4BWFB

Pex4p-pex22p disulphide bond mutant
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
123
structure length
117
Chain Sequence
b'ARKSKCIIMSKSIQGLPIKWEEYAADEVVLLVPTSHTDGSMKQAIGDAFRKTKNEHKIIYCDSMDGLWSCVRRLGKFQCILNSRDFTSSVVPEDIGRFVKFVVDSDVEDVLIDTLCN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UBIQUITIN-CONJUGATING ENZYME E2-21 KDA
publication title A Disulphide Bond in the E2 Enzyme Pex4P Modulates Ubiquitin-Conjugating Activity
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Ligase/signaling protein
total genus 38
structure length 117
sequence length 123
ec nomenclature
pdb deposition date 2013-07-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.11730 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4bwfB00
2Y9PB 2Y9MB 4BWFB
chains in the Genus database with same CATH superfamily
4M22A 4D9IA 1WLSA 2C77A 2LKDA 2R6DA 2XNDD 5IDYA 3HY6A 1TGVA 4M49A 4Z3DA 4ECAA 2R9VA 5L3QA 3B3AA 4K0KB 3A4NA 4LNUA 3UJBA 1SC6A 3EOAI 4FEGA 1BAPA 4WOPA 2HHLA 3M6VA 3UM9A 1RHKA 5K51A 3B6JA 1F17A 1TAGA 4UXHA 3PDIA 3JATA 3R40A 1VKHA 2MU1A 4PN3A 3WLEA 3VA7A 3ZGZA 1VG0B 1YCDA 4E1BA 1US8A 3EGIA 3GHHA 4U4AA 3ROKA 4E7OA 2FVXA 4DCVA 1VJ5A 2ZB4A 5DI9A 4EELA 4BMSA 2OPHA 1J33A 1NY5A 5I9NA 4FX2A 4Z1MA 1ZGHA 4AYTA 1XQYA 3EGDB 1CZOA 2V5UA 4ZDKA 1UOPA 1WVMA 2G25A 4B82A 3DW1X 2BKAA 3O03A 3RAJA 5TSDA 3IT2A 3E5RA 4I6EA 1Q1BA 1SHLA 5ALKA 4YY3B 2DU8A 1N7GA 4RV9A 4C04A 1HDYA 4GOJA 2FPMA 3II6X 4LTNA 4XJVA 5HMLA 5T3YA 3JWEA 2A86A 1LPPA 1XJ0A 2XMCA 1YO6A 1WHSA 3SYRA 4EKIA 3QQ5A 3AONB 2B7BA 3OE1A 4GPD1 4DMLA 4ZYUA 5HW0A 4WZ6A 5LNK6 2E5LB 3KLNA 3WKBA 3IKJA 3PCRB 2BBTA 5L95A 1VI5A 3L2OB 3WJ7A 2EJUA 3IP8A 4ZMRA 4FT4A 2BFWA 3CF4A 3HWWA 4GZ6A 4HNQA 