPD A;  4ISE A;  1IJJ A;  4RWT A;  4A2A A;  5FPM A;  3VEN A;  3MCP A;  1NMD A;  1XUP O;  3IFR A;  4FWM A;  4B1Z A;  1LOT B;  2ZGZ A;  2VYP A;  5AQM A;  1QZ6 A;  1NGI A;  5EX5 A;  4BRI A;  3GDQ A;  4KBO A;  2FF6 A;  4FPA A;  1MWK A;  2F9T A;  5AQI A;  3HBT A;  3SMP A;  3VEY A;  4FPB A;  2GTD A;  4CZI A;  4CZF A;  2YHY A;  1R59 O;  4HWI A;  2FSK A;  2EWS A;  4FWK A;  3LDP A;  5AZI A;  1SZ2 A;  4H0P A;  4J8F A;  5TKY A;  3D2E A;  3O4W A;  4GY2 B;  3B8A X;  1GLJ O;  1NGH A;  2P9L A;  2W40 A;  2QWR A;  3HI0 A;  3U8X A;  3MN6 A;  4CZE A;  3MN7 A;  4XEI A;  3LM9 A;  4I6M B;  3O08 A;  4JHD A;  3U4L A;  1NGD A;  4H5R A;  4H5V A;  2P9I B;  2ZGY A;  4FOE A;  3MK6 A;  1ESV A;  2E88 A;  2CH5 A;  3AAR A;  2Q0R A;  4YDU A;  5AQJ A;  4BGA A;  5BPL A;  1Q18 A;  3DJC A;  3O8M A;  1BG3 A;  1K8K B;  1S3X A;  5AQQ A;  3QIC A;  2ITM A;  2D1K A;  4I6M A;  4EIA A;  5AZJ A;  3HZ6 A;  4FWL A;  3FLC O;  4BR9 A;  5LY3 A;  4A2B A;  2FF3 B;  2V7Z A;  4L3Q A;  4BRH A;  1C0G A;  1NGB A;  1NGF A;  3LDN A;  1ATR A;  3HTV A;  1KAX A;  4BR7 A;  2Q0U A;  2QWO A;  1E4F T;  2HOE A;  1NGG A;  3VEZ A;  3S41 A;  2CGK A;  5AFU H;  1HKB A;  5AQL A;  1X3M A;  2HF3 A;  3M1F A;  2P9I A;  3EZW A;  1Y64 A;  3I8B A;  1BDG A;  5AFU A;  2CGL A;  3IMX A;  5EXW A;  3BP8 A;  5AQU A;  2E2P A;  3FZM A;  2IIR A;  4FSV A;  1OKJ A;  4CBX A;  2E20 A;  5BRF A;  3LM2 A;  4B1X B;  3FZH A;  2NLX A;  4IO8 A;  5FPN A;  3CI5 A;  3FZL A;  4AM6 A;  4CBU A;  4JD2 A;  2Q1N A;  3C7N A;  5F0X A;  1QHA A;  4BRQ A;  5AQG A;  4BRA A;  3VEV A;  2P9S A;  4PL7 A;  4ISG A;  3UKR A;  3CIP A;  4FWQ A;  1KXP A;  3ZX0 A;  1Z6R A;  4CI6 A;  4CD1 A;  5ADX A;  3VEW A;  4XH1 A;  3FZK A;  3G25 A;  3ZX2 A;  4WQ4 C;  2QWM A;  2E1Z A;  3CJ7 A;  1RGI A;  3ATU A;  3ZET B;  3O1B A;  4Z94 A;  3IDH A;  5KPR A;  1H1V A;  5F1X A;  1QQO A;  3C0B A;  2P9K A;  5BPM A;  4H0X B;  3H6E A;  2A3Z A;  3CJC A;  1HJO A;  2IVO A;  2YCH A;  2ZF5 O;  3DAW A;  1ZC6 A;  5AQO A;  3BUZ B;  3R8E A;  4BRL A;  4BGB A;  3BF3 A;  1NGE A;  3ULE B;  1EQY A;  2WUS A;  3GG4 A;  1BWF O;  3GE1 A;  2P9N A;  4RTF D;  1GLD G;  3VEO A;  1ZBS A;  3EO3 A;  4QS8 A;  4BRM A;  4MLE A;  1DKG D;  2A41 A;  2IVN A;  4QS7 A;  2UYT A;  1T6D A;  3AAP A;  3RSE B;  1NLV A;  1K8K A;  4BC2 A;  3VF4 A;  3QML A;  5AZI B;  5JMV A;  4JAX A;  2YJE A;  3UE5 A;  1T6C A;  4JD2 B;  2AP1 A;  3H3N O;  1SQK A;  1JCG A;  2ASM A;  3CET A;  4O5F A;  4IXC A;  1C0F A;  4F9O A;  2P9K B;  3ZX3 A;  4O8K A;  5AQY A;  5AQS A;  3GL1 A;  4K43 A;  5LJV A;  1HKG A;  3QFP A;  4EFH A;  4B1U B;  4H0T B;  1RDW X;  2DPN A;  4BG9 A;  4CBW A;  4FWP A;  4BRN A;  4BQL A;  3H1V X;  2E2O A;  4B1V A;  1S22 A;  4H0V B;  3L0Q A;  4CZM A;  3O80 A;  5AQT A;  1MDU B;  5KPZ A;  5LJW A;  4RCH A;  3KVG A;  4HTL A;  2GEL A;  4H0Y B;  3P4I A;  2GUP A;  4MO5 A;  3JXU A;  1NBW A;  2IVP A;  4MO4 A;  3VF2 A;  3A0I X;  3UB5 A;  4BRP A;  5E26 A;  2P9U B;  3ENH A;  4K42 A;  4IZ9 A;  4M63 C;  4PKH A;  4NO7 A;  4WQ5 C;  1KAZ A;  1QZ5 A;  4QS9 A;  4M7X A;  4YDU C;  3M3Z A;  5BPN A;  3CQX A;  1BOT O;  3VGL A;  5E84 A;  4BR0 A;  3LDQ A;  3LDL A;  3QBW A;  1YUW A;  3UKU A;  3FFK B;  3MN9 A;  5AQR A;  1G99 A;  3SJH A;  4JHD B;  2QWP A;  3TU5 A;  3L6Q A;  4H03 B;  3O6W A;  3VET A;  4NB4 A;  5BR9 A;  3AAQ A;  5B8H A;  4H0O A;  5JLF A;  2P9L B;  3CJA A;  1BA0 A;  3CER A;  1HX1 A;  3QBX A;  2E1Y A;  1YXQ A;  3SLC A;  4XH5 A;  3LL3 A;  3SMS A;  3R6M A;  3VER A;  3MDQ A;  1NGC A;  1E4G T;  2GWJ A;  3MN5 A;  5AR0 A;  3ZEU B;  3VPZ A;  1X9J A;  4ISF A;  4IWV A;  4JN4 A;  5BRD A;  2P9U A;  1P8Z A;  2FXU A;  5FPE A;  2GEM A;  3DXM B;  1MWM A;  3KHY A;  1ATN A;  3U9Z A;  3FR0 A;  2HF4 A;  2QWQ A;  3EL2 A;  5AQZ A;  3U9D A;  3EKU A;  1J6Z A;  4BC4 A;  4C23 A;  1TYQ A;  5EVZ A;  4CD3 A;  1NGA A;  3LDO A;  3CJ9 A;  3QB0 A;  4DQ8 A;  5EY4 A;  1DEJ A;  3AY9 A;  1U2V A;  4IJA A;  1HUX A;  2A40 A;  1LCU A;  1YVN A;  3DWL A;  3CHW A;  1YAG A;  1U2V B;  1XQS C;  2I7P A;  4WYB A;  5AQN A;  1GLA G;  3QFU A;  3RSE A;  2YHW A;  1V4S A;  3CQY A;  1GLC G;  2QWN A;  4JNE A;  3VOV A;  3WUH A;  2I7N A;  2Q36 A;  1ZXO A;  4B9Q A;  2VWB A;  4WQ5 A;  4BRF A;  4H5N A;  1D4X A;  1HPM A;  4FWR A;  4H5T A;  5ELZ A;  1QQM A;  3WXI A;  1Z05 A;  1X3N A;  4K25 A;  4BRO A;  2QWL A;  4FWO A;  4AM7 A;  3H45 C;  5BN9 A;  4BRD A;  4CZH A;  1XC3 A;  5AQV A;  5CE3 A;  4CJ7 A;  2FSJ A;  2V52 B;  2YJF A;  3WQU A;  1U6Z A;  3D2F A;  1MA9 B;  1TYQ B;  5AQH A;  3L4I A;  3VGK A;  1NGJ A;  2QW9 A;  3O5B A;  1NM1 A;  2A5X A;  4BVO A;  3A8Y A;  4H5W A;  2CH6 A;  4FWN A;  3ZET A;  5KPT A;  2P9N B;  3WT0 A;  4PL8 A;  4BR2 A;  3FGU A;  1HKC A;  4GNI A;  5AQF A;  5BN8 A;  4CZK A;  3GBT A;  3ZEU A;  2PAV A;  1DGK N;  2FSN A; 
