4BVUA

Structure of shigella effector ospg in complex with host ubch5c- ubiquitin conjugate
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
171
structure length
171
Chain Sequence
EPILGKLIGQGSTAEIFEDVNDSSALYKKYDLIGNQYNEILEMAWQESELFNAFYGDEASVVIQYGGDVYLRMLRVPGTPLSDIDTADIPDNIESLYLQLICKLNELSIIHYDLNTGNMLYDKESESLFPIDFRNIYAEYYAATKKDKEIIDRRLQMRTNDFYSLLNRKYL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title E2~Ub Conjugates Regulate the Kinase Activity of Shigella Effector Ospg During Pathogenesis.
pubmed doi rcsb
source organism Shigella flexneri
molecule tags Transferase/ligase/protein binding
molecule keywords PROTEIN KINASE OSPG
total genus 47
structure length 171
sequence length 171
ec nomenclature
pdb deposition date 2013-06-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4bvuA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4bvuA01
4F7JA 3ORIA 5LVMA 1WBPA 3PJ2A 4AZSA 4D4VA 2R7BA 4IIRA 3WARA 4TWPA 3S4QA 2O5KA 4EOMA 1OL1A 2B52A 4CG9A 3PSDA 4M8TA 1H1QA 2CKPA 2JDSA 4AACA 2WU7A 2PSQA 4M69A 3KMUA 4Q5HA 3DDPA 3Q2JA 5HCXA 4Q9SA 5GZ9A 2WMWA 4QNYA 4QT1A 4CFUA 3EFJA 4O0SA 3FKNA 3RAHA 1U46A 4FEWA 2IZSA 3NUNA 4QP9A 3LM0A 4M97A 1YDSE 4QQTA 3ZO3A 5CANA 2BMCA 3PE1A 5BVKA 3MPMA 4WIHA 5ACBC 4EH8A 4EOPA 4U40A 1PJKA 4GK3A 3QUEA 2YM8A 1OPLA 3BZ3A 5HE1A 3C0IA 3VBWA 4AZTA 3HMMA 3FC2A 4DGLC 2R3MA 4EQMA 4GIIA 5FM3A 3R0TA 4AZWA 1OBDA 1PY5A 1TVOA 4G3FA 4RJ8A 4ANBA 2FA2A 4NZWB 4YJSA 3RHXA 1XR1A 5HESA 2JEDA 2FB8A 3NGAA 5FBOA 3ANQA 3D2KA 3FKOA 2BCJA 4O0YA 3DNEA 2H9VA 2ITVA 4QTAA 4ASXA 4D4YA 2ZAZA 4DH1A 4L7SA 4FTOA 2IZUA 5CALA 2C6TA 3O2MA 5JGDA 2PUPA 3NPCA 3UYTA 2CDZA 4FOCA 4LL5A 2UW3A 4J52A 3EOCA 3ZM4A 4OT6A 1KE6A 4D4RA 1Y8GA 3FI3A 3GUBA 5AR7A 3ZZEA 4A4LA 2Q83A 4EK5A 2W7XA 3ORLA 5AUTA 4FBXA 3CP9A 4NCTA 4QPMA 4DH5A 4UMUA 1JNKA 4J8MA 2XK6A 4A9UA 4USEA 1VJYA 3R22A 3T3UA 5JT2A 5HNGA 1MRUA 1OITA 5IA5A 2O63A 5CY3A 4YR8A 4EUUA 5A4QA 1IEPA 3QRTA 1QCFA 2XUUA 2YACA 4AGWA 3E87A 2QHMA 3SC1A 4BCOA 2ZV7A 3AQVA 2BZHB 1PYEA 3VBVA 3FZSA 4UMQA 3EYHA 4JIAA 3LQ8A 4A7CA 4R7HA 3SVVA 4YPSA 5IEVA 4FG9A 3GU5A 4CFVA 4KKHA 1V0BA 5KMLA 5GIOE 2OXXA 4CCUA 3GQLA 2YDKA 1ZYDA 3M42A 2PMIA 2DS1A 2R64A 3GCSA 4J99A 3G90X 3COIA 3NWWA 3OG7A 4V0GA 4EYMA 1OKVA 2PY3A 5EI2A 2YCRA 3BIZA 3C13A 3RI1A 5DYJA 1Q8TA 3H3CA 5EYCA 5HLPA 3ZH8A 2ZV8A 4M68A 4BDAA 3LJ0A 1J7LA 4YUQA 1YXUA 2B4SB 4NTTA 1OIYA 3DV3A 3TCPA 5B2KA 4UZHA 2XYNA 4OT5A 1LR4A 3MB7A 3HV7A 5EYKA 2LAVA 5M56A 3KFAA 2VU3A 4FTQA 3ORPA 4XV9A 3TZ9A 2YA9A 5M07A 4XG9A 4C3PA 3ELJA 3O23A 2NRYA 3QQJA 4IVDA 3O17A 4FZ6A 3VBTA 4N4SA 3QTQA 3HV6A 4LGHA 4XNEA 4WD5A 4YGAA 2JAMA 3R7UA 3RJCA 3SRVB 3G33A 2C1AA 2HWPA 3QQLA 3C1XA 4E26A 5K0XA 5F9EA 2BHEA 4FIEA 4ERKA 4FEXA 3R1SA 1LEZA 2UZWE 4A9TA 5IMEA 3IDBA 4GKIA 1ZARA 5E8SA 2VWXA 3W2OA 3WILA 1M14A 4F1MA 4TRLA 4USDA 3VRYA 4RA5A 4E5AX 3NNVA 4KS8A 2OJJA 3GC8A 1BI8A 1YDTE 3P23A 4FVPA 4LMNA 5BUJA 4KSPA 3OEZA 3R2YA 4TWOA 3CQWA 4TYJA 2JBOA 2R9SA 3EN7A 3NNUA 4OTPA 4F6SA 4M67A 4DTBA 5CEKA 5ANGA 3HMOA 4QMXA 4O1PA 5I4NA 1BUHA 1O6KA 3BHUA 2DWBA 2YJSA 3QZGA 4NKAA 5HTCA 5E92A 2BZKB 1M52A 5GJGA 3F3ZA 5EI6A 5K4JA 3SXFA 3QD3A 4YNEA 3KXNA 4IX5A 4R1YA 2QOKA 4WOVA 4AX8A 4E7WA 4GFMA 4PUZA 3Q53A 3QHWA 1DI9A 3VF8A 3I7CA 3WE4A 4EK3A 3F88A 1W7HA 3HEGA 3QKLA 4HVGA 1FQ1B 4PDYA 2J5FA 4YJPA 2WTDA 1GZ8A 2Y4IC 4IZAA 2R3IA 2ITOA 3QFVA 3RPOA 4LV8A 1YWNA 3VJOA 3G0EA 3R8PA 3MIAA 2QURA 4I92A 4K6ZA 3R6XA 4ANQA 3E8EA 5J1WA 3LQ5A 4I5MA 5BYZA 4U97A 3PXRA 4LGDA 3ET7A 2FVDA 1JKKA 5LVOA 5LCJA 3BGZA 4W8DA 1MQBA 4A9SA 5CAUA 3CPCA 5M44A 5AP0A 2JDVA 2QVSE 3TTIA 5CEQA 4F08A 4RX8A 3V01A 2OZAA 4EL9A 3NX8A 5AAGA 4FEUA 1JQHA 2R0UA 1YXTA 3QYZA 4EHZA 4APCA 4EWQA 1G3NA 1WMKA 2W1CA 2Y0AA 4FIIA 3G6GA 4IACA 4KIQA 1U4DA 4C0TA 1EH4A 4Y73A 4O86A 4FL3A 2YM4A 5HHWA 1ERKA 2CKEA 2CMWA 4JBVA 4QMLA 4S31A 3QGWA 4FIHA 4ZY5A 3V5JA 5EQYA 3LFQA 4DH7A 4JT3A 3BEGA 5L2IA 4XH6A 2YDIA 3CKXA 3TT0A 1FOTA 2VTAA 3W10A 3UQGA 1UU8A 4LFIA 3GCPA 4ALWA 3BBWA 4QRCA 3KN5A 2W9FB 1BMKA 2QD9A 4EHGA 4EUTA 2C0TA 4LYNA 1U54B 4RQKA 5FP5A 3AC4A 4C4HA 2ZV9A 3E8CA 4YZBA 4EBWA 4EKLA 3JVRA 4F9CA 4D5HA 4E6AA 1WVYA 2A27A 2PVKA 5J8IA 5IKWA 4AA5A 4RPVA 4U81A 4BN1A 3U8WA 4K2RA 2GU8A 2O2UA 3E92A 5CENA 3F7WA 3ZDIA 4OGRA 3UOKA 3LFAA 1APME 4EH4A 2ZMDA 3UNJA 3E93A 3IQ7A 4PP9A 1OM1A 3CE3A 3PVBA 3CR0A 3NUYA 3H10A 3KA0A 3QQFA 2XH5A 3D7TB 3R28A 4X2KA 4XS2A 2YM3A 2PYWA 3D15A 2C68A 2XIZA 3KK8A 2PZ5A 2R3JA 4TY1A 1FGIA 4GJ2A 3QTWA 3R63A 2WTJA 2P2HA 3A8XA 4Q2AA 3G2FA 2O65A 3VVHA 1GIIA 3SXRA 4UMRA 2BHHA 3PFQA 4FKLA 4R3PA 4DEHA 3V5LA 4M84A 3ORMA 1BL6A 4PTGA 5CXZA 5L2QA 3C4FA 4OTRA 4FZFB 4AW1A 3U6HA 1YKRA 2X7GA 4AZEA 2RKUA 3O8PA 4Y8DA 3HRBA 3JYAA 1WBWA 2XEZA 3OT8A 4C4JA 4CQGA 3KY2A 3QGYA 2VWZA 4AWIA 1SVGA 3L8PA 3MVLA 1ZOGA 5CSWA 5H8GA 4FZDB 1ZYJA 2F4JA 1M2QA 3A61A 3GC9A 4RC3A 4B8LA 3GU4A 2F7EE 4FKSA 2CN8A 3MVMA 2OU7A 5AV2A 1PXMA 4WNMA 2GCDA 5AX9A 4BTJA 4E8AA 1RQQA 1VR2A 2AC3A 4XJ0A 3G5DA 4FSTA 4JAJA 4WUNA 4CSVA 2XYUA 4IC7A 1J3HA 3ORTA 3AT2A 4CXAA 2RFNA 5CEMA 5CF6A 5KKRB 3CSVA 4HCUA 5CX9A 5JH6A 2XIYA 3OBGA 5EM6A 3Q60A 3PPKA 3Q9YA 2WTCA 1XJDA 4FV8A 5B0XA 2VWUA 