4BVPA

Legionella pneumophila ntpdase1 crystal form ii (closed) in complex with heptamolybdate and octamolybdate
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
365
structure length
365
Chain Sequence
NPCEKHSCIAVIDAGSTGSRLHIYSYDTDDTNTPIHIEEIWNKKIKPGFASIQPNSVTIDAYLTMLLADAPIHNIPVYFYATAGMRLLPQSQQKKYYDELDYWFRQQSQWQLVEAKTITGNDEALFDWLAVNYKLDTLKSVQNKSVGVMDMGGASVQIVFPMPKNAEISKHNQVELNIYGQNINLYVHSFLGLGQTEMSHQFLNSPSCFANDYPLPDGESGQGNAPSCKEEVTSLMNSVHKVNQQIQPLLALNPVNEWYSIGGISNLASSQLFHFENSELTNQSLLQQGDNQICHQQWDILNGQYPDDEYLYQYCLLSSYYYALMVDGYGINPNQTIHYIPPEQNLDWTIGVVLHRALEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ECTONUCLEOSIDE TRIPHOSPHATE DIPHOSPHOHYDROLASE I
publication title Structures of Legionella Pneumophila Ntpdase1 in Complex with Polyoxometallates.
pubmed doi rcsb
source organism Legionella pneumophila
molecule tags Hydrolase
total genus 124
structure length 365
sequence length 365
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-06-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01150 GDA1_CD39 GDA1/CD39 (nucleoside phosphatase) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4bvpA01
3.30.420.150 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Exopolyphosphatase. Domain 2 4bvpA02
5AQHA 2F9WA 3EZWA 5AFUH 3BF1A 1BWFO 2GWKA 3H3OB 2QWOA 2A6AA 5EXWA 1ATRA 4HWIA 3VEZA 2A41A 1YVNA 3BF3A 3MCPA 4PKGA 1HKBA 4FWQA 1GLFO 2P9KB 4FPAA 3D7EO 4FWRA 1T6DA 2ZF5O 3LDPA 5AQFA 4EFHA 5KPZA 4RWTA 3AAQA 3OHRA 3FZMA 1GLCG 2YHWA 4Y0WA 2QWLA 3SMPA 1NGCA 5BPNA 1V4SA 1Q18A 2CGJA 3CJBA 5EY4A 1SQKA 1MWKA 1K8KB 3ZX3A 1JCEA 2ASOA 2CH6A 3ZX0A 4BGBA 4XH5A 2DPNA 2HF4A 3O1BA 3QDKA 2ITMA 4B1VA 2F9TA 5FPEA 3UKUB 3D2FA 1X3MA 3QFUA 2GUPA 3MDQA 3LDLA 3DXKA 1XQSC 5AQPA 2FF3B 3VGKA 3BEXA 3U9ZA 1QZ6A 4JHDA 3QMLA 2P9SA 3UB5A 4FL9A 5AZJB 5AQMA 3VEWA 3WQUA 2NRHA 3A0IX 3LDNA 4EHUA 4O5FA 4H0XB 3LM9A 1YXQA 4B1ZA 3L4IA 4DQ8A 4BC2A 2Q0UA 3VETA 2E8AA 2PBDA 4BC3A 1NGAA 4CZJA 3LDOA 2VYPA 4K41A 3DJCA 4MO4A 3S41A 2I7NA 2UYTA 3D2EA 4CJ7A 5BPMA 3UKRA 1ZXOA 2A40A 2P9LA 3VESA 2NLXA 4BR9A 4I6MB 3C0BA 3EN9A 3A5OC 3ATVA 4FOIA 5AZIA 4B1XB 3GBTA 2GEMA 4CD3A 1NGBA 3QBWA 4H0PA 3D2FB 3C7NA 1BUPA 1Z6RA 3DXKB 4FSVA 4BRKA 3CQXA 1BO5O 2P9NA 4NO7A 4MLEA 3KVGA 5KPTA 2P9SB 3HM8A 4BQLA 4IXCA 4KBOA 3U4LA 3I33A 3CI5A 3ULEA 4E1JA 1E4GT 3DWLA 3ZEUA 5AQIA 4BR0A 4FPBA 4B1WB 1BA1A 1KXPA 2E2OA 4B1YB 4FWKA 1YAGA 1EQYA 3AAPA 3VPZA 3O80A 2IVPA 1T44A 4AM7A 1P8ZA 3FZLA 4BC4A 1QZ5A 2YI1A 1J6ZA 4YDUC 2HMPA 3G25A 2A42A 2ZGYA 3MMVA 5AZIB 1LCUA 5AFUA 4CZGA 1U2VB 2E2PA 4BRHA 4H5VA 4CZHA 3HTVA 5E26A 5FPDA 3SK3A 1RGIA 3BP8A 1BDGA 5JMVA 4PL8A 4QS7A 3P4IA 4IJNA 4MO5A 1TYQB 2W40A 3IUCA 5AQXA 4A61A 3QICA 2WUSA 4LC9B 3WT0A 1TUYA 1SZ2A 1JCGA 1NLVA 2Q97A 1NBWA 5AQNA 3I8BA 3UKUA 1NWKA 1WUAA 4BVPA 1DEJA 4WQ4A 5AR0A 1G99A 2ZWHA 1BA0A 3MN9A 1GLBG 1BOTO 4WYBA 3AY9A 3LM2A 3CJAA 5AZJA 2GTDA 1NGHA 1HKGA 4IWVA 1QHAA 5BR9A 1XUPO 4RTFD 4AM6A 2BUPA 4C23A 1HUXA 4H5TA 1ATNA 4BRPA 3ZETB 3FZKA 5JICA 1C0GA 3A5MC 4H03B 3WXLA 3FGUA 1X9JA 4I6MA 1IJJA 2J4RA 5BRFA 4DCHA 3FLCO 2QWRA 3MN7A 1NGGA 3H3NO 5AQKA 2ASMA 2E2NA 4H0VB 5KQDA 5JLHA 3DXMA 2HOEA 3WEEA 2Q1NA 1HX1A 1LOTB 4IZ9A 4BRLA 3VF2A 1R59O 2W41A 4BVOA 3L6QA 3GDQA 4JN4A 1OKJA 3TU5A 4PKIA 2H3GX 4XEIA 3VENA 3ID8A 5AQZA 1YUWA 2KHOA 3MK6A 3O4WA 3AARA 3ENHA 5KQ8A 3HZ6A 5ADXH 2OANA 3EL2A 4ISGA 1GLLO 2ASPA 5AQJA 3IFRA 4BGAA 4CZEA 3QFPA 3HI0A 5LY3A 5B8HA 5JLFA 2QW9A 1NGEA 4FOEA 4H5RA 3MN5A 4GY2B 1JCFA 1U2VA 3A5LC 3VEOA 5AQLA 3DXMB 3WEEB 4HTLA 4CBWA 2P9UB 2YJEA 3FZFA 1TYQA 3JXUA 3VEVA 3WXJA 4BR7A 4BRMA 1IG8A 1NGIA 1U6ZA 4CI6A 3RSEB 1NGJA 3VEXA 5KPRA 1NGDA 4WQ5C 3DAWA 5F2RA 3B8AX 4IO8A 2Q31A 2FF6A 1QQMA 2V51B 3VOVA 4DHYA 2CGKA 3O8MA 1HPMA 2NZTA 4CBXA 1CZAN 2A3ZA 3F9MA 4EAHD 3L0QA 4BROA 1DKGD 4FWNA 5BREA 3O1WA 4CZIA 3IMXA 3SMSA 3VGLA 4EIAA 2QM1A 5BRDA 1D4XA 4K43A 3SJHA 2E20A 2V7YA 2YHXA 3A5NC 5EVZA 4DB3A 4A62A 3ZETA 5E84A 4Z94A 1ESVA 4JD2A 3MN6A 2VWBA 5LJVA 3TPQA 5FPNA 2AP1A 4JAXA 1WOQA 2A5XA 4L3QA 2FXUA 1QQNA 2E2QA 4CZMA 4EHTA 3CHWA 2QWQA 3CETA 4QS8A 1BG3A 4BR5A 5F0XA 4BC5A 4O8KA 4H5WA 3UE5A 2I7PA 3CERA 2ZGZA 2FLOA 3H45C 1KAXA 5BN9A 4RCHA 2IIRA 3O6WA 1HLUA 4B9QA 1HJOA 2E1YA 4MLHA 1SAZA 2HF3A 4M63C 4M7XA 3FFKB 4ISFA 4YDUA 3HSCA 3VF4A 2VCPA 5LJWA 4BRNA 4JD2B 5AQQA 4F9OA 4BRIA 5F1XA 3CJ9A 4BR4A 4ISEA 5AQRA 4BQZA 4BRCA 3GOIA 2P9PA 3U9DA 4FWPA 4A2AA 1BU6O 1XC3A 4M7YA 4FO0A 1Z05A 4FWOA 3QBXA 4H0YB 2YHYA 5ADXA 1GLJO 1ATSA 4XH1A 5BPLA 5AQGA 2BTFA 2P9UA 5AQSA 4BRGA 3M6GA 1NM1A 3ZX2A 2AA4A 2GWJA 4H0OA 3EKUA 2YCHA 3RSEA 5TKYA 3H6EA 2IVNA 4PL7A 3O5BA 4CD1A 3BUZB 3WXIA 3LL3A 3LDQA 4A2BA 3CJCA 3VERA 3O08A 2IVOA 5AQVA 2E88A 2QXLA 2QWPA 3FZHA 1QQOA 3WUHA 1X3NA 1E4FT 3M3ZA 1S3XA 2FSKA 1MA9B 4H5NA 3GG4A 2P9PB 2FSNA 1ZBSA 3CQYA 5AQWA 1DGKN 1GLAG 2Q36A 3FR0A 2V52B 5AQYA 1GLEG 3EKSA 4BRFA 1H1VA 3ATUA 4CZFA 4BRAA 3CJ1A 2D0PA 3KZBA 1Y64A 4PKHA 2P9IA 2QWNA 2Q0RA 5AQUA 1KAYA 3W0LA 3R9PA 1V4TA 4GNIA 3ENOA 2FSJA 3CJ7A 2CH5A 4BG8A 1HKCA 4K25A 3CIPA 5EOYA 4BG9A 3VEYA 3KHYA 3EO3A 2QWMA 3H46O 2EWSA 3GE1A 3H1VX 2D0OA 4BR2A 4BREA 4JHDB 4CZLA 3U8XA 2Q2RA 4WQ4C 4B1UB 4J8FA 5ELZA 3J8AA 4BRQA 3WXKA 1NGFA 1NMDA 3JS6A 2E1ZA 3GL1A 1GLDG 1MWMA 1S22A 5AQTA 3VF6A 3W3DA 5BN8A 4JNEA 4CZKA 1RDWX 5EX5A 1MDUB 1ZC6A 3R8EA 3HBTA 1T6CA 3D2EB 4XH4A 1C0FA 4BRDA 2P9IB 3UKRB 2P9LB 2P9KA 4CBUA 2D4WA 4NB4A 1TUUA 2PAVA 4H0TB 2YJFA 3WQTA 4K42A 4FWLA 5I9EB 4WQ5A 1RFQA 3SLCA 3C7NB 3QB0A 4IJAA 5BRHA 5FPMA 4FWSA 4FWMA 3R6MA 5AQOA 3VGMA 2CGLA 2D1KA 2GELA 2P9NB 1K8KA 4QS9A 2V7ZA 3H1QA 3A8YA 3IDHA 5CE3A 3M1FA 3ULEB 1KAZA 3FE1A 3ZEUB
chains in the Genus database with same CATH superfamily
3SUPA 1EETA 2QKBA 3K5MA 4CJSA 3MXMA 3TR8A 2AJQA 2JGUA 5EXWA 5CZ2A 3K59A 3U3YA 1T8EA 4GVEA 1UA0A 3MCPA 2QA4N 3C94A 4X62K 4CEQA 3D7EO 2YNGA 3NGIA 4CHPA 1TKZA 4IOAL 1MU2A 4Y0WA 1RT4A 1NGCA 4CGDA 3MEEA 3CMAN 1T3VA 3RMDA 4ZTFA 3HPHA 1J5OA 1MWKA 4PUOA 2FBYA 2ASOA 2CH6A 4O4GA 1VQ4N 1S9EA 1VSMA 4BGBA 4XH5A 4EZ9A 2HF4A 3O1BA 3QDKA 3THWB 1VQPN 3AVAA 3MDQA 4J2AA 3LDLA 5AQPA 3VGKA 3OYGA 3K5LA 1TK0A 1WBBA 4B9VA 2RHKA 1X9WA 3ZSXA 4FJ9A 5AZJB 4EHUA 1ASUA 3V6DA 2NRHA 3A0IX 3DOLA 4H0XB 1EO1A 3KK3A 3AVKA 5MLCQ 4NXMK 1YXQA 4B1ZA 4DQ8A 4E1MA 4BC2A 3U6FA 3HYFA 5HRNA 3OYJA 3SCXA 5HOOA 1SKWA 4BC3A 2G8KA 4K41A 3DJCA 4N76A 5HP1A 3L4QA 3NF8A 2I7NA 3D2EA 5BPMA 2P9LA 4M3UA 4B9UA 2Q3SA 3VQ7A 3EN9A 4PWDA 4FOIA 2HHWA 4NYNA 3NH0A 2OPRA 1BUPA 1VSHA 3DXKB 1VQMN 1L3SA 1N32K 4DLEA 5GAGP 2P9SB 4F2SA 1OH8A 3E9OA 3CFOA 4Z4CA 4FLUA 4M3XA 1NJWA 3AVLA 4B1YB 3PY8A 3DRPA 5C25A 1EQYA 3AAPA 1OH6A 3O80A 5I3UA 4BC4A 1IKYA 2YI1A 2VWKA 4DTRA 2EX3A 4QCLA 3NGYA 3L2QA 1J6ZA 2A42A 2ZGYA 2D0BA 2IAJA 4Q0BA 4CF2A 4MDAA 4KTWA 4FJ5A 4CZGA 4OGEA 4BRHA 4H5VA 4CZHA 5E26A 2Z1JA 4PQUA 3D6RA 2WBNA 4QS7A 4MO5A 2YX6A 3L2VA 4FM1A 1SZ2A 1NWKA 2O8EB 4BVPA 4M3WA 3O4QA 4PHTX 2HVHA 3KWIA 3ZCMA 3CJAA 4ZHRA 3L3UA 1BGXT 3AVFA 4W5TA 4IWVA 1QHAA 1FKPA 3OYHA 4YFUA 3VQBA 3TAMA 1XUPO 4LFCK 4H4OA 4CFAA 2B4JA 5CZ1A 4B08A 1JLCA 1GOBA 3I55N 3FGUA 4I6MA 3ZSWA 1WNSA 3V9ZA 3CCVN 4FJ8A 5BRFA 4DCHA 3L2RA 3CC4N 3MN7A 3ZT1A 2O4GA 5AQKA 4HVJA 4H0VB 4L8RB 1HJRA 4FJ7A 3SUOA 1LOTB 1W7AA 3P39A 4BY9C 1S72N 4BVOA 3CFPA 1G15A 2KW4A 2E6LA 3RVCA 3VENA 3ID8A 3THVA 4DSEA 1EKEA 4DSLA 2XY8A 3MK6A 3MX2A 3O4NA 3O4WA 3AARA 3ENHA 5ADXH 4ISGA 1U49A 1GLLO 2ASPA 2OPSA 1VSIA 4B3OA 2O8FB 3LPUA 4M3RA 3NE6A 4ILHA 1RTDA 2HHTA 4H5RA 3MN5A 2OTJN 3T1AA 4DU1A 1XMOK 3A5LC 2RN2A 3VEOA 4LF8K 4XIUA 3LAMA 3WEEB 4FJGA 4HTLA 2P5OA 4CBWA 1NK8A 3WXJA 1WSFA 1U6ZA 3RSEB 1HRHA 3DAWA 1BI4B 4IO8A 1HNWK 1QQMA 1NOYA 3ZSVA 2XO7A 1LWCA 4IBNA 4RW7A 4ID5A 3WNFA 4NXNK 1D9DA 4WCEL 4BROA 4C1NK 4EP5A 4FJIA 5BREA 3IMXA 3RR8A 4EIAA 1HMVA 2QM1A 3MWPA 3M5RA 2E20A 2HB5A 3A5NC 3S3MA 3ZETA 5E84A 4Z94A 4RW8A 5J2QA 3MN6A 4YOWA 2BANA 5LJVA 2D0AA 5FPNA 4JAXA 2A5XA 4L3QA 1VSLA 4CHZA 5KGWA 4IFYA 3EE9A 