#chains in the Genus database with same CATH topology
 1BUP A;  1TL3 A;  1S6Q A;  3AVC A;  1SUQ A;  2O8B A;  1OVY A;  4E7I A;  1TUU A;  5FRN A;  1QVF M;  3HSC A;  3SUO A;  4BRC A;  3SPY A;  2BE2 A;  3OYE A;  3AO5 A;  3DXK A;  4BRE A;  4J2B A;  5JIC A;  3THX B;  3WXJ A;  4BVP A;  1WUA A;  1WOQ A;  5FLX O;  1RIL A;  1SKR A;  2NUB A;  2A6A A;  3LZJ A;  3F9M A;  2UUA K;  4CF1 A;  3HRG A;  1Q9Y A;  3M6G A;  4XIU A;  2FLO A;  5SWM A;  4C8K A;  4DTU A;  1TVR A;  4M7Y A;  1Q82 O;  3D45 A;  2RE2 A;  4CK2 A;  1SAZ A;  3NH1 A;  2QM1 A;  3SYZ A;  1QQN A;  3W3D A;  2HMP A;  4DV3 K;  1S1W A;  1LW2 A;  3NBP A;  3R9P A;  5HRR A;  3KJV A;  1NJW A;  3RRH A;  1HNV A;  3K5N A;  1K73 O;  3OTO K;  1ASU A;  3WEE A;  3VQE A;  5JS1 A;  5T7B A;  2E4L A;  3SCX A;  1VQL N;  4B8A B;  1IKV A;  1B9D A;  4H4O A;  3VES A;  5AQX A;  1VRU A;  3BDP A;  1BIZ A;  4CZG A;  3ID8 A;  1CZA N;  3AV9 A;  4WQ4 A;  4CJR A;  3HXM A;  1IG8 A;  3KK1 A;  4RW8 A;  3TAP A;  2DFE A;  4FJ9 A;  3FE1 A;  3SBG A;  3O3H A;  3BF1 A;  3SAH A;  2OAN A;  4G1Q A;  2KFZ A;  4E1J A;  3LWM A;  4KHW A;  3O1W A;  2W6L A;  2Q31 A;  5H1S Q;  4NCB A;  2YX6 A;  4FL9 A;  3H46 O;  1DTT A;  3L3V A;  3VMF B;  4DV5 K;  3OVN A;  5CR4 A;  4K8X A;  3BY5 A;  4FO0 A;  3QEI A;  1VSL A;  4CFB A;  2D0O A;  3MED A;  3W0L A;  3EEQ A;  4E7L A;  3ZSQ A;  2X74 A;  4MLH A;  4ICL A;  3VA3 A;  1HLU A;  4DV7 K;  2YHA A;  3H1Q A;  2P5O A;  2F9W A;  4N47 A;  5K14 A;  1JCF A;  2RF2 A;  3L2R A;  1XNR K;  4EP5 A;  2AA4 A;  2CGJ A;  3O9S A;  3WXK A;  1L5U A;  3VTI A;  4G9Z A;  3KLF A;  3DLK A;  3THY A;  4FLW A;  1KVA A;  4BAC A;  4YHH K;  1IJJ A;  5FPM A;  3VEN A;  1Q7Y O;  3V1O A;  3CFP A;  4FWM A;  4B1Z A;  1LOT B;  2B6A A;  4CED A;  2VYP A;  5EX5 A;  3ZSO A;  2G8H A;  1RT6 A;  3GDQ A;  3PUF A;  4BRI A;  5HOO A;  2QEX N;  3SPZ A;  3OYI A;  3LP1 A;  3VEY A;  4FPB A;  2GTD A;  4O8U A;  1C1A A;  4KFB A;  3T69 A;  3O3F A;  2PZS A;  2YHY A;  4HWI A;  4CIG A;  1J54 A;  2WON A;  4FWK A;  1UWB A;  2WBN A;  1SZ2 A;  4H0P A;  4C8N A;  3P38 A;  3O4W A;  1GLJ O;  2OA8 A;  2KFN A;  5C15 A;  1VQO N;  4KHN A;  4IFE A;  2P9L A;  4IG0 A;  4Y1C A;  3U8X A;  3MN6 A;  3LM9 A;  4I6M B;  3O08 A;  3U4L A;  4H5R A;  1SV5 A;  4DU4 A;  4FOE A;  2O8B B;  3DMJ A;  3DJC A;  3CFO A;  4YOT A;  1WN7 A;  1ZBH A;  3O8M A;  1RBV A;  5AQQ A;  3MWP A;  4I6M A;  4DMN A;  3HP9 A;  3RTV A;  4EIA A;  5AZJ A;  4NYF A;  4FWL A;  3HT3 A;  2FF3 B;  4L3Q A;  1NGB A;  5GAG P;  3NH0 A;  1NGF A;  1MU2 A;  3MAQ A;  3P1G A;  3HTV A;  4CGH A;  4FJG A;  4BR7 A;  4E1N A;  4PUO A;  1E4F T;  1JJ2 M;  1J53 A;  3VEZ A;  4BE0 A;  1VQK N;  1HKB A;  5AQL A;  1X3M A;  2FC0 A;  3L3U A;  4HCC A;  3HPH A;  3I8B A;  2CGL A;  4BE2 A;  5DMR A;  5EXW A;  3BP8 A;  1G15 A;  2E2P A;  1HNX K;  3FZM A;  3NFA A;  4FSV A;  5BRF A;  5CZ1 A;  2NLX A;  4CEF A;  1N6Q A;  4BY9 C;  3FZL A;  4AM6 A;  4CBU A;  5M1O A;  1IKY A;  2Q1N A;  4JD2 A;  4BRQ A;  1RTH A;  4O4G A;  3ENB A;  4PL7 A;  1ZBL A;  1QS4 A;  3KLG A;  1KXP A;  5HRP A;  5IT9 O;  4KH4 A;  3G25 A;  1LWE A;  3KWI A;  2F7T A;  2QWM A;  4ELU A;  5HLF A;  4ZHR A;  3ATU A;  1BIU A;  4FJN A;  5M1K A;  3SQ4 A;  4DUZ K;  4Z94 A;  3IDH A;  5KPR A;  1H1V A;  2D5R A;  5F1X A;  3K2P A;  4OJR A;  4DV6 K;  4KTW A;  4HUF A;  3S3N A;  3OYG A;  3KIO A;  3CMA N;  5HRN A;  1ZC6 A;  1ASV A;  4BGB A;  4F8R A;  3F2K A;  4DS4 A;  2WUS A;  4OO1 J;  3VQD A;  1S1U A;  4CJV A;  1GLD G;  1SKW A;  1VQM N;  1ZBS A;  3EO3 A;  4KV8 A;  3LAM A;  1SL0 A;  2A41 A;  3C6U A;  1KRP A;  2O4I A;  4DQP A;  5KTQ A;  5CYQ A;  4KHS A;  4CCH A;  4IBN A;  4BC2 A;  2VQF K;  5JMV A;  3CM5 A;  3UE5 A;  5GAD P;  1VHX A;  4CEB A;  4Z4I A;  4JD2 B;  1D9F A;  2GV9 A;  4CK1 A;  4DF4 A;  3CC7 N;  2ASM A;  5IWA K;  4OPJ A;  3TAN A;  4IEI A;  2G8F A;  3I0S A;  2HB5 A;  4CJ4 A;  3GL1 A;  5BR8 K;  3AVJ A;  3TSU A;  2XY8 A;  3QIN A;  4BG9 A;  1KVC A;  4Q5V A;  4FWP A;  3H1V X;  4FLT A;  1KVB A;  4YOU A;  1A5W A;  4A59 