4A9YA 1PMEA 2WMVA 4BDKA 1YQJA 4FK3A 3QQHA 3QUPA 5J5SA 2GDOA 4FR4A 5J5TA 2CGWA 3L8XA 1PXNA 3D2IA 4G1WA 5H2UA 5L2SA 3AMYA 3Q2MA 2IJMA 2ZOQA 4F4PA 2B9JA 1R3CA 4BHNA 4DFNA 1FVRA 4FV3A 5KO1A 3FYKX 2YFXA 4YJQA 3SAYA 3T3VA 4FL1A 4ZOGA 3PXKA 1RJBA 2HIWA 2QNJA 4AW5A 2QOIA 5CSVA 1OPJA 3LIJA 5DT4A 3RK7A 4CG8A 2W1FA 2OH0E 4AOJA 3TUDA 4HPUE 4ITIA 2F7ZE 5AR2A 5C01A 3TKIA 4ACCA 4EI4A 3RM6A 1UNHA 5EI8A 3GCQA 3OWPA 2JITA 4I23A 3V5WA 5AV3A 3HP2A 5CI7A 1JSUA 2J0LA 4YMJA 4ITHA 2OJFE 3IONA 4FG8A 2GNJA 3BHVA 4FIFA 3V5PA 1SYKA 4JL9A 5FDPA 2OG8A 5FD2A 5K3YA 3B8QA 1DI8A 4OR5A 5KHWA 1QPEA 4GCJA 2VWVA 5IA4A 5DGZA 1OL2A 2X4ZA 3SW7A 4C35A 3LCTA 1UKIA 3RP9A 4EHEA 1BI7A 2RSVA 4TPTA 4L43A 4O7NA 1GAGA 2W05A 4MVFA 4QTDA 4FV2A 2PMOX 2GNIA 4GUBA 4S34A 4CYIA 4FKUA 4EH7A 3BE2A 4IE9A 4IANA 5DG5A 3S95A 4V05A 4YJNA 2V22A 3ULZA 3K54A 3LCDA 3MFRA 4Y95A 2Y6MA 3FLWA 5DI1A 5D10A 3R1QA 4I5HA 4V04A 3DLZA 1HOWA 3NS9A 3QCQA 5EM5A 3HAVA 3O8TA 3Q96A 2IW6A 3P7CA 3UO4A 5IH6A 1XBBA 2BZIB 4QMMA 3SOAA 2HXQA 3LCKA 5AR8A 3W2CA 5DMZA 5E7RA 5AV1A 5TE0A 4CVAA 5C03A 2H6DA 3LMHA 3LJ2A 3C4EA 3LW0A 1M7NA 3DQWA 4P90A 5JRSA 4C37A 4ZJJA 4BCFA 4FSYA 5AFVA 5EQEA 4XG3A 3BYMA 4ZY4A 2QQ7A 2WXVA 3VAPA 4MCVA 2HZIA 5T68A 5I0BA 5AR3A 2GQGA 5D11A 2GS2A 4JLCA 4WUAA 5DH3A 4YJUA 3I7BA 3Q9XA 2BUJA 3I5ZA 1XQZA 4GK4A 2YIRA 3ZSGA 5KMKA 4BGGA 1KOBA 4XOYA 3ZRLA 1UNLA 4Q9ZA 4R77A 4QP1A 2YABA 3C4XA 3K3JA 4IAZA 5G6VA 1IAJA 5B2LA 2X9EA 4NSTA 5FDXA 1CDKA 3VC4A 4X3FC 2CLXA 2CGXA 1YXSA 2HY81 2IG7A 3BU5A 5AA9A 3AT4A 2VTLA 4RLKA 3OWLA 4DYMA 4DG2E 3CY3A 4YURA 4AUAA 1WBTA 2XKFA 4O0TA 4AE9A 5E8TA 5JZNA 3VHKA 1Q61A 1ZMVA 3QHRA 4JAIA 4O0WA 3C7QA 5HKMA 4YU2A 2BFXA 2XK8A 4GRBA 4QYGA 2X8DA 1NVQA 2KTYA 1ZOHA 1LP4A 5ANOA 5F94A 4LRJA 4F6UA 3IW8A 3VS1A 5KMIA 4XV3A 3MI9A 2ZM1A 4PNIA 1PKDA 3JXWA 5KZIA 4XOZA 3U4UA 4FYOA 3JY0A 4AAAA 3UIUA 3FXWA 4G17A 4FZAB 3P79A 4C7TA 4FIJA 2WOUA 3OD6X 4U45A 4ZSEA 4FNWA 3D7ZA 3ORXA 3IOPA 3Q3BA 3QRUA 3DBQA 4TZRA 3ID6C 5JFXA 2BRBA 5FEDA 1W82A 4FSMA 1UNGA 3VN9A 2QU6A 5AUUA 2QO9A 2QLQA 3K5UA 5FTOA 4O2ZA 4EC9A 3BX5A 3REPA 3MESA 5AM6A 4XP2A 4RIOA 4IB0A 2C6DA 1R0EA 2VRXA 4HYIA 4FSZA 4BYJA 4D58A 4L42A 3FMMA 2OBJA 3P5KA 2YWPA 4RVKA 4BC6A 3CD8A 1KUTA 5IQHA 2XNEA 4WNOA 3RINA 1H1PA 4KRCA 5L2WA 3GU8A 4XUFA 4G3GA 1YHSA 2J6MA 3TG1A 2WTWA 1LEWA 3K3IA 4D1SA 2BTRA 3FZ1A 3GOPA 3DK6A 2XNMA 3DKCA 2CN5A 4AA4A 4S32A 3ACJA 5DRDA 3EQFA 5HG9A 3IDPA 3UO6A 5TO8A 4ZP5A 3VS7A 1F3MC 2LGCA 4MKCA 4UBAA 2IW8A 3VW6A 3F2NA 1OVEA 4CT2A 4B0GA 3AGLA 1FVTA 4X3JA 2XVDA 1GZKA 4WT6A 2CKOA 3A60A 3WF5A 3Q6WA 1H0WA 5IU2A 1LUFA 5K4IA 4XV1A 4WBOA 2XP2A 2VTTA 1BYGA 5A4TA 3ERKA 3RWQA 2FGIA 4XG8A 5FG8A 4CZYB 1M17A 4IMYA 3HGKA 1Q97A 3MH1A 4KA3A 4F70A 4X2FA 3R00A 5KZ0A 3RPSA 2ITYA 3GQIA 3JUHA 3LLAA 3H30A 2OI4X 3NCGA 5D7AA 3U55A 4BBFA 4EKKA 4JRNA 3UPZA 4DFBA 3MY0A 2IVSA 4IAIA 5FWKK 4DGOA 1Z57A 3IPHA 5IA3A 5AM7A 4BDEA 5J95A 5AADA 3QCSA 1IR3A 4K33A 1H28A 3MTFA 5T6KA 4EK6A 4BIBA 4KNBA 2RF9A 2ZVAA 5LMKC 2JC6A 4FEVA 1JKTA 1V1KA 2I0HA 1NVSA 1YRPA 3DLSA 1GY3A 4XRLA 2NO3A 3I6WA 3OTVA 4OBQA 3RAWA 4IJ9A 4RIXB 3GU7A 3OROA 3Q6UA 4GG7A 2WPAA 4J8NA 1JVPP 3NSZA 3CJGA 2PVMA 3LZBA 4GEOA 4L8MA 4O91A 5IF1A 3MVJA 4IX3A 3BI6A 5EFQA 3E7VA 3HYHA 5DWRA 5IH4A 2WMTA 4JR7A 3KCFA 3G0FA 1UU3A 3FMEA 3GEQA 4BVUA 2WMSA 1P2AA 2GNFA 3BU3A 4IW0A 2C3LA 3PY1A 5L2TA 2B53A 3FMHA 4NW6A 4FKGA 2B0QA 4DT8A 3CLYA 3R30A 4OUCA 3TL8A 2VGPA 2O3PA 2XB7A 1A9UA 3N51A 3QZIA 3W33A 2C5XA 4HW7A 5LOHA 4O7VA 4CYJA 1ZOEA 1VEBA 1T45A 2X2KA 4IWPA 4QTBA 3F66A 2X0GA 3U9CA 3POOA 2EB3A 2W5AA 1K2PA 3F69A 3NYVA 4XEYA 4HVDA 4L52A 4CD0A 3P78A 2B9FA 3PPZA 3NCZA 5K0KA 4BZNA 3N9XA 3TZ8A 3RKBA 4GFOA 4MBJA 4ZSGA 3NVMB 4JQ7A 4IB1A 2F2CB 5AEPA 3E5AA 2QU5A 3FDNA 3MN3A 2HCKA 4YTHA 5EYDA 4YJOA 5HGIA 4EOSA 3PJCA 5EKNA 3BYSA 4H58A 2WQOA 3QTSA 4EH9A 4QO9A 4CZTA 2XMYA 2G2IA 3WZDA 5LJJA 2XNGA 4GKHA 4OTWA 3ALOA 4U8ZA 5A46A 4IM0A 3A7FA 4FICA 4K8AA 4PPBA 2CGVA 4HZSA 4AFJA 2PVLA 3RMFA 4FTMA 4U44A 3UVQA 3ZEWA 2VX0A 4YBJA 2W17A 4QYEA 2YM6A 5L6OA 3U6JA 3V6RA 4D2SA 2ERZE 3HLLA 3ZLYA 5CQUA 5HICA 5A4CA 4HCVA 4KRDA 1UWHA 3E64A 5AUXA 5TR6A 1ZXEA 5I9VA 3BGQA 4C57A 3HL7A 3HV4A 3MW1A 4BCIA 2XBJA 3TWJA 1H4LA 1GOLA 2JDRA 3VIDA 4MTAA 3NNXA 2W06A 4OLIA 4PTCA 1KSWA 4BDDA 5CAVA 3C0HA 5GZAA 2YWVA 2O8YA 4DGGA 1TKIA 2J4ZA 4RFYA 2WNTA 4RWIA 2WKMA 5L8LA 5BYLA 4JOAA 2QC6A 5FXQA 1PYXA 4JI9A 5HCYA 3UPXA 2C6MA 2UW8A 4D2TA 1J7IA 5L3AA 4H1JA 4MQ1A 2HYYA 4O7RA 3PXQA 3DKOA 4QQ5A 2VO7A 4ZJVA 3PWYA 4CLIA 3PUPA 1Y91A 4FV1A 4NJDA 3QD4A 2JKMA 4GU6A 5AMNA 4OBPA 2OZOA 2Y8OA 5HX8A 4DC2A 5CU6A 2J5EA 4HYSA 4KIKB 1XH8A 4QP3A 4EOOA 1GIHA 4RJ5A 3P7BA 4B8MA 2XKDA 4FV4A 5TT7A 4AP7A 5CAOA 2YZAA 4ASZA 4WBBB 5KKRC 3WYXA 3FI8A 3M1SA 3IW6A 3G9LX 3FZPA 4KIKA 4TN6A 5I3OA 5FTGA 3IKAA 2DQ7X 1V0OA 4FTJA 4JX3A 4L3LA 3A7HA 5DN3A 4USFA 3FSKA 4AT5A 4EQCA 2UW0A 3E3BX 3ZC6A 2JIUA 1OMWA 4XHKB 5L8KA 4NEUA 5D12A 5EHYA 3FUPA 4BB4A 4D9TA 1XBAA 4FTCA 1STCE 4EONA 1ZRZA 3MIYA 4I4EA 3M11A 4MD8E 5CU4A 2XM9A 4QMNA 4DA5A 5AP4A 1UU7A 3E8DA 4TYHB 3O8UA 1NW1A 2J0JA 4EH5A 4ENYA 1XH6A 5EDQA 3ZSIA 2WMAA 4JBPA 3H0YA 1Y6BA 4L3PA 2C5YA 4GT5A 4QMZA 5CU2A 5IQFA 2ITXA 