5ITWA 5CDGA 3FHCB 1F0NA 1KI9A 3W9UA 3EF0A 4XTRA 1KJNA 5JO9A 4XFJA 4Q7KA 4MVJF 1U9IC 4MS3A 4YI5A 3WHLA 2JJ2D 4ZI3A 3QBJA 2PSJA 1Q83A 4LZZA 3GZJA 1NXSA 3B1WA 3L18A 3SR0A 2EGGA 3MYYA 3NDJA 4OJKA 4OYLA 2AUMA 5EXEA 3BMQA 3PKJA 5TJHA 3ZQUA 3RLFA 2P78A 3DZCA 3A9CA 2K5UA 3AR5A 3THOA 3ELWA 1HLPA 5C3MA 3Q7TA 1DIBA 2JVIA 1EFPB 1ID8A 2HMSA 2QZJA 2Z3VA 3J7AC 1T26A 1A9XB 2ZJBA 3L9XA 4IICA 4LXQA 3NOQA 4MGHA 3VDQA 2NTJA 3K9HA 3QUTA 3S29A 3RVRA 1O5OA 3JQBA 4NYJR 1PO7A 2RDMA 1G6KA 1YE3A 1KYQA 3PA6A 3BMOA 4LVNA 2DOKA 4ETWA 4OMCA 4R40A 1MKYA 4MUYA 1KRWA 4GX1A 5IBCA 4WFQA 1S96A 5COAA 2QJTA 2V6MA 4L4RA 1TYEB 2R751 1CR6A 1BJKA 2FCRA 1C0EA 2RGAA 2X4LA 1ZM9A 2ZDGA 4E5MA 3WLAA 1DMSA 3HO1A 3L4BA 4RK5A 3QE3A 2IYOA 1Y8QA 5HS6A 1G3UA 2YN2A 4DEYA 1IVNA 2AOUB 1E1KA 3M4NA 4TKUA 2QR5A 4IDAA 1YT5A 2O0HA 1FP1D 1EK2A 4ECEA 2ZCVA 5DHFA 4D9NA 2CFSA 4EKNB 3T35A 3CMCO 2BEUB 3RUEA 4FN5A 4EUKA 4Q9NA 3ZI7A 1GGFA 4QTYA 2I99A 3W8DA 3BD9A 3GFRA 1KY2A 1RYHA 2B99A 4Q3DA 3U7FB 4OYHA 1LRKA 5EJFA 3EEQA 4YJGA 1TIBA 3AY6A 4AJ4A 1E7WA 1WEKA 4F9EA 2V6BA 2PM8A 1LSJA 3VOTA 3MUEA 3WO0A 2FX2A 3IHKA 3N6VA 2CNLA 3KQHA 2G09A 4GYWA 3T3MB 2G77B 1G8KA 3KD2A 5IJXA 3PT9A 4GPTA 4X44A 3WLIA 4AN0A 4ZYZA 2FR0A 2NO4A 4KOEC 4US1R 421PA 4N4AA 1HT3A 2XCLA 1KP3A 4U02A 1XA3A 2CSUA 5FA5A 5JAQA 2CGEA 2OZKA 2VEDA 3MBIA 4K6MA 5FBZA 3EEYA 2G5GX 3G9UA 4LYJA 4HQNA 3AF4A 1Y3CE 4DKJA 2OPBA 2R5WA 3PHHA 5ITZB 1A5ZA 1QQBA 1GP2A 4DA8A 3AEKA 4LZWA 3HBAA 3UAOA 2RK3A 3M5PA 2OB2A 1USVA 4N6GA 3NNNA 1P17A 4XXHA 3S2ZA 5JH7B 2NZXA 2J4DA 2YUTA 5K3SA 1MB3A 1OJ7A 3IJPA 3OCCA 4KKXB 4NCKA 4P81A 2HW8A 1IY9A 1P2GA 3E1GA 3PA8A 4LJ5A 4A8HA 5CLIA 1ZRSA 4RETA 5J23A 4FU0A 3HZHA 2LE0A 4CR8A 1N6HA 4YO8A 2HF7A 4E21A 4TSFD 1G8SA 4WDRA 