A;  4FJX A;  3O80 A;  5AJ3 K;  4B3M K;  4DR4 K;  5KPZ A;  4B9L A;  3KVG A;  4HTL A;  4B08 A;  1BQN A;  3AO4 A;  4LF7 K;  3T1A A;  4CGG A;  2GUP A;  4MO5 A;  5D3G A;  3MCA B;  3JXU A;  4MO4 A;  2NNW A;  1HQE A;  3RVC A;  4BRP A;  1KQS M;  1S1X A;  2G8W A;  5E26 A;  2P9U B;  5GIP A;  4K42 A;  4M7X A;  5BPN A;  4YOR A;  2RPI A;  1VSD A;  4X66 K;  1WSJ A;  3VGL A;  1C1B A;  3LDQ A;  1NNE A;  3LDL A;  1VAZ A;  3LPU A;  1ZBF A;  3MN9 A;  3CCL N;  4WFN L;  1G99 A;  3VQC A;  4FLU A;  3TU5 A;  4B9U A;  4ILH A;  1TL1 A;  1WBB A;  5B8H A;  4H0O A;  4HVJ A;  1WLJ A;  3CJA A;  4IOA L;  4I2P A;  4QOZ B;  1HX1 A;  3U3G A;  4CFC A;  3N4P A;  4AHR A;  4CJU A;  4WFB L;  3CCQ N;  4E7J A;  5HRO A;  1VQ9 N;  4CVN E;  3E66 A;  3HST B;  4O0J A;  1NK7 A;  4GV6 A;  3THV A;  3SMS A;  4C8M A;  1E4G T;  4CHP A;  1X9J A;  3KD1 E;  2P9U A;  3CME N;  1T05 A;  1YVU A;  1U48 A;  1MWM A;  2OPS A;  3U9Z A;  3FR0 A;  3E9P A;  2HF4 A;  4CES A;  2QWQ A;  3EL2 A;  2QI2 A;  3EKU A;  1J6Z A;  2OPQ A;  4BDY A;  4DTX A;  3OA9 A;  4YY3 K;  1NOY A;  3QB0 A;  4RW6 A;  4ZTJ A;  2Z1I A;  3ZLJ A;  4KHY A;  2ZQB A;  4N5S A;  4CHZ A;  1YVN A;  2ZJR L;  4FM0 A;  4FVM A;  2A1R A;  1YAG A;  1U2V B;  1XQS C;  4OKK A;  3EY1 A;  4IOC L;  3RMC A;  1GLA G;  1VSK A;  3MX5 A;  2YHW A;  3EE9 A;  1ZXO A;  1HRH A;  4H5N A;  2HHH K;  1QQM A;  4JRQ A;  3LP3 A;  1Z05 A;  4FZX C;  1EWR A;  4K25 A;  4BRO A;  2QWL A;  4FWO A;  4AM7 A;  3H45 C;  4N56 A;  4AIL C;  2DFH A;  1NMN A;  1S5J A;  3OYH A;  2YJF A;  1NK8 A;  4JLH A;  4DR6 K;  3THW B;  3KLE A;  3K57 A;  4CHY A;  1MA9 B;  2O8E A;  1RNH A;  3VGK A;  4FCY A;  4B8C A;  2A5X A;  4BVO A;  3V9Z A;  2WC9 A;  3A8Y A;  4JKD A;  1QQC A;  1RBU A;  1C1C A;  3HP6 A;  4HHT A;  1WAF A;  2P9N B;  5GIO A;  4BR2 A;  3AVI A;  5AQF A;  3TTF A;  3O9T A;  4NXM K;  1BL3 A;  1D9D A;  2FSN A;  4Z4F A;  1KCF A;  2P51 A;  1GOA A;  4IDH A;  3ZT0 A;  4DHY A;  4DQI A;  3O9Q A;  1N33 K;  3MMV A;  1JLQ A;  3E1Y A;  3F5T A;  4EHU A;  2YI1 A;  4CJ5 A;  2OTJ N;  5EU7 A;  3VQ8 A;  3QER A;  3NCI A;  4CZJ A;  5HL7 L;  2BTF A;  1JL2 A;  4JKG A;  1VSE A;  2QXL A;  3EYZ A;  4JI6 K;  3D2E B;  4NCG A;  1BA1 A;  2NRH A;  3SQ2 A;  4RW4 A;  1IBK K;  4DTJ A;  3A5O C;  4BC3 A;  4BR4 A;  3IKM A;  4EHT A;  1TK0 A;  2BUP A;  1EXQ A;  2Q3S A;  1FXX A;  5A2Q O;  1NK5 A;  4BQZ A;  2WTU A;  4PHT X;  4CJW A;  4E7K A;  4IG3 A;  3DXK B;  5M1P A;  3QNN A;  1S6P A;  4JKB A;  4LFA K;  4KB0 A;  1W0H A;  2D0P A;  2VWK A;  4B3O A;  2F4V K;  3ASM A;  3EN9 A;  1LV5 A;  1KSP A;  4F2R A;  1KC8 O;  2KHO A;  5ADX H;  5F2R A;  1L3U A;  4C1N K;  1FJG K;  3FZF A;  2PBD A;  4B3S K;  3CCE N;  1U49 A;  3ATV A;  4E3S A;  4V19 S;  4IEE A;  4DLG A;  4KHP K;  4U67 L;  2ZWH A;  1JLC A;  3ENO A;  1BCO A;  4B1Y B;  3NAE A;  2PYJ A;  1VSH A;  5J2M A;  3AVA A;  3VEX A;  4EAH D;  5C42 A;  4DSF A;  3J7Z O;  3I56 N;  5DM7 L;  4O0I A;  2VCP A;  4W5N A;  3J8A A;  5AQW A;  4OLB A;  3ULE A;  3CCU N;  3TAB A;  2ZJP L;  5J2P A;  4TSX A;  1V4T A;  4DS5 A;  4N76 A;  4NXN K;  4DTP A;  4CZL A;  1FKP A;  1YJ9 N;  5I9E B;  1VK0 A;  4PKG A;  5C12 A;  3D0P A;  4J2A A;  3VQ7 A;  4BWJ A;  1TAU A;  2O8C A;  1GOB A;  3J81 O;  3TTC A;  2D4W A;  4LC9 B;  2P9S B;  1HMV A;  3D6R A;  3UKR B;  2ZD1 A;  2YNG A;  2J4R A;  2V51 B;  4DV2 K;  4FJI A;  4Q0B A;  2Q2R A;  1YIT N;  5C10 A;  3OYL A;  1NJZ A;  3VQA A;  1XUP O;  1BGX T;  4DG1 A;  1D5A A;  4C1N I;  3DOK A;  1NGI A;  1Q9X A;  4FPA A;  2F9T A;  5AQI A;  3HBT A;  3WNH A;  3SMP A;  1M90 O;  3OYF A;  3DRR A;  4FK4 A;  1R59 O;  1WSH A;  2FSK A;  4WE1 A;  4CJQ A;  1NJY A;  3LDP A;  4FLY A;  4J8F A;  3D2E A;  3B8A X;  1NGH A;  3PV8 A;  2GBZ A;  3HOT A;  4CZE A;  2DTU A;  1B92 A;  1NGD A;  4H5V A;  3ZSR A;  3L2U A;  3DLL L;  3AVG A;  4B9S A;  3MK6 A;  1YJN N;  4H8K A;  1VQP N;  3QO9 A;  3HL8 A;  1BG3 A;  1K8K B;  4LSN A;  1QVG M;  4GKK K;  1S1T A;  3QIC A;  1UA0 A;  4HCB A;  3FLC O;  4BR9 A;  5LY3 A;  1BI4 B;  3V9W A;  4Y1D A;  2IOC A;  1TV6 A;  4FLZ A;  4JI8 K;  2Z1J A;  1YTU A;  4CIE A;  1NJX A;  1KAX A;  1J5O A;  4DV0 K;  4GKJ K;  2QWO A;  3P83 D;  4CEZ A;  1S9E A;  2CGK A;  1KFD A;  4FJH A;  2XO7 A;  2E5L K;  4MFB A;  4M3Z A;  3AVM A;  3KK7 A;  4H4M A;  3O9R A;  4K0K K;  1IH7 A;  2BH1 A;  5AQU A;  4DR5 K;  1F21 A;  4LFC K;  4HUG A;  1NU0 A;  2FBV A;  1TKT A;  2E20 A;  4B1X