4ZIMA 4BDGA 4J96A 2C6EA 4FEQA 2YLFA 4FSQA 1OIUA 2GFCA 3A8WA 4IEBA 3VBYA 4ENXA 4L68A 3OXIA 4E20A 3QRKA 3UODA 3OCGA 3UZPA 3KXZA 3U9NA 3UQFA 2XZSA 2BDFA 3F3VA 3FXZA 4IADA 2X7OA 4U80A 2Q0NA 3HECA 5DFPA 2HAKA 3LOKA 3GNIB 3PZEA 4FSUA 5HD7A 4F0FA 2YCSA 3QWKA 5I9ZA 1FBNA 4RMZA 5FUTA 5AP3A 5B2MA 3OUKA 4P2KA 4X21A 1MP8A 4I6HA 4ASEA 3VNTA 4CRSA 3P86A 4O21A 4DBNA 3KRLA 5KHXA 4IB5A 2VZ6A 2IVVA 3FLNC 4YHJA 4JQEA 4O2PA 1F5QA 3C0GA 3MVHA 4NW5A 4NM7A 2QG5A 3QLGA 4HYUA 3U51A 4L6QA 4F1OA 3ZO2A 1SMHA 3Q52A 1HCLA 3AGMA 3DFAA 4GT3A 4FL2A 4X2GA 2QLUA 4O7WA 5HZNA 5GIPE 3PRFA 2WGJA 3VBXA 4FGBA 4YP8A 4C4FA 1YOJA 5JEBA 4UB7A 2QOCA 2VWIA 4L3JA 3ZUUA 3D9VA 3OC1A 3NAYA 4CEGA 1GZOA 5HEZA 2C6LA 3ACKA 2WQEA 2WMRA 3BWFA 4J71A 4AN3A 4TYGA 3WF8A 3PIYA 1AQ1A 2VWBA 5C9CA 1OECA 5BUEA 4O7TA 2BILB 4OTQA 4CKJA 4QMUA 1ZYLA 4OTGA 5LMKA 3OMVA 3E8NA 2E9PA 5C8KA 5CS6A 2BIKB 5M4CA 3A2CA 1YI6A 2I0EA 3C50A 5HIBA 5BQ0A 4IAAA 5M51A 1ZYSA 2XK7A 3LXKA 3RAIA 2OIQA 4ANOA 3D5WA 3DJ6A 1MUOA 3UNKA 4OTHA 5TOZA 4FVRA 2IVUA 3K2LA 4YC6A 1KE8A 3QKKA 2ZB1A 1H8FA 3EQGA 5LWNA 3KREA 4MAOA 4AZVA 4I5PA 4LM5A 2IN6A 4RX9A 4WNPA 4TXCA 2Z8CA 3ZXZA 1PKGA 1OIRA 4O0UA 4CFMA 5AR5A 3M2WA 4QYYA 2YCQA 1MQ4A 4TTHB 4K1BA 4HVIA 5JFSA 1GIJA 3SLSA 4I93A 4JS8A 1QPDA 2R3PA 2E9NA 1U59A 3AD6A 3DAKA 4RWKA 4O7YA 2G2FA 5HBJA 3VW8A 5DA3A 4D28A 4BRXA 4CCBA 1A06A 3L8VA 4DEAA 2VTJA 2VTMA 5HCZA 4B9DA 4UMTA 3KRJA 4QPAA 4DFYA 5HBHA 2BRHA 5CT0A 5AJQA 4D9UA 5EW3A 2C1BA 4I0TA 4WG5A 4DEDA 3TNIA 1QPCA 3FMJA 4X3FA 3AG9A 3W2QA 3BWJA 4YSJA 5JGAA 4N6ZA 1KOAA 3QU0A 2GS6A 4LL0A 1ZLTA 4ZTHA 5I9WA 5M57A 4G9CA 3CTJA 2CJMA 1P14A 4XLIA 4CLJA 3U54A 2FH9A 4JR3A 1JWHA 3CTQA 4C4GA 5IMXA 3MV5A 3NUXA 4LG4A 2BZJA 4Z3VA 3NIZA 5M09A 2P2IA 4WG3A 3RPRA 4E4LA 5HO7A 2OJGA 2BDJA 3QYWA 3EB0A 3NYNA 4RX5A 2VTQA 4IWDA 3ZFMA 1YW2A 1NVRA 2WD1A 4CFFA 5EHLA 1X8BA 3BCEA 1PF8A 1UU9A 3ZUVA 3R9OA 5IG1A 3FL5A 3P7AA 2XIRA 3LVPA 3NW7A 4IZYA 5HVYA 3VUHA 3EN4A 1WCCA 5HNBA 4DE4A 3PPJA 4JDIA 4LRMA 2PULA 2J0MB 4L53A 1SZMA 4JG6A 3S3IA 5AV4A 1CSNA 3V8SA 3UIBA 1U5QA 4A07A 2J0IA 5KBQA 5HG8A 3OTUA 1H00A 3EQRA 2QO2A 2UVXA 3GT8A 4KWPA 4O84A 3QLFA 4MXCA 4FA2A 2VGOA 4I24A 5D9HA 2ACXA 5KMMA 3C9WA 2ZYBA 2UZNA 4JQ8A 4TNBA 3F9NA 3OUNB 3LM5A 3I5NA 4FKQA 4ANSA 3P0MA 1PXIA 2Z02A 4BGQA 1TQIA 3RCJA 3QXPA 4BCMA 3ZHPC 3MS9A 4UXLA 3G15A 5J1VA 2PE0A 1P4OA 3KCKA 2EXCX 3FJQE 4J53A 3TNHA 3DK3A 4G16A 3D83A 2JIVA 2C3JA 2Z7RA 5I9XA 3UQCA 4H39A 3KRRA 3W16A 4O81A 4RWLA 4BKZA 2J2IB 3UDBA 5IEXA 3PY3A 2R3FA 1XBCA 1VYZA 4E4XA 3AC5A 3DDQA 3EQBA 3R73A 5IA0A 1JAMA 3COMA 3FMNA 4GV1A 2A1AB 2PK9A 4U42A 5DT3A 2YCFA 4I41A 3R21A 4A4XA 1Q8YA 4E6QA 5CNNA 1R1WA 1OB3A 4BY9E 4J98A 3LXNA 1XH9A 2OIDA 3BV3A 3B8RA 4XBUA 2V7AA 5JQ8A 3DNDA 3R2BA 4BYIA 3NEWA 2ITPA 5CQWA 3NRMA 3O7LD 5CVFA 4IX6A 1ZY5A 2HELA 4MXOA 3GP0A 3UGCA 1Q8UA 4ARKA 4NH1A 1G8SA 3FPMA 3GFWA 4D2PA 1Q24A 5HVKA 4QMOA 3BEAA 2VNWA 4BCPA 1WFCA 3BE9A 4GL9A 2C5NA 4NT4A 4QP6A 3LE6A 3DKFA 5AUVA 4C61A 3RAKA 3TV4A 2WFYA 3GENA 3DA6A 3QL8A 2OIBA 2YITA 3MGYA 3F3TA 4Y46A 3TNWA 4MXXA 4BDHA 2W1DA 2ZJWA 5EQPA 3VULA 2DYLA 2OKRA 4JBOA 4HNFA 5AV0A 3ATSA 5LVNA 3NUAA 2PVRA 4Z9LA 4MQ2A 4WSYA 5I9YA 4HGSA 5C4KA 4D2WA 4YLKA 4F7NA 2I40A 2YISA 4ZTLA 5AP2A 3SKCA 3R83A 4U0IA 2QOFA 4BF2A 3MSSA 1L8TA 3RM7A 3CQUA 2R3KA 3NDMA 4JRVA 5DPVA 5IQBA 2B9HA 4OTDA 5FGKA 5EDRA 3ZM9A 1H27A 4CKIA 4BWKA 3PIZA 5I5ZA 2YAKA 4JNWA 2YLEA 3DTWA 3EFLA 2O0UA 1OGUA 2ETMA 3AD5A 3DPKA 3FQEA 3II5A 3PJ1A 3TNQB 2X4FA 4DAWA 3R9NA 4D2VA 3HZTA 4LGGA 3OWKA 4FV0A 5EDPA 5HU3A 2X2LA 3D5XA 3QX4A 2OGVA 2W1ZA 4RC4A 3UVPA 3WIGA 3ZC5A 1XH5A 3OS3A 3WF6A 3ZRKA 4BIDA 1IAHA 4NL0A 4IXPA 2CKQA 3BQRA 3R1YA 3IO7A 5ANDA 5G1XA 3SW4A 3E88A 3PP1A 2XM8A 3PVUA 4EOQA 2EB2A 4LI5A 5E90A 5CVHA 2YERA 4EOIA 1JOWB 4IBMA 4M0YA 1H26A 3RK5A 2W1EA 2F2UA 4ZAUA 5KCVA 3FC1X 1GJOA 3FLSA 4YZDA 4L45A 4GW8A 5EHOA 3EKNA 4ZK5A 3TI1A 5A54A 4DCAA 3VQHA 5GINE 4BCQA 2PUNA 4FNXA 1YDRE 4DITA 3FHIA 1DM2A 3G51A 1OUYA 3CD3A 3AXWA 1YWRA 3V3VA 4CV9A 3VS0A 3WBLA 5C8NA 2QOOA 3BV2A 3LXPA 5AP5A 4FKWA 4KD1A 3VS2A 3IW5A 4AT4A 4C4IA 3TJCA 5A4LA 2W5BA 1M7QA 4KB8A 1AGWA 5L6WL 3D4QA 4MBLA 4QNAA 3SG9A 4ZLYA 4L00A 1SM2A 2C0IA 5L8JA 2IW9A 2ZDTA 4J7BA 4AZFA 5AIRA 4MHAA 4TYEA 4WA9A 2IPXA 2OO8X 5D7VA 4EYJA 3R01A 3EYGA 3C4ZA 3FBVA 4NWMA 5M53A 4W4WA 2C3KA 3ROCA 4KBKA 2W4JA 1Q3DA 2OF2A 2VUWA 3DZQA 4U41A 4WKQA 5I9UA 5BYYA 4RVTA 3ALNA 3HDMA 4QMVA 5M08A 2WMUA 3F7ZA 3TTJA 3UZTA 1XO2B 3PLSA 2Q0BA 2ERKA 3O0GA 2CSNA 2WQBA 3I79A 4HYHA 5LQFA 3NYOA 3DBEA 3TM0A 2UV2A 4CMUA 4TYHA 4B99A 1Q5KA 4ZTQA 3GBZA 4FT5A 1VYWA 3SDJA 4U3ZA 3UMXA 5A6OA 5ACKA 4F7LA 2AUHA 4GS6A 1KV1A 4IDVA 4AF3A 3EN5A 4AW0A 2W5HA 3HMPA 2GTMA 1H1WA 2WU6A 5BUIA 3SG8A 1UWJA 3KL8A 5K5XA 4CFWA 4FV7A 5I3RA 1SNUA 4BCKA 3PE2A 4QMWA 3MY1A 4EQUA 2WEVA 2Y9QA 4KKGA 3QRIA 4F65A 3D0EA 3KEXA 3CQEA 3HNGA 5ANEA 4DTKA 3CGOA 1B6CB 2QR8A 4FSNA 2R7IA 4RQVA 3RGFA 4AQCA 5KMNA 3HA6A 4FMQA 2X39A 4RGJA 3H9FA 3H0ZA 3UTOA 5C26A 3COHA 4IAYA 4G3CA 5JN2A 2C6OA 3B2TA 5HE2A 2X9FA 3RCDA 2UZOA 3C5UA 3FY0A 3QX2A 4YLLA 3ZRMA 3BQCA 3HDNA 4EH6A 1NY3A 4E5BA 2R0IA 4PMPA 3ZBFA 5AIKA 5FEEA 3ZFXA 4AG8A 4BKJA 2P3GX 4ZMFA 2F57A 