2NRWA 3DRSA 4AILC 5D3GA 1NK4A 4BR5A 2PFUA 3V1QA 4BC5A 4H5WA 5M1QA 2I7PA 4CJ4A 4DR7K 1WSJA 4LD0A 5E41A 3H45C 4FLZA 3OBYA 1Q9YA 2IIRA 1Y97A 1RTIA 2E1YA 1N8RO 4MLHA 2Y1JA 3HP9A 2JWKA 4OPAA 4YDUA 1ZBUA 4F8RA 1RT7A 4QAGA 5DMRA 4K8ZA 1VQLN 4BRNA 4JD2B 3QESA 4LFAK 4ISEA 2OTLN 2OZMA 2BE2A 4JI0K 1JLFA 2P9PA 3C95A 1JLQA 4FWPA 1BU6O 4YNQA 4JS4A 1XC3A 2VQEK 2G8IA 5C24A 2F7TA 4DUYK 2YHYA 1BCMA 5ADXA 1TL1A 4G1QA 1ATSA 5BPLA 3HVTA 5AQGA 4DSIA 1FXXA 4LH5A 5AQSA 4DTSA 2AA4A 4YOXA 1W2BM 4CJPA 2IVNA 2GBZA 3K58A 4E7KA 4PL7A 4HUEA 1Q86O 4CD1A 4DQIA 3WXIA 2BGGA 3VTIA 3O08A 3E1YA 1B9DA 1RT2A 2ZM6K 1WSEA 1QQOA 5C15A 4DMNA 4GKJK 5BR8K 2P51A 4BE2A 1HNXK 4H5NA 4F4KA 4JKAA 3GG4A 1SL1A 2FSNA 4JKGA 3C6TA 4M3ZA 2NUBA 3ULDA 3FR0A 1GLEG 1GOAA 4Z4HA 4CZFA 1CXQA 3TAEA 3DM2A 4JK8A 3NBPA 4FZYA 2P9IA 2QWNA 3M8PA 3PV8A 1V4TA 3QNOA 2CH5A 4B3SK 3PSIA 4K25A 4CESA 5EOYA 3D45A 3VEYA 2QWMA 3GE1A 3HK2A 3H1VX 1N34K 4BREA 2NRXA 3ALYA 3QO9A 4JI3K 1VQ6N 1SS6A 5SZTA 2Q2RA 3B6OA 4B1UB 3ZLJA 3QIOA 3RR7A 4Z4GA 1SUQA 1UOCA 4IO9L 3W3DA 5BN8A 5EX5A 3OJUA 1ZC6A 1JL2A 1T6CA 4XH4A 3UKRB 5HRRA 4WFNL 1WSIA 4CBUA 3V81A 3SPYA 5FLXO 1T03A 1IV0A 3I0RA 4WQ5A 1J9AA 2GX9A 3C7NB 3QB0A 1UA1A 2UUBK 4FWSA 3PUFA 1A5XA 1QVFM 3R6MA 4A57A 2GELA 4ILJA 4FJNA 4AHCA 3ZSQA 2HBLA 3H1QA 4JKHA 3EY1A 5CE3A 5GADP 3LP3A 3M1FA 3THWA 5AQHA 2F9WA 5K14A 3MEGA 4U67L 2GWKA 3V1OA 2QWOA 2A6AA 1X9SA 4J2DA 4NLBA 3WXMB 4CJUA 4Z4FA 3HT3A 4Z0UA 4CF0A 3QEIA 4C1NI 1HKBA 1S1XA 4FWQA 3O3HA 4RWTA 1T6DA 2ZF5O 2YNHA 3DYAA 3LDPA 5KPZA 3VQQA 3AAQA 3AO5A 3QERA 3KKSA 1RDCA 3DOKA 4NYFA 1GLCG 3SQ0A 3DLBA 4FYDA 1ILYA 4Z4IA 3CCLN 2G8FA 3NH2A 2CGJA 2IS3A 3QEWA 1RDBA 2KZMA 1SQKA 1P90A 3SBTA 4CJQA 3VQCA 1D8YA 3L3VA 3V9WA 1VRTA 1U47A 2G8VA 1VQON 4OVLA 2ITMA 5FPEA 3UKUB 4M45A 4DQPA 2DFEA 3H08A 3DXKA 1XQSC 4X64K 2FF3B 3BEXA 3M8QA 4CJ5A 5GIPA 2P9SA 5FRMA 4DQSA 4CECA 5CHIA 4BACA 4I2QA 3KK7A 2ITGA 3BZCA 3K2PA 5AQMA 3VEWA 4JKCA 3L4IA 5JVGL 2E8AA 4JS5A 1NGAA 1Z26A 4CZJA 1S6PA 3LDOA 4MO4A 3OYMA 1VRUA 1N6QA 2RF2A 3THXB 2XHBA 1TAUA 2A40A 2X74A 4RW9A 3U3GA 3A5OC 1U04A 1NGBA 3QBWA 4FLWA 3QNNA 4CEDA 1Z6RA 4OPHA 4FSVA 3RMAA 4I2PA 3OS1A 2P9NA 3JAMO 3KVGA 4O0IA 4N5SA 3HM8A 4BQLA 1JL1A 3PIPL 1JLEA 1C0MA 3VQEA 3BGRA 3CI5A 3I33A 1N36K 4KTQA 3DWLA 4BR0A 1BA1A 2O8EA 1LWEA 1KVAA 5KRTA 4N47A 4W5NA 1YAGA 4KRFA 4WE1A 3TAFA 4HUFA 1T44A 1J54A 3FZLA 3NF6A 4YDUC 4DV5K 4LF4K 2HMPA 1DTQA 3MXIA 3AA3A 4A5AA 2HW3A 3NMUA 4CFDA 3ZSOA 1RBVA 3HTVA 4DTUA 2G8HA 1BDGA 5JMVA 3P4IA 1TYQB 4JKEA 3HOSA 2WUSA 3WT0A 1IBKK 5AQNA 3I8BA 3SAFA 1J53A 1DEJA 5FRNA 4WQ4A 3SUQA 1FW6A 3O9RA 3T19A 3I0SA 1GLBG 1DTTA 4WYBA 4A59A 3ZT4A 3CF5L 2ATQA 3DMJA 1HKGA 4LFBK 2X78A 4CGFA 2O8BB 4C23A 1JKHA 2BUPA 4BE0A 4DFKA 4NCAA 4H5TA 4DKWA 1ATNA 5HL7L 3TABA 1U48A 4CEFA 1KCFA 4H8KA 3FZKA 3AO2A 3AGKA 3A5MC 3WXLA 1CZBA 4KO0A 5KRSA 2EHGA 2PYLA 2O8FA 3CQ8A 3FLCO 4FJKA 4DV1K 4FK0A 5KGXA 3WEEA 4JI1K 2Q1NA 4I9LA 1HX1A 2W41A 3MCAB 4DSJA 4CEEA 1BISA 4JN4A 3TU5A 4PKIA 2H3GX 1BI4A 3F5TA 2X6NA 1TK5A 3MWTA 4B9LA 5CY4A 5KQ8A 3SAGA 2OANA 1Q81O 3EL2A 1NK9A 1WAFA 1BL3A 2XRIA 1NK0A 5JLFA 1U45A 2W42A 3O3FA 3C65A 2QW9A 4FOEA 4KHSA 3SYZA 1HNVA 1JCFA 1U2VA 1T05A 1Q7YO 4CGHA 3BY5A 1QSLA 2P9UB 3NF9A 3FZFA 4KFBA 3VEVA 3JXUA 1YF5L 4CI6A 4B8CA 4GW6A 4LSLA 3VEXA 3TAPA 1NGDA 4WQ5C 3CPEA 3OYAA 2IC3A 1VSFA 2Q31A 4LF7K 2FF6A 1IKVA 4DHYA 4J2EA 2NZTA 3MEDA 1CZAN 1BQNA 3SV4A 3KLIA 3L0QA 3E66A 3O9QA 2UXCK 4KH6A 3QIPA 3SMSA 3VGLA 5BRDA 3THYB 3SJHA 5JS2A 3HO1A 2YHXA 3EE8A 4DB3A 2HHVA 3AVNA 1WSHA 4JD2A 1WOQA 2HNZA 4LF9K 1QQNA 2E2QA 2IOCA 3HSTB 4CZMA 2ETJA 2QWQA 4DLGA 2D0CA 4DTNA 4Q5VA 1RT5A 3A2FA 3OYEA 4FW2A 4ZTJA 2VQFK 4HTUA 2ZGZA 4IDHA 2FLOA 4KHUA 1KAXA 5BN9A 1CXUA 4EP4A 1VSDA 3O6WA 3P83D 1HLUA 4B9QA 1HJOA 4IOCL 2Y1IA 1YTUA 1SAZA 2HBJA 4JEPA 4M7XA 4ISFA 3ZT3A 4FLVA 3LP2A 2VCPA 5LJWA 3CCRN 2VG5A 1XMQK 1A5WA 4BRIA 5F1XA 4BR4A 1RILA 5A2QO 4BQZA 4BRCA 4CGGA 3K9JA 3OYBA 4DF4A 3CCMN 4AQYK 3KTQA 4M7YA 3LWLA 4JRQA 3ITHA 4FO0A 1Z05A 3LANA 3QBXA 1LV5A 2DY4A 3M6GA 3ZX2A 3EKUA 3IG1A 5TKYA 4GV6A 2XY5A 1C1AA 4DR6K 3LL3A 3LDQA 4A2BA 3VN5A 3VERA 2VG7A 4DV4K 2IVOA 3ISNC 5AQVA 3RMCA 4CVNE 1E4FT 2RKIA 3M3ZA 3CCEN 1S3XA 2FSKA 1SKSA 3LZIA 4KI6A 1ZBSA 4CCHA 1DGKN 4FLTA 2UXBK 3KK1A 1REVA 1VSKA 5LL6Z 4BDYA 4CJVA 4OLBA 1XWLA 4DV6K 1GOCA 3KZBA 1Y64A 3G6EN 2YHBA 4GNIA 1HNIA 3ENOA 2PYJA 1HKCA 3DLEA 4IEEA 1YITN 4CE9A 1NK7A 3H46O 2NRTA 4OPJA 2A1SA 3NH1A 4BR2A 4KB0A 1RTJA 4X66K 3L2UA 1NJYA 1YJ9N 4CJTA 4X65K 4WQ4C 4J8FA 4CIGA 3DLKA 4BRQA 1F21A 3MX5A 4E7JA 1NMDA 1NKBA 2E1ZA 3GL1A 3VF6A 4YOYA 4DUZK 4JNEA 3RWUA 1MDUB 3R8EA 3HBTA 3D2EB 5C2DA 4BRDA 4BE1A 5C2FA 2P9LB 3M8RA 3VA0A 4CHQA 4DFPA 3QINA 3OYDA 1TUUA 2YJFA 3J7AP 3OBWA 3VQ9A 3SJJA 3T69A 2ZE2A 4IOXA 4IJAA 4OPKA 5BRHA 2B6AA 4OKEA 5AQOA 4C8LA 2CGLA 2D1KA 4AH9A 2OPPA 4QS9A 1S1VA 2KFZA 1E3MA 3A8YA 4E7IA 1NMNA 2ZD1A 2WTUA 3IUCA 4JI4K 3FE1A 5KI6A 3EZWA 3BF1A 3R1XA 1D9FA 3K5OA 1HYSA 4HWIA 3VEZA 1YVNA 2YNIA 4PKGA 4DTJA 4K8XA 4J2BA 4KPYA 1GLFO 5M1KA 4FWRA 5AQFA 3SAHA 3HL8A 1LW0A 4PA1A 4AHUA 2G8WA 3FZMA 2YHWA 2QWLA 1OH7A 4JI5K 1HYZA 5BPNA 1O13A 1JLGA 1L3TA 3RMBA 3T1HK 3OVNA 3ZX0A 3ZX3A 3Q7CA 4U7BA 3HPOA 3S3NA 4B1VA 2F9TA 1HQEA 4FJXA 3AVHA 1TKXA 3QFUA 4O8UA 4JI7K 1Z25A 3U9ZA 1B9FA 1QZ6A 4B9SA 4JHDA 4C8NA 4CHNA 2O8CA 1U4BA 4FXDA 5J2PA 4FL9A 3LDNA 4M3TA 4O5FA 5HLFA 3HJFA 3T3FA 3LM9A 1TAQA 2HHHK 1I3AA 2Q0UA 2PBDA 3PX6A 4DV0K 3EEQA 2UYTA 4E89A 3KWGA 3NVKA 3VESA 4E19A 2OZSA 1NNEA 4BR9A 4I6MB 4IG3A 1KC8O 4N41A 3ATVA 1VQ8N 4B1XB 3CCSN 3GBTA 3TAQA 1QQCA 4H0PA 3D2FB 3IAYA 4NCBA 4IDKA 4BRKA 3CQXA 1IKWA 4NO7A 3NCIA 1RDUA 5FDLA 5SWMA 2GV9A 5KPTA 1IO2A 5AJ3K 4KBOA 4E1JA 2O8DB 3ULEA 1VQNN 1E4GT 3ZEUA 5AQIA 4HCCA 2D5RA 4FPBA 3CPWM 5HBMA 2E2OA 3SPZA 4FVUA 4FWKA 1W0HA 4MFBA 3VPZA 1RBRA 2IVPA 3LALA 2NNWA 4JKBA 3HXMA 1QZ5A 3F73A 3G25A 3G4SN 1C0UA 5AZIB 3KIOA 4GV9A 3MECA 4GKKK 3V1RA 3NHGA 2HHSA 2E2PA 1VSEA 5FPDA 3SK3A 1RGIA 3BP8A 3JYTA 4PL8A 4KHNA 3KLHA 4IJNA 2W40A 4A61A 3VQ4A 1L3UA 3OW2M 1TUYA 1QVGM 1JCGA 2Q97A 4HHTA 1NBWA 1HQUA 4CJEA 1WUAA 1XC9A 1G99A 1BA0A 3MN9A 1R0AA 4JKDA 1BOTO 4JI6K 1KFDA 1VHXA 4DTPA 3J81O 2HHXA 5AZJA 2GTDA 1K73O 2ZJRL 1XNRK 5BR9A 4FM0A 5J1EA 4RTFD 4DU4A 1HUXA 2VWJA 1YVUA 3ZETB 3SQ2A 4DSKA 1RBUA 1C0GA 4H03B 3CCUN 1C1BA 1HNZK 4FW1A 3UIQA 3O9UA 1IJJA 1C6VA 4AHRA 1OVYA 4CHYA 2QWRA 3R3LA 1NGGA 3H3NO 2ASMA 3IKMA 5KQDA 4IZ9A 3TSPA 4BRLA 1R59O 3KLGA 3L6QA 3CXCM 1OKJA 4XEIA 5AQZA 1K9MO 2UUCK 1RT1A 4ID1A 1JXEA 4OGCA 4GV3A 3HZ6A 1VAZA 1BCOA 1TK8A 1RT3A 3EYZA 5JS1A 2Z1HA 3IFRA 4CZEA 4DV2K 5LY3A 1D5AA 1KVBA 4Y1DA 1YT3A 1DLOA 4GY2B 4DG1A 5J2MA 5FROA 4JK7A 3DXMB 3ZT2A 2YJEA 3AV9A 5HROA 3ENBA 4BRMA 1IG8A 1NGIA 2HMIA 3KJVA 1NJZA 1NGJA 4R5PA 3SV3A 4ELVA 4RG8A 5F2RA 3B8AX 4B8AB 5DM7L 4DF8A 4KKOA 4ELUA 1XNQK 1HYVA 4I7FA 4TSXA 3OJSA 1BQMA 2NRZA 3VOVA 4C8MA 3O8MA 3G0ZA 3I56N 1KQSM 3JSMA 4CF8A 4LF5K 3F9MA 2FBXA 3VQ6A 2YHAA 4N56A 3E9PA 1L5UA 2W6LA 2HHQA 4FWNA 4CZIA 3CYMA 4AF1A 4E1NA 4JKGB 3J7ZO 5EVZA 3PLAA 4A62A 4CFCA 4OKJA 1NKCA 1ESVA 1S9GA 2VWBA 3TPQA 4O5BA 2AP1A 1WN7A 3SI6A 2E5LK 4EHTA 3CHWA 1BG3A 3TARA 4CJWA 3VQDA 5F0XA 4GMJB 4O8KA 4OX9K 1ZBLA 4DV3K 3AO1A 1TKDA 1LAVA 1RBSA 4FM2A 1EWRA 2HF3A 3LPTA 4IEIA 3HSCA 3LP0A 4DR5K 4RW6A 3N4PA 4FLXA 3ZSZA 4F9OA 5AQRA 5C0YA 5GIOA 3CMEN 1Q8IA 3GOIA 4LSNA 3AA4A 1L3VA 4NCGA 3K5NA 3SQ4A 2WONA 4FWOA 3VQPA 3AA2A 1GLJO 4XH1A 2BTFA 4BRGA 1J5EK 3OA9A 1NM1A 2IDOA 2P5GA 3CG7A 3HRGA 3RSEA 4E7LA 3I8DA 3H6EA 3J80O 3CFRA 3RRHA 1VQ7N 3G10A 3LP1A 3O5BA 1M1KO 1BIUA 3CJCA 3TTCA 1FJGK 4YOTA 2IGIA 2E88A 1M90O 2QXLA 2Z1GA 1WAJA 2QWPA 4CJLA 3FZHA 4CERA 3WUHA 1SV5A 5TKWA 1NG9A 4OLAA 3K9KA 3OS2A 1VQKN 3ASMA 1RDDA 2KZZA 2FBTA 3AVMA 2UU9K 3TTFA 1TVRA 3RRGA 1GLAG 4CEAA 3P38A 4KHQA 3NDKA 2Q36A 3NGZA 1QS4A 3FFIA 3ZT0A 2V52B 4FZXC 4CEOA 2HHUA 3ATUA 3TSUA 5HRSA 1OVQA 4BRAA 1S5JA 3P31A 4PKHA 2Q0RA 1KAYA 3W0LA 4FLYA 3OYFA 4A5BA 3ZSRA 4DU3A 4AHSA 