B;  3HPO A;  3LP0 A;  5FPN A;  4DR2 K;  3C7N A;  1QHA A;  4FK2 A;  2BGG A;  5AQG A;  3P5J A;  1ZBU A;  3KK3 A;  3CIP A;  4FWQ A;  4DFJ A;  4OX9 K;  4XH1 A;  1NK4 A;  4WQ4 C;  1YI2 N;  1Y97 A;  3AO2 A;  5KGW A;  3CJ7 A;  1LWC A;  4CHQ A;  4GV3 A;  4CJP A;  1YJW N;  3KKR A;  4Z4G A;  3O4N A;  2A1S A;  2DY4 A;  3IG1 A;  1HJO A;  3ZSX A;  2YCH A;  2FBX A;  2HVH A;  3KLI A;  1RT5 A;  3M8Q A;  4PWD A;  4QCL A;  1BWF O;  3GE1 A;  2P9N A;  4FVU A;  3QES A;  3CCS N;  5JVG L;  1DKG D;  4FJL A;  2IVN A;  3OS2 A;  4J2D A;  4CF8 A;  3VQ6 A;  2HNY A;  2QKK A;  3AAP A;  1NLV A;  1K8K A;  1Q81 O;  3VF4 A;  3P31 A;  3QML A;  5AZI B;  1FW6 A;  4DSE A;  2YJE A;  1SS6 A;  2WFB A;  3JSM A;  3TAR A;  3L4Q A;  1T6C A;  1RTD A;  2AP1 A;  3H3N O;  3K9K A;  4CEC A;  4HUE A;  1VQ6 N;  2P9K B;  4DTO A;  1BHL A;  3OW2 M;  4C8L A;  4O8K A;  4KPY A;  4K43 A;  3QFP A;  4EFH A;  3ZSW A;  3E01 A;  1NK9 A;  2HBJ A;  1UOC A;  2DPN A;  5FRO A;  4CER A;  1R0A A;  4W5Q A;  4DSI A;  1KLM A;  4NLB A;  5LJW A;  4E1M A;  2YKN A;  4RCH A;  2O4G A;  2GEL A;  5M1N A;  2D0A A;  4JS5 A;  3AGK A;  4A5B A;  1NBW A;  2IVP A;  3PO5 A;  4OGE A;  2XHB A;  5J2N A;  4DSL A;  3UB5 A;  3LPT A;  3AO3 A;  4M63 C;  4NO7 A;  4WQ5 C;  1K9M O;  1QZ5 A;  3TAF A;  1OH8 A;  4IFY A;  4QS9 A;  3PX6 A;  1U45 A;  1KTQ A;  2X6S A;  3AGR A;  5KGX A;  3UKU A;  1YUW A;  4W5T A;  2VQE K;  3FFK B;  3SJH A;  1RT2 A;  4JHD B;  4FJJ A;  4H03 B;  1S9G A;  3VET A;  1QSL A;  3OS1 A;  5CHI A;  2HVI A;  4JI1 K;  4I9Q A;  5JLF A;  3CPE A;  2VG7 A;  4JK9 A;  4M41 A;  3KTQ A;  3V1R A;  1L3S A;  1RT1 A;  3QBX A;  2E1Y A;  1OH7 A;  1CXQ A;  1XWL A;  2W42 A;  1VQ7 N;  4XH5 A;  1BIS A;  4LH5 A;  4JI0 K;  2IGI A;  3R6M A;  1N32 K;  3VER A;  2GWJ A;  5AR0 A;  1HR0 K;  4DFP A;  4IWV A;  4CEQ A;  4YOX A;  1VRT A;  5KI6 A;  1P8Z A;  2FXU A;  2VGN A;  3DXM B;  3KHY A;  1DT9 A;  1J9A A;  3H08 A;  1C6V A;  5AQZ A;  3O4Q A;  3U9D A;  2HBK A;  4BC4 A;  4C23 A;  5EVZ A;  1JLF A;  1NGA A;  3LDO A;  4AHS A;  1U2V A;  1K8A O;  4PA1 A;  1HUX A;  1NKB A;  2XY7 A;  3CCR N;  4JYA K;  3IS9 A;  2XY5 A;  4DSK A;  4M3Y A;  3RRG A;  3SQ0 A;  5AQN A;  2UUB K;  1CZB A;  1BCM A;  1TAQ A;  1V4S A;  1LW0 A;  3WUH A;  3OBY A;  3DLB A;  2D0B A;  4B9Q A;  4WQ5 A;  4B9M A;  1XHZ A;  1WSG A;  3CQ8 A;  2JWL A;  1HPM A;  4FWR A;  4OPK A;  3WXI A;  1JL1 A;  1X3N A;  5KRT A;  3HOS A;  3LAL A;  4ILJ A;  3M8S A;  1XC3 A;  5E41 A;  4CJ7 A;  2F96 A;  3D2F A;  3LP2 A;  4CF9 A;  4IOX A;  1TYQ B;  1RBR A;  3C6A A;  3DLH A;  3ITH A;  1NM1 A;  1WSF A;  3TAM A;  3VTH A;  4FWN A;  1YTA A;  3ZET A;  5KPT A;  3WT0 A;  5BN8 A;  4CZK A;  4ELT A;  4AHV A;  2JLE A;  4CJS A;  3THW A;  4F3T A;  4LH4 A;  5M1Q A;  2H3G X;  3JS6 A;  1ZBI A;  3CG7 A;  4DB3 A;  5KRS A;  4BG8 A;  4FM2 A;  1KAY A;  2YV0 X;  1VQ4 N;  4B9N A;  3NF7 A;  3VGM A;  3L2Q A;  2FBT A;  1ATS A;  4DFM A;  3D7E O;  1RDD A;  3SQ1 A;  4CJ3 A;  1C0U A;  4E89 A;  1NOZ A;  3BEX A;  2HBL A;  1RT4 A;  4ID5 A;  3HM8 A;  2HHQ A;  3THY B;  4FW2 A;  4DCH A;  4JK8 A;  3CFR A;  3PIO L;  4B9V A;  5KQD A;  3EKS A;  1QTM A;  5CY4 A;  3A5N C;  2YNH A;  5JLH A;  1RFQ A;  1N34 K;  2E2Q A;  3CCM N;  2Q97 A;  4JI2 K;  3LDS A;  3AVN A;  4BDP A;  3G10 A;  1NJI O;  2E8A A;  1BQM A;  4B1W B;  3CJ1 A;  2G8U A;  2HHU A;  2O8F B;  4KH6 A;  5JVH L;  2ASP A;  3AVL A;  1JLB A;  1Z25 A;  2Z1H A;  3DOL A;  4LFB K;  1UA1 A;  4CEE A;  3P39 A;  3Q7B A;  4JV5 K;  3I33 A;  1JXE A;  4DTS A;  4FZZ A;  3AVF A;  1JLA A;  1NG9 A;  4BRK A;  1I3A A;  3U6F A;  4YNQ A;  1OH6 A;  3DXM A;  4Y0W A;  2P9P A;  3TPQ A;  1REV A;  5AZJ B;  4CGI A;  2OZM A;  4NCA A;  3TAG A;  1IBM K;  3T3F A;  3H3O B;  3NF6 A;  3OYC A;  2IAJ A;  2NRW A;  4AQY K;  2HMI A;  5EOY A;  3WEE B;  5AQK A;  4C8O A;  4EP4 A;  3L8B A;  1O1W A;  3WXL A;  3PIP L;  4DTN A;  3SI6 A;  4K41 A;  4I9L A;  4X62 K;  2QK9 A;  1HPZ A;  5AQP A;  3TTD A;  2YHX A;  3VQB A;  4OPA A;  3EZ5 A;  1KLN A;  3V6D A;  4CGJ A;  3UKU B;  1XMQ K;  1GOC A;  3IRX A;  3IUC A;  3NF8 A;  4CHN A;  1NWK A;  4FM1 A;  3J7Y P;  4KH5 A;  3D2F B;  4OVL A;  1Q8I A;  3PLA A;  1ITG A;  3C6T A;  4E7H A;  4ISE A;  4OLA A;  4KRF A;  2W6K A;  3T7Z A;  4IKF A;  4NYN A;  1NMD A;  4DV1 K;  3M5R A;  2ZGZ A;  5AQM A;  1SL2 A;  2EHG A;  3ZT4 A;  4DQS A;  3SV4 A;  3ZT3 A;  5CZ2 A;  4CZI A;  4CZF A;  3RMB A;  2O8D B;  