1NW6A 2GCOB 2YRXA 2GZDA 4MYUA 1EBBA 5DGDA 2OFFA 2PGOA 2QI9C 2QE7A 4Q39A 4ZAWA 4F2PA 3AOEC 5AVYA 3OTWA 1GPNA 3QUCA 4LHSA 1F8UA 3PPIA 5EWMB 1UXKA 5F7ZA 1QH8A 3COSA 1HFWA 3IQIX 2H57A 3PVZA 3TG2A 3AESA 1OBOA 2DUNA 1JSXA 3B85A 2PGJA 1IUNA 2BOVA 1UBGA 5CA1B 4ER6A 3ZD6A 1WP9A 4P3OA 2A84A 1SURA 2V9ZA 3I4FA 4U7PB 1GVNB 2ZZKA 2BT4A 1L5LA 4YRIA 1G38A 1QH1A 1JQAA 3LDGA 3QU7A 5ERXA 5LB4A 1TZBA 2PRSA 4JUAA 7REQB 1K0UA 1T2DA 2JCYA 1GGEA 1Q92A 4BNTA 1EFVA 4UHHA 4EHNA 5CA1F 4YRPA 4W1QA 4ZO7A 2W2TA 3AJDA 5HF5A 2NZYA 2R8ZA 4L15A 5D3ZA 2WFAA 5DNUA 3G59A 1ORTA 1QIJA 3A31A 3I0ZA 3IB6A 4QUEA 2ZPTX 3C7KA 2H65A 3I8SA 3LPCA 2GM5A 1QK5A 4TN1A 4QXAA 1W7AA 5DXJA 3FI9A 4CMGA 3OD5A 1Y42X 4X1KB 4WLNA 2VHVA 1FDVA 4KUEA 4ND5A 4UAUA 3EFOA 2DBYA 3CG4A 4NV1A 3L3BA 3QKRB 3N0VA 4Y1FA 5JCJD 4UD2A 4C5BA 1PDVA 3O7MA 3N7UA 3QVWA 4BV8A 3G82C 1UWVA 3QU2A 4RZUA 2EVWX 1LPNA 4XARA 4MV4A 3UT6A 2FXIA 1W87A 1NTRA 4IVNA 5BV1A 2R7LA 2MSDB 1GU7A 3SX2A 2NZ2A 1XTVA 2ZSBA 4EK9A 5K09A 2CB9A 2ORED 2X0IA 1N8NA 1TQ4A 2HDHA 4NYMQ 1M2WA 2R6AA 4GOLD 1S2IA 3TXXA 4PNZA 4F3CA 4BE4A 2VG8A 5THKA 1MO4A 2UVPA 4PYNA 4EO4A 3ZHXA 4YMLA 4J76A 2XECA 1JECA 1SU8A 1YR6A 3NBUA 1V96A 4TS4A 5L4NA 3EXG1 4CM9A 4DC0A 1NLMA 2OE2A 1BQ4A 2WKSA 3QKTA 4J03A 3FYDA 3HFJA 4UQLA 3FI0A 2VTBB 4URZR 3FPEA 5FQOA 4EUNA 3NG1A 3AEZA 4D44A 2ZJYA 3SJZA 2JFFA 2NU9A 2VPPA 3UANA 4Q7QA 3DDNA 3O3OB 4D3YA 1HTBA 2JANA 4KBFA 2C4HA 5C8DA 1X15A 1XBTA 3ZWCA 4EENA 1TAQA 1DAKA 3ZCRA 3HCDA 3I1JA 4OIMA 1C1XA 2DTXA 5SZJA 1QGOA 3O4JA 4DHWA 3HVHA 2O8FA 2ID9A 3R6LA 4JBWA 3BXPA 1XCJA 4M9RA 4GIBA 2EX1A 1TZKA 5FOTA 1SUWA 1T8RA 1NP7A 3B48A 2BHRA 2QT9A 3OQVA 3TECE 3FYUB 5I51A 4LY9A 1W6UA 2IU4A 3O1LA 2QTHA 4X97A 4KXUA 2JIMA 5I9TA 4RTPA 1T2VA 2HB6A 