2E6MA 1A5VA 1NU0A 3KHYA 3EO3A 3KLEA 1XI1A 2D0OA 4CGIA 2OCEA 4F2RA 4CZLA 4JKFA 1K6YA 1RDAA 4V19S 5ELZA 3J8AA 4DWIA 1ZYQA 3HOTA 3JS6A 3AVCA 4KHYA 1S22A 3VQ5A 3V9SA 4KV8A 4CEBA 1ZBFA 1HPZA 4CZKA 1YHQN 4CF1A 1C0FA 1EWQA 2KLAA 1IBMK 4F3TA 4NB4A 4FJHA 2PAVA 3DLGA 5I9EB 4JRPA 4IFEA 5I42A 4B3MK 5C12A 4FK2A 3Q7BA 4KTZA 5FPMA 3VGMA 2VGNA 2P9NB 2QKKA 3QETA 3PO5A 3IDHA 4KHPK 3KLFA 1KAZA 1LAWA 5CYQA 5AFUH 2G8UA 3CM6A 1BWFO 3H3OB 4O0JA 4JK9A 4DTOA 1ATRA 1LWFA 2A41A 1NOZA 3BF3A 3NFAA 3P5JA 4LH4A 4DR3K 2P9KB 3C6AA 5CR4A 4FPAA 4EFHA 4Y1CA 4JYAK 3OHRA 3E01A 4OJRA 4BDPA 4DFJA 4DQQA 3SMPA 1IKXA 2PZSA 1V4SA 1Q18A 3WNHA 3CJBA 5EY4A 4FCYA 2UXDK 2HBKA 1K8KB 3KKRA 3BDPA 1JCEA 4PY5A 4CIEA 1I94K 2DPNA 2F8SA 1T7PA 2KQ2A 3D2FA 1X3MA 1NJXA 2GUPA 4C8KA 1FK9A 3AO3A 3KD5E 1KSPA 3AVBA 1IG9A 3QMLA 4CK2A 5EU7A 4G9ZA 3UB5A 3V9XA 2O8DA 2OPQA 4BWJA 3WQUA 3V9UA 1WBDA 4DR2K 1CLQA 3J7YP 3AA5X 4CJFA 4C8OA 1SKRA 4CFBA 2W6KA 3VETA 1QSSA 2VYPA 1B92A 5JVHL 1ZBHA 3S41A 4CJ7A 4MQ3A 3UKRA 1NJIO 1ZXOA 2NLXA 2X6SA 3QEXA 3C0BA 1VQ5N 3LAKA 5AZIA 4I9QA 5GAHP 2GEMA 4CD3A 3LWMA 3HM9A 3C7NA 1JXBA 4WFBL 4DTXA 1QHTA 3C6UA 4CEZA 4YY3K 1BO5O 1VSJA 3NF7A 4GVMA 4MLEA 4FJLA 3L8BA 4KH4A 3TTDA 2XY7A 3SZ2A 3DLRA 3VQ8A 4YHHK 4IXCA 3OS0A 3U4LA 4W5OA 3VA3A 3DLLL 4B1WB 1KXPA 1RT6A 4JI2K 4H4MA 3TWHA 3M8SA 1KD1O 2P1JA 4CF9A 2HSTA 4AM7A 1YTAA 5LMUK 2B5JA 1P8ZA 1NK6A 5C42A 5M1FA 5H1SQ 3MMVA 4CJKA 1LCUA 1RBTA 2DTUA 2HNYA 5AFUA 1HR0K 3OY9A 3OYLA 1U2VB 4E3SA 1DT9A 4DFMA 1Q9XA 4YOVA 4ILGB 4ELTA 1KLMA 5LMNK 1SL2A 5AQXA 4M3YA 3QICA 4LC9B 3O9TA 5GINA 3SQ1A 4B3RK 1NLVA 3VMFB 3UKUA 2NRRA 1TV6A 1SL0A 1N33K 4E7HA 5AR0A 2ZWHA 4MDBA 3HVRA 4FJMA 3AY9A 3LM2A 2NRVA 1NGHA 2GUIA 1UAXA 4AHVA 1XHXA 3AVJA 4O55A 4AM6A 3QEPA 4HUGA 3AGRA 2BH1A 4IKFA 3CC2N 4BRPA 3WNEA 4CGJA 5M1OA 5JICA 3THXA 1OH5A 3T1YK 4W5QA 1X9JA 4Z4EA 3AO4A 2J4RA 3LDSA 4K0KK 4M41A 1CZ9A 4B9MA 3S9HA 1RNHA 2E2NA 3E9LA 3PO4A 5JLHA 3DXMA 2HOEA 1KRPA 4BWMA 3G71N 3VF2A 1O1WA 2HNDA 3V4IA 3GDQA 2FC0A 3DLHA 4NLCA 4R79A 4AHTA 1YUWA 2KHOA 1S1TA 3OYNA 4HCBA 2R7YA 3PIOL 1KVCA 3EZ5A 3B6PA 3TAGA 1X9MA 4FVMA 5AQJA 4BGAA 3O3GA 4CW7B 3QFPA 3HI0A 1W9HA 5M1NA 1NGEA 3PX4A 4DQRA 3T7ZA 3HPGA 1N5YA 3DRRA 5AQLA 1TKTA 1RTHA 1TYQA 3LZJA 4FK4A 4OO1J 4JLHA 4BR7A 3TANA 1S6QA 5KPRA 1JJ2M 2KTQA 4B3TK 5KTQA 3O9SA 3F2KA 2ZQBA 2V51B 1VQ9N 1W97L 2CGKA 1HPMA 4CBXA 1TGOA 1NK5A 2A3ZA 1QE1A 1C1CA 4KHWA 2WOMA 4EAHD 4QOZB 2F8TA 2QXFA 1S1UA 2DFHA 5T7BA 1DKGD 2O8BA 3O1WA 2YKNA 3OYCA 4WF9L 4CK3A 1D4XA 2JWLA 2QTDA 4K43A 3SBGA 4DSFA 1EXQA 4DR4K 3IRXA 2V7YA 5IWAK 2PY5A 4FZZA 1WB9A 1BHLA 4CHOA 3OYKA 2RE2A 3QEVA 2FXUA 3S3OA 3PX0A 2HBMA 3CETA 4ICLA 4QS8A 4IFVA 3ZSYA 3D0PA 5CYMA 5DM6L 5IT9O 4JI8K 4KB1A 2KFNA 3UE5A 2F96A 3CERA 2QK9A 3NAEA 2WC9A 3ZYYX 3SNNA 3OYIA 4RCHA 3BZKA 4RW4A 2XY6A 3RTVA 4DV7K 2F4VK 1WLJA 1FKOA 4M63C 2ZJPL 3SUNA 3FFKB 3VF4A 2UUAK 2YNFA 2OYQA 4CK1A 2VGMA 1C0TA 5AQQA 1YI2N 3CJ9A 1IH7A 3KD1E 1KLNA 3AVGA 1X1PA 1RCHA 4WFAL 2JLEA 3U9DA 2E4LA 4A2AA 4B9NA 1ITGA 4H0YB 1I39A 1TL3A 2LSNA 3OTOK 3KK2A 3NVMA 5HRPA 2P9UA 4BDZA 3N4QA 4YORA 4DTMA 2GWJA 4H0OA 2YCHA 1XHZA 2DFFA 4CJRA 1ASWA 2ZJQL 3TSQA 3BUZB 3PSFA 4OKKA 3K57A 3F9KA 1KTQA 1YJNN 4DR1K 4DS4A 4LF6K 2OA8A 4DS5A 1IBLK 2YV0X 1X3NA 5C10A 2BDPA 4LY7A 1MA9B 4KREA 1YIJN 3THYA 1QSYA 2P9PB 3MXJA 5AQWA 3CQYA 2O4IA 3VQAA 4CJ3A 5AQYA 2FBVA 1KFSA 3EKSA 4BRFA 1H1VA 2KKZA 3CJ1A 4E0DA 1Q82O 3CD6N 1S1WA 2D0PA 5AQUA 1JLBA 3R9PA 2FSJA 3CJ7A 1EP4A 3AVIA 4BG8A 1K8AO 1UWBA 2I5JA 2A1RA 3CIPA 4B9TA 3C6HA 4BG9A 3CCQN 1JLAA 1QTMA 2EWSA 3VTHA 3QLHA 3P1GA 3MAQA 3K0SA 1YJWN 3TI0A 3ID6A 4JHDB 4KAZA 4UQGA 2O8CB 5J2NA 3U8XA 4F3OA 1LW2A 3WXKA 1BIZA 3HP6A 1NGFA 1GLDG 1MWMA 5AQTA 1ASVA 3CM5A 1EX4A 5M1PA 2QEXN 1RDWX 3DI6A 4KH5A 4CIFA 4UY8O 2P9IB 2P9KA 2D4WA 4KI4A 4H0TB 4O44A 4M42A 3WQTA 5DK5A 2YKMA 4K42A 4FWLA 4W5RA 1NKEA 4IG0A 5GAEP 4FJJA 2RPIA 1RFQA 3SLCA 1VK0A 3CCJN 2VG6A 3CC7N 1WSGA 4FWMA 1ZBIA 4YOUA 4EZ6A 2QI2A 1K8KA 2V7ZA 3WNGA 3L2WA 2Z1IA 2WFBA 2HVIA 3IS9A 3ULEB 4JV5K 5B8HA 3ZEUB
chains in the Genus database with same CATH topology
5AQHA 2F9WA 3EZWA 5AFUH 3BF1A 3R1XA 4U67L 1BWFO 2GWKA 3H3OB 2QWOA 2A6AA 5EXWA 4NLBA 4JK9A 3WXMB 1ATRA 4HWIA 3VEZA 2A41A 1YVNA 4GVEA 3BF3A 3MCPA 4PKGA 2QA4N 4C1NI 1HKBA 4FWQA 1GLFO 2P9KB 3C6AA 4FPAA 5CR4A 3D7EO 4FWRA 1T6DA 2ZF5O 3LDPA 5AQFA 4EFHA 5KPZA 3SAHA 3AAQA 4RWTA 4IOAL 3OHRA 3FZMA 1GLCG 1ILYA 2YHWA 4Y0WA 2QWLA 3SMPA 1NGCA 5BPNA 3CCLN 1O13A 1Q18A 1V4SA 2CGJA 3CJBA 5EY4A 3CMAN 1T3VA 1SQKA 1P90A 2HBKA 3SBTA 1MWKA 1K8KB 3ZX3A 1JCEA 2ASOA 2CH6A 3Q7CA 3ZX0A 4BGBA 4U7BA 1VQ4N 4XH5A 2DPNA 2HF4A 1VQON 3O1BA 3QDKA 2ITMA 4B1VA 2F9TA 5FPEA 1VQPN 3UKUB 3D2FA 1X3MA 3QFUA 2GUPA 3MDQA 4O8UA 3LDLA 3DXKA 1XQSC 5AQPA 2FF3B 3VGKA 3BEXA 3U9ZA 1QZ6A 5GIPA 4JHDA 3QMLA 2P9SA 2RHKA 4G9ZA 5CHIA 3KK7A 3UB5A 4FL9A 5AZJB 5AQMA 3VEWA 3WQUA 2NRHA 3A0IX 3LDNA 4EHUA 4O5FA 4H0XB 1EO1A 3LM9A 4JKCA 5MLCQ 1YXQA 4B1ZA 3L4IA 4DQ8A 4BC2A 2Q0UA 3VETA 5JVGL 2E8AA 2PBDA 5HOOA 4BC3A 1NGAA 4CZJA 3LDOA 2VYPA 4K41A 3DJCA 4MO4A 5JVHL 3L4QA 3S41A 2I7NA 2UYTA 3D2EA 3KWGA 4CJ7A 5BPMA 3NVKA 3UKRA 1NJIO 1ZXOA 2A40A 2P9LA 3VESA 2NLXA 4BR9A 4I6MB 3C0BA 1KC8O 1VQ5N 3EN9A 3A5OC 3ATVA 4FOIA 5AZIA 1VQ8N 4B1XB 3CCSN 3GBTA 5GAHP 2GEMA 4CD3A 1NGBA 3QBWA 4H0PA 3D2FB 3C7NA 1BUPA 1Z6RA 3DXKB 4OPHA 1VQMN 4WFBL 4FSVA 4BRKA 3CQXA 1BO5O 2P9NA 1RDUA 4NO7A 4MLEA 3KVGA 5GAGP 5KPTA 2P9SB 4KH4A 3TTDA 3HM8A 4BQLA 3PIPL 4IXCA 4KBOA 3U4LA 3I33A 3CI5A 3ULEA 4E1JA 1E4GT 3DLLL 1VQNN 3DWLA 3E9OA 3ZEUA 5AQIA 4BR0A 4FPBA 4B1WB 1BA1A 3CPWM 1KXPA 2E2OA 4B1YB 4FVUA 4FWKA 1YAGA 1KD1O 1EQYA 3AAPA 3VPZA 5M1KA 3O80A 2IVPA 2HSTA 1T44A 2NNWA 4JKBA 4AM7A 1P8ZA 3FZLA 4BC4A 1QZ5A 2YI1A 5M1FA 1J6ZA 4YDUC 2HMPA 3G25A 3G4SN 2A42A 5H1SQ 2ZGYA 3MMVA 5AZIB 1LCUA 4GV9A 4A5AA 4MDAA 5AFUA 3NMUA 4CZGA 1U2VB 2E2PA 4BRHA 4H5VA 4CZHA 1DT9A 3HTVA 5E26A 5FPDA 3SK3A 4YOVA 1RGIA 3BP8A 1BDGA 2WBNA 3D6RA 4ILGB 4PL8A 4QS7A 5JMVA 3P4IA 4IJNA 4MO5A 1TYQB 2W40A 3IUCA 4JKEA 5AQXA 4A61A 3QICA 2WUSA 2YX6A 3O9TA 4LC9B 3WT0A 5GINA 3OW2M 1TUYA 1SZ2A 1QVGM 1JCGA 2Q97A 1NLVA 3VMFB 1NBWA 2NRRA 3I8BA 5AQNA 3UKUA 1NWKA 1WUAA 4BVPA 1DEJA 3SAFA 4WQ4A 5AR0A 1G99A 3O9RA 2ZWHA 4MDBA 4PHTX 1BA0A 3MN9A 1GLBG 4JKDA 1BOTO 4WYBA 3KWIA 3AY9A 3LM2A 2NRVA 3CJAA 4A59A 3CF5L 5AZJA 2GTDA 1NGHA 1HKGA 1K73O 4IWVA 2ZJRL 1QHAA 5BR9A 1XUPO 4RTFD 4AM6A 2BUPA 4C23A 1HUXA 3AGRA 2BH1A 4H5TA 4DKWA 1ATNA 5HL7L 3CC2N 4BRPA 3ZETB 5M1OA 3FZKA 5JICA 3AGKA 3I55N 1C0GA 3A5MC 4H03B 3WXLA 3CCUN 3FGUA 1X9JA 4I6MA 3O9UA 1IJJA 2J4RA 3CCVN 1OVYA 5BRFA 4DCHA 3FLCO 2QWRA 3MN7A 3CC4N 3R3LA 1NGGA 3H3NO 5AQKA 2ASMA 2E2NA 3E9LA 3IKMA 4H0VB 5KQDA 5JLHA 3DXMA 2HOEA 3WEEA 2Q1NA 1HX1A 1LOTB 4IZ9A 3TSPA 3VF2A 4BRLA 1R59O 3G71N 3P39A 4BY9C 2W41A 3MCAB 1S72N 4BVOA 3L6QA 3CXCM 3GDQA 4JN4A 1OKJA 3RVCA 3TU5A 4PKIA 2H3GX 4XEIA 4NLCA 3ID8A 3VENA 3F5TA 5AQZA 4R79A 1YUWA 2KHOA 3MWTA 1K9MO 3MK6A 3MX2A 3PIOL 3O4WA 3AARA 3ENHA 5KQ8A 4GV3A 3HZ6A 5ADXH 1VAZA 3SAGA 2OANA 1Q81O 3EL2A 4ISGA 1GLLO 2ASPA 5AQJA 3IFRA 4BGAA 4CZEA 3QFPA 3HI0A 5LY3A 5B8HA 5JLFA 4ILHA 3C65A 2QW9A 5M1NA 1NGEA 4FOEA 4H5RA 3MN5A 4GY2B 2OTJN 1JCFA 1U2VA 3T7ZA 1Q7YO 4JK7A 3A5LC 3VEOA 5AQLA 3DXMB 3WEEB 4HTLA 4CBWA 2P9UB 2YJEA 3FZFA 1TYQA 3JXUA 1YF5L 3VEVA 3WXJA 4OO1J 3ENBA 4BR7A 4BRMA 1IG8A 1NGIA 1U6ZA 4CI6A 3RSEB 1NGJA 3VEXA 5KPRA 1NGDA 4WQ5C 3CPEA 3DAWA 5F2RA 1JJ2M 3B8AX 5DM7L 4IO8A 3O9SA 3F2KA 2Q31A 2FF6A 1QQMA 2V51B 1VQ9N 1W97L 2NRZA 3VOVA 4DHYA 2CGKA 3O8MA 1HPMA 2NZTA 4CBXA 3I56N 1KQSM 1CZAN 2A3ZA 3F9MA 4EAHD 4WCEL 3L0QA 4BROA 4C1NK 3E66A 3E9PA 3O9QA 4KH6A 1DKGD 4FWNA 5BREA 3O1WA 4CZIA 3IMXA 3SMSA 3VGLA 4EIAA 2QM1A 3MWPA 5BRDA 4WF9L 1D4XA 2JWLA 2QTDA 4K43A 3M5RA 3SBGA 3SJHA 4AF1A 2E20A 4JKGB 3J7ZO 2V7YA 2YHXA 3A5NC 3EE8A 5EVZA 4DB3A 3PLAA 4A62A 3ZETA 5E84A 4Z94A 1ESVA 4JD2A 3MN6A 2VWBA 4YOWA 5LJVA 3TPQA 5FPNA 2RE2A 2AP1A 4JAXA 1WOQA 2A5XA 