3LWL A;  1T7P A;  1S1V A;  5TKY A;  2HHX A;  2QWR A;  3HI0 A;  3MN7 A;  2JWK A;  4JHD A;  4DF8 A;  4CK3 A;  4CFD A;  2CH5 A;  2Q0R A;  1WB9 A;  1Q18 A;  3CD6 N;  2RN2 A;  3MXM A;  2LSN A;  1S3X A;  3AA2 A;  4MDA A;  2D1K A;  1DLO A;  4FW1 A;  3HZ6 A;  3SBT A;  5GIN A;  5LL6 Z;  1C0G A;  3AVH A;  3DM2 A;  3LDN A;  1CZ9 A;  1ATR A;  3B6P A;  5MLC Q;  1RT3 A;  3QNO A;  4ID1 A;  2Q0U A;  4DTM A;  4WFA L;  2XY6 A;  4JKC A;  5C0Y A;  1TKX A;  3S41 A;  5AFU H;  5C2D A;  3M1F A;  4I7F A;  3K5M A;  1W7A A;  2P9I A;  1JKH A;  4M45 A;  4LF6 K;  1BDG A;  3RWU A;  3LZI A;  5FDL A;  3IMX A;  1RDA A;  3TSQ A;  5I42 A;  1RT7 A;  2IIR A;  3MX2 A;  4W5O A;  1OKJ A;  4CBX A;  2G8K A;  1HYS A;  2ZE2 A;  4DU3 A;  3DI6 A;  3LM2 A;  3FZH A;  4MDB A;  3SJJ A;  1D8Y A;  2WOM A;  2ZJQ L;  3CI5 A;  2ITG A;  1X9M A;  1QSS A;  2P9S A;  3DLG A;  4ISG A;  4WF9 L;  1NK0 A;  3UKR A;  3PO4 A;  1XNQ K;  1TKD A;  4CI6 A;  5ADX A;  4CD1 A;  2QKB A;  3R3L A;  3ZX2 A;  4E19 A;  2E1Z A;  3OS0 A;  4LD0 A;  4KHU A;  1EP4 A;  1RGI A;  3AA3 A;  3BGR A;  3ZET B;  2X78 A;  4UY8 O;  3CM6 A;  4AHC A;  4B3T K;  5DK5 A;  1EO1 A;  1W97 L;  1QQO A;  5BPM A;  1Z26 A;  2Z1G A;  3CJC A;  2G8V A;  3KK2 A;  5AQO A;  2Y1I A;  4BRL A;  4AF1 A;  3BF3 A;  3ULE B;  3NDK A;  3I55 N;  2HHW A;  1HJR A;  4RTF D;  3TWH A;  4QS8 A;  4BRM A;  1BI4 A;  1I94 K;  1K6Y A;  4KO0 A;  1TK8 A;  4QS7 A;  1EET A;  3K59 A;  1T6D A;  1IO2 A;  3C95 A;  3V9S A;  1HNZ K;  3TAE A;  1XHX A;  1T3V A;  1XMO K;  2NRV A;  1LWF A;  1IKW A;  1JCG A;  3CET A;  4IXC A;  4F9O A;  3OYN A;  4FJ7 A;  4LF9 K;  3BZC A;  4MQ3 A;  4F3O A;  3QLH A;  2UXB K;  5AQY A;  5AQS A;  2VG5 A;  4O55 A;  3MEC A;  4CF0 A;  5J2Q A;  2UUC K;  4B1U B;  3G71 N;  4H0T B;  1RDW X;  5GAH P;  4CBW A;  4CJE A;  4BQL A;  2E2O A;  4B1V A;  1S22 A;  3QET A;  4H0V B;  2O8F A;  3V1Q A;  1MDU B;  4FK0 A;  1ILY A;  4H0Y B;  3J80 O;  3U3Y A;  4YOY A;  1XC9 A;  3VF2 A;  3SUN A;  3THX A;  1P90 A;  4M3U A;  4JEP A;  3ENH A;  3DRP A;  4IZ9 A;  2QXF A;  2PYL A;  4DR7 K;  1KAZ A;  4JK7 A;  3SUP A;  2IC3 A;  4QAG A;  4X65 K;  3MEE A;  4BR0 A;  3MXJ A;  3ZSY A;  3DLE A;  4F4K A;  2HHS A;  2OPR A;  3SUQ A;  5AQR A;  1HNW K;  4N41 A;  2QWP A;  3L6Q A;  2XRI A;  3O9U A;  4DUY K;  3OYK A;  3V4I A;  4NB4 A;  4M3X A;  1X9W A;  4FJM A;  2KW4 A;  1BA0 A;  3CER A;  4BWM A;  4PQU A;  3KKS A;  5SZT A;  4DWI A;  4YOV A;  2HNZ A;  1YXQ A;  3SLC A;  4DTR A;  4LF4 K;  3SNN A;  2PY5 A;  4OGC A;  2B5J A;  3PX4 A;  3ZEU B;  3KLH A;  1YIJ N;  4JKA A;  4ISF A;  1NK6 A;  1T8E A;  1IBL K;  3L2V A;  2YNF A;  3NH2 A;  5FPE A;  3QIO A;  4A57 A;  3CF5 L;  3QEV A;  1ATN A;  2E6M A;  3NE6 A;  2I5J A;  5FRM A;  3AVK A;  3NVM A;  4RW9 A;  1RBS A;  4CD3 A;  3I8D A;  3CJ9 A;  1C0M A;  4DU1 A;  3TAQ A;  3NGI A;  5EY4 A;  3HPG A;  3AY9 A;  4FJK A;  4IJA A;  3K0S A;  1LCU A;  4CJK A;  2GUI A;  3KWG A;  4WYB A;  2YHB A;  4KTQ A;  4KHQ A;  1LAW A;  3VOV A;  3K9J A;  2I7N A;  2Q36 A;  2RKI A;  1JLE A;  3DYA A;  2KQ2 A;  4LF5 K;  3HJF A;  1HQU A;  2HW3 A;  1I39 A;  3LAN A;  1B9F A;  2AJQ A;  4BRD A;  3MEG A;  3L2W A;  5CE3 A;  2FSJ A;  2QA4 N;  2V52 B;  1U6Z A;  3FFI A;  4FXD A;  5AQH A;  4Z4C A;  4B3R K;  5LMU K;  1NGJ A;  2QW9 A;  3IAY A;  2O8C B;  4DSJ A;  2ETJ A;  2CH6 A;  4JS4 A;  4PL8 A;  3F9K A;  3FGU A;  1HKC A;  4GNI A;  3GBT A;  3ZYY X;  3ZEU A;  3CYM A;  2HBM A;  1DGK N;  1CLQ A;  1A5V A;  4X64 K;  3HVR A;  2O8D A;  3S3M A;  2YNI A;  3MWT A;  4KI6 A;  3WQT A;  1FKO A;  4KB1 A;  3OY9 A;  1GLE G;  2KZZ A;  3TR8 A;  4AHU A;  3BZK A;  4RG8 A;  1IV0 A;  2P5G A;  1GLB G;  2HST A;  4CIF A;  1VSF A;  4GW6 A;  4A62 A;  2P9P B;  4JI7 K;  2ASO A;  3ZT2 A;  4I2Q A;  1KFS A;  2P1J A;  2HHT A;  3SK3 A;  3QIP A;  3KZB A;  2A42 A;  5KQ8 A;  3QDK A;  4EZ6 A;  4IJN A;  2NRT A;  2W41 A;  2VWJ A;  3GOI A;  3OYM A;  2HHV A;  1N36 K;  2R7Y A;  4CEA A;  1T44 A;  1A5X A;  4BR5 A;  3OYD A;  4FOI A;  1C0T A;  4PKI A;  1RTI A;  1WBD A;  5I3U A;  4L8R B;  1RBT A;  4OKJ A;  1GLF O;  3NF9 A;  2FBY A;  3SAF A;  4FWS A;  4CGD A;  3K5L A;  4M3W A;  3VF6 A;  1VSJ A;  4R79 A;  4XH4 A;  1HYZ A;  4CE9 A;  1XI1 A;  4PY5 A;  2GWK A;  1HNI A;  1FK9 A;  5BRH A;  3A5L C;  4CJF A;  4JI3 K;  4BC5 A;  5HBM A;  3VQ4 A;  3ZSV A;  1JCE A;  1VQN N;  3KD5 E;  3G6E N;  2O8E B;  3A5M C;  1HYV A;  3HO1 A;  4A61 A;  