3SXSA 4FVQA 3I81A 3F82A 3Q04A 4IQ6A 5CAPA 3Q4TA 1H1SA 2ESMA 2QKWB 3F6XA 4ACGA 4N57A 1SVHA 4YC3A 5HLWA 4YJTA 5LARA 4ERWA 2R3NA 2WQMA 3IS5A 2F49A 5E8ZA 4BTFA 2W99B 2JBPA 2XCKA 5DVRA 5K5NA 5KMOA 3VF9A 4O83A 1WZYA 2XK9A 4JDKA 5DR2A 4CT1A 4M7IA 1VZOA 4U5JA 4ZTSA 2R3OA 2UZDA 2GFSA 4R7BA 5CZHA 3E3PA 2G1TA 3TN8A 3N4UA 5HTIA 4NFNA 5IDNA 2WB8A 5JRQA 3FEGA 2VN9A 3IGGA 3R1NA 4PL3A 3MDYA 3F5PA 5BVOA 5CEOA 5IA2A 1YVJA 2FSOX 2PVYA 4D5KA 4W4VA 4EC8A 4DEEA 4KABA 3BPRA 4MEDA 4ZS4A 1ZZ2A 3HA8A 2CHLA 3BLRA 2PZRA 1YWVA 5GJDA 1CMKE 3DCVA 1PXJA 3IW7A 4PF4A 3FL4A 5A6NA 2JLDA 4FT7A 3E63A 4NYEA 5JKGA 2B54A 3GCUA 2XNPA 4ANLA 2HY0A 3ZYAA 5E1SA 3ORKA 1REKA 2W1HA 4F6WA 4BCHA 1FGKA 3WF9A 4LUDA 2WMXA 1W8CA 2C5VA 2ITUA 4KIOA 4N70A 2YN8A 2SRCA 4O0XA 2OXYA 4TKSA 3T8OA 4FTUA 3FY2A 4YBKA 2BAJA 4A9RA 3DGKA 4AS0A 4E1ZA 5KE0A 3IDCA 3VS3A 5HD4A 4FUXA 4IH8A 3ATTA 4YNOA 3R7YA 1NXKA 4FT0A 4WG4A 3FLYA 3TKHA 4FI1A 1FPUA 3QALE 3HX4A 3KULA 4MNEB 5HIDA 3LFFA 2B7AA 2DUVA 4FKVA 3EL8A 1PHKA 1PMVA 4FIGA 2V0DA 5FP6A 3A62A 3BGPA 2IVTA 1PXLA 4XG4A 4XP0A 3ZXTA 3W8LA 1CTPE 4IDTA 4O82A 2H96A 1YHVA 4AA0A 2VD5A 2A2AA 3GGFA 3AC1A 1CKJA 3BLHA 4I0SA 5FM2A 4WRGA 2H8HA 3RVGA 2VTPA 4D2RA 3OW4A 4K77A 3RTPA 3HRCA 3AC2A 3AC3A 4ZZOA 1PXPA 2QODA 3DAEA 3PVWA 5AUZA 4NCTC 1P5EA 3L1SA 2RGPA 4G6NA 3ZDUA 3ZO1A 3ZUTA 4ZMEA 2EVAA 2HWOA 4TWCA 2EXMA 2QOLA 3V51A 3CC6A 4ZLZA 5IQEA 3NR9A 1W83A 4APPA 3A7IA 3QD2B 3PG1A 4ZS0A 3QTZA 3TIZA 2ZM3A 3QQUA 3KXXA 4MWHA 5J9LA 3D94A 4G34A 4IFGA 4HJOA 4FTKA 1W0XC 2JKKA 4FG7A 5HE0A 3W2SA 3AOXA 4R5YA 4IVBA 3R8UA 4YTCA 1HCKA 3FAAA 2PTKA 2YIYA 4JG7A 4RSSA 3EQCA 3EZRA 4G3EA 3RWPA 4G5JA 4F64A 2WHBA 2P0CA 4RG0A 4X3FB 4XG2A 2BR1A 4ID7A 4YC8A 3JY9A 3AD4A 3V5TA 3A99A 2UW6A 2XKCA 2BDWA 2XCHA 4MWIA 5IPJA 3OHTA 4UWCA 2X6EA 3NNWA 4QD6A 5KUPA 1WBOA 4F09A 5DR6A 2VTSA 4M69B 3ZLWA 4V0GB 2OZAB 3D5VA 3MPAA 1GZNA 2IO6A 3EJ1A 2Y6OA 4QP4A 4DHFA 4O7SA 4BDBA 1URWA 2BAQA 2ZV2A 4AN9A 4Y72A 3Q4ZA 2HZNA 4YPDA 3BHHA 3DT1A 2WQNA 3F2AA 2UZLA 5AP1A 3DBDA 4D4SA 3PA4A 1JSTA 1TQPA 3PIXA 3ZONA 3Q5ZA 1PXOA 2HXLA 4S30A 3L9NA 4BTMA 2OFVA 1JPAA 3LFEA 2E9VA 5CAQA 3TUCA 2CCIA 2VWYA 1H1RA 1CM8A 4E6CA 2CNUA 3R7OA 1Z9XA 5JFVA 4IHPA 4AW2A 4L9IA 4PDOA 3PWDA 3G9NA 3K5VA 3KRWA 4QMPA 5HO6A 2OF4A 3UOHA 3W18A 3LCOA 4KBCA 3R8LA 5EW8A 4D0XA 4G31A 2Z2WA 5CWZA 5J79A 3BU6A 3QC9A 1XHAA 2UZTA 3ZBXA 4AOTA 2VO0A 1JKSA 4KKEA 3FLZA 3MBLA 3CEKA 3NW6A 5IQGA 2VAGA 3FI4A 2NPQA 4IZ5A 4XMOA 4DGMA 4D1ZA 2XKEA 3FZRA 4EZ3A 1E9HA 4TL0A 5JFWA 3QAME 4MNFA 4O22A 4JX7A 4S2ZA 4ZJIA 3UP7A 4U7ZA 1KE9A 3WOWA 4FC0A 5AAEA 5E9EA 2HZ4A 3OOMA 4I6QA 2FYSA 3KRXA 2E9OA 1YOMA 1K9AA 2GHLA 2XNNA 4XV2A 2OWBA 5BVDA 1CKPA 2JDOA 1J7UA 1Q8WA 1ZMWA 3FZOA 2YAAA 5M4IA 4E73A 3CGFA 4QOXA 3UJGA 1IRKA 1UA2A 4PP7A 4ZZNA 2PL0A 3GU6A 4UX9A 2ITNA 3EQPA 3QCXA 4M0ZA 4QTEA 3AC8A 5IQCA 3LLTA 2VO6A 2GNGA 1IA8A 2QR7A 2UW9A 2X6DA 3CPBA 4IM3A 3UOLA 1WVXA 4FTAA 2EU9A 2J0KA 5AX3A 3SRVA 3HMIA 3UYSA 3JPVA 2E2BA 3E62A 4QMYA 1UKHA 4Y83A 4AE6A 4EJ7A 1PMUA 3MFSA 2EUFB 3LJ1A 3OY1A 4O1OA 3MA3A 4JDJA 2YIWA 4W8EA 1JLUE 3R8MA 3CS9A 3R7GA 4BKYA 4EZ7A 5HNIX 3V8WA 5HX6A 5J9ZA 4YO6A 5LWMA 5C1QB 3D7TA 3PDTA 3EFWA 3GC7A 4P4CA 2AC5A 5CEIA 3KXMA 3W55A 2G01A 3DY7A 3KC3A 3N4TA 1PXKA 1YI4A 1YOLA 3HKOA 5HORA 1ND4A 4A4OA 3KVXA 3ODYX 3QWJA 4I22A 4OBOA 5KX8A 3O50A 5DLSA 2WIPA 3CXWA 4OW8A 3UO5A 1FVVA 1Y57A 3SHEA 3V8TA 1H25A 2XEYA 4LUEA 1QMZA 1REJA 1FMKA 4BCGA 1OZ1A 5IUHA 4ALUA 3Q32A 3PZHA 4R1VA 3P08A 3OCBA 4QMSA 2CLQA 4R6VA 5GJFA 1PRYA 4BI0A 4JDHA 5JK3A 2OLCA 1U54A 2PHKA 2BROA 5CF5A 5ETCA 3VHEA 3MH0A 3OXTA 4O6EA 5L6PA 5LMBA 3CY2A 3H4JA 4D1XA 2RFSA 4UXQA 4ZLOA 3DOGA 3RBWA 2GQSA 2PMNX 4ORKA 4C8BA 4GYGA 5CYIA 3LMGA 2ETRA 4L7FA 2QOHA 1I09A 3A7GA 4HGEA 4QP2A 3HUBA 2A4LA 4AU8A 2Y4PA 5GZ8A 4IWQA 4RZVA 3V6SA 4DG3E 4KAOA 2C4GA 4C3RA 4PL4A 4UV0A 3NIEA 5BVEA 4I6BA 3BYOA 3Q5IA 3THBA 1Q8ZA 3FMLA 3PJ8A 2R3RA 2XBAA 5AWMA 2WAJA 4UWYA 5AUYA 2Y4IB 5H9BA 4F7SA 3Q9ZA 4H3PA 4WSQA 4E5WA 3VJNA 4GJ3A 2BRNA 3QQGA 4GFGA 2XS0A 3HAMA 4ZTNA 3QKMA 2XJ1A 4HCTA 1PMNA 3H9OA 2I1MA 3IG7A 3MPTA 4BI1A 2WTIA 5M4FA 3QTRA 4YLJA 2XIXA 3WE8A 3EZVA 4RIWA 4BDCA 4EWHA 4L46A 5LVPA 4YO4A 3FQHA 4LOPA 4RFMA 5ANKA 5D41A 2XNOA 4Z16A 3C51A 4WNKA 3ROYA 5EKOA 4DTAA 2R3GA 1BL7A 2PZIA 3F5XA 4PDSA 4C2WA 2PPQA 1LPUA 4X2JA 4I20A 4RIYA 3UG2A 4WHZA 3ITZA 4H3BA 4ACHA 3HV5A 2PE2A 3UOJA 2WZJA 2WOTA 3VS5A 3W1FA 5BPYA 2GHGA 4CFNA 4J1RA 1Y6AA 4GT4A 1NA7A 3EN6A 2W1GA 1YHWA 4O96A 3GXLA 3I0QA 5IUGA 3OT3A 4NM5A 3WZEA 1S9IA 2YZLA 4DF3A 4YJRA 1V0PA 1Q3WA 3A4OX 1YI3A 5FXSA 3DU8A 5FEQA 2R2PA 4XX9A 4IAKA 2I0VA 5IA1A 3KF7A 2G9XA 5M55A 1WBSA 4RBLA 3ZMMA 4EORA 2WMBA 1F0QA 5TKDA 3O96A 3CIKA 3SQQA 5E8WA 3TUBA 2HK5A 4DBXA 4U9AA 3R7IA 3FMDA 2PZPA 3FMKA 3PY0A 3W2RA 3FHRA 5J7HA 1WBNA 2FO0A 3V04A 3QTXA 2ITTA 2RL5A 2HENA 5DBXA 2VV9A 5CT7A 1OPKA 3R7VA 2B55A 4X6RA 3RK9A 2R5TA 3L9MA 3TDWA 4X0MA 2YM7A 4CNHA 5EG3A 4DGNA 3O7LB 4NK9A 2J7TA 2X81A 5K9IA 2GMXA 5HQ0A 3JR1A 4H05A 1R39A 1W84A 3FZTA 4MD9E 4Z55A 2HOGA 4BCJA 4YTFA 4II5A 4X7QA 4BBMA 3RPYA 4IB3A 4UALA 5CSXA 1IASA 3QUDA 1QPJA 4WO5A 2PUIA 1JKLA 4MH7A 3VS4A 1DS5A 4MXZA 4YTIA 3C4CA 3PSBA 4Z7GA 4IJPA 