4L3QA 2FXUA 1QQNA 2E2QA 4CZMA 4EHTA 3CHWA 2NRWA 2QWQA 3EE9A 2HBMA 3CETA 4QS8A 1BG3A 4BR5A 2PFUA 5F0XA 5DM6L 4BC5A 4O8KA 4H5WA 5M1QA 3UE5A 2I7PA 3CERA 2ZGZA 4IDHA 2WC9A 3ZYYX 2FLOA 3H45C 1KAXA 3OBYA 4RCHA 5BN9A 2IIRA 3O6WA 1HLUA 4B9QA 1HJOA 4IOCL 2E1YA 1N8RO 3HOSA 4MLHA 1SAZA 2HF3A 4M63C 4IEIA 2ZJPL 2HBJA 2JWKA 4JEPA 4M7XA 3FFKB 4ISFA 4OPAA 3HSCA 4YDUA 3VF4A 3N4PA 2VGMA 2VCPA 5LJWA 3CCRN 1VQLN 4BRNA 4JD2B 5AQQA 4F9OA 4BRIA 5F1XA 1YI2N 3CJ9A 4BR4A 4ISEA 5AQRA 4BQZA 2OTLN 5C0YA 4BRCA 5GIOA 3CMEN 3GOIA 3K9JA 4WFAL 2P9PA 3U9DA 3CCMN 4FWPA 4A2AA 1BU6O 1XC3A 4M7YA 4FO0A 1Z05A 4FWOA 3QBXA 2F7TA 4H0YB 2YHYA 5ADXA 1GLJO 1ATSA 3NVMA 4XH1A 5AQGA 2BTFA 5BPLA 2P9UA 5AQSA 4BRGA 3M6GA 3OA9A 1NM1A 3N4QA 3ZX2A 3HRGA 2AA4A 2GWJA 4H0OA 3EKUA 2YCHA 4YORA 3RSEA 5TKYA 4YOXA 4GV6A 1W2BM 3H6EA 2IVNA 1VQ7N 4PL7A 1Q86O 2ZJQL 3O5BA 3TSQA 4CD1A 3BUZB 3WXIA 1M1KO 3LL3A 3LDQA 4A2BA 3CJCA 3TTCA 3VERA 3VTIA 4YOTA 3O08A 2IVOA 5AQVA 2E88A 1M90O 2QXLA 3E1YA 1YJNN 2QWPA 3FZHA 1QQOA 3WUHA 5C15A 1X3NA 5TKWA 1E4FT 5C10A 3M3ZA 3K9KA 3CCEN 1S3XA 2FSKA 1MA9B 1VQKN 4H5NA 1YIJN 4JKAA 3GG4A 2P9PB 3TTFA 2FSNA 1ZBSA 3CQYA 4JKGA 5AQWA 1DGKN 1GLAG 3P38A 2Q36A 3FR0A 2V52B 5AQYA 1GLEG 3EKSA 4BRFA 1H1VA 3ATUA 3TSUA 4CZFA 2KKZA 4BRAA 3CJ1A 3CD6N 1Q82O 4JK8A 2D0PA 3KZBA 3P31A 1Y64A 4PKHA 2P9IA 2QWNA 2Q0RA 5AQUA 3G6EN 1KAYA 3W0LA 3R9PA 1V4TA 4GNIA 3ENOA 4A5BA 2FSJA 3CJ7A 2CH5A 4BG8A 1K8AO 1HKCA 4IEEA 1YITN 4K25A 3CIPA 5EOYA 3C6HA 4BG9A 3CCQN 3VEYA 3KHYA 3EO3A 2QWMA 3H46O 2EWSA 2NRTA 3GE1A 3H1VX 3VTHA 1YJWN 2D0OA 4BR2A 4BREA 2NRXA 3ID6A 4JHDB 4CZLA 4JKFA 1YJ9N 1VQ6N 1SS6A 3U8XA 2Q2RA 4WQ4C 4B1UB 4J8FA 5ELZA 3J8AA 4BRQA 3WXKA 1NGFA 3MX5A 1NMDA 3JS6A 3HOTA 2E1ZA 3GL1A 1GLDG 1MWMA 1S22A 5AQTA 3VF6A 4IO9L 4YOYA 3W3DA 5BN8A 4JNEA 5M1PA 4CZKA 1YHQN 1RDWX 5EX5A 2QEXN 1MDUB 4KH5A 1ZC6A 4UY8O 3R8EA 3HBTA 1T6CA 3D2EB 4XH4A 1C0FA 4BRDA 5C2DA 2P9IB 3UKRB 2KLAA 2P9LB 5C2FA 2P9KA 4WFNL 4CBUA 2D4WA 4NB4A 1TUUA 2PAVA 4H0TB 2YJFA 3WQTA 4K42A 4FWLA 5I9EB 4IFEA 3OBWA 5GAEP 4WQ5A 1RFQA 5C12A 3SLCA 3T69A 2GX9A 3Q7BA 4IOXA 3CCJN 3C7NB 3QB0A 4IJAA 5BRHA 5FPMA 4FWSA 3CC7N 4FWMA 1QVFM 3R6MA 5AQOA 3VGMA 2VGNA 2CGLA 2D1KA 4YOUA 2QI2A 4A57A 2GELA 2P9NB 1K8KA 4ILJA 4QS9A 2V7ZA 2HBLA 3H1QA 4JKHA 3A8YA 3IDHA 2WFBA 5CE3A 5GADP 3M1FA 3ULEB 1KAZA 3FE1A 3ZEUB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AQH A;  2F9W A;  3EZW A;  5AFU H;  3BF1 A;  1BWF O;  2GWK A;  3H3O B;  2QWO A;  2A6A A;  5EXW A;  1ATR A;  4HWI A;  3VEZ A;  2A41 A;  1YVN A;  3BF3 A;  3MCP A;  4PKG A;  1HKB A;  4FWQ A;  1GLF O;  2P9K B;  4FPA A;  3D7E O;  4FWR A;  1T6D A;  2ZF5 O;  3LDP A;  5AQF A;  4EFH A;  5KPZ A;  4RWT A;  3AAQ A;  3OHR A;  3FZM A;  1GLC G;  2YHW A;  4Y0W A;  2QWL A;  3SMP A;  1NGC A;  5BPN A;  1V4S A;  1Q18 A;  2CGJ A;  3CJB A;  5EY4 A;  1SQK A;  1MWK A;  1K8K B;  3ZX3 A;  1JCE A;  2ASO A;  2CH6 A;  3ZX0 A;  4BGB A;  4XH5 A;  2DPN A;  2HF4 A;  3O1B A;  3QDK A;  2ITM A;  4B1V A;  2F9T A;  5FPE A;  3UKU B;  3D2F A;  1X3M A;  3QFU A;  2GUP A;  3MDQ A;  3LDL A;  3DXK A;  1XQS C;  5AQP A;  2FF3 B;  3VGK A;  3BEX A;  3U9Z A;  1QZ6 A;  4JHD A;  3QML A;  2P9S A;  3UB5 A;  4FL9 A;  5AZJ B;  5AQM A;  3VEW A;  3WQU A;  2NRH A;  3A0I X;  3LDN A;  4EHU A;  4O5F A;  4H0X B;  3LM9 A;  1YXQ A;  4B1Z A;  3L4I A;  4DQ8 A;  4BC2 A;  2Q0U A;  3VET A;  2E8A A;  2PBD A;  4BC3 A;  1NGA A;  4CZJ A;  3LDO A;  2VYP A;  4K41 A;  3DJC A;  4MO4 A;  3S41 A;  2I7N A;  2UYT A;  3D2E A;  4CJ7 A;  5BPM A;  3UKR A;  1ZXO A;  2A40 A;  2P9L A;  3VES A;  2NLX A;  4BR9 A;  4I6M B;  3C0B A;  3EN9 A;  3A5O C;  3ATV A;  4FOI A;  5AZI A;  4B1X B;  3GBT A;  2GEM A;  4CD3 A;  1NGB A;  3QBW A;  4H0P A;  3D2F B;  3C7N A;  1BUP A;  1Z6R A;  3DXK B;  4FSV A;  4BRK A;  3CQX A;  1BO5 O;  2P9N A;  4NO7 A;  4MLE A;  3KVG A;  5KPT A;  2P9S B;  3HM8 A;  4BQL A;  4IXC A;  4KBO A;  3U4L A;  3I33 A;  3CI5 A;  3ULE A;  4E1J A;  1E4G T;  3DWL A;  3ZEU A;  5AQI A;  4BR0 A;  4FPB A;  4B1W B;  1BA1 A;  1KXP A;  2E2O A;  4B1Y B;  4FWK A;  1YAG A;  1EQY A;  3AAP A;  3VPZ A;  3O80 A;  2IVP A;  1T44 A;  4AM7 A;  1P8Z A;  3FZL A;  4BC4 A;  1QZ5 A;  2YI1 A;  1J6Z A;  4YDU C;  2HMP A;  3G25 A;  2A42 A;  2ZGY A;  3MMV A;  5AZI B;  1LCU A;  5AFU A;  4CZG A;  1U2V B;  2E2P A;  4BRH A;  4H5V A;  4CZH A;  3HTV A;  5E26 A;  5FPD A;  3SK3 A;  1RGI A;  3BP8 A;  1BDG A;  5JMV A;  4PL8 A;  4QS7 A;  3P4I A;  4IJN A;  4MO5 A;  1TYQ B;  2W40 A;  3IUC A;  5AQX A;  4A61 A;  3QIC A;  2WUS A;  4LC9 B;  3WT0 A;  1TUY A;  1SZ2 A;  1JCG A;  1NLV A;  2Q97 A;  1NBW A;  5AQN A;  3I8B A;  3UKU A;  1NWK A;  1WUA A;  4BVP A;  1DEJ A;  4WQ4 A;  5AR0 A;  1G99 A;  2ZWH A;  1BA0 A;  3MN9 A;  1GLB G;  1BOT O;  4WYB A;  3AY9 A;  3LM2 A;  3CJA A;  5AZJ A;  2GTD A;  1NGH A;  1HKG A;  4IWV A;  1QHA A;  5BR9 A;  1XUP O;  4RTF D;  4AM6 A;  2BUP A;  4C23 A;  1HUX A;  4H5T A;  1ATN A;  4BRP A;  3ZET B;  3FZK A;  5JIC A;  1C0G A;  3A5M C;  4H03 B;  3WXL A;  3FGU A;  1X9J A;  4I6M A;  1IJJ A;  2J4R A;  5BRF A;  4DCH A;  3FLC O;  2QWR A;  3MN7 A;  1NGG A;  3H3N O;  5AQK A;  2ASM A;  2E2N A;  4H0V B;  5KQD A;  5JLH A;  3DXM A;  2HOE A;  3WEE A;  2Q1N A;  1HX1 A;  1LOT B;  4IZ9 A;  4BRL A;  3VF2 A;  1R59 O;  2W41 A;  4BVO A;  3L6Q A;  3GDQ A;  4JN4 A;  1OKJ A;  3TU5 A;  4PKI A;  2H3G X;  4XEI A;  3VEN A;  3ID8 A;  5AQZ A;  1YUW A;  2KHO A;  3MK6 A;  3O4W A;  3AAR A;  3ENH A;  5KQ8 A;  3HZ6 A;  5ADX H;  2OAN A;  3EL2 A;  4ISG A;  1GLL O;  2ASP A;  5AQJ A;  3IFR A;  4BGA A;  4CZE A;  3QFP A;  3HI0 A;  5LY3 A;  5B8H A;  5JLF A;  2QW9 A;  1NGE A;  4FOE A;  4H5R A;  3MN5 A;  4GY2 B;  1JCF A;  1U2V A;  3A5L C;  3VEO A;  5AQL A;  3DXM B;  3WEE B;  4HTL A;  4CBW A;  2P9U B;  2YJE A;  3FZF A;  1TYQ A;  3JXU A;  3VEV A;  3WXJ A;  4BR7 A;  4BRM A;  1IG8 A;  1NGI A;  1U6Z A;  4CI6 A;  3RSE B;  1NGJ A;  3VEX A;  5KPR A;  1NGD A;  4WQ5 C;  3DAW A;  5F2R A;  3B8A X;  4IO8 A;  2Q31 A;  2FF6 A;  1QQM A;  2V51 B;  3VOV A;  4DHY A;  2CGK A;  3O8M A;  1HPM A;  2NZT A;  4CBX A;  1CZA N;  2A3Z A;  3F9M A;  4EAH D;  3L0Q A;  4BRO A;  1DKG D;  4FWN A;  5BRE A;  3O1W A;  4CZI A;  3IMX A;  3SMS A;  3VGL A;  4EIA A;  2QM1 A;  5BRD A;  1D4X A;  4K43 A;  3SJH A;  2E20 A;  2V7Y A;  2YHX A;  3A5N C;  5EVZ A;  4DB3 A;  4A62 A;  3ZET A;  5E84 A;  4Z94 A;  1ESV A;  4JD2 A;  3MN6 A;  2VWB A;  5LJV A;  3TPQ A;  5FPN A;  2AP1 A;  4JAX A;  1WOQ A;  2A5X A;  4L3Q A;  2FXU A;  1QQN A;  2E2Q A;  4CZM A;  4EHT A;  3CHW A;  2QWQ A;  3CET A;  4QS8 A;  1BG3 A;  4BR5 A;  5F0X A;  4BC5 A;  4O8K A;  4H5W A;  3UE5 A;  2I7P A;  3CER A;  2ZGZ A;  2FLO A;  3H45 C;  1KAX A;  5BN9 A;  4RCH A;  2IIR A;  3O6W A;  1HLU A;  4B9Q A;  1HJO A;  2E1Y A;  4MLH A;  1SAZ A;  2HF3 A;  4M63 C;  4M7X A;  3FFK B;  4ISF A;  4YDU A;  3HSC A;  3VF4 A;  2VCP A;  5LJW A;  4BRN A;  4JD2 B;  5AQQ A;  4F9O A;  4BRI A;  5F1X A;  3CJ9 A;  4BR4 A;  4ISE A;  5AQR A;  4BQZ A;  4BRC A;  3GOI A;  2P9P A;  3U9D A;  4FWP A;  4A2A A;  1BU6 O;  1XC3 A;  4M7Y A;  4FO0 A;  1Z05 A;  4FWO A;  3QBX A;  4H0Y B;  2YHY A;  5ADX A;  1GLJ O;  1ATS A;  4XH1 A;  5BPL A;  5AQG A;  2BTF A;  2P9U A;  5AQS A;  4BRG A;  3M6G A;  1NM1 A;  3ZX2 A;  2AA4 A;  2GWJ A;  4H0O A;  3EKU A;  2YCH A;  3RSE A;  5TKY A;  3H6E A;  2IVN A;  4PL7 A;  3O5B A;  4CD1 A;  3BUZ B;  3WXI A;  3LL3 A;  3LDQ A;  4A2B A;  3CJC A;  3VER A;  3O08 A;  2IVO A;  5AQV A;  2E88 A;  2QXL A;  2QWP A;  3FZH A;  1QQO A;  3WUH A;  1X3N A;  1E4F T;  3M3Z A;  1S3X A;  2FSK A;  1MA9 B;  4H5N A;  3GG4 A;  2P9P B;  2FSN A;  1ZBS A;  3CQY A;  5AQW A;  1DGK N;  1GLA G;  2Q36 A;  3FR0 A;  2V52 B;  5AQY A;  1GLE G;  3EKS A;  4BRF A;  1H1V A;  3ATU A;  4CZF A;  4BRA A;  3CJ1 A;  2D0P A;  3KZB A;  1Y64 A;  4PKH A;  2P9I A;  2QWN A;  2Q0R A;  5AQU A;  1KAY A;  3W0L A;  3R9P A;  1V4T A;  4GNI A;  3ENO A;  2FSJ A;  3CJ7 A;  2CH5 A;  4BG8 A;  1HKC A;  4K25 A;  3CIP A;  5EOY A;  4BG9 A;  3VEY A;  3KHY A;  3EO3 A;  2QWM A;  3H46 O;  2EWS A;  3GE1 A;  3H1V X;  2D0O A;  4BR2 A;  4BRE A;  4JHD B;  4CZL A;  3U8X A;  2Q2R A;  4WQ4 C;  4B1U B;  4J8F A;  5ELZ A;  3J8A A;  4BRQ A;  3WXK A;  1NGF A;  1NMD A;  3JS6 A;  2E1Z A;  3GL1 A;  1GLD G;  1MWM A;  1S22 A;  5AQT A;  3VF6 A;  3W3D A;  5BN8 A;  4JNE A;  4CZK A;  1RDW X;  5EX5 A;  1MDU B;  1ZC6 A;  3R8E A;  3HBT A;  1T6C A;  3D2E B;  4XH4 A;  1C0F A;  4BRD A;  2P9I B;  3UKR B;  2P9L B;  2P9K A;  4CBU A;  2D4W A;  4NB4 A;  1TUU A;  2PAV A;  4H0T B;  2YJF A;  3WQT A;  4K42 A;  4FWL A;  5I9E B;  4WQ5 A;  1RFQ A;  3SLC A;  3C7N B;  3QB0 A;  4IJA A;  5BRH A;  5FPM A;  4FWS A;  4FWM A;  3R6M A;  5AQO A;  3VGM A;  2CGL A;  2D1K A;  2GEL A;  2P9N B;  1K8K A;  4QS9 A;  2V7Z A;  3H1Q A;  3A8Y A;  3IDH A;  5CE3 A;  3M1F A;  3ULE B;  1KAZ A;  3FE1 A;  3ZEU B; 