4F3TA 3CIFA 3FPAA 4GF5A 4E5VA 1NUPA 1RBYA 3VZSA 4QXQA 4RVHA 2M6SA 4HAUA 3ZIAA 1YDMA 1U3WA 4IDNA 1UBRS 2DKOA 1U3UA 5CVDA 1A9SA 2J9ZB 2FI1A 4BKPA 1EX1A 3PNMA 1YJQA 2DUWA 2IGTA 2R97A 3ECSA 2VYVD 3PWSA 3UGKA 3BTSA 1D1SA 2FEXA 4N48A 4XR4A 4MRSA 2ZAYA 3GZNB 3H13A 4EZIA 3W5DA 4TLCA 2PUCA 4BUZA 1NPYA 3OT1A 2J9FA 3IMFA 3MWGA 4ZD6A 4MP6A 4CEHA 4JROA 5FWXA 2PYDA 1SZJG 1E2BA 4HSGA 3D5QA 2ZAOA 5DNDA 3RT1A 5A4IS 2GJSA 3FHLA 2CL7X 3OMLA 3WL6A 1BW9A 2VKQA 2UUCB 2W2LA 2WP8J 1T4DA 1RPJA 4M9ZA 2HMYB 2HADA 2I3ZA 1N5OX 5B7NA 2V6GA 2VHJA 2ZBFA 1G6Q1 1JKJB 2BTQB 3R7SA 3HYNA 4G0NA 4DV7B 1D07A 4E22A 4F4HA 2FE4A 1TEZA 1PD1A 2FSPA 1JHUA 2K2QB 4DILA 5C9ZA 2A35A 2OQIA 1FUYB 5EGNA 1SCDA 4BMCA 5KYXA 1UP4A 1XZBA 3A9SA 1VPDA 1RWBA 4EPYA 5FB3A 3MAGA 3CKYA 3UJ7A 4AJOA 1T4CB 1R4NA 3AKZA 3DAFA 2Q50A 3U56A 3RU9A 1GLGA 1VRWA 3OY2A 4UUAA 4YS6A 1QP0A 2H08A 1FZTA 4TLAA 4KIWA 4CMBA 3DMTA 3ZWYA 2JLUA 3ZOZA 4I55A 2XUFA 3LLMA 1E2NA 4YJHA 3U4QB 2YJ6A 1Y3FE 1S2LA 1K1EA 1RYZA 3MJTA 5I7EA 1NBMA 3SS8A 4N7BA 4O59O 2CVHA 3A05A 4A0HA 3EHDA 3SD7A 4OJQA 2IXFA 4L16A 5AK4A 2BF4A 3EF3A 4CG2A 3LXUX 1WG8A 4JU9A 1AHHA 2H2FA 3ZJTA 1LXCA 3BILA 3OLXA 3TOZA 2O4CA 3BT7A 1RQ2A 2O3RA 4MP3A 2NXJA 4LHZA 4W5WA 1MGOA 4OF4A 3URMA 1HDIA 3D64A 1F3LA 5AUOB 5BMOA 1ATZA 1PX0A 1Z5GA 3PXBA 4M99A 4YRTA 1FFSA 3LTEA 5K8VA 2C2GA 1GQYA 4C2BA 3GLUA 4ONEA 1QMPA 2XB2A 4WV3A 2I2DA 3LWZA 3ZHRA 1XC7A 2Z98A 5FOSA 4Q05A 4WBSA 5M29A 1Z16A 3PQ3A 4LXXA 2R87A 3JD0A 4R01A 1SG6A 4G5QA 1WV0A 2CDNA 4R1NA 4F91B 3F46A 2CLMB 2IEGA 3X0DA 4Y2PA 8GPBA 5CT5A 2O2XA 5LYYA 3GUUA 3I05A 3OZIA 4ZANA 5EXXA 2P9JA 2HNAA 5DHUA 3WOVA 1NNUA 3QV2A 3EAQA 1DWQA 3GRFA 4IBOA 4CHGA 4X24A 7MHTA 1VRCA 3MS7A 4L0DA 4PAWA 1E4OA 1YR7A 2GVDC 3IP6A 1MJ5A 