1BX6A 3RALA 3R8VA 5EH0A 5CEPA 3TKUA 2YIXA 4ZSJA 3R9HA 5BX0A 2C30A 3ENMA 2C6IA 4K9YA 4E4MA 2I0YA 3SGCA 3DJ5A 4E4NA 4C2VA 4AN2A 4OAVB 3VUTA 2YIQA 3CKWA 3DBFA 2XJ0A 5D1JA 2X8IA 4J97A 4PPAA 4EHVA 5HTBA 4GG5A 2ITWA 4GMYA 5ICPA 4MX9A 3RZBA 4HOKA 3SD0A 1SNXA 2RFEA 4TWNA 3PG3A 3VUMA 3O51A 5EW9A 1H24A 3OY3A 1OKYA 3LXLA 3VS6A 2GQRA 3DZOA 2R3LA 3PP0A 1OIQA 2GNLA 2HZ0A 3T9TA 2Z7QA 1E1VA 4F1TA 2FSTX 4PV0A 4PTEA 4BZOA 3UIXA 2ZDUA 5EOBA 3DKGA 4FKOA 4RWJA 5DT0A 3QA8A 3RZFA 3TIYA 4BFMA 3QRJA 2JKOA 4BCNA 5A9UA 5JQ5A 4DFZE 2B9IA 4FOBA 2JD5A 1RDQE 1Q41A 2WTKC 2VTRA 4NU1A 4C4EA 2QI8A 3F2RA 4CFXA 4ZEGA 3Q4CA 4MK0A 4W9XA 4ZXTA 4E93A 2BALA 4I1ZA 4RJ3A 1Z5MA 3NAXA 5AP7A 2BFYA 4B6LA 4TNDA 3EKKA 2R4BA 4W4XA 3PVGA 3NUUA 2PE1A 4RC2A 5HE3A 3D5UA 2QHNA 4M13A 3R7EA 5IQIA 3TZMA 2EXEA 4DEGA 2W1IA 5IH5A 3GFEA 3EL7A 1FMOE 1ZZLA 5H8EA 1ZYCA 1Q62A 5M06A 1IG1A 2YDJA 5J7BA 4AXAA 4QMQA 1J1CA 2J50A 4FZ7A 4PRJA 3F3WA 1WVWA 1O9UA 2OFUA 2CCHA 4QYFA 5F95A 4DEBA 4V01A 1E1XA 3OCTA 4YZCA 5BVNA 2GSFA 2V7OA 2WIHA 3FQSA 5CU3A 3RNYA 3MB6A 4L44A 4QYHA 5CSPA 2BIYA 5AA8A 2UW5A 4FKIA 1MRYA 3EQHA 5KMJA 5EM8A 3F5GA 4I3ZA 1UV5A 4G5PA 1H0VA 5AP6A 4FNYA 3IK3A 4RLLA 3KMMA 3EN9A 3CTHA 4FUYA 4E6DA 2GTNA 3OOGA 3OWJA 2X7FA 2P33A 2VTOA 5ETIA 1Y8YA 1M2RA 4M15A 3NZ0A 4RIYB 5CNOA 3L8SA 5FXRA 2QKRA 3KU2A 5DEWA 2J9MA 3POZA 1OBGA 1OUKA 2WEIA 5IQDA 2C69A 3BYVA 5DNRA 4KSQA 2X8EA 4FODA 2UZUE 4I4FA 4HPTE 4C36A 4JIKA 4MD7E 1KV2A 4RJ6A 4RJ7A 3IOKA 3F61A 2GHMA 2XK3A 3OFMA 4NJ3A 3BLQA 2REIA 3FE3A 1Q4LA 5DR9A 4CQEA 1RE8A 4G2FA 3DK7A 2XA4A 3G6HA 4QMTA 4IVCA 4W4YA 5E1EA 3TEIA 4C38A 5IEYA 2NRUA 3MYGA 4XG7A 4C62A 4QP7A 4YHFA 2QO7A 3I4BA 1OKWA 4W9WA 3NMUF 1P4FA 3A4PA 3R04A 2BKKA 3EQDA 3HV3A 4I94A 4K11A 4CGAA 5IQAA 3KQ7A 4KS7A 4I21A 4G6LA 2V55A 3KULB 2V62A 5C27A 4R3RA 5DE2A 5A3XA 4K0YA 3S0OA 3ZS5A 4CRLA 3EQIA 3KK9A 5IUIA 1IA9A 3R9RA 4KIPA 3NLBA 4RIWB 4C02A 3E7OA 2P4IA 5DHJA 5JSMA 4DT9A 4JBQA 2PVNA 1ZAOA 2ZM4A 4PPCA 5IZFA 4PWNA 2YM5A 3DJ7A 3PA5A 4JJRA 4WRSA 2PU8A 1XKKA 3NYXA 3QTUA 3SA0A 3QF9A 4DFLA 4C59A 2PZYA 4R7IA 3QD0A 3IW4A 4RJ4A 4KINA 4MXYA 4P5ZA 4TT7A 4ZZMA 3ZTXA 4FKTA 1R0PA 4KUJA 5FQDC 4P5QA 4LRKA 4S33A 5EOLA 5HBEA 5F4NA 4NIFB 4C58A 2C3IB 4G3DA 4RFZA 5JZJA 1L3RE 1H07A 3KMWA 4FYNA 3WF7A 4EBVA 2Z7LA 5HVJA 1BLXA 5GHVA 2BVAA 4JXFA 4BWXA 4FKJA 4F0IA 4DH8A 4H3QA 2W4OA 4GVAA 4GVJA 5CZIA 5AAFA 4FV9A 4K18A 4NM3A 3U4WA 5C4LA 3UP2A 4GH2A 3ZLSA 3S2PA 3Q4UA 4LQMA 3MH2A 3FV8A 2QONA 5ETAA 3AMBA 4PY1A 5LXMA 5A4EA 2J51A 2JKQA 4OAUC 2FSMX 3DQXA 4IVAA 4QPSA 5CASA 3QCYA 2JDTA 3ORZA 2W9ZB 3ZOSA 2QG7A 4DCEA 4NKSA 2VTIA 1T46A 4F9AA 4ZSLA 4O27B 3TV6A 2BKZA 3EFKA 4PQNA 3W32A 4AOIA 4B4LA 4F99A 2XF0A 3FYJX 3L9PA 4YZNA 3PRIA 4YZMA 4D0WA 3VUGA 3IECA 4BIEA 3DTCA 3OW3A 4NUSA 5E8XA 2NP8A 4AFEA 4PDPA 3ODZX 5E91A 2VTHA 4DEIA 2FUMA 4ASDA 2H34A 4PMMA 4JVGA 5HI2A 1UVRA 2BAKA 3R9DA 2AYPA 5E8YA 3P4KA 4R8QA 5EM7A 4EH2A 4AGDA 4EZ5A 2WTKB 3BELA 1CKIA 5EYMA 3OF0A 3I1AA 2W4KA 3JVSA 5HG7A 2RG6A 2EWAA 2IWIA 3ULIA 5DEYA 4R3CA 4RZWA 3RHKA 4DFXE 2FSLX 3PSCA 4RT7A 4FT3A 2CNQA 4UZDA 3DXNA 3LPBA 3LFBA 4BDIA 1OL5A 4U6RA 5C8MA 5BMSA 4CV8A 5BNJA 5IDPA 5FRIA 2O64A 1O6YA 2I6LA 3FSFA 4ZTRA 4QQCA 4YSMA 1G8AA 4UY9A 3I6UA 3WYYA 1YXVA 2VX3A 2UW4A 1TQMA 4BICA 3QQKA 4ALVA 2PWLA 3ZFYA 4BWPA 4OTIA 4BL1A 3L9LA 1GNGA 4RX7A 5ANIA 2BTSA 4AT3A 4GIHA 3JS2A 3LFCA 1DAWA 3TV7A 4HZRA 2YHVA 5F1ZA 5DOSA 3KKVA 4LOOA 4CMTA 2XNBA 4LMUA 5JMSA 4Q5EA 4UYNA 5ANJA 3LFDA 1K3AA 3DAJA 3UIMA 4FTRA 1SVEA 5BVWA 3SOCA 3NVKI 3R8ZA 3KXGA 5H3QA 1B39A 4GUEA 3N4VA 4BDJA 1OL7A 3GI3A 4FGRA 4PNKA 3FLQA 4PMTA 2ETKA 4DN5A 3ENHA 3MTLA 3UE4A 3QC4A 3U6IA 4J95A 5LVLA 4BZDA 3LQ3A 3VUIA 4CTCA 4P7EA 2CPKE 3PXZA 4IFCA 2OK1A 2XRWA 2A0CX 2GNHA 3KXHA 5E8UA 3LAUA 3UC4A 5HU9A 2RG5A 1J1BA 4M3QA 5T3QA 3WZKA 2UZBA 4JG8A 1KE7A 3DBCA 4HVHA 3VWAA 2VX1A 4ANMA 3D14A 4FTIA 2CGUA 3UBDA 3ZO4A 4IAFA 4CTBA 4MF0A 1JSVA 4U3YA 4OTFA 4IM2A 4Z7HA 3H9RA 4FTNA 4BGHA 2UUEA 3HUCA 3VBQA 1ATPE 2NNWB 2OH4A 2OJ9A 3RNIA 3QA0A 2VNYA 3RPVA 4I5CA 2JFMA 3OZ6A 3AMAA 2RFDA 4UEUA 4QP8A 3LFNA 4IX4A 3DXQA 3EIDA 3ANRA 4LOQA 4EEVA 4BTKA 3HMNA 3S1HA 5H8BA 5HIEA 3R71A 4XLVA 1H08A 3UC3A 5CF4A 3VO3A 4XCUA 4IWOA 2C0OA 3SX9A 3W8QA 5LMAA 3Q9WA 1KWPA 2X1NA 4DLJA 2GPHA 3CJFA 4I0RA 4ONAA 3EMGA 4EOKA 1Q99A 4FSRA 4QQJA 3PTGA 4MF1A 4PX6A 3KB7A 3UMWA 3WI6A 4FSWA 3VUKA 1XH4A 2PVHA 3GCVA 4ZY6A 4BHZA 2E9UA 2XRUA 4Y5QA 4E3CA 3PXYA 2G2HA 3DB6A 3OVVA 3MH3A 5J87A 5ETFA 4F9YA 1JBPE 3DXPA 2RIOA 3A7JA 4M14A 3OXZA 5FTQA 4O7ZA 3QZFA 4BI2A 4G6OA 4MNEA 5CTPA 5BMMA 2OW3A 3FWQA 4I6FA 5KBRA 4L01A 5M4UA 2VWWA 3ZZWA 2ZMCA 2I7QA 3VUDA 4YHTA 2C47A 4NM0A 4F9WA 3TJDA 2XJ2A 4HGTA 2ITQA 3CBLA 4D55A 4EH3A 3P9JA 1OKZA 1WAKA 2UZVA 2JIIA 4AGCA 3ZLXA 4FT9A 4ACDA 2X2MA 4A06A 2WO6A 2JGZA 5HG5A 3TNPC 2OXDA 5J9YA 2A19B 4F9BA 2UVYA 5HOAA 4AGUA 4ANNA 5DIAA 2BPMA 5TF9A 4EK4A 3QXOA 4CKRA 1MRVA 4FKRA 3R02A 2UZEA 4TW9A 2Y7JA 1OL6A 4FE2A 2WELA 2XIKA 2VO3A 4X2NA 3FPQA 4RRVA 4FKPA 3BRBA 3MJ2A 4H1MA 2ZB0A 4NFMA 5FBNC 1M2PA 5L4QA 1B38A 3PJ3A 4RVMA 3HP5A 4PMSA 3MJ1A 3QZHA 4X6QC 4FV6A 3O71A 5F20A 4IC8A 2UVZA 4C34A 4ITJA 2JFLA 3B2WA 3V5QA 4EK8A 3SV0A 2IZRA 4FTTA 3PXFA 