#chains in the Genus database with same CATH topology
 3SUP A;  1EET A;  2QKB A;  3K5M A;  4CJS A;  3MXM A;  3TR8 A;  2AJQ A;  2JGU A;  5EXW A;  5CZ2 A;  3K59 A;  3U3Y A;  1T8E A;  4GVE A;  1UA0 A;  3MCP A;  2QA4 N;  3C94 A;  4X62 K;  4CEQ A;  3D7E O;  2YNG A;  3NGI A;  4CHP A;  1TKZ A;  4IOA L;  1MU2 A;  4Y0W A;  1RT4 A;  1NGC A;  4CGD A;  3MEE A;  3CMA N;  1T3V A;  3RMD A;  4ZTF A;  3HPH A;  1J5O A;  1MWK A;  4PUO A;  2FBY A;  2ASO A;  2CH6 A;  4O4G A;  1VQ4 N;  1S9E A;  1VSM A;  4BGB A;  4XH5 A;  4EZ9 A;  2HF4 A;  3O1B A;  3QDK A;  3THW B;  1VQP N;  3AVA A;  3MDQ A;  4J2A A;  3LDL A;  5AQP A;  3VGK A;  3OYG A;  3K5L A;  1TK0 A;  1WBB A;  4B9V A;  2RHK A;  1X9W A;  3ZSX A;  4FJ9 A;  5AZJ B;  4EHU A;  1ASU A;  3V6D A;  2NRH A;  3A0I X;  3DOL A;  4H0X B;  1EO1 A;  3KK3 A;  3AVK A;  5MLC Q;  4NXM K;  1YXQ A;  4B1Z A;  4DQ8 A;  4E1M A;  4BC2 A;  3U6F A;  3HYF A;  5HRN A;  3OYJ A;  3SCX A;  5HOO A;  1SKW A;  4BC3 A;  2G8K A;  4K41 A;  3DJC A;  4N76 A;  5HP1 A;  3L4Q A;  3NF8 A;  2I7N A;  3D2E A;  5BPM A;  2P9L A;  4M3U A;  4B9U A;  2Q3S A;  3VQ7 A;  3EN9 A;  4PWD A;  4FOI A;  2HHW A;  4NYN A;  3NH0 A;  2OPR A;  1BUP A;  1VSH A;  3DXK B;  1VQM N;  1L3S A;  1N32 K;  4DLE A;  5GAG P;  2P9S B;  4F2S A;  1OH8 A;  3E9O A;  3CFO A;  4Z4C A;  4FLU A;  4M3X A;  1NJW A;  3AVL A;  4B1Y B;  3PY8 A;  3DRP A;  5C25 A;  1EQY A;  3AAP A;  1OH6 A;  3O80 A;  5I3U A;  4BC4 A;  1IKY A;  2YI1 A;  2VWK A;  4DTR A;  2EX3 A;  4QCL A;  3NGY A;  3L2Q A;  1J6Z A;  2A42 A;  2ZGY A;  2D0B A;  2IAJ A;  4Q0B A;  4CF2 A;  4MDA A;  4KTW A;  4FJ5 A;  4CZG A;  4OGE A;  4BRH A;  4H5V A;  4CZH A;  5E26 A;  2Z1J A;  4PQU A;  3D6R A;  2WBN A;  4QS7 A;  4MO5 A;  2YX6 A;  3L2V A;  4FM1 A;  1SZ2 A;  1NWK A;  2O8E B;  4BVP A;  4M3W A;  3O4Q A;  4PHT X;  2HVH A;  3KWI A;  3ZCM A;  3CJA A;  4ZHR A;  3L3U A;  1BGX T;  3AVF A;  4W5T A;  4IWV A;  1QHA A;  1FKP A;  3OYH A;  4YFU A;  3VQB A;  3TAM A;  1XUP O;  4LFC K;  4H4O A;  4CFA A;  2B4J A;  5CZ1 A;  4B08 A;  1JLC A;  1GOB A;  3I55 N;  3FGU A;  4I6M A;  3ZSW A;  1WNS A;  3V9Z A;  3CCV N;  4FJ8 A;  5BRF A;  4DCH A;  3L2R A;  3CC4 N;  3MN7 A;  3ZT1 A;  2O4G A;  5AQK A;  4HVJ A;  4H0V B;  4L8R B;  1HJR A;  4FJ7 A;  3SUO A;  1LOT B;  1W7A A;  3P39 A;  4BY9 C;  1S72 N;  4BVO A;  3CFP A;  1G15 A;  2KW4 A;  2E6L A;  3RVC A;  3VEN A;  3ID8 A;  3THV A;  4DSE A;  1EKE A;  4DSL A;  2XY8 A;  3MK6 A;  3MX2 A;  3O4N A;  3O4W A;  3AAR A;  3ENH A;  5ADX H;  4ISG A;  1U49 A;  1GLL O;  2ASP A;  2OPS A;  1VSI A;  4B3O A;  2O8F B;  3LPU A;  4M3R A;  3NE6 A;  4ILH A;  1RTD A;  2HHT A;  4H5R A;  3MN5 A;  2OTJ N;  3T1A A;  4DU1 A;  1XMO K;  3A5L C;  2RN2 A;  3VEO A;  4LF8 K;  4XIU A;  3LAM A;  3WEE B;  4FJG A;  4HTL A;  2P5O A;  4CBW A;  1NK8 A;  3WXJ A;  1WSF A;  1U6Z A;  3RSE B;  1HRH A;  3DAW A;  1BI4 B;  4IO8 A;  1HNW K;  1QQM A;  1NOY A;  3ZSV A;  2XO7 A;  1LWC A;  4IBN A;  4RW7 A;  4ID5 A;  3WNF A;  4NXN K;  1D9D A;  4WCE L;  4BRO A;  4C1N K;  4EP5 A;  4FJI A;  5BRE A;  3IMX A;  3RR8 A;  4EIA A;  1HMV A;  2QM1 A;  3MWP A;  3M5R A;  2E20 A;  2HB5 A;  3A5N C;  3S3M A;  3ZET A;  5E84 A;  4Z94 A;  4RW8 A;  5J2Q A;  3MN6 A;  4YOW A;  2BAN A;  5LJV A;  2D0A A;  5FPN A;  4JAX A;  2A5X A;  4L3Q A;  1VSL A;  4CHZ A;  5KGW A;  4IFY A;  3EE9 A;  2NRW A;  3DRS A;  4AIL C;  5D3G A;  1NK4 A;  4BR5 A;  2PFU A;  3V1Q A;  4BC5 A;  4H5W A;  5M1Q A;  2I7P A;  4CJ4 A;  4DR7 K;  1WSJ A;  4LD0 A;  5E41 A;  3H45 C;  4FLZ A;  3OBY A;  1Q9Y A;  2IIR A;  1Y97 A;  1RTI A;  2E1Y A;  1N8R O;  4MLH A;  2Y1J A;  3HP9 A;  2JWK A;  4OPA A;  4YDU A;  1ZBU A;  4F8R A;  1RT7 A;  4QAG A;  5DMR A;  4K8Z A;  1VQL N;  4BRN A;  4JD2 B;  3QES A;  4LFA K;  4ISE A;  2OTL N;  2OZM A;  2BE2 A;  4JI0 K;  1JLF A;  2P9P A;  3C95 A;  1JLQ A;  4FWP A;  1BU6 O;  4YNQ A;  4JS4 A;  1XC3 A;  2VQE K;  2G8I A;  5C24 A;  2F7T A;  4DUY K;  2YHY A;  1BCM A;  5ADX A;  1TL1 A;  4G1Q A;  1ATS A;  5BPL A;  3HVT A;  5AQG A;  4DSI A;  1FXX A;  4LH5 A;  5AQS A;  4DTS A;  2AA4 A;  4YOX A;  1W2B M;  4CJP A;  2IVN A;  2GBZ A;  3K58 A;  4E7K A;  4PL7 A;  4HUE A;  1Q86 O;  4CD1 A;  4DQI A;  3WXI A;  2BGG A;  3VTI A;  3O08 A;  3E1Y A;  1B9D A;  1RT2 A;  2ZM6 K;  1WSE A;  1QQO A;  5C15 A;  4DMN A;  4GKJ K;  5BR8 K;  2P51 A;  4BE2 A;  1HNX K;  4H5N A;  4F4K A;  4JKA A;  3GG4 A;  1SL1 A;  2FSN A;  4JKG A;  3C6T A;  4M3Z A;  2NUB A;  3ULD A;  3FR0 A;  1GLE G;  1GOA A;  4Z4H A;  4CZF A;  1CXQ A;  3TAE A;  3DM2 A;  4JK8 A;  3NBP A;  4FZY A;  2P9I A;  2QWN A;  3M8P A;  3PV8 A;  1V4T A;  3QNO A;  2CH5 A;  4B3S K;  3PSI A;  4K25 A;  4CES A;  5EOY A;  3D45 A;  3VEY A;  2QWM A;  3GE1 A;  3HK2 A;  3H1V X;  1N34 K;  4BRE A;  2NRX A;  3ALY A;  3QO9 A;  4JI3 K;  1VQ6 N;  1SS6 A;  5SZT A;  2Q2R A;  3B6O A;  4B1U B;  3ZLJ A;  3QIO A;  3RR7 A;  4Z4G A;  1SUQ A;  1UOC A;  4IO9 L;  3W3D A;  5BN8 A;  5EX5 A;  3OJU A;  1ZC6 A;  1JL2 A;  1T6C A;  4XH4 A;  3UKR B;  5HRR A;  4WFN L;  1WSI A;  4CBU A;  3V81 A;  3SPY A;  5FLX O;  1T03 A;  1IV0 A;  3I0R A;  4WQ5 A;  1J9A A;  2GX9 A;  3C7N B;  3QB0 A;  1UA1 A;  2UUB K;  4FWS A;  3PUF A;  1A5X A;  1QVF M;  3R6M A;  4A57 A;  2GEL A;  4ILJ A;  4FJN A;  4AHC A;  3ZSQ A;  2HBL A;  3H1Q A;  4JKH A;  3EY1 A;  5CE3 A;  5GAD P;  3LP3 A;  3M1F A;  3THW A;  5AQH A;  2F9W A;  5K14 A;  3MEG A;  4U67 L;  2GWK A;  3V1O A;  2QWO A;  2A6A A;  1X9S A;  4J2D A;  4NLB A;  3WXM B;  4CJU A;  4Z4F A;  3HT3 A;  4Z0U A;  4CF0 A;  3QEI A;  4C1N I;  1HKB A;  1S1X A;  4FWQ A;  3O3H A;  4RWT A;  1T6D A;  2ZF5 O;  2YNH A;  3DYA A;  3LDP A;  5KPZ A;  3VQQ A;  3AAQ A;  3AO5 A;  3QER A;  3KKS A;  1RDC A;  3DOK A;  4NYF A;  1GLC G;  3SQ0 A;  3DLB A;  4FYD A;  1ILY A;  4Z4I A;  3CCL N;  2G8F A;  3NH2 A;  2CGJ A;  2IS3 A;  3QEW A;  1RDB A;  2KZM A;  1SQK A;  1P90 A;  3SBT A;  4CJQ A;  3VQC A;  1D8Y A;  3L3V A;  3V9W A;  1VRT A;  1U47 A;  2G8V A;  1VQO N;  4OVL A;  2ITM A;  5FPE A;  3UKU B;  4M45 A;  4DQP A;  2DFE A;  3H08 A;  3DXK A;  1XQS C;  4X64 K;  2FF3 B;  3BEX A;  3M8Q A;  4CJ5 A;  5GIP A;  2P9S A;  5FRM A;  4DQS A;  4CEC A;  5CHI A;  4BAC A;  4I2Q A;  3KK7 A;  2ITG A;  3BZC A;  3K2P A;  5AQM A;  3VEW A;  4JKC A;  3L4I A;  5JVG L;  2E8A A;  4JS5 A;  1NGA A;  1Z26 A;  4CZJ A;  1S6P A;  3LDO A;  4MO4 A;  3OYM A;  1VRU A;  1N6Q A;  2RF2 A;  3THX B;  2XHB A;  1TAU A;  2A40 A;  2X74 A;  4RW9 A;  3U3G A;  3A5O C;  1U04 A;  1NGB A;  3QBW A;  4FLW A;  3QNN A;  4CED A;  1Z6R A;  4OPH A;  4FSV A;  3RMA A;  4I2P A;  3OS1 A;  2P9N A;  3JAM O;  3KVG A;  4O0I A;  4N5S A;  3HM8 A;  4BQL A;  1JL1 A;  3PIP L;  1JLE A;  1C0M A;  3VQE A;  3BGR A;  3CI5 A;  3I33 A;  1N36 K;  4KTQ A;  3DWL A;  4BR0 A;  1BA1 A;  2O8E A;  1LWE A;  1KVA A;  5KRT A;  4N47 A;  4W5N A;  1YAG A;  4KRF A;  4WE1 A;  3TAF A;  4HUF A;  1T44 