4LG1A 1QGAA 3N39C 2Q5JA 3CGWA 3QUQA 4O4IB 4DKXA 2L17A 2WA2A 1KIAA 2V03A 1TZ2A 4NU0A 2GLXA 1QFSA 1IQPA 4QOFA 521PA 3VBEA 2IODA 3WHKA 2G36A 1A97A 4YMVA 4U5QA 2EF0A 3TWOA 4EJ2A 4BLOA 2XYPA 3L01A 5F1YA 1J2TA 1IHOA 1K7YA 3FCCA 4QTTB 5CLGA 2ZI6A 3A6GA 4ZZ2A 4LZNA 3FMGA 1YIOA 1W1IA 3H1PA 2JGDB 4B73A 3QMPA 1I3MA 2ZJ3A 2G9ZA 3EC1A 4ZZ3A 5JADA 4KAAA 1W5FA 2V96A 3LT2A 3K20A 2WD9A 1IZ0A 3CKLA 2P68A 3KQWA 1NXQA 4L9RA 2BGJA 3HUFA 1E3JA 3AETB 2PZLA 3BKXA 3L8DA 1KVUA 4BX8A 2BI8A 4DV2B 1PT8A 4I9NA 4EO9A 3CPJB 1PUIA 1JNXX 2G9RA 2JATA 3EVDA 4K9MA 4TKVB 4DSOA 4ZMBA 2ZRQA 3PL5A 1DLJA 2V7VA 4RY2A 2VRWA 1HDRA 3O38A 2P1RA 3UK2A 5A4DA 4BTEA 2FEOA 3VNQA 3HQ4O 3LWBA 3L7DA 4X84A 1GPH1 3REFA 3KWLA 1ESMA 3UKJA 2X2FA 3B3FA 2HA4A 1QHXA 3RV4A 4ZCPA 5DB4A 3VH4A 4G8DA 1K5HA 2FN4A 4RHEA 4GFDA 3UMVA 2Z2KA 4K6FA 3AVWA 1NONA 3JAMA 4FFRA 5DHPA 1KS9A 3CEMA 4ZO4A 4B4UA 4DDWA 2IYPA 3HDGA 3P9ZA 1XB2A 5DNAA 1G19A 1U8CB 2JGIA 1P4JA 2DF8A 2JW5A 3JQ8A 1BOOA 5EKSA 3SM9A 3STTA 3WS7A 4CUJA 3HBNA 2PO5A 3QI2A 4E11A 1DEOA 2VDUE 4NDNE 2JBHA 1J2YA 5LDGA 2YNMC 2O2DA 3E58A 4YRZA 2PUVA 3GN1A 4UMFA 1QU2A 2QLFA 3ESXA 3IR7A 1D6NA 1MB4A 4KK3A 3WLPA 4PYIA 3TF5A 3MIIA 3O0TA 1H1LA 3ZCPA 2AXNA 3QVGB 3TGWA 1X1QA 1ZMRA 3ZBPA 1GZSA 4FFBA 5BSTA 3T0IA 4BVBA 3TSOA 1K06A 3V00A 1NAIA 4H60A 1S2NA 3W2HA 1GCOA 3W1EA 1FC0A 3LPLA 5I7SA 1R3UA 2IX9A 2PS0A 4CTNA 4OV6B 3RSZA 4ZOLB 3AY7A 2WJGA 4ZT6A 1PYDA 2HA2A 3LKBA 1KPHA 3I76A 1WCIB 1JU4A 1LY1A 3UMSA 3H9JA 4ZO8A 2IV2X 3OJFA 2F43A 3QF4B 4RTOA 3RFFA 3V1KA 4INPA 1FMCA 4LRYA 1OAOC 3GDFA 4PANA 1UP7A 3EZ9A 2FWBA 2PV7A 2QB5A 3RVLA 4IMPA 3DE6X 3S70A 4DLTA 1QHEA 2DT5A 2TMKA 4P0TA 1G21A 3K9WA 4XPZA 2IH2A 1TFRA 4Q37A 3GMTA 1YRQA 1SQGA 5J4VA 4PGFA 3P0IA 5FI0B 1AE1A 2V8BA 