1FINA 4O7LA 2QCSA 3GVUA 2GS7A 4UWBA 5JGBA 5A14A 3WZUA 1U5RA 1ZY4A 3ZU7A 4H36A 3BKBA 3FI2A 3KF4A 3TACA 1R78A 3KN6A 3QBNA 4IZ7A 2F9GA 3GB2A 3C4WA 2PUUA 5CVGA 4DLIA 5B7VA 3LKMA 5CU0A 1PW2A 3GC0A 1S9JA 4L67A 4MXAA 4UYAA 3MFTA 1I44A 4DFUA 1DAYA 4FTLA 5AUWA 3U87A 3VRZA 4ACMA 3ZSHA 5HO8A 3MWUA 5CSHA 3OBJA 2C5OA 1G5SA 3F5UA 3F3UA 2G15A 2YEXA 3AT3A 3BHYA 4GK2A 4R5SA 3EH9A 5E4HA 4N6YA 2CNVA 3DS6A 4XRJA 2F7XE 4HNIA 4U43A 3T9IA 3TDVA 2BRMA 4XYFA 4EOJA 4GU9A 4XBRA 4NTSA 5FLFA 4DG0E 4FX3A 3UZRA 2YJRA 1WBVA 4G9RA 5EK7A 4HVSA 3DB8A 4N0SA 4F0GA 3QTIA 1J91A 2J90A 4BDFA 4O6LA 1H01A 4EOLA 2WTVA 4RA4A 1BKXA 2ONLA 2HW7A 4PL5A 3MY5A 2QOBA 2QOQA 3BBTB 4KBAA 3I60A 2XK4A 3LHJA 5DRBA 3WIKA 5BVFA 4C3FA 3P1AA 1URCA 4O0RA 4Y5HA 5AR4A 3W2PA 4R78A 4O0VA 3UVRA 3LCSA 2W0JA 4XG6A 5IISA 4GSBA 3COKA 1OI9A 3VQUA 2Z60A 3LMIA 4C33A 4FK6A 4HGLA 2UW7A 1NT2A 2V5QA 3EHAA 4RIXA 4DINA 1W98A 3EWHA 1RW8A 2PMLX 3KVWA 3PA3A 4M12A 4MBIA 3HRFA 4RVLA 2PVFA 4F63A 3WZJA 1YXXA 1XWSA 3PYYA 2ONLC 4YJVA 4U79A 1A48A 2WMQA 2PVJA 5GNKA 2W96B 2JAVA 2OJIA 3CCNA 5CI6A 3ZEPA 2R3HA 5CF8A 1XH7A 3TZ7A 3TXOA 3NUPA 4FF8A 3FKLA 4M66A 4CZUA 3BYUA 5HLNA 3PLAE 4QTCA 3NUSA 5E8VA 3ORNA 4TYIA 1KE5A 3OEFX 1O6LA 1QL6A 4ZTMA 4B7TA 5ITAA 3ETAA 3IGOA 5CLPA 1AD5A 3HVCA 5LCKA 5KNJA 4BR3A 3KGAA 4NIFA 4EJNA 3NW5A 4XP3A 2P55A 3GOKA 3C5IA 4DH3A 4ZSAA 4FV5A 4UN0C 3S00A 2BRGA 2OSCA 2KULA 2Z7SA 4CMOA 3MA6A 1ZMUA 4BBEA 4Y85A 2VTNA 2OICA 3BHTA 4FNZA 4O38A 2R3QA 4UMPA 2IZTA 3OP5A 4YZ9A 3MFUA 3I0OA 4LV5A 3UNZA 2HW6A 3FXXA 3OCSA 5CXHA 3UG1A 3ZCLA 1ZWSA 2ITZA 3DFCB 2B1PA 4MYGA 3LFSA 4GYIA 2C6KA
chains in the Genus database with same CATH superfamily
4F7JA 3ORIA 5LVMA 1WBPA 3PJ2A 4AZSA 4D4VA 2R7BA 4IIRA 3WARA 1TZDA 4TWPA 3S4QA 2O5KA 4EOMA 1OL1A 2B52A 4CG9A 3PSDA 4M8TA 1H1QA 2CKPA 2JDSA 4AACA 2WU7A 2PSQA 4M69A 3KMUA 4Q5HA 3DDPA 3Q2JA 5HCXA 4Q9SA 5GZ9A 2WMWA 4QNYA 4QT1A 5BV3A 4CFUA 3EFJA 4O0SA 3FKNA 3RAHA 1U46A 4FEWA 2IZSA 3NUNA 4QP9A 3LM0A 4M97A 1YDSE 4QQTA 3ZO3A 5CANA 2BMCA 3PE1A 5BVKA 3MPMA 4WIHA 5ACBC 4EH8A 4EOPA 4U40A 1PJKA 4GK3A 3QUEA 2YM8A 1OPLA 3BZ3A 5HE1A 3C0IA 3VBWA 4AZTA 3HMMA 3FC2A 4DGLC 2R3MA 4EQMA 4GIIA 5FM3A 3R0TA 4AZWA 1OBDA 1PY5A 1TVOA 4G3FA 4RJ8A 4ANBA 2FA2A 4NZWB 4YJSA 3RHXA 1XR1A 5HESA 2JEDA 2FB8A 3NGAA 5FBOA 3ANQA 3D2KA 3FKOA 2BCJA 4O0YA 3DNEA 2H9VA 2ITVA 4QTAA 4ASXA 4D4YA 2ZAZA 4DH1A 4L7SA 4FTOA 2IZUA 5CALA 2C6TA 3O2MA 5JGDA 2PUPA 3NPCA 3UYTA 2CDZA 4FOCA 4LL5A 2UW3A 4J52A 3EOCA 3ZM4A 4OT6A 1KE6A 4D4RA 1Y8GA 3FI3A 3GUBA 5AR7A 3ZZEA 4A4LA 2Q83A 4EK5A 2W7XA 3ORLA 5AUTA 4FBXA 3CP9A 4NCTA 4QPMA 4DH5A 4UMUA 1JNKA 4J8MA 2XK6A 4A9UA 4USEA 1VJYA 3R22A 3T3UA 5JT2A 5HNGA 1MRUA 1OITA 5IA5A 2AEGA 2O63A 5CY3A 4YR8A 4EUUA 5A4QA 1IEPA 3QRTA 1QCFA 2XUUA 2YACA 4AGWA 3E87A 2QHMA 4QEBA 3SC1A 4BCOA 2ZV7A 3AQVA 2BZHB 1PYEA 3VBVA 3FZSA 4UMQA 3EYHA 4JIAA 3LQ8A 4A7CA 4R7HA 3SVVA 4YPSA 5IEVA 4FG9A 3GU5A 4CFVA 4KKHA 1V0BA 5KMLA 5GIOE 2OXXA 4CCUA 3GQLA 2YDKA 1ZYDA 3M42A 2PMIA 2DS1A 2R64A 3GCSA 4J99A 3G90X 3COIA 3NWWA 3OG7A 4V0GA 4EYMA 1OKVA 2PY3A 5EI2A 2YCRA 3BIZA 3C13A 3RI1A 5DYJA 1Q8TA 3H3CA 5EYCA 5HLPA 3ZH8A 2ZV8A 4M68A 4BDAA 3LJ0A 1J7LA 4YUQA 1YXUA 2B4SB 4NTTA 1OIYA 3DV3A 3TCPA 5B2KA 4UZHA 2XYNA 4OT5A 1LR4A 3MB7A 3HV7A 5EYKA 2LAVA 5M56A 3KFAA 2VU3A 4FTQA 3ORPA 4XV9A 3TZ9A 2YA9A 5M07A 4XG9A 4C3PA 3ELJA 3O23A 2NRYA 3QQJA 4IVDA 3O17A 4FZ6A 3VBTA 4N4SA 3QTQA 3HV6A 4LGHA 4XNEA 4WD5A 4YGAA 2JAMA 3R7UA 3RJCA 3SRVB 3G33A 2C1AA 2HWPA 3QQLA 3C1XA 4E26A 5K0XA 5F9EA 2BHEA 4FIEA 4ERKA 4FEXA 3R1SA 1LEZA 2UZWE 4A9TA 5IMEA 3IDBA 4GKIA 1ZARA 5E8SA 2VWXA 3W2OA 3WILA 1M14A 4F1MA 2XAMA 4TRLA 4USDA 3VRYA 4RA5A 1W2CA 3NNVA 4E5AX 4KS8A 2OJJA 3GC8A 1BI8A 1YDTE 3P23A 4FVPA 4LMNA 5BUJA 4KSPA 3OEZA 3R2YA 4TWOA 3CQWA 4TYJA 2JBOA 2R9SA 3EN7A 3NNUA 4OTPA 4F6SA 1W2FA 4M67A 4DTBA 5CEKA 5ANGA 3HMOA 4QMXA 4O1PA 5I4NA 1BUHA 1O6KA 3BHUA 2DWBA 2YJSA 3QZGA 4NKAA 5HTCA 5E92A 2BZKB 1M52A 5GJGA 3F3ZA 5EI6A 5K4JA 3SXFA 3QD3A 4YNEA 3KXNA 4IX5A 4R1YA 2QOKA 4WOVA 4AX8A 4E7WA 4GFMA 4PUZA 3Q53A 3QHWA 1DI9A 3VF8A 3I7CA 3WE4A 4EK3A 3F88A 1W7HA 3HEGA 3QKLA 4HVGA 1FQ1B 4PDYA 2J5FA 4YJPA 2WTDA 1GZ8A 2Y4IC 4IZAA 2R3IA 2ITOA 3QFVA 3RPOA 4LV8A 1YWNA 3VJOA 3G0EA 3R8PA 3MIAA 2QURA 4I92A 4K6ZA 3R6XA 4ANQA 3E8EA 5J1WA 3LQ5A 4I5MA 5BYZA 4U97A 3PXRA 4LGDA 3ET7A 2FVDA 1JKKA 5LVOA 5LCJA 3BGZA 4W8DA 1MQBA 4A9SA 5CAUA 3CPCA 5M44A 5AP0A 2JDVA 2QVSE 3TTIA 4BJJA 5CEQA 4F08A 4RX8A 3V01A 2OZAA 4EL9A 3NX8A 5AAGA 4FEUA 1JQHA 2R0UA 1YXTA 3QYZA 4EHZA 4APCA 4EWQA 1G3NA 1WMKA 2W1CA 2Y0AA 4FIIA 3G6GA 4IACA 4KIQA 1U4DA 4C0TA 1EH4A 4Y73A 4O86A 4FL3A 2YM4A 5HHWA 1ERKA 2CKEA 2CMWA 4JBVA 4QMLA 4S31A 3QGWA 4FIHA 4ZY5A 3V5JA 5EQYA 3LFQA 4DH7A 4JT3A 3BEGA 5L2IA 4XH6A 2YDIA 3CKXA 3TT0A 1FOTA 2VTAA 3W10A 3UQGA 1UU8A 4LFIA 3GCPA 4ALWA 3BBWA 4QRCA 3KN5A 2W9FB 1BMKA 2QD9A 4EHGA 4EUTA 2C0TA 4LYNA 1U54B 4RQKA 5FP5A 4AQKA 3AC4A 4C4HA 2ZV9A 3E8CA 4YZBA 4EBWA 4EKLA 3JVRA 4F9CA 4D5HA 4E6AA 4DHJA 1WVYA 2A27A 2PVKA 5J8IA 5IKWA 4AA5A 4RPVA 4U81A 4BN1A 3U8WA 4K2RA 2GU8A 2O2UA 3E92A 5CENA 3F7WA 3ZDIA 4OGRA 3UOKA 3LFAA 1APME 4EH4A 2ZMDA 3UNJA 3E93A 3IQ7A 4PP9A 1OM1A 