A;  1J54 A;  3FZL A;  3NF6 A;  4YDU C;  4DV5 K;  4LF4 K;  2HMP A;  1DTQ A;  3MXI A;  3AA3 A;  4A5A A;  2HW3 A;  3NMU A;  4CFD A;  3ZSO A;  1RBV A;  3HTV A;  4DTU A;  2G8H A;  1BDG A;  5JMV A;  3P4I A;  1TYQ B;  4JKE A;  3HOS A;  2WUS A;  3WT0 A;  1IBK K;  5AQN A;  3I8B A;  3SAF A;  1J53 A;  1DEJ A;  5FRN A;  4WQ4 A;  3SUQ A;  1FW6 A;  3O9R A;  3T19 A;  3I0S A;  1GLB G;  1DTT A;  4WYB A;  4A59 A;  3ZT4 A;  3CF5 L;  2ATQ A;  3DMJ A;  1HKG A;  4LFB K;  2X78 A;  4CGF A;  2O8B B;  4C23 A;  1JKH A;  2BUP A;  4BE0 A;  4DFK A;  4NCA A;  4H5T A;  4DKW A;  1ATN A;  5HL7 L;  3TAB A;  1U48 A;  4CEF A;  1KCF A;  4H8K A;  3FZK A;  3AO2 A;  3AGK A;  3A5M C;  3WXL A;  1CZB A;  4KO0 A;  5KRS A;  2EHG A;  2PYL A;  2O8F A;  3CQ8 A;  3FLC O;  4FJK A;  4DV1 K;  4FK0 A;  5KGX A;  3WEE A;  4JI1 K;  2Q1N A;  4I9L A;  1HX1 A;  2W41 A;  3MCA B;  4DSJ A;  4CEE A;  1BIS A;  4JN4 A;  3TU5 A;  4PKI A;  2H3G X;  1BI4 A;  3F5T A;  2X6N A;  1TK5 A;  3MWT A;  4B9L A;  5CY4 A;  5KQ8 A;  3SAG A;  2OAN A;  1Q81 O;  3EL2 A;  1NK9 A;  1WAF A;  1BL3 A;  2XRI A;  1NK0 A;  5JLF A;  1U45 A;  2W42 A;  3O3F A;  3C65 A;  2QW9 A;  4FOE A;  4KHS A;  3SYZ A;  1HNV A;  1JCF A;  1U2V A;  1T05 A;  1Q7Y O;  4CGH A;  3BY5 A;  1QSL A;  2P9U B;  3NF9 A;  3FZF A;  4KFB A;  3VEV A;  3JXU A;  1YF5 L;  4CI6 A;  4B8C A;  4GW6 A;  4LSL A;  3VEX A;  3TAP A;  1NGD A;  4WQ5 C;  3CPE A;  3OYA A;  2IC3 A;  1VSF A;  2Q31 A;  4LF7 K;  2FF6 A;  1IKV A;  4DHY A;  4J2E A;  2NZT A;  3MED A;  1CZA N;  1BQN A;  3SV4 A;  3KLI A;  3L0Q A;  3E66 A;  3O9Q A;  2UXC K;  4KH6 A;  3QIP A;  3SMS A;  3VGL A;  5BRD A;  3THY B;  3SJH A;  5JS2 A;  3HO1 A;  2YHX A;  3EE8 A;  4DB3 A;  2HHV A;  3AVN A;  1WSH A;  4JD2 A;  1WOQ A;  2HNZ A;  4LF9 K;  1QQN A;  2E2Q A;  2IOC A;  3HST B;  4CZM A;  2ETJ A;  2QWQ A;  4DLG A;  2D0C A;  4DTN A;  4Q5V A;  1RT5 A;  3A2F A;  3OYE A;  4FW2 A;  4ZTJ A;  2VQF K;  4HTU A;  2ZGZ A;  4IDH A;  2FLO A;  4KHU A;  1KAX A;  5BN9 A;  1CXU A;  4EP4 A;  1VSD A;  3O6W A;  3P83 D;  1HLU A;  4B9Q A;  1HJO A;  4IOC L;  2Y1I A;  1YTU A;  1SAZ A;  2HBJ A;  4JEP A;  4M7X A;  4ISF A;  3ZT3 A;  4FLV A;  3LP2 A;  2VCP A;  5LJW A;  3CCR N;  2VG5 A;  1XMQ K;  1A5W A;  4BRI A;  5F1X A;  4BR4 A;  1RIL A;  5A2Q O;  4BQZ A;  4BRC A;  4CGG A;  3K9J A;  3OYB A;  4DF4 A;  3CCM N;  4AQY K;  3KTQ A;  4M7Y A;  3LWL A;  4JRQ A;  3ITH A;  4FO0 A;  1Z05 A;  3LAN A;  3QBX A;  1LV5 A;  2DY4 A;  3M6G A;  3ZX2 A;  3EKU A;  3IG1 A;  5TKY A;  4GV6 A;  2XY5 A;  1C1A A;  4DR6 K;  3LL3 A;  3LDQ A;  4A2B A;  3VN5 A;  3VER A;  2VG7 A;  4DV4 K;  2IVO A;  3ISN C;  5AQV A;  3RMC A;  4CVN E;  1E4F T;  2RKI A;  3M3Z A;  3CCE N;  1S3X A;  2FSK A;  1SKS A;  3LZI A;  4KI6 A;  1ZBS A;  4CCH A;  1DGK N;  4FLT A;  2UXB K;  3KK1 A;  1REV A;  1VSK A;  5LL6 Z;  4BDY A;  4CJV A;  4OLB A;  1XWL A;  4DV6 K;  1GOC A;  3KZB A;  1Y64 A;  3G6E N;  2YHB A;  4GNI A;  1HNI A;  3ENO A;  2PYJ A;  1HKC A;  3DLE A;  4IEE A;  1YIT N;  4CE9 A;  1NK7 A;  3H46 O;  2NRT A;  4OPJ A;  2A1S A;  3NH1 A;  4BR2 A;  4KB0 A;  1RTJ A;  4X66 K;  3L2U A;  1NJY A;  1YJ9 N;  4CJT A;  4X65 K;  4WQ4 C;  4J8F A;  4CIG A;  3DLK A;  4BRQ A;  1F21 A;  3MX5 A;  4E7J A;  1NMD A;  1NKB A;  2E1Z A;  3GL1 A;  3VF6 A;  4YOY A;  4DUZ K;  4JNE A;  3RWU A;  1MDU B;  3R8E A;  3HBT A;  3D2E B;  5C2D A;  4BRD A;  4BE1 A;  5C2F A;  2P9L B;  3M8R A;  3VA0 A;  4CHQ A;  4DFP A;  3QIN A;  3OYD A;  1TUU A;  2YJF A;  3J7A P;  3OBW A;  3VQ9 A;  3SJJ A;  3T69 A;  2ZE2 A;  4IOX A;  4IJA A;  4OPK A;  5BRH A;  2B6A A;  4OKE A;  5AQO A;  4C8L A;  2CGL A;  2D1K A;  4AH9 A;  2OPP A;  4QS9 A;  1S1V A;  2KFZ A;  1E3M A;  3A8Y A;  4E7I A;  1NMN A;  2ZD1 A;  2WTU A;  3IUC A;  4JI4 K;  3FE1 A;  5KI6 A;  3EZW A;  3BF1 A;  3R1X A;  1D9F A;  3K5O A;  1HYS A;  4HWI A;  3VEZ A;  1YVN A;  2YNI A;  4PKG A;  4DTJ A;  4K8X A;  4J2B A;  4KPY A;  1GLF O;  5M1K A;  4FWR A;  5AQF A;  3SAH A;  3HL8 A;  1LW0 A;  4PA1 A;  4AHU A;  2G8W A;  3FZM A;  2YHW A;  2QWL A;  1OH7 A;  4JI5 K;  1HYZ A;  5BPN A;  1O13 A;  1JLG A;  1L3T A;  3RMB A;  3T1H K;  3OVN A;  3ZX0 A;  3ZX3 A;  3Q7C A;  4U7B A;  3HPO A;  3S3N A;  4B1V A;  2F9T A;  1HQE A;  4FJX A;  3AVH A;  1TKX A;  3QFU A;  4O8U A;  4JI7 K;  1Z25 A;  3U9Z A;  1B9F A;  1QZ6 A;  4B9S A;  4JHD A;  4C8N A;  4CHN A;  2O8C A;  1U4B A;  4FXD A;  5J2P A;  4FL9 A;  3LDN A;  4M3T A;  4O5F A;  5HLF A;  3HJF A;  3T3F A;  3LM9 A;  1TAQ A;  2HHH K;  1I3A A;  2Q0U A;  2PBD A;  3PX6 A;  4DV0 K;  3EEQ A;  2UYT A;  4E89 A;  3KWG A;  3NVK A;  3VES A;  4E19 A;  2OZS A;  1NNE A;  4BR9 A;  4I6M B;  4IG3 A;  1KC8 O;  4N41 A;  3ATV A;  1VQ8 N;  4B1X B;  3CCS N;  3GBT A;  3TAQ A;  1QQC A;  4H0P A;  3D2F B;  3IAY A;  4NCB A;  4IDK A;  4BRK A;  3CQX A;  1IKW A;  4NO7 A;  3NCI A;  1RDU A;  5FDL A;  5SWM A;  2GV9 A;  5KPT A;  1IO2 A;  5AJ3 K;  4KBO A;  4E1J A;  2O8D B;  3ULE A;  1VQN N;  1E4G T;  3ZEU A;  5AQI A;  4HCC A;  2D5R A;  4FPB A;  3CPW M;  5HBM A;  2E2O A;  3SPZ A;  4FVU A;  4FWK A;  1W0H A;  4MFB A;  3VPZ A;  1RBR A;  2IVP A;  3LAL A;  2NNW A;  4JKB A;  3HXM A;  1QZ5 A;  3F73 A;  3G25 A;  3G4S N;  1C0U A;  5AZI B;  3KIO A;  4GV9 A;  3MEC A;  4GKK K;  3V1R A;  3NHG A;  2HHS A;  2E2P A;  1VSE A;  5FPD A;  3SK3 A;  1RGI A;  3BP8 A;  3JYT A;  4PL8 A;  4KHN A;  3KLH A;  4IJN A;  2W40 A;  4A61 A;  3VQ4 A;  1L3U A;  3OW2 M;  1TUY A;  1QVG M;  1JCG A;  2Q97 A;  4HHT A;  1NBW A;  1HQU A;  4CJE A;  1WUA A;  1XC9 A;  1G99 A;  1BA0 A;  3MN9 A;  1R0A A;  4JKD A;  1BOT O;  4JI6 K;  1KFD A;  1VHX A;  4DTP A;  3J81 O;  2HHX A;  5AZJ A;  2GTD A;  1K73 O;  2ZJR L;  1XNR K;  5BR9 A;  4FM0 A;  5J1E A;  4RTF D;  4DU4 A;  1HUX A;  2VWJ A;  1YVU A;  3ZET B;  3SQ2 A;  4DSK A;  1RBU A;  1C0G A;  4H03 B;  3CCU N;  1C1B A;  1HNZ K;  4FW1 A;  3UIQ A;  3O9U A;  1IJJ A;  1C6V A;  4AHR A;  1OVY A;  4CHY A;  2QWR A;  3R3L A;  1NGG A;  3H3N O;  2ASM A;  3IKM A;  5KQD A;  4IZ9 A;  3TSP A;  4BRL A;  1R59 O;  3KLG A;  3L6Q A;  3CXC M;  1OKJ A;  4XEI A;  5AQZ A;  1K9M O;  2UUC K;  1RT1 A;  4ID1 A;  1JXE A;  4OGC A;  4GV3 A;  3HZ6 A;  1VAZ A;  1BCO A;  1TK8 A;  1RT3 A;  3EYZ A;  5JS1 A;  2Z1H A;  3IFR A;  4CZE A;  4DV2 K;  5LY3 A;  1D5A A;  1KVB A;  4Y1D A;  1YT3 A;  1DLO A;  4GY2 B;  4DG1 A;  5J2M A;  5FRO A;  4JK7 A;  3DXM B;  3ZT2 A;  2YJE A;  3AV9 A;  5HRO A;  3ENB A;  4BRM A;  1IG8 A;  1NGI A;  2HMI A;  3KJV A;  1NJZ A;  1NGJ A;  4R5P A;  3SV3 A;  4ELV A;  4RG8 A;  5F2R A;  3B8A X;  4B8A B;  5DM7 L;  4DF8 A;  4KKO A;  4ELU A;  1XNQ K;  1HYV A;  4I7F A;  4TSX A;  3OJS A;  1BQM A;  2NRZ A;  3VOV A;  4C8M A;  3O8M A;  3G0Z A;  3I56 N;  1KQS M;  3JSM A;  4CF8 A;  4LF5 K;  3F9M A;  2FBX A;  3VQ6 A;  2YHA A;  4N56 A;  3E9P A;  1L5U A;  2W6L A;  2HHQ A;  4FWN A;  4CZI A;  3CYM A;  4AF1 A;  4E1N A;  4JKG B;  3J7Z O;  5EVZ A;  3PLA A;  4A62 A;  4CFC A;  4OKJ A;  1NKC A;  1ESV A;  1S9G A;  2VWB A;  3TPQ A;  4O5B A;  2AP1 A;  1WN7 A;  3SI6 A;  2E5L K;  4EHT A;  3CHW A;  1BG3 A;  3TAR A;  4CJW A;  3VQD A;  5F0X A;  4GMJ B;  4O8K A;  4OX9 K;  1ZBL A;  4DV3 K;  3AO1 A;  1TKD A;  1LAV A;  1RBS A;  4FM2 A;  1EWR A;  2HF3 A;  3LPT A;  4IEI A;  3HSC A;  3LP0 A;  4DR5 K;  4RW6 A;  3N4P A;  4FLX A;  3ZSZ A;  4F9O A;  5AQR A;  5C0Y A;  5GIO A;  3CME N;  1Q8I A;  3GOI A;  4LSN A;  3AA4 A;  1L3V A;  4NCG A;  3K5N A;  3SQ4 A;  2WON A;  4FWO A;  3VQP A;  3AA2 A;  1GLJ O;  4XH1 A;  2BTF A;  4BRG A;  1J5E K;  3OA9 A;  1NM1 A;  2IDO A;  2P5G A;  3CG7 A;  3HRG A;  3RSE A;  4E7L A;  3I8D A;  3H6E A;  3J80 O;  3CFR A;  3RRH A;  1VQ7 N;  3G10 A;  3LP1 A;  3O5B A;  1M1K O;  1BIU A;  3CJC A;  3TTC A;  1FJG K;  4YOT A;  2IGI A;  2E88 A;  1M90 O;  2QXL A;  2Z1G A;  1WAJ A;  2QWP A;  4CJL A;  3FZH A;  4CER A;  3WUH A;  1SV5 A;  5TKW A;  1NG9 A;  4OLA