3TSP A;  3PY8 A;  1GLL O;  1QHT A;  4Z0U A;  3OJS A;  3T1H K;  1ZYQ A;  1W9H A;  4Z4E A;  4LSL A;  4GV9 A;  4BDZ A;  4RW7 A;  4M42 A;  3CJB A;  4JRP A;  3PX0 A;  4BRG A;  1BO5 O;  1TGO A;  3OHR A;  3F73 A;  3ID6 A;  4FYD A;  2E2N A;  1EX4 A;  1QE1 A;  2NZT A;  4GVE A;  1J5E K;  2F8T A;  1TUY A;  1U04 A;  1TKZ A;  1L3V A;  4AH9 A;  4DR3 K;  4WCE L;  3OYA A;  1BU6 O;  4CJT A;  1T03 A;  3QEX A;  3C7N B;  5BRE A;  2V7Y A;  5M1F A;  3HYF A;  5DM6 L;  2BDP A;  1OVQ A;  1JLG A;  5FPD A;  2F8S A;  5HRS A;  4FZY A;  4RWT A;  4A2A A;  2DFF A;  4IFV A;  3MCP A;  1VQ8 N;  3IFR A;  2UU9 K;  1O13 A;  3M8P A;  1TK5 A;  1QZ6 A;  4KBO A;  2FF6 A;  1MWK A;  2B4J A;  4BE1 A;  4M3T A;  4JKE A;  3T19 A;  2EWS A;  5AZI A;  4CF2 A;  3NHG A;  4GY2 B;  1EWQ A;  2W40 A;  1X9S A;  4XEI A;  2BAN A;  2P9I B;  2ZGY A;  3EE8 A;  3PSI A;  1ESV A;  2E88 A;  4YDU A;  3AAR A;  4BGA A;  5AQJ A;  5BPL A;  4CFA A;  3NMU A;  3CCV N;  2ITM A;  4E0D A;  5C25 A;  4F2S A;  1EKE A;  1WSE A;  4A2B A;  2V7Z A;  4BRH A;  3CC2 N;  2NRX A;  1U47 A;  2PFU A;  3V9X A;  3E9O A;  2ZM6 K;  1SL1 A;  4CHO A;  3WNG A;  2HOE A;  1NGG A;  5C2F A;  5LMN K;  2HF3 A;  1WAJ A;  4OKE A;  3ZSZ A;  4IDK A;  3NGY A;  3EZW A;  1Y64 A;  2NRZ A;  5AFU A;  2VGM A;  4JI5 K;  3CC4 N;  1VQ5 N;  4OPH A;  2IDO A;  4DR1 K;  5GAE P;  4IO8 A;  3VQP A;  5F0X A;  4IO9 L;  3RMD A;  4BRA A;  3ZT1 A;  1Q86 O;  3VEV A;  3CCJ N;  2RHK A;  3CPW M;  1VSI A;  3ZX0 A;  1Z6R A;  3ZCM A;  3OYB A;  1UAX A;  3VEW A;  3FZK A;  4GVM A;  4FLV A;  1RDU A;  1KD1 O;  1DTQ A;  4UQG A;  4CEO A;  3O1B A;  4FLX A;  3JAM O;  4ELV A;  3J7A P;  3O3G A;  3C0B A;  3G0Z A;  2P9K A;  4JI4 K;  4H0X B;  3H6E A;  2A3Z A;  4LF8 K;  1IKX A;  3I0R A;  2IVO A;  2ZF5 O;  3V81 A;  3DAW A;  3BUZ B;  5CYM A;  3R8E A;  3VQ5 A;  1QSY A;  3ISN C;  1NGE A;  1OH5 A;  1EQY A;  3GG4 A;  3VQQ A;  2NRR A;  4FJ5 A;  3VEO A;  3M8R A;  3DLR A;  4MLE A;  3N4Q A;  3B6O A;  4KI4 A;  2VG6 A;  1RTJ A;  2UYT A;  3K58 A;  3AA4 A;  1U4B A;  3RSE B;  3TI0 A;  2OYQ A;  1IG9 A;  4JAX A;  3C6H A;  4CJL A;  3S3O A;  3C65 A;  1SQK A;  2UXD K;  4O5F A;  3QEP A;  1C0F A;  4ILG B;  1ASW A;  4CW7 B;  4DQR A;  2IS3 A;  2GX9 A;  3ZX3 A;  3OBW A;  3AA5 X;  1HKG A;  5LJV A;  3RMA A;  2X6N A;  3CXC M;  3AVB A;  4DLE A;  4BRN A;  3A2F A;  3VQ9 A;  1X1P A;  1S72 N;  2QTD A;  3L0Q A;  3PSF A;  4CZM A;  4YFU A;  5AQT A;  2HND A;  2OTL N;  3HVT A;  4ZTF A;  1NKC A;  5HP1 A;  1JXB A;  3P4I A;  4JKG B;  2OZS A;  4CGF A;  3A0I X;  3AO1 A;  4LY7 A;  4PKH A;  3T1Y K;  1N8R O;  4JKH A;  1VSM A;  4YDU C;  3M3Z A;  3ULD A;  3CQX A;  3E9L A;  1BOT O;  3VA0 A;  2OPP A;  3K5O A;  5E84 A;  2UXC K;  3QBW A;  4KAZ A;  2ATQ A;  3O6W A;  1M1K O;  2KZM A;  5BR9 A;  3AAQ A;  4KRE A;  3OYJ A;  4GMJ B;  3RR7 A;  4FJ8 A;  1E3M A;  2P9L B;  3NGZ A;  4U7B A;  4K8Z A;  3ALY A;  5TKW A;  2JGU A;  3LL3 A;  2Y1J A;  3MDQ A;  1NGC A;  3SZ2 A;  3MN5 A;  4W5R A;  3VPZ A;  4NLC A;  4JN4 A;  4A5A A;  5BRD A;  1WSI A;  1RDC A;  1CXU A;  3UIQ A;  1YT3 A;  3C94 A;  1WNS A;  2GEM A;  2D0C A;  3Q7C A;  4M3R A;  3QEW A;  1NKE A;  4HTU A;  3SV3 A;  2KTQ A;  1LAV A;  5J1E A;  3V9U A;  3G4S N;  1TYQ A;  4O5B A;  5C24 A;  4DQ8 A;  1RDB A;  2OCE A;  1W2B M;  1DEJ A;  2G8I A;  3WNF A;  2A40 A;  2KLA A;  3R1X A;  3DWL A;  3CHW A;  4O44 A;  2I7P A;  2EX3 A;  3QFU A;  4JKF A;  3RSE A;  3CQY A;  1GLC G;  2QWN A;  4JNE A;  4J2E A;  4DKW A;  5JS2 A;  3VN5 A;  2VWB A;  4BRF A;  3S9H A;  1D4X A;  4Z4H A;  1SKS A;  4DV4 K;  4H5T A;  5ELZ A;  4DFK A;  4AHT A;  3JYT A;  1YF5 L;  5BN9 A;  3WXM B;  3MXI A;  4CZH A;  5AQV A;  3NVK A;  4KTZ A;  3WQU A;  4R5P A;  4B9T A;  4KKO A;  1L3T A;  3HM9 A;  2YKM A;  3L4I A;  3OJU A;  2E6L A;  3HK2 A;  3LAK A;  4EZ9 A;  3O5B A;  3RR8 A;  3WNE A;  4H5W A;  1RCH A;  3SAG A;  1YHQ N;  1N5Y A;  4YOW A;  2KKZ A;  3DRS A;  2PAV A;  4DQQ A; 
#chains in the Genus database with same CATH homology