3CE3A 3PVBA 3CR0A 3NUYA 3H10A 3KA0A 3QQFA 2XH5A 3D7TB 3R28A 4X2KA 4XS2A 2YM3A 2PYWA 3D15A 2C68A 2XIZA 3KK8A 2PZ5A 2R3JA 4TY1A 1FGIA 4GJ2A 3QTWA 3R63A 2WTJA 2P2HA 3A8XA 4Q2AA 3G2FA 2O65A 4O4FA 3VVHA 1GIIA 3SXRA 4UMRA 2BHHA 3PFQA 4FKLA 4R3PA 4DEHA 3V5LA 4M84A 3ORMA 1BL6A 4PTGA 5CXZA 5L2QA 3C4FA 4OTRA 4FZFB 4AW1A 3U6HA 1YKRA 2X7GA 4AZEA 2RKUA 3O8PA 4Y8DA 3HRBA 3JYAA 1WBWA 2XEZA 3OT8A 4C4JA 4CQGA 4DHIB 3KY2A 3QGYA 2VWZA 4AWIA 1SVGA 3L8PA 3MVLA 1ZOGA 5CSWA 5H8GA 4FZDB 1ZYJA 2F4JA 1M2QA 3A61A 3GC9A 4RC3A 4B8LA 3GU4A 2F7EE 4FKSA 2CN8A 3MVMA 2OU7A 5AV2A 1PXMA 4WNMA 2GCDA 5AX9A 4BTJA 4E8AA 1RQQA 1VR2A 2AC3A 4XJ0A 3G5DA 4DDGA 4FSTA 4JAJA 4WUNA 4CSVA 2XYUA 4IC7A 1J3HA 3ORTA 3AT2A 4CXAA 2RFNA 5CEMA 5CF6A 5KKRB 3CSVA 4HCUA 5CX9A 5JH6A 2XIYA 3OBGA 5EM6A 3Q60A 3PPKA 3Q9YA 2WTCA 1XJDA 4FV8A 5B0XA 2VWUA 4A9YA 1PMEA 2WMVA 1ST0A 4BDKA 1YQJA 4FK3A 3QQHA 3QUPA 5J5SA 2GDOA 4FR4A 5J5TA 2CGWA 3L8XA 1PXNA 3D2IA 4G1WA 5H2UA 5L2SA 3AMYA 3Q2MA 2IJMA 2ZOQA 4F4PA 2B9JA 3UDZA 1R3CA 4BHNA 4DFNA 1FVRA 4FV3A 5KO1A 3FYKX 2YFXA 4YJQA 3SAYA 3T3VA 4FL1A 4ZOGA 3PXKA 1RJBA 2HIWA 2QNJA 4AW5A 2QOIA 5CSVA 1OPJA 3LIJA 5DT4A 3RK7A 4CG8A 2W1FA 1G8KA 2OH0E 4AOJA 3TUDA 4HPUE 4ITIA 2F7ZE 5AR2A 5C01A 3TKIA 4ACCA 4EI4A 3RM6A 1UNHA 5EI8A 3GCQA 3OWPA 2JITA 4I23A 3V5WA 5AV3A 3HP2A 5CI7A 1JSUA 2J0LA 4YMJA 4ITHA 2OJFE 3IONA 4FG8A 2GNJA 3BHVA 4FIFA 3V5PA 1SYKA 4JL9A 5FDPA 2OG8A 5FD2A 5K3YA 3B8QA 1DI8A 4OR5A 5KHWA 1QPEA 4GCJA 2VWVA 5IA4A 5DGZA 1OL2A 2X4ZA 3SW7A 4C35A 3LCTA 1UKIA 3RP9A 4EHEA 1BI7A 2RSVA 4TPTA 4L43A 4O7NA 1GAGA 2W05A 4MVFA 4QTDA 4FV2A 2PMOX 2GNIA 4GUBA 4S34A 4CYIA 4FKUA 4EH7A 3BE2A 4IE9A 4IANA 5DG5A 3S95A 4V05A 4YJNA 2V22A 3ULZA 3K54A 3LCDA 3MFRA 4Y95A 2Y6MA 3FLWA 5DI1A 5D10A 3R1QA 4I5HA 4V04A 3DLZA 1HOWA 3NS9A 3QCQA 5EM5A 3HAVA 3O8TA 3Q96A 2IW6A 3P7CA 3UO4A 5IH6A 1XBBA 2BZIB 4QMMA 3SOAA 2HXQA 3LCKA 5AR8A 3NFGB 3W2CA 5DMZA 5E7RA 5AV1A 5TE0A 4CVAA 5C03A 2H6DA 3LMHA 3LJ2A 3C4EA 3LW0A 1M7NA 3DQWA 4P90A 5JRSA 4C37A 4ZJJA 4BCFA 4FSYA 5AFVA 5EQEA 4XG3A 3BYMA 4ZY4A 2QQ7A 4AAYA 2WXVA 3VAPA 4MCVA 2HZIA 5T68A 5I0BA 5AR3A 2GQGA 5D11A 2GS2A 4JLCA 4WUAA 5DH3A 4YJUA 2X0PA 3I7BA 3Q9XA 2BUJA 3I5ZA 1XQZA 4GK4A 2YIRA 3ZSGA 5KMKA 4BGGA 1KOBA 4XOYA 2ZFYA 3ZRLA 1UNLA 4Q9ZA 4R77A 4QP1A 2YABA 3C4XA 3K3JA 4IAZA 5G6VA 1IAJA 5B2LA 2X9EA 4NSTA 5FDXA 1CDKA 3VC4A 4X3FC 2CLXA 2CGXA 1YXSA 2HY81 2IG7A 3BU5A 5AA9A 3AT4A 2VTLA 4RLKA 3OWLA 4DYMA 4DG2E 3CY3A 4YURA 4AUAA 1WBTA 2XKFA 4O0TA 4AE9A 5E8TA 5JZNA 3VHKA 1Q61A 1ZMVA 3QHRA 4JAIA 4O0WA 3C7QA 5HKMA 4YU2A 2BFXA 2XK8A 4GRBA 4QYGA 2X8DA 1NVQA 2KTYA 1ZOHA 1LP4A 5ANOA 5F94A 4LRJA 4F6UA 3IW8A 3VS1A 5KMIA 4XV3A 3MI9A 2ZM1A 4PNIA 1PKDA 3JXWA 5KZIA 4XOZA 3U4UA 4FYOA 3JY0A 4AAAA 4O4BB 3FXWA 4G17A 4FZAB 3P79A 3UIUA 4FIJA 2WOUA 3OD6X 4U45A 4ZSEA 4C7TA 4FNWA 3D7ZA 3ORXA 3IOPA 3Q3BA 3QRUA 3DBQA 4TZRA 3ID6C 5JFXA 2BRBA 5FEDA 1W82A 4FSMA 1UNGA 3VN9A 2QU6A 5AUUA 2QO9A 2QLQA 3K5UA 5FTOA 4O2ZA 4EC9A 3BX5A 3REPA 3MESA 5AM6A 4XP2A 4RIOA 4IB0A 2C6DA 1R0EA 2VRXA 4HYIA 4FSZA 4BYJA 4D58A 4L42A 3FMMA 2OBJA 3P5KA 2YWPA 4RVKA 4BC6A 3CD8A 1KUTA 5IQHA 2XNEA 4WNOA 3RINA 1H1PA 4KRCA 5L2WA 3GU8A 4XUFA 4G3GA 1YHSA 4FJVA 2J6MA 3VONA 3TG1A 2WTWA 1LEWA 3K3IA 4D1SA 2BTRA 3FZ1A 3GOPA 3DK6A 2XNMA 3DKCA 2CN5A 4AA4A 4S32A 3ACJA 5DRDA 3EQFA 5HG9A 3IDPA 3UO6A 5TO8A 4ZP5A 3VS7A 1F3MC 2LGCA 4MKCA 4UBAA 2IW8A 3VW6A 3F2NA 1OVEA 4CT2A 4B0GA 3AGLA 1FVTA 4X3JA 2XVDA 1GZKA 4WT6A 2CKOA 3A60A 3WF5A 3Q6WA 1H0WA 4F78A 5IU2A 1LUFA 5K4IA 3W0QA 4XV1A 4WBOA 2XP2A 2VTTA 1BYGA 5A4TA 3ERKA 3RWQA 2FGIA 4XG8A 5FG8A 4CZYB 1M17A 4O4EA 4IMYA 3HGKA 1Q97A 3MH1A 4KA3A 4F70A 4X2FA 3R00A 5KZ0A 3RPSA 2ITYA 3GQIA 3JUHA 3LLAA 3H30A 2OI4X 3NCGA 5D7AA 3U55A 4BBFA 4EKKA 4JRNA 3UPZA 4DFBA 3MY0A 2IVSA 4IAIA 5FWKK 4DGOA 1Z57A 3IPHA 5IA3A 5AM7A 4BDEA 5J95A 5AADA 3QCSA 1IR3A 4K33A 1H28A 3MTFA 5T6KA 4EK6A 4BIBA 4KNBA 2RF9A 2ZVAA 5LMKC 2JC6A 4FEVA 1JKTA 1V1KA 2I0HA 1NVSA 1YRPA 3DLSA 1GY3A 4XRLA 2NO3A 3I6WA 3OTVA 4OBQA 3RAWA 4IJ9A 4RIXB 3GU7A 3OROA 3Q6UA 4GG7A 2WPAA 4J8NA 1JVPP 3NSZA 3CJGA 2PVMA 3LZBA 4GEOA 4L8MA 4O91A 5IF1A 3MVJA 4IX3A 3BI6A 5EFQA 3E7VA 3HYHA 5DWRA 5IH4A 2WMTA 4JR7A 3KCFA 3G0FA 1UU3A 3FMEA 3GEQA 4BVUA 2WMSA 1P2AA 2GNFA 3BU3A 4IW0A 2C3LA 3PY1A 5L2TA 2B53A 3FMHA 4NW6A 4FKGA 2B0QA 4DT8A 3CLYA 3R30A 4OUCA 3TL8A 2VGPA 2O3PA 2XB7A 1A9UA 3N51A 3QZIA 3W33A 2C5XA 4HW7A 5LOHA 4O7VA 4CYJA 1ZOEA 1VEBA 1T45A 2X2KA 4IWPA 4QTBA 3F66A 2X0GA 3U9CA 3POOA 2EB3A 2W5AA 1K2PA 3F69A 3NYVA 4XEYA 4HVDA 4L52A 4CD0A 3P78A 2B9FA 3PPZA 3NCZA 5K0KA 4BZNA 3N9XA 3TZ8A 3RKBA 4GFOA 4MBJA 4ZSGA 3NVMB 4JQ7A 4IB1A 2F2CB 5AEPA 3E5AA 2QU5A 3FDNA 3MN3A 2HCKA 4YTHA 5EYDA 4YJOA 5HGIA 4EOSA 3PJCA 5EKNA 3BYSA 4H58A 2WQOA 3QTSA 4EH9A 4QO9A 4CZTA 2XMYA 2G2IA 3WZDA 5LJJA 2XNGA 4GKHA 4OTWA 3ALOA 4U8ZA 5A46A 4IM0A 3A7FA 4FICA 4K8AA 4PPBA 2CGVA 4HZSA 4AFJA 2PVLA 3RMFA 4FTMA 4U44A 3UVQA 3ZEWA 2VX0A 1XMLA 4YBJA 2W17A 4QYEA 2YM6A 5L6OA 3U6JA 3V6RA 4D2SA 2ERZE 3HLLA 3ZLYA 5CQUA 5HICA 5A4CA 4HCVA 4KRDA 1UWHA 3E64A 5AUXA 5TR6A 1ZXEA 5I9VA 3BGQA 4C57A 3HL7A 3HV4A 3MW1A 4BCIA 4QDVA 2XBJA 3TWJA 1H4LA 1GOLA 2JDRA 3VIDA 4MTAA 