4BWCA

X-ray structure of a phospholiapse b like protein 1 from bovine kidneys
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
170
structure length
170
Chain Sequence
GVYYATAYWMPTEKTIQVKNVLDRKGDAYGFYNNSVKTTGWGILEIKAGYGSQSLSNEIIMFAAGFLEGYLTAPHMDDHFTNLYPQLIKKRSMLNKVQDFLTKQDQWTRENIKYYKSDPFWRHADYVMAQMDGLFAGATKRAVLEGKKPMTLFQIQFLNAIGDLLDLIPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PHOSPHOLIPASE B-LIKE 1
publication title Is the Bovine Lysosomal Phospholipase B-Like Protein an Amidase?
pubmed doi rcsb
molecule tags Hydrolase
total genus 58
structure length 170
sequence length 170
ec nomenclature ec 3.1.1.-:
pdb deposition date 2013-07-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.439.20 Mainly Alpha Orthogonal Bundle Penicillin Amidohydrolase; domain 1 Penicillin Amidohydrolase; domain 1 4bwcA02
2.10.70.60 Mainly Beta Ribbon Complement Module; domain 1 Complement Module; domain 1 4bwcA01
4BWCA 3FGRA 3FGTA
chains in the Genus database with same CATH superfamily
2EHFA 1HCCA 1H04P 4PO7A 1TPMA 4MUCA 3GXEA 2AE3A 4N7EA 1GKGA 1VVDA 3T5OA 1GHQB 1QGBA 2MCYA 1Z92B 1OR0A 4FXGG 2AE5A 4HSRA 1G4FA 4BWCA 4E55A 1HFIA 1E3AA 2CG7A 3L94A 3ERBA 5JPMG 2O39C 1H2QP 1OK9A 2RLQA 1JVZA 3SRAA 3S8RA 4E57A 3ML0A 2W81A 2CKUA 1E8BA 5DN5A 1SRZA 3GOVA 2WYDA 1Q3XA 2WYCA 2I2LA 2V8EA 3OXUD 1MD7A 2X2ZA 4LOSA 1AI4A 2WYBA 1H2GA 1FBRA 1PNKA 1PPQA 3RJ3D 5DN4A 3F6KA 2IZ4A 3KXVA 3KZJA 2BZMA 4AYIA 5HYUB 3NJAA 4K2GA 1AJQA 4ZH1D 2XRDA 4WJG2 2JGWA 3IX0A 1U5MA 1AI7A 4KKDA 4J38B 4YF9A 2EC3A 5FO8C 1GM7A 2QY0A 2KRIA 3JTQA 3SRCA 4CSYA 1G4GA 3NFPI 3ZRZA 1TPGA 2B5ID 2Y8SA 1KEHA 1GK9A 4PELA 2RKYA 3OEDC 1OJYA 3TVJA 2JRAA 3SW0X 1E88A 3ZLDA 4WKVA 5I0QB 4WKUA 1JW0A 2A55A 3FGRA 4YFBA 1FXVA 2JGXA 1K5SA 4F4OC 1K7DA 3L91A 1ELVA 2AE4A 1FM2A 1GHDA 3K3WA 3EJHA 4B2SA 4PZ5A 2RL0A 1CKLA 1GK1A 2G7IA 1OJVA 1OK2A 1GKNA 3ZD1A 2XWBF 4YNXA 4E56A 3K3TA 1C1ZA 1GKFA 4K2FA 3L89M 1UOTP 5HYPA 3OP8A 2XRBA 4ONTD 2CG6A 4YIZA 1OK3A 3O8EB 4LOTA 1TPNA 2XWJI 1QUBA 1SS2A 1GPZA 1FXHA 1H03P 3VWOA 5HYTB 3SRBA 2ZYCA 1PNLA 3R62A 1ZJKA 2KMSA 3CALA 4IGDA 3WSYA 4AYEA 1LY2A 1O9AA 4C16A 3CI0J 2ADVA 1GM9A 1MD8A 2YRAA 2MCZA 3ZD2A 4B2RA 2LOJA 1OK1A 1AI6A 3FGTA 1VVCA 1RLHA 3JTRA 2XQWC 4K12A 4YFAA 3WSXA 1KECA 1AI5A 5HZPB 4A5WB 3MQLA 4AYMA 1AJNA 4M1JA 4AYDA 2WYEA 1CP9A 3ZLEA 2YBYA 4BTHA 1K5QA 2ERJA 3INBC 4APLA 2Y8TA 1GM8A 2UWNA 4PEMA 4HSTA 1GK0A 1HFHA 2RKZA 1PNMA 3IU3I 1OJWA 2WIIC 1H2PP 1NWVA 4WKTA 1E5GA 2Y8RA 2IZ3A 4MSLA 1QO6A 3M7PA 2W80A 1AJPA 2RLPA 4DJZA 4WKSA 4JHSA 1JX9A
chains in the Genus database with same CATH topology
4PO7A 3F6KA 4N7EA 3NJAA 3FGTA 3WSXA 4BWCA 3ZLEA 4YIZA 4APLA 2Y8TA 3ZLDA 2I2LA 3FGRA 2Y8RA 4MSLA 2X2ZA 3WSYA 2Y8SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BWC A;  3FGR A;  3FGT A; 
#chains in the Genus database with same CATH topology
 2EHF A;  1HCC A;  1H04 P;  4PO7 A;  1TPM A;  4MUC A;  3GXE A;  2AE3 A;  4N7E A;  1GKG A;  1VVD A;  3T5O A;  1GHQ B;  1QGB A;  2MCY A;  1Z92 B;  1OR0 A;  4FXG G;  2AE5 A;  4HSR A;  1G4F A;  4BWC A;  4E55 A;  1HFI A;  1E3A A;  2CG7 A;  3L94 A;  3ERB A;  5JPM G;  2O39 C;  1H2Q P;  1OK9 A;  2RLQ A;  1JVZ A;  3SRA A;  3S8R A;  4E57 A;  3ML0 A;  2W81 A;  2CKU A;  1E8B A;  5DN5 A;  1SRZ A;  3GOV A;  2WYD A;  1Q3X A;  2WYC A;  2I2L A;  2V8E A;  3OXU D;  1MD7 A;  2X2Z A;  4LOS A;  1AI4 A;  2WYB A;  1H2G A;  1FBR A;  1PNK A;  1PPQ A;  3RJ3 D;  5DN4 A;  3F6K A;  2IZ4 A;  3KXV A;  3KZJ A;  2BZM A;  4AYI A;  5HYU B;  3NJA A;  4K2G A;  1AJQ A;  4ZH1 D;  2XRD A;  4WJG 2;  2JGW A;  3IX0 A;  1U5M A;  1AI7 A;  4KKD A;  4J38 B;  4YF9 A;  2EC3 A;  5FO8 C;  1GM7 A;  2QY0 A;  2KRI A;  3JTQ A;  3SRC A;  4CSY A;  1G4G A;  3NFP I;  3ZRZ A;  1TPG A;  2B5I D;  2Y8S A;  1KEH A;  1GK9 A;  4PEL A;  2RKY A;  3OED C;  1OJY A;  3TVJ A;  2JRA A;  3SW0 X;  1E88 A;  3ZLD A;  4WKV A;  5I0Q B;  4WKU A;  1JW0 A;  2A55 A;  3FGR A;  4YFB A;  1FXV A;  2JGX A;  1K5S A;  4F4O C;  1K7D A;  3L91 A;  1ELV A;  2AE4 A;  1FM2 A;  1GHD A;  3K3W A;  3EJH A;  4B2S A;  4PZ5 A;  2RL0 A;  1CKL A;  1GK1 A;  2G7I A;  1OJV A;  1OK2 A;  1GKN A;  3ZD1 A;  2XWB F;  4YNX A;  4E56 A;  3K3T A;  1C1Z A;  1GKF A;  4K2F A;  3L89 M;  1UOT P;  5HYP A;  3OP8 A;  2XRB A;  4ONT D;  2CG6 A;  4YIZ A;  1OK3 A;  3O8E B;  4LOT A;  1TPN A;  2XWJ I;  1QUB A;  1SS2 A;  1GPZ A;  1FXH A;  1H03 P;  3VWO A;  5HYT B;  3SRB A;  2ZYC A;  1PNL A;  3R62 A;  1ZJK A;  2KMS A;  3CAL A;  4IGD A;  3WSY A;  4AYE A;  1LY2 A;  1O9A A;  4C16 A;  3CI0 J;  2ADV A;  1GM9 A;  1MD8 A;  2YRA A;  2MCZ A;  3ZD2 A;  4B2R A;  2LOJ A;  1OK1 A;  1AI6 A;  3FGT A;  1VVC A;  1RLH A;  3JTR A;  2XQW C;  4K12 A;  4YFA A;  3WSX A;  1KEC A;  1AI5 A;  5HZP B;  4A5W B;  3MQL A;  4AYM A;  1AJN A;  4M1J A;  4AYD A;  2WYE A;  1CP9 A;  3ZLE A;  2YBY A;  4BTH A;  1K5Q A;  2ERJ A;  3INB C;  4APL A;  2Y8T A;  1GM8 A;  2UWN A;  4PEM A;  4HST A;  1GK0 A;  1HFH A;  2RKZ A;  1PNM A;  3IU3 I;  1OJW A;  2WII C;  1H2P P;  1NWV A;  4WKT A;  1E5G A;  2Y8R A;  2IZ3 A;  4MSL A;  1QO6 A;  3M7P A;  2W80 A;  1AJP A;  2RLP A;  4DJZ A;  4WKS A;  4JHS A;  1JX9 A; 
#chains in the Genus database with same CATH homology
 4PO7 A;  3F6K A;  4N7E A;  3NJA A;  3FGT A;  3WSX A;  4BWC A;  3ZLE A;  4YIZ A;  4APL A;  2Y8T A;  3ZLD A;  2I2L A;  3FGR A;  2Y8R A;  4MSL A;  2X2Z A;  3WSY A;  2Y8S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...