 2H3G X;  1BUP A;  4IDH A;  4DHY A;  3JS6 A;  3O9Q A;  3MMV A;  4DB3 A;  4BG8 A;  1OVY A;  3MWT A;  3E1Y A;  1KAY A;  3WQT A;  3F5T A;  1TUU A;  4EHU A;  1VQ4 N;  1GLE G;  2YI1 A;  3VGM A;  1QVF M;  1ATS A;  3HSC A;  2OTJ N;  4BRC A;  4CZJ A;  3D7E O;  3DXK A;  4BRE A;  5HL7 L;  2BTF A;  1GLB G;  2HST A;  4A62 A;  2P9P B;  5JIC A;  4JKG A;  3WXJ A;  2ASO A;  4BVP A;  3BEX A;  1WUA A;  2HBL A;  2QXL A;  3HM8 A;  3D2E B;  1WOQ A;  1BA1 A;  2NRH A;  3SK3 A;  2A6A A;  3F9M A;  3KZB A;  2A42 A;  3A5O C;  5KQ8 A;  3HRG A;  4JK8 A;  4DCH A;  3PIO L;  3M6G A;  3QDK A;  4BC3 A;  5KQD A;  4IJN A;  2FLO A;  3EKS A;  4BR4 A;  3IKM A;  2NRT A;  4EHT A;  2BUP A;  2W41 A;  3A5N C;  5JLH A;  3GOI A;  4M7Y A;  1Q82 O;  1RFQ A;  2RE2 A;  4BQZ A;  2E2Q A;  4PHT X;  1SAZ A;  1T44 A;  3CCM N;  2QM1 A;  4BR5 A;  4FOI A;  1QQN A;  2Q97 A;  3DXK B;  5M1P A;  3W3D A;  2HMP A;  4JKB A;  3R9P A;  4PKI A;  2D0P A;  3EN9 A;  1K73 O;  1GLF O;  3WEE A;  1NJI O;  1KC8 O;  3SAF A;  2E8A A;  2KHO A;  4FWS A;  4B1W B;  5F2R A;  5ADX H;  3CJ1 A;  3VF6 A;  4C1N K;  3FZF A;  2PBD A;  4KH6 A;  5JVH L;  2ASP A;  4R79 A;  1VQL N;  3VES A;  5AQX A;  4XH4 A;  3CCE N;  3ATV A;  2GWK A;  3P39 A;  3Q7B A;  4IEE A;  4CZG A;  3I33 A;  3ID8 A;  1CZA N;  2ZWH A;  4U67 L;  4BRK A;  4WQ4 A;  3ENO A;  5BRH A;  3A5L C;  1IG8 A;  3DXM A;  4B1Y B;  4Y0W A;  2P9P A;  4BC5 A;  3FE1 A;  3SBG A;  3TPQ A;  1JCE A;  1VQN N;  3VEX A;  4EAH D;  3BF1 A;  5AZJ B;  3SAH A;  3J7Z O;  3G6E N;  2OAN A;  3I56 N;  3A5M C;  5M1Q A;  4E1J A;  5DM7 L;  2VCP A;  3J8A A;  5AQW A;  4A61 A;  3TSP A;  1GLL O;  3O1W A;  3ULE A;  2Q31 A;  5H1S Q;  3CCU N;  2ZJP L;  4GV9 A;  3H3O B;  1V4T A;  2YX6 A;  4FL9 A;  2NRW A;  3CJB A;  3H46 O;  5EOY A;  4BRG A;  3VMF B;  1BO5 O;  3WEE B;  5AQK A;  5CR4 A;  3OHR A;  4FO0 A;  3ID6 A;  3WXL A;  4CZL A;  3PIP L;  4K41 A;  2D0O A;  1YJ9 N;  5I9E B;  2E2N A;  3W0L A;  5C12 A;  4PKG A;  2NZT A;  4MLH A;  5AQP A;  4GVE A;  3TTD A;  1HLU A;  2YHX A;  1TUY A;  4OPA A;  3H1Q A;  3TTC A;  2F9W A;  2D4W A;  4WCE L;  3UKU B;  1BU6 O;  1JCF A;  2P9S B;  4LC9 B;  3D6R A;  3IUC A;  1NWK A;  3UKR B;  2AA4 A;  2CGJ A;  3O9S A;  4KH5 A;  3C7N B;  3D2F B;  3WXK A;  5BRE A;  2V7Y A;  3VTI A;  5M1F A;  4G9Z A;  2J4R A;  2V51 B;  5DM6 L;  2Q2R A;  3PLA A;  1YIT N;  5C10 A;  5FPD A;  4ISE A;  1IJJ A;  4RWT A;  4A2A A;  3T7Z A;  5FPM A;  3VEN A;  3MCP A;  1NMD A;  1XUP O;  1Q7Y O;  3IFR A;  1VQ8 N;  1O13 A;  4FWM A;  4B1Z A;  1LOT B;  3M5R A;  4C1N I;  2ZGZ A;  2VYP A;  5AQM A;  1QZ6 A;  1NGI A;  5EX5 A;  4BRI A;  3GDQ A;  4KBO A;  5HOO A;  2FF6 A;  4FPA A;  2QEX N;  1MWK A;  2F9T A;  5AQI A;  3HBT A;  3SMP A;  3VEY A;  4FPB A;  2GTD A;  4O8U A;  4CZI A;  4CZF A;  1M90 O;  3T69 A;  4JKE A;  2YHY A;  1R59 O;  4HWI A;  2FSK A;  2EWS A;  4FWK A;  3LDP A;  5AZI A;  2WBN A;  1SZ2 A;  4H0P A;  4J8F A;  3P38 A;  5TKY A;  3D2E A;  3O4W A;  4GY2 B;  3B8A X;  1GLJ O;  1NGH A;  5C15 A;  1VQO N;  4IFE A;  2P9L A;  2W40 A;  2QWR A;  3HI0 A;  3U8X A;  3HOT A;  3MN6 A;  4CZE A;  3MN7 A;  4XEI A;  3LM9 A;  2JWK A;  4I6M B;  3O08 A;  4JHD A;  3U4L A;  1NGD A;  4H5R A;  4H5V A;  3DLL L;  2P9I B;  2ZGY A;  3EE8 A;  4FOE A;  3MK6 A;  1YJN N;  1ESV A;  2E88 A;  2CH5 A;  3AAR A;  2Q0R A;  4YDU A;  5AQJ A;  4BGA A;  5BPL A;  1VQP N;  1Q18 A;  3DJC A;  3CD6 N;  4YOT A;  3NMU A;  3O8M A;  1BG3 A;  3CCV N;  1K8K B;  1S3X A;  1QVG M;  5AQQ A;  3QIC A;  4MDA A;  2ITM A;  2D1K A;  3MWP A;  4I6M A;  4EIA A;  5AZJ A;  3HZ6 A;  3SBT A;  4FWL A;  5GIN A;  3FLC O;  4BR9 A;  5LY3 A;  4A2B A;  2FF3 B;  2V7Z A;  4L3Q A;  4BRH A;  1C0G A;  3CC2 N;  1NGB A;  2NRX A;  5GAG P;  2PFU A;  1NGF A;  3LDN A;  1ATR A;  5MLC Q;  3HTV A;  3E9O A;  1KAX A;  4BR7 A;  2Q0U A;  2QWO A;  1E4F T;  4WFA L;  1JJ2 M;  2HOE A;  4JKC A;  1NGG A;  5C2F A;  5C0Y A;  3VEZ A;  3S41 A;  2CGK A;  5AFU H;  1HKB A;  5AQL A;  5C2D A;  1X3M A;  2HF3 A;  1VQK N;  3M1F A;  2P9I A;  3EZW A;  1Y64 A;  2NRZ A;  3I8B A;  1BDG A;  5AFU A;  2CGL A;  3KK7 A;  2VGM A;  3O9R A;  3IMX A;  5EXW A;  3CC4 N;  3BP8 A;  2BH1 A;  5AQU A;  3TSQ A;  2E2P A;  1VQ5 N;  3FZM A;  2IIR A;  4OPH A;  4FSV A;  3MX2 A;  1OKJ A;  4CBX A;  2E20 A;  5GAE P;  5BRF A;  3LM2 A;  4MDB A;  3FZH A;  4B1X B;  2NLX A;  4IO8 A;  5FPN A;  3CI5 A;  3FZL A;  4AM6 A;  2ZJQ L;  4CBU A;  5M1O A;  4JD2 A;  2Q1N A;  4BY9 C;  3C7N A;  5F0X A;  1QHA A;  4IO9 L;  4BRQ A;  5AQG A;  4BRA A;  1Q86 O;  3VEV A;  2P9S A;  3ENB A;  3CCJ N;  4PL7 A;  4ISG A;  2RHK A;  4WF9 L;  3CPW M;  3UKR A;  3CIP A;  4FWQ A;  1KXP A;  3ZX0 A;  1Z6R A;  4CI6 A;  4CD1 A;  5ADX A;  3VEW A;  4KH4 A;  3R3L A;  4XH1 A;  3FZK A;  3G25 A;  3ZX2 A;  3KWI A;  4WQ4 C;  2F7T A;  1YI2 N;  1RDU A;  2QWM A;  2E1Z