A;  3K9K A;  3OS2 A;  1VQK N;  3ASM A;  1RDD A;  2KZZ A;  2FBT A;  3AVM A;  2UU9 K;  3TTF A;  1TVR A;  3RRG A;  1GLA G;  4CEA A;  3P38 A;  4KHQ A;  3NDK A;  2Q36 A;  3NGZ A;  1QS4 A;  3FFI A;  3ZT0 A;  2V52 B;  4FZX C;  4CEO A;  2HHU A;  3ATU A;  3TSU A;  5HRS A;  1OVQ A;  4BRA A;  1S5J A;  3P31 A;  4PKH A;  2Q0R A;  1KAY A;  3W0L A;  4FLY A;  3OYF A;  4A5B A;  3ZSR A;  4DU3 A;  4AHS A;  2E6M A;  1A5V A;  1NU0 A;  3KHY A;  3EO3 A;  3KLE A;  1XI1 A;  2D0O A;  4CGI A;  2OCE A;  4F2R A;  4CZL A;  4JKF A;  1K6Y A;  1RDA A;  4V19 S;  5ELZ A;  3J8A A;  4DWI A;  1ZYQ A;  3HOT A;  3JS6 A;  3AVC A;  4KHY A;  1S22 A;  3VQ5 A;  3V9S A;  4KV8 A;  4CEB A;  1ZBF A;  1HPZ A;  4CZK A;  1YHQ N;  4CF1 A;  1C0F A;  1EWQ A;  2KLA A;  1IBM K;  4F3T A;  4NB4 A;  4FJH A;  2PAV A;  3DLG A;  5I9E B;  4JRP A;  4IFE A;  5I42 A;  4B3M K;  5C12 A;  4FK2 A;  3Q7B A;  4KTZ A;  5FPM A;  3VGM A;  2VGN A;  2P9N B;  2QKK A;  3QET A;  3PO5 A;  3IDH A;  4KHP K;  3KLF A;  1KAZ A;  1LAW A;  5CYQ A;  5AFU H;  2G8U A;  3CM6 A;  1BWF O;  3H3O B;  4O0J A;  4JK9 A;  4DTO A;  1ATR A;  1LWF A;  2A41 A;  1NOZ A;  3BF3 A;  3NFA A;  3P5J A;  4LH4 A;  4DR3 K;  2P9K B;  3C6A A;  5CR4 A;  4FPA A;  4EFH A;  4Y1C A;  4JYA K;  3OHR A;  3E01 A;  4OJR A;  4BDP A;  4DFJ A;  4DQQ A;  3SMP A;  1IKX A;  2PZS A;  1V4S A;  1Q18 A;  3WNH A;  3CJB A;  5EY4 A;  4FCY A;  2UXD K;  2HBK A;  1K8K B;  3KKR A;  3BDP A;  1JCE A;  4PY5 A;  4CIE A;  1I94 K;  2DPN A;  2F8S A;  1T7P A;  2KQ2 A;  3D2F A;  1X3M A;  1NJX A;  2GUP A;  4C8K A;  1FK9 A;  3AO3 A;  3KD5 E;  1KSP A;  3AVB A;  1IG9 A;  3QML A;  4CK2 A;  5EU7 A;  4G9Z A;  3UB5 A;  3V9X A;  2O8D A;  2OPQ A;  4BWJ A;  3WQU A;  3V9U A;  1WBD A;  4DR2 K;  1CLQ A;  3J7Y P;  3AA5 X;  4CJF A;  4C8O A;  1SKR A;  4CFB A;  2W6K A;  3VET A;  1QSS A;  2VYP A;  1B92 A;  5JVH L;  1ZBH A;  3S41 A;  4CJ7 A;  4MQ3 A;  3UKR A;  1NJI O;  1ZXO A;  2NLX A;  2X6S A;  3QEX A;  3C0B A;  1VQ5 N;  3LAK A;  5AZI A;  4I9Q A;  5GAH P;  2GEM A;  4CD3 A;  3LWM A;  3HM9 A;  3C7N A;  1JXB A;  4WFB L;  4DTX A;  1QHT A;  3C6U A;  4CEZ A;  4YY3 K;  1BO5 O;  1VSJ A;  3NF7 A;  4GVM A;  4MLE A;  4FJL A;  3L8B A;  4KH4 A;  3TTD A;  2XY7 A;  3SZ2 A;  3DLR A;  3VQ8 A;  4YHH K;  4IXC A;  3OS0 A;  3U4L A;  4W5O A;  3VA3 A;  3DLL L;  4B1W B;  1KXP A;  1RT6 A;  4JI2 K;  4H4M A;  3TWH A;  3M8S A;  1KD1 O;  2P1J A;  4CF9 A;  2HST A;  4AM7 A;  1YTA A;  5LMU K;  2B5J A;  1P8Z A;  1NK6 A;  5C42 A;  5M1F A;  5H1S Q;  3MMV A;  4CJK A;  1LCU A;  1RBT A;  2DTU A;  2HNY A;  5AFU A;  1HR0 K;  3OY9 A;  3OYL A;  1U2V B;  4E3S A;  1DT9 A;  4DFM A;  1Q9X A;  4YOV A;  4ILG B;  4ELT A;  1KLM A;  5LMN K;  1SL2 A;  5AQX A;  4M3Y A;  3QIC A;  4LC9 B;  3O9T A;  5GIN A;  3SQ1 A;  4B3R K;  1NLV A;  3VMF B;  3UKU A;  2NRR A;  1TV6 A;  1SL0 A;  1N33 K;  4E7H A;  5AR0 A;  2ZWH A;  4MDB A;  3HVR A;  4FJM A;  3AY9 A;  3LM2 A;  2NRV A;  1NGH A;  2GUI A;  1UAX A;  4AHV A;  1XHX A;  3AVJ A;  4O55 A;  4AM6 A;  3QEP A;  4HUG A;  3AGR A;  2BH1 A;  4IKF A;  3CC2 N;  4BRP A;  3WNE A;  4CGJ A;  5M1O A;  5JIC A;  3THX A;  1OH5 A;  3T1Y K;  4W5Q A;  1X9J A;  4Z4E A;  3AO4 A;  2J4R A;  3LDS A;  4K0K K;  4M41 A;  1CZ9 A;  4B9M A;  3S9H A;  1RNH A;  2E2N A;  3E9L A;  3PO4 A;  5JLH A;  3DXM A;  2HOE A;  1KRP A;  4BWM A;  3G71 N;  3VF2 A;  1O1W A;  2HND A;  3V4I A;  3GDQ A;  2FC0 A;  3DLH A;  4NLC A;  4R79 A;  4AHT A;  1YUW A;  2KHO A;  1S1T A;  3OYN A;  4HCB A;  2R7Y A;  3PIO L;  1KVC A;  3EZ5 A;  3B6P A;  3TAG A;  1X9M A;  4FVM A;  5AQJ A;  4BGA A;  3O3G A;  4CW7 B;  3QFP A;  3HI0 A;  1W9H A;  5M1N A;  1NGE A;  3PX4 A;  4DQR A;  3T7Z A;  3HPG A;  1N5Y A;  3DRR A;  5AQL A;  1TKT A;  1RTH A;  1TYQ A;  3LZJ A;  4FK4 A;  4OO1 J;  4JLH A;  4BR7 A;  3TAN A;  1S6Q A;  5KPR A;  1JJ2 M;  2KTQ A;  4B3T K;  5KTQ A;  3O9S A;  3F2K A;  2ZQB A;  2V51 B;  1VQ9 N;  1W97 L;  2CGK A;  1HPM A;  4CBX A;  1TGO A;  1NK5 A;  2A3Z A;  1QE1 A;  1C1C A;  4KHW A;  2WOM A;  4EAH D;  4QOZ B;  2F8T A;  2QXF A;  1S1U A;  2DFH A;  5T7B A;  1DKG D;  2O8B A;  3O1W A;  2YKN A;  3OYC A;  4WF9 L;  4CK3 A;  1D4X A;  2JWL A;  2QTD A;  4K43 A;  3SBG A;  4DSF A;  1EXQ A;  4DR4 K;  3IRX A;  2V7Y A;  5IWA K;  2PY5 A;  4FZZ A;  1WB9 A;  1BHL A;  4CHO A;  3OYK A;  2RE2 A;  3QEV A;  2FXU A;  3S3O A;  3PX0 A;  2HBM A;  3CET A;  4ICL A;  4QS8 A;  4IFV A;  3ZSY A;  3D0P A;  5CYM A;  5DM6 L;  5IT9 O;  4JI8 K;  4KB1 A;  2KFN A;  3UE5 A;  2F96 A;  3CER A;  2QK9 A;  3NAE A;  2WC9 A;  3ZYY X;  3SNN A;  3OYI A;  4RCH A;  3BZK A;  4RW4 A;  2XY6 A;  3RTV A;  4DV7 K;  2F4V K;  1WLJ A;  1FKO A;  4M63 C;  2ZJP L;  3SUN A;  3FFK B;  3VF4 A;  2UUA K;  2YNF A;  2OYQ A;  4CK1 A;  2VGM A;  1C0T A;  5AQQ A;  1YI2 N;  3CJ9 A;  1IH7 A;  3KD1 E;  1KLN A;  3AVG A;  1X1P A;  1RCH A;  4WFA L;  2JLE A;  3U9D A;  2E4L A;  4A2A A;  4B9N A;  1ITG A;  4H0Y B;  1I39 A;  1TL3 A;  2LSN A;  3OTO K;  3KK2 A;  3NVM A;  5HRP A;  2P9U A;  4BDZ A;  3N4Q A;  4YOR A;  4DTM A;  2GWJ A;  4H0O A;  2YCH A;  1XHZ A;  2DFF A;  4CJR A;  1ASW A;  2ZJQ L;  3TSQ A;  3BUZ B;  3PSF A;  4OKK A;  3K57 A;  3F9K A;  1KTQ A;  1YJN N;  4DR1 K;  4DS4 A;  4LF6 K;  2OA8 A;  4DS5 A;  1IBL K;  2YV0 X;  1X3N A;  5C10 A;  2BDP A;  4LY7 A;  1MA9 B;  4KRE A;  1YIJ N;  3THY A;  1QSY A;  2P9P B;  3MXJ A;  5AQW A;  3CQY A;  2O4I A;  3VQA A;  4CJ3 A;  5AQY A;  2FBV A;  1KFS A;  3EKS A;  4BRF A;  1H1V A;  2KKZ A;  3CJ1 A;  4E0D A;  1Q82 O;  3CD6 N;  1S1W A;  2D0P A;  5AQU A;  1JLB A;  3R9P A;  2FSJ A;  3CJ7 A;  1EP4 A;  3AVI A;  4BG8 A;  1K8A O;  1UWB A;  2I5J A;  2A1R A;  3CIP A;  4B9T A;  3C6H A;  4BG9 A;  3CCQ N;  1JLA A;  1QTM A;  2EWS A;  3VTH A;  3QLH A;  3P1G A;  3MAQ A;  3K0S A;  1YJW N;  3TI0 A;  3ID6 A;  4JHD B;  4KAZ A;  4UQG A;  2O8C B;  5J2N A;  3U8X A;  4F3O A;  1LW2 A;  3WXK A;  1BIZ A;  3HP6 A;  1NGF A;  1GLD G;  1MWM A;  5AQT A;  1ASV A;  3CM5 A;  1EX4 A;  5M1P A;  2QEX N;  1RDW X;  3DI6 A;  4KH5 A;  4CIF A;  4UY8 O;  2P9I B;  2P9K A;  2D4W A;  4KI4 A;  4H0T B;  4O44 A;  4M42 A;  3WQT A;  5DK5 A;  2YKM A;  4K42 A;  4FWL A;  4W5R A;  1NKE A;  4IG0 A;  5GAE P;  4FJJ A;  2RPI A;  1RFQ A;  3SLC A;  1VK0 A;  3CCJ N;  2VG6 A;  3CC7 N;  1WSG A;  4FWM A;  1ZBI A;  4YOU A;  4EZ6 A;  2QI2 A;  1K8K A;  2V7Z A;  3WNG A;  3L2W A;  2Z1I A;  2WFB A;  2HVI A;  3IS9 A;  3ULE B;  4JV5 K;  5B8H A;  3ZEU B; 
#chains in the Genus database with same CATH homology
 5AQH A;  2F9W A;  3EZW A;  5AFU H;  3BF1 A;  3R1X A;  4U67 L;  1BWF O;  2GWK A;  3H3O B;  2QWO A;  2A6A A;  5EXW A;  4NLB A;  4JK9 A;  3WXM B;  1ATR A;  4HWI A;  3VEZ A;  2A41 A;  1YVN A;  4GVE A;  3BF3 A;  3MCP A;  4PKG A;  2QA4 N;  4C1N I;  1HKB A;  4FWQ A;  1GLF O;  2P9K B;  3C6A A;  4FPA A;  5CR4 A;  3D7E O;  4FWR A;  1T6D A;  2ZF5 O;  3LDP A;  5AQF A;  4EFH A;  5KPZ A;  3SAH A;  3AAQ A;  4RWT A;  4IOA L;  3OHR A;  3FZM A;  1GLC G;  1ILY A;  2YHW A;  4Y0W A;  2QWL A;  3SMP A;  1NGC A;  5BPN A;  3CCL N;  1O13 A;  1Q18 A;  1V4S A;  2CGJ A;  3CJB A;  5EY4 A;  3CMA N;  1T3V A;  1SQK A;  1P90 A;  2HBK A;  3SBT A;  1MWK A;  1K8K B;  3ZX3 A;  1JCE A;  2ASO A;  2CH6 A;  3Q7C A;  3ZX0 A;  4BGB A;  4U7B A;  1VQ4 N;  4XH5 A;  2DPN A;  2HF4 A;  1VQO N;  3O1B A;  3QDK A;  2ITM A;  4B1V A;  2F9T A;  5FPE A;  1VQP N;  3UKU B;  3D2F A;  1X3M A;  3QFU A;  2GUP A;  3MDQ A;  4O8U A;  3LDL A;  3DXK A;  1XQS C;  5AQP A;  2FF3 B;  3VGK A;  3BEX A;  3U9Z A;  1QZ6 A;  5GIP A;  4JHD A;  3QML A;  2P9S A;  2RHK A;  4G9Z A;  5CHI A;  3KK7 A;  3UB5 A;  4FL9 A;  5AZJ B;  5AQM A;  3VEW A;  3WQU A;  2NRH A;  3A0I X;  3LDN A;  4EHU A;  4O5F A;  4H0X B;  1EO1 A;  3LM9 A;  4JKC A;  5MLC Q;  1YXQ A;  4B1Z A;  3L4I A;  4DQ8 A;  4BC2 A;  2Q0U A;  3VET A;  5JVG L;  2E8A A;  2PBD A;  5HOO A;  4BC3 A;  1NGA A;  4CZJ A;  3LDO A;  2VYP A;  4K41 A;  3DJC A;  4MO4 A;  5JVH L;  3L4Q A;  3S41 A;  2I7N A;  2UYT A;  3D2E A;  3KWG A;  4CJ7 A;  5BPM A;  3NVK A;  3UKR A;  1NJI O;  1ZXO A;  2A40 A;  2P9L A;  3VES A;  2NLX A;  4BR9 A;  4I6M B;  3C0B A;  1KC8 O;  1VQ5 N;  3EN9 A;  3A5O C;  3ATV A;  4FOI A;  5AZI A;  1VQ8 N;  4B1X B;  3CCS N;  3GBT A;  5GAH P;  2GEM A;  4CD3 A;  1NGB A;  3QBW A;  4H0P A;  3D2F B;  3C7N A;  1BUP A;  1Z6R A;  3DXK B;  4OPH A;  1VQM N;  4WFB L;  4FSV A;  4BRK A;  3CQX A;  1BO5 O;  2P9N A;  1RDU A;  4NO7 A;  4MLE A;  3KVG A;  5GAG P;  5KPT A;  2P9S B;  4KH4 A;  3TTD A;  3HM8 A;  4BQL A;  3PIP L;  4IXC A;  4KBO A;  3U4L A;  3I33 A;  3CI5 A;  3ULE A;  4E1J A;  1E4G T;  3DLL L;  1VQN N;  3DWL A;  3E9O A;  3ZEU A;  5AQI A;  4BR0 A;  4FPB A;  4B1W B;  1BA1 A;  3CPW M;  1KXP A;  2E2O A;  4B1Y B;  4FVU A;  4FWK A;  1YAG A;  1KD1 O;  1EQY A;  3AAP A;  3VPZ A;  5M1K A;  3O80 A;  2IVP A;  2HST A;  1T44 A;  2NNW A;  4JKB A;  4AM7 A;  1P8Z A;  3FZL A;  4BC4 A;  1QZ5 A;  2YI1 A;  5M1F A;  1J6Z A;  4YDU C;  2HMP A;  3G25 A;  3G4S N;  2A42 A;  5H1S Q;  2ZGY A;  3MMV A;  5AZI B;  1LCU A;  4GV9 A;  4A5A A;  4MDA A;  5AFU A;  3NMU A;  4CZG A;  1U2V B;  2E2P A;  4BRH A;  4H5V A;  4CZH A;  1DT9 A;  3HTV A;  5E26 A;  5FPD A;  3SK3 A;  4YOV A;  1RGI A;  3BP8 A;  1BDG A;  2WBN A;  3D6R A;  4ILG B;  4PL8 A;  4QS7 A;  5JMV A;  3P4I A;  4IJN A;  4MO5 A;  1TYQ B;  2W40 A;  3IUC A;  4JKE A;  5AQX A;  4A61 A;  3QIC A;  2WUS A;  2YX6 A;  3O9T A;  4LC9 B;  3WT0 A;  5GIN A;  3OW2 M;  1TUY A;  1SZ2 A;  1QVG M;  1JCG A;  2Q97 A;  1NLV A;  3VMF B;  1NBW A;  2NRR A;  3I8B A;  5AQN A;  3UKU A;  1NWK A;  1WUA A;  4BVP A;  1DEJ A;  3SAF A;  4WQ4 A;  5AR0 A;  1G99 A;  3O9R A;  2ZWH A;  4MDB A;  4PHT X;  1BA0 A;  3MN9 A;  1GLB G;  4JKD A;  1BOT O;  4WYB A;  3KWI A;  3AY9 A;  3LM2 A;  2NRV A;  3CJA A;  4A59 A;  3CF5 L;  5AZJ A;  2GTD A;  1NGH A;  1HKG A;  1K73 O;  4IWV A;  2ZJR L;  1QHA A;  5BR9 A;  1XUP O;  4RTF D;  4AM6 A;  2BUP A;  4C23 A;  1HUX A;  3AGR A;  2BH1 A;  4H5T A;  4DKW A;  1ATN A;  5HL7 L;  3CC2 N;  4BRP A;  3ZET B;  5M1O A;  3FZK A;  5JIC A;  3AGK A;  3I55 N;  1C0G A;  3A5M C;  4H03 B;  3WXL A;  3CCU N;  3FGU A;  1X9J A;  4I6M A;  3O9U A;  1IJJ A;  2J4R A;  3CCV N;  1OVY A;  5BRF A;  4DCH A;  3FLC O;  2QWR A;  3MN7 A;  3CC4 N;  3R3L A;  1NGG A;  3H3N O;  5AQK A;  2ASM A;  2E2N A;  3E9L A;  3IKM A;  4H0V B;  5KQD A;  5JLH A;  3DXM A;  2HOE A;  3WEE A;  2Q1N A;  1HX1 A;  1LOT B;  4IZ9 A;  3TSP A;  3VF2 A;  4BRL A;  1R59 O;  3G71 N;  3P39 A;  4BY9 C;  2W41 A;  3MCA B;  1S72 N;  4BVO A;  3L6Q A;  3CXC M;  3GDQ A;  4JN4 A;  1OKJ A;  3RVC A;  3TU5 A;  4PKI A;  2H3G X;  4XEI A;  4NLC A;  3ID8 A;  3VEN A;  3F5T A;  5AQZ A;  4R79 A;  1YUW A;  2KHO A;  3MWT A;  1K9M O;  3MK6 A;  3MX2 A;  3PIO L;  3O4W A;  3AAR A;  3ENH A;  5KQ8 A;  4GV3 A;  3HZ6 A;  5ADX H;  1VAZ A;  3SAG A;  2OAN A;  1Q81 O;  3EL2 A;  4ISG A;  1GLL O;  2ASP A;  5AQJ A;  3IFR A;  4BGA A;  4CZE A;  3QFP A;  3HI0 A;  5LY3 A;  5B8H A;  5JLF A;  4ILH A;  3C65 A;  2QW9 A;  5M1N A;  1NGE A;  4FOE A;  4H5R A;  3MN5 A;  4GY2 B;  2OTJ N;  1JCF A;  1U2V A;  3T7Z A;  1Q7Y O;  4JK7 A;  3A5L C;  3VEO A;  5AQL A;  3DXM B;  3WEE B;  4HTL A;  4CBW A;  2P9U B;  2YJE A;  3FZF A;  1TYQ A;  3JXU A;  1YF5 L;  3VEV A;  3WXJ A;  4OO1 J;  3ENB A;  4BR7 A;  4BRM A;  1IG8 A;  1NGI A;  1U6Z A;  4CI6 A;  3RSE B;  1NGJ A;  3VEX A;  5KPR A;  1NGD A;  4WQ5 C;  3CPE A;  3DAW A;  5F2R A;  1JJ2 M;  3B8A X;  5DM7 L;  4IO8 A;  3O9S A;  3F2K A;  2Q31 A;  2FF6 A;  1QQM A;  2V51 B;  1VQ9 N;  1W97 L;  2NRZ A;  3VOV A;  4DHY A;  2CGK A;  3O8M A;  1HPM A;  2NZT A;  4CBX A;  3I56 N;  1KQS M;  1CZA N;  2A3Z A;  3F9M A;  4EAH D;  4WCE L;  3L0Q A;  4BRO A;  4C1N K;  3E66 A;  3E9P A;  3O9Q A;  4KH6 A;  1DKG D;  4FWN A;  5BRE A;  3O1W A;  4CZI A;  3IMX A;  3SMS A;  3VGL A;  4EIA A;  2QM1 A;  3MWP A;  5BRD A;  4WF9 L;  1D4X A;  2JWL A;  2QTD A;  4K43 A;  3M5R A;  3SBG A;  3SJH A;  4AF1 A;  2E20 A;  4JKG B;  3J7Z O;  2V7Y A;  2YHX A;  3A5N C;  3EE8 A;  5EVZ A;  4DB3 A;  3PLA A;  4A62 A;  3ZET A;  5E84 A;  4Z94 A;  1ESV A;  4JD2 A;  3MN6 A;  2VWB A;  4YOW A;  5LJV A;  3TPQ A;  5FPN A;  2RE2 A;  2AP1 A;  4JAX A;  1WOQ A;  2A5X A;  4L3Q A;  2FXU A;  1QQN A;  2E2Q A;  4CZM A;  4EHT A;  3CHW A;  2NRW A;  2QWQ A;  3EE9 A;  2HBM A;  3CET A;  4QS8 A;  1BG3 A;  4BR5 A;  2PFU A;  5F0X A;  5DM6 L;  4BC5 A;  4O8K A;  4H5W A;  5M1Q A;  3UE5 A;  2I7P A;  3CER A;  2ZGZ A;  4IDH A;  2WC9 A;  3ZYY X;  2FLO A;  3H45 C;  1KAX A;  3OBY A;  4RCH A;  5BN9 A;  2IIR A;  3O6W A;  1HLU A;  4B9Q A;  1HJO A;  4IOC L;  2E1Y A;  1N8R O;  3HOS A;  4MLH A;  1SAZ A;  2HF3 A;  4M63 C;  4IEI A;  2ZJP L;  2HBJ A;  2JWK A;  4JEP A;  4M7X A;  3FFK B;  4ISF A;  4OPA A;  3HSC A;  4YDU A;  3VF4 A;  3N4P A;  2VGM A;  2VCP A;  5LJW A;  3CCR N;  1VQL N;  4BRN A;  4JD2 B;  5AQQ A;  4F9O A;  4BRI A;  5F1X A;  1YI2 N;  3CJ9 A;  4BR4 A;  4ISE A;  5AQR A;  4BQZ A;  2OTL N;  5C0Y A;  4BRC A;  5GIO A;  3CME N;  3GOI A;  3K9J A;  4WFA L;  2P9P A;  3U9D A;  3CCM N;  4FWP A;  4A2A A;  1BU6 O;  1XC3 A;  4M7Y A;  4FO0 A;  1Z05 A;  4FWO A;  3QBX A;  2F7T A;  4H0Y B;  2YHY A;  5ADX A;  1GLJ O;  1ATS A;  3NVM A;  4XH1 A;  5AQG A;  2BTF A;  5BPL A;  2P9U A;  5AQS A;  4BRG A;  3M6G A;  3OA9 A;  1NM1 A;  3N4Q A;  3ZX2 A;  3HRG A;  2AA4 A;  2GWJ A;  4H0O A;  3EKU A;  2YCH A;  4YOR A;  3RSE A;  5TKY A;  4YOX A;  4GV6 A;  1W2B M;  3H6E A;  2IVN A;  1VQ7 N;  4PL7 A;  1Q86 O;  2ZJQ L;  3O5B A;  3TSQ A;  4CD1 A;  3BUZ B;  3WXI A;  1M1K O;  3LL3 A;  3LDQ A;  4A2B A;  3CJC A;  3TTC A;  3VER A;  3VTI A;  4YOT A;  3O08 A;  2IVO A;  5AQV A;  2E88 A;  1M90 O;  2QXL A;  3E1Y A;  1YJN N;  2QWP A;  3FZH A;  1QQO A;  3WUH A;  5C15 A;  1X3N A;  5TKW A;  1E4F T;  5C10 A;  3M3Z A;  3K9K A;  3CCE N;  1S3X A;  2FSK A;  1MA9 B;  1VQK N;  4H5N A;  1YIJ N;  4JKA A;  3GG4 A;  2P9P B;  3TTF A;  2FSN A;  1ZBS A;  3CQY A;  4JKG A;  5AQW A;  1DGK N;  1GLA G;  3P38 A;  2Q36 A;  3FR0 A;  2V52 B;  5AQY A;  1GLE G;  3EKS A;  4BRF A;  1H1V A;  3ATU A;  3TSU A;  4CZF A;  2KKZ A;  4BRA A;  3CJ1 A;  3CD6 N;  1Q82 O;  4JK8 A;  2D0P A;  3KZB A;  3P31 A;  1Y64 A;  4PKH A;  2P9I A;  2QWN A;  2Q0R A;  5AQU A;  3G6E N;  1KAY A;  3W0L A;  3R9P A;  1V4T A;  4GNI A;  3ENO A;  4A5B A;  2FSJ A;  3CJ7 A;  2CH5 A;  4BG8 A;  1K8A O;  1HKC A;  4IEE A;  1YIT N;  4K25 A;  3CIP A;  5EOY A;  3C6H A;  4BG9 A;  3CCQ N;  3VEY A;  3KHY A;  3EO3 A;  2QWM A;  3H46 O;  2EWS A;  2NRT A;  3GE1 A;  3H1V X;  3VTH A;  1YJW N;  2D0O A;  4BR2 A;  4BRE A;  2NRX A;  3ID6 A;  4JHD B;  4CZL A;  4JKF A;  1YJ9 N;  1VQ6 N;  1SS6 A;  3U8X A;  2Q2R A;  4WQ4 C;  4B1U B;  4J8F A;  5ELZ A;  3J8A A;  4BRQ A;  3WXK A;  1NGF A;  3MX5 A;  1NMD A;  3JS6 A;  3HOT A;  2E1Z A;  3GL1 A;  1GLD G;  1MWM A;  1S22 A;  5AQT A;  3VF6 A;  4IO9 L;  4YOY A;  3W3D A;  5BN8 A;  4JNE A;  5M1P A;  4CZK A;  1YHQ N;  1RDW X;  5EX5 A;  2QEX N;  1MDU B;  4KH5 A;  1ZC6 A;  4UY8 O;  3R8E A;  3HBT A;  1T6C A;  3D2E B;  4XH4 A;  1C0F A;  4BRD A;  5C2D A;  2P9I B;  3UKR B;  2KLA A;  2P9L B;  5C2F A;  2P9K A;  4WFN L;  4CBU A;  2D4W A;  4NB4 A;  1TUU A;  2PAV A;  4H0T B;  2YJF A;  3WQT A;  4K42 A;  4FWL A;  5I9E B;  4IFE A;  3OBW A;  5GAE P;  4WQ5 A;  1RFQ A;  5C12 A;  3SLC A;  3T69 A;  2GX9 A;  3Q7B A;  4IOX A;  3CCJ N;  3C7N B;  3QB0 A;  4IJA A;  5BRH A;  5FPM A;  4FWS A;  3CC7 N;  4FWM A;  1QVF M;  3R6M A;  5AQO A;  3VGM A;  2VGN A;  2CGL A;  2D1K A;  4YOU A;  2QI2 A;  4A57 A;  2GEL A;  2P9N B;  1K8K A;  4ILJ A;  4QS9 A;  2V7Z A;  2HBL A;  3H1Q A;  4JKH A;  3A8Y A;  3IDH A;  2WFB A;  5CE3 A;  5GAD P;  3M1F A;  3ULE B;  1KAZ A;  3FE1 A;  3ZEU B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...