3NNXA 2W06A 4OLIA 4PTCA 1KSWA 4BDDA 5CAVA 3C0HA 5GZAA 2YWVA 2O8YA 4DGGA 2IF8A 1TKIA 2J4ZA 4RFYA 2WNTA 4RWIA 2WKMA 5L8LA 5BYLA 4JOAA 2QC6A 5FXQA 1PYXA 4JI9A 5HCYA 3UPXA 2C6MA 2UW8A 4D2TA 1J7IA 5L3AA 4H1JA 4MQ1A 2HYYA 4O7RA 3PXQA 3DKOA 4QQ5A 2VO7A 4ZJVA 3PWYA 4CLIA 3PUPA 1Y91A 4FV1A 4NJDA 3QD4A 2JKMA 4GU6A 5AMNA 4OBPA 2OZOA 2Y8OA 5HX8A 4DC2A 5CU6A 2J5EA 4HYSA 4KIKB 1XH8A 4QP3A 4EOOA 1GIHA 4RJ5A 3P7BA 4B8MA 2XKDA 4FV4A 5TT7A 4AP7A 5CAOA 2YZAA 4ASZA 4WBBB 5KKRC 3WYXA 3FI8A 3M1SA 3IW6A 3G9LX 3FZPA 4KIKA 4TN6A 5I3OA 5FTGA 3IKAA 2DQ7X 1V0OA 4FTJA 4JX3A 4L3LA 3A7HA 5DN3A 4USFA 3FSKA 4AT5A 4EQCA 2UW0A 3E3BX 3ZC6A 2JIUA 1OMWA 4XHKB 5L8KA 4NEUA 5D12A 5EHYA 3FUPA 4BB4A 4D9TA 1XBAA 4FTCA 1STCE 4EONA 1ZRZA 3MIYA 4I4EA 3M11A 4MD8E 5CU4A 2XM9A 4QMNA 4DA5A 5AP4A 1UU7A 3E8DA 4TYHB 3O8UA 1NW1A 2J0JA 4EH5A 4ENYA 1XH6A 5EDQA 3ZSIA 2WMAA 4JBPA 3H0YA 1Y6BA 4L3PA 2C5YA 4GT5A 4QMZA 5CU2A 5IQFA 2ITXA 4ZIMA 4BDGA 4J96A 2C6EA 4FEQA 2YLFA 4FSQA 1OIUA 2GFCA 3A8WA 4IEBA 3VBYA 4ENXA 4L68A 3OXIA 4E20A 3QRKA 3UODA 3OCGA 3UZPA 3KXZA 3U9NA 3UQFA 2XZSA 2BDFA 3F3VA 3FXZA 4IADA 2X7OA 4U80A 3UDSA 2Q0NA 3HECA 5DFPA 2HAKA 3LOKA 3GNIB 3PZEA 4FSUA 5HD7A 4F0FA 2YCSA 3QWKA 5I9ZA 1FBNA 4RMZA 5FUTA 5AP3A 5B2MA 3OUKA 4P2KA 4X21A 1MP8A 4I6HA 3BL9A 4ASEA 3VNTA 4CRSA 3P86A 4O21A 4DBNA 3KRLA 5KHXA 4IB5A 2VZ6A 2IVVA 3FLNC 4YHJA 4JQEA 4O2PA 1F5QA 3C0GA 3MVHA 4NW5A 4NM7A 2QG5A 3QLGA 4HYUA 3U51A 4L6QA 4F1OA 3ZO2A 1SMHA 3Q52A 1HCLA 3BL7A 3AGMA 3DFAA 4GT3A 4FL2A 4X2GA 2QLUA 4I6LA 4O7WA 5HZNA 5GIPE 3PRFA 2WGJA 3VBXA 4FGBA 4YP8A 4C4FA 1YOJA 5JEBA 4UB7A 2QOCA 2VWIA 4L3JA 3ZUUA 3D9VA 3OC1A 3NAYA 4CEGA 1GZOA 5HEZA 2C6LA 3ACKA 2WQEA 2WMRA 3BWFA 4J71A 4AN3A 4TYGA 3WF8A 3PIYA 1AQ1A 2VWBA 5C9CA 1OECA 5BUEA 4O7TA 2BILB 4OTQA 4CKJA 4QMUA 1ZYLA 4OTGA 5LMKA 3OMVA 3E8NA 2E9PA 5C8KA 5CS6A 2BIKB 5M4CA 3A2CA 1YI6A 2I0EA 3C50A 5HIBA 5BQ0A 4DDIA 4IAAA 5M51A 1ZYSA 2XK7A 3LXKA 3RAIA 2OIQA 4ANOA 3D5WA 3DJ6A 4JMQA 1MUOA 3UNKA 4OTHA 5TOZA 4FVRA 2IVUA 3K2LA 4YC6A 1KE8A 3QKKA 2ZB1A 1H8FA 3EQGA 5LWNA 3KREA 4MAOA 4AZVA 4I5PA 4LM5A 2IN6A 4RX9A 4WNPA 4TXCA 2Z8CA 3ZXZA 1PKGA 1OIRA 4O0UA 4CFMA 5AR5A 3M2WA 4QYYA 2YCQA 1MQ4A 4TTHB 4K1BA 4HVIA 5JFSA 1GIJA 3SLSA 4I93A 4JS8A 1QPDA 2R3PA 2E9NA 1U59A 3AD6A 3DAKA 4RWKA 4O7YA 2G2FA 5HBJA 3VW8A 5DA3A 4D28A 4BRXA 4CCBA 1A06A 3L8VA 4DEAA 2VTJA 2VTMA 5HCZA 4B9DA 4UMTA 3KRJA 4QPAA 4DFYA 5HBHA 1XMMA 2BRHA 5CT0A 5AJQA 4D9UA 5EW3A 2C1BA 4I0TA 4WG5A 4DEDA 1VLRA 3TNIA 1QPCA 3FMJA 4X3FA 3AG9A 3W2QA 3BWJA 4YSJA 5JGAA 4N6ZA 1KOAA 3QU0A 2GS6A 4LL0A 1ZLTA 4ZTHA 5I9WA 5M57A 4G9CA 3CTJA 2CJMA 1P14A 4XLIA 4CLJA 3U54A 2FH9A 4JR3A 1JWHA 3CTQA 4C4GA 5IMXA 3MV5A 3NUXA 4LG4A 2BZJA 4Z3VA 3NIZA 5M09A 2P2IA 4WG3A 3RPRA 4E4LA 5HO7A 2OJGA 2BDJA 3QYWA 3EB0A 3NYNA 4RX5A 2VTQA 4IWDA 3ZFMA 1YW2A 1NVRA 2WD1A 4CFFA 5EHLA 1X8BA 3BCEA 4AXCA 1PF8A 1UU9A 3ZUVA 3ML1A 3R9OA 5IG1A 3FL5A 3P7AA 2XIRA 3LVPA 3NW7A 4IZYA 5HVYA 3VUHA 3EN4A 1WCCA 5HNBA 4DE4A 3PPJA 4JDIA 4LRMA 2PULA 2J0MB 4L53A 1SZMA 4JG6A 3S3IA 5AV4A 1CSNA 3V8SA 3UIBA 1U5QA 4A07A 2J0IA 5KBQA 5HG8A 3OTUA 1H00A 3EQRA 2QO2A 2UVXA 3GT8A 4KWPA 4O84A 3QLFA 1OGYA 4MXCA 4FA2A 2VGOA 4I24A 5D9HA 2ACXA 5KMMA 3C9WA 2ZYBA 2UZNA 4JQ8A 4TNBA 3F9NA 3OUNB 3LM5A 3I5NA 4FKQA 4ANSA 3P0MA 1PXIA 2Z02A 4BGQA 1TQIA 3RCJA 3QXPA 4BCMA 3ZHPC 3MS9A 4UXLA 3G15A 5J1VA 2PE0A 1P4OA 3KCKA 2EXCX 3FJQE 4J53A 3TNHA 3DK3A 4G16A 3D83A 2JIVA 2C3JA 2Z7RA 5I9XA 3UQCA 4H39A 3KRRA 3W16A 4O81A 4RWLA 4BKZA 2J2IB 3UDBA 5IEXA 3PY3A 2R3FA 1XBCA 1VYZA 4E4XA 3AC5A 3DDQA 3EQBA 3R73A 5IA0A 1JAMA 3COMA 3FMNA 4GV1A 2A1AB 2PK9A 4U42A 5DT3A 4FRFA 2YCFA 4I41A 3R21A 4A4XA 1Q8YA 4E6QA 5CNNA 1R1WA 1OB3A 4BY9E 4J98A 3LXNA 1XH9A 2OIDA 3BV3A 3B8RA 4XBUA 2V7AA 5JQ8A 3DNDA 3R2BA 4BYIA 3NEWA 2ITPA 5CQWA 3NRMA 3O7LD 5CVFA 4IX6A 1ZY5A 2HELA 4MXOA 3GP0A 3UGCA 1Q8UA 4ARKA 4NH1A 1G8SA 3FPMA 3GFWA 4D2PA 1Q24A 5HVKA 4QMOA 3BEAA 2VNWA 4BCPA 1WFCA 3BE9A 4GL9A 2C5NA 4NT4A 4QP6A 3LE6A 3DKFA 5AUVA 4C61A 3RAKA 3TV4A 2WFYA 3GENA 3DA6A 1ST4A 2X0OA 3QL8A 2OIBA 2YITA 3MGYA 3F3TA 4Y46A 3TNWA 4MXXA 4BDHA 2W1DA 2ZJWA 5EQPA 3VULA 2DYLA 2OKRA 4JBOA 4HNFA 5AV0A 3ATSA 5LVNA 3NUAA 2PVRA 4Z9LA 4MQ2A 4WSYA 5I9YA 4HGSA 5C4KA 4D2WA 4YLKA 4F7NA 2I40A 2YISA 4ZTLA 5AP2A 3SKCA 3R83A 4U0IA 2QOFA 4BF2A 3MSSA 1L8TA 3RM7A 3CQUA 2R3KA 3NDMA 4JRVA 5DPVA 5IQBA 2B9HA 4OTDA 5FGKA 5EDRA 3ZM9A 1H27A 4CKIA 4BWKA 3PIZA 5I5ZA 2YAKA 4JNWA 2YLEA 3DTWA 3EFLA 2O0UA 1OGUA 2ETMA 3AD5A 3DPKA 3FQEA 3II5A 3PJ1A 3TNQB 2X4FA 4DAWA 3R9NA 4D2VA 3HZTA 4LGGA 3OWKA 3AKLA 4FV0A 5EDPA 5HU3A 2X2LA 3D5XA 3QX4A 2OGVA 2W1ZA 4RC4A 3UVPA 3WIGA 3ZC5A 1XH5A 3OS3A 3WF6A 3ZRKA 4BIDA 1IAHA 4NL0A 4IXPA 2CKQA 3BQRA 3R1YA 3IO7A 2NYAA 5ANDA 5G1XA 3SW4A 3E88A 3PP1A 2XM8A 3PVUA 3BLAA 4EOQA 2EB2A 4LI5A 5E90A 5CVHA 2YERA 4EOIA 1JOWB 4IBMA 4M0YA 1H26A 3RK5A 2W1EA 2F2UA 4ZAUA 5KCVA 3FC1X 1GJOA 3FLSA 4YZDA 4L45A 4GW8A 5EHOA 3EKNA 4ZK5A 3TI1A 5A54A 4DCAA 3VQHA 5GINE 4BCQA 2PUNA 4FNXA 1YDRE 4DITA 3FHIA 1DM2A 3G51A 1OUYA 3CD3A 3AXWA 1YWRA 3V3VA 4CV9A 3VS0A 3WBLA 5C8NA 2QOOA 3BV2A 3LXPA 5AP5A 4FKWA 4KD1A 3VS2A 3IW5A 4AT4A 4C4IA 3TJCA 5A4LA 2W5BA 1M7QA