A;  1KD1 O;  3CJ7 A;  1RGI A;  3ATU A;  4GV3 A;  3ZET B;  5M1K A;  4UY8 O;  3O1B A;  4Z94 A;  3IDH A;  5KPR A;  1YJW N;  1H1V A;  1EO1 A;  1W97 L;  5F1X A;  1QQO A;  3C0B A;  2P9K A;  5BPM A;  4H0X B;  3H6E A;  2A3Z A;  3CJC A;  3CMA N;  1HJO A;  2IVO A;  2YCH A;  2ZF5 O;  3DAW A;  1ZC6 A;  5AQO A;  3BUZ B;  3R8E A;  4BRL A;  4BGB A;  4AF1 A;  3BF3 A;  1NGE A;  3F2K A;  1EQY A;  3ULE B;  3I55 N;  2WUS A;  4OO1 J;  3GG4 A;  1BWF O;  2NRR A;  2P9N A;  3GE1 A;  1GLD G;  4RTF D;  3VEO A;  4FVU A;  1VQM N;  3CCS N;  1ZBS A;  3EO3 A;  4QS8 A;  4BRM A;  4MLE A;  3N4Q A;  5JVG L;  1DKG D;  2A41 A;  2IVN A;  4QS7 A;  2UYT A;  1T6D A;  3AAP A;  3RSE B;  1NLV A;  1K8K A;  4BC2 A;  1Q81 O;  3VF4 A;  3P31 A;  3QML A;  5AZI B;  5JMV A;  4JAX A;  2YJE A;  3UE5 A;  1T3V A;  1SS6 A;  5GAD P;  2WFB A;  2NRV A;  3C6H A;  3L4Q A;  1T6C A;  4JD2 B;  3CC7 N;  2AP1 A;  3H3N O;  3C65 A;  1SQK A;  3K9K A;  1JCG A;  2ASM A;  3CET A;  4O5F A;  4IXC A;  1C0F A;  4F9O A;  1VQ6 N;  2P9K B;  4ILG B;  4IEI A;  3OW2 M;  3ZX3 A;  2GX9 A;  4O8K A;  5AQY A;  3OBW A;  5AQS A;  3GL1 A;  4K43 A;  5LJV A;  1HKG A;  3QFP A;  4EFH A;  3CXC M;  4B1U B;  3TSU A;  3G71 N;  2HBJ A;  1RDW X;  2DPN A;  4H0T B;  4BG9 A;  5GAH P;  4NLB A;  4CBW A;  4FWP A;  4BRN A;  4BQL A;  3H1V X;  1S72 N;  2E2O A;  4B1V A;  1S22 A;  4H0V B;  4YOU A;  2QTD A;  3L0Q A;  4A59 A;  4CZM A;  3O80 A;  5AQT A;  1MDU B;  2OTL N;  5KPZ A;  5LJW A;  4RCH A;  3KVG A;  4HTL A;  2GEL A;  5M1N A;  1ILY A;  4H0Y B;  3P4I A;  2GUP A;  4JKG B;  3AGK A;  4MO5 A;  4A5B A;  3MCA B;  3JXU A;  1NBW A;  2IVP A;  4MO4 A;  4YOY A;  2NNW A;  3VF2 A;  3A0I X;  3UB5 A;  3RVC A;  1P90 A;  4BRP A;  1KQS M;  4JEP A;  5E26 A;  2P9U B;  3ENH A;  5GIP A;  4K42 A;  4IZ9 A;  4M63 C;  4PKH A;  4NO7 A;  1N8R O;  4WQ5 C;  1KAZ A;  1QZ5 A;  4JK7 A;  1K9M O;  4JKH A;  4QS9 A;  4M7X A;  4YDU C;  3M3Z A;  5BPN A;  4YOR A;  3CQX A;  3AGR A;  3E9L A;  1BOT O;  3VGL A;  5E84 A;  4BR0 A;  3LDQ A;  3LDL A;  3QBW A;  1YUW A;  1VAZ A;  3UKU A;  3CCL N;  3FFK B;  3MN9 A;  5AQR A;  4WFN L;  1G99 A;  3SJH A;  4JHD B;  2QWP A;  3TU5 A;  3L6Q A;  3O9U A;  4H03 B;  4ILH A;  3O6W A;  3VET A;  4NB4 A;  1M1K O;  5BR9 A;  3AAQ A;  5B8H A;  5CHI A;  4H0O A;  5JLF A;  3CPE A;  2P9L B;  3CJA A;  1BA0 A;  4JK9 A;  4IOA L;  3CER A;  4U7B A;  1HX1 A;  3QBX A;  3CCQ N;  3N4P A;  4YOV A;  2E1Y A;  4WFB L;  1VQ9 N;  1YXQ A;  3E66 A;  3SLC A;  5TKW A;  1VQ7 N;  4XH5 A;  4GV6 A;  3LL3 A;  3SMS A;  3R6M A;  3VER A;  3MDQ A;  1NGC A;  1E4G T;  2GWJ A;  3MN5 A;  5AR0 A;  1DGK N;  1YIJ N;  3ZEU B;  4JKA A;  3VPZ A;  1X9J A;  4ISF A;  4IWV A;  4JN4 A;  4NLC A;  4A5A A;  5BRD A;  2P9U A;  3CME N;  4YOX A;  1P8Z A;  2FXU A;  3Q7C A;  2GEM A;  5FPE A;  4A57 A;  2VGN A;  3CF5 L;  3DXM B;  1MWM A;  3KHY A;  1ATN A;  3U9Z A;  3FR0 A;  1DT9 A;  2HF4 A;  2QWQ A;  3E9P A;  3EL2 A;  5AQZ A;  3U9D A;  2QI2 A;  3EKU A;  1J6Z A;  2HBK A;  3NVM A;  4BC4 A;  4C23 A;  3G4S N;  1TYQ A;  5EVZ A;  3OA9 A;  4CD3 A;  1NGA A;  3LDO A;  3CJ9 A;  3QB0 A;  4DQ8 A;  5EY4 A;  1W2B M;  1DEJ A;  3AY9 A;  1U2V A;  4IJA A;  1K8A O;  1HUX A;  2A40 A;  3CCR N;  1LCU A;  1YVN A;  2KLA A;  3R1X A;  3DWL A;  2ZJR L;  3CHW A;  1YAG A;  1U2V B;  3KWG A;  1XQS C;  2I7P A;  4WYB A;  5AQN A;  4IOC L;  1GLA G;  3QFU A;  4JKF A;  3RSE A;  3MX5 A;  2YHW A;  1V4S A;  3CQY A;  1GLC G;  2QWN A;  3OBY A;  4JNE A;  3EE9 A;  3K9J A;  3VOV A;  3WUH A;  4DKW A;  2I7N A;  2Q36 A;  1ZXO A;  4B9Q A;  2VWB A;  4WQ5 A;  4BRF A;  4H5N A;  1D4X A;  2JWL A;  1HPM A;  4FWR A;  4H5T A;  5ELZ A;  1QQM A;  3WXI A;  1Z05 A;  1X3N A;  4K25 A;  4BRO A;  2QWL A;  4FWO A;  4AM7 A;  3HOS A;  3H45 C;  1YF5 L;  5BN9 A;  3WXM B;  4ILJ A;  4BRD A;  4CZH A;  1XC3 A;  5AQV A;  5CE3 A;  4CJ7 A;  2FSJ A;  2QA4 N;  3NVK A;  2V52 B;  2YJF A;  3WQU A;  1U6Z A;  3D2F A;  4IOX A;  1MA9 B;  1TYQ B;  3C6A A;  5AQH A;  3L4I A;  3VGK A;  1NGJ A;  2QW9 A;  3O5B A;  1NM1 A;  2A5X A;  4BVO A;  2WC9 A;  3A8Y A;  4JKD A;  4H5W A;  3VTH A;  3SAG A;  2CH6 A;  4FWN A;  3ZET A;  5KPT A;  1YHQ N;  2P9N B;  5GIO A;  3WT0 A;  4PL8 A;  4BR2 A;  3FGU A;  1HKC A;  4GNI A;  5AQF A;  3TTF A;  4CZK A;  5BN8 A;  4YOW A;  3O9T A;  2KKZ A;  3GBT A;  3ZYY X;  3ZEU A;  2PAV A;  2HBM A;  2FSN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...