5KNCH 1M6VA 2XYQA 3MTJA 3WQRA 4DB2A 3C41J 5KKAA 1X1DA 2GN1A 1D1QA 5AXAA 3AOGA 2W58A 2JC3A 1V7QA 4RVUA 1YQEA 2HWKA 3MRVA 1HE8B 4GRIA 4NOMA 1W29A 1K8ZB 1T5SA 2WG2A 4F0JA 4DSAA 1WS6A 4F9TA 1XNGA 4PIVA 1B73A 1U8YA 1XRQA 4ZV9A 3LIPA 4QC2A 3NYQA 2I4RA 3WB9A 4BNVA 3EXG2 5DSXA 1IN6A 2HXSA 3OCXA 4C6SA 2JFZA 1IHXA 2JH3A 2QD2A 4IXNA 1PGNA 3NTOA 4LJAA 4OQXA 2GZ3A 4F06A 4M8LA 4F4UA 5TQ0A 2O50A 4C30A 2Z4RA 3WIBA 2A4MA 5DBHX 4EF5A 5CFPA 3WK8A 1RYMA 1R7RA 3ZDAA 5BN3A 3LKZA 4G37A 1Z33A 4HDKA 4DCCA 1E2GA 1I4EB 4JBGA 3HFGA 5EKTA 1HYQA 2JJYA 1DUVG 3KAKA 2D1RA 1XT6A 1ISIA 2YWGA 5M3BA 4BO2A 1ONPA 2ZUWA 1E5TA 4RSHA 4BZWA 2GBPA 4FDUA 5JFGA 2QVLA 1JJAA 2VNHA 1DKOA 3DFUA 2UUBB 1MDBA 4PSAA 3KR0A 3FBGA 2JDIA 3PPXA 3A1FA 4GOOD 4L02A 1WXIA 3TRKA 4BWFB 1M72A 4D9CA 4E4RA 4FX5A 3EDYA 2JGLA 3MGKA 2VP4A 4KN5A 1UBTS 4P7BA 1UUFA 5ESRA 1ODFA 2WE8A 1X1EA 3EARA 4QAJA 5FLYA 1KJJA 3KOOA 1M1XB 3REQB 4BN0A 3FDJA 4YRAA 3KKZA 4LBVA 1GQOA 4LOJA 5IFKA 4JLSA 4HZUB 1V1RB 2QD3A 3PD7A 2X40A 4L8WB 2F1HA 2H5LA 4Z54A 3EG9A 3LC0A 4TLDA 1QJCA 3RJTA 4CXMA 1G9TA 1NMQA 3CR7A 1KDVA 1PR0A 4KACA 4C9BA 4Z4HA 3PXCX 5AIBA 2QNRA 4P4GA 3DD1A 2GSWA 3I12A 1AA6A 3I3OA 3NGXA 2IHUA 4PBTA 4OH1A 5CVVA 4G07A 2ECFA 4CM9D 3OBBA 5LYJB 2OZVA 3PF9A 3L6BA 5C52B 2NZWA 1A27A 1R0RE 5BSUA 5H9WA 2BFDB 1JDSA 5FAXA 5AJWA 3PC8A 3T9AA 1YQDA 1PAUA 3ITEA 4KGVA 3BL6A 3IE2A 3MQFA 1ISGA 2FF5A 4I1RA 3GGCA 1VJ0A 1RWOA 2CLCX 1WUKS 5EJGA 2RGDA 2PZJA 2BP7A 5EC8A 1DC8A 2WJ3A 2A8YA 3DLCA 4I2NA 1AQNA 1N3LA 3FUWA 3ZWBA 1GDTA 3OCVA 4JCOA 4J7XA 4KR0A 3CZRA 4JBIA 2BGIA 2H17A 1FB5A 1KR5A 4MDYA 4B79A 3VX3A 4Z0HO 5K6AC 3ORFA 3IMGA 4QGSA 3IVXA 3VPBA 5LKAA 2XXAA 5TB5A 5A5FA 2HIGA 4NEHB 4ZEOA 1GT91 1R4ZA 4CEJA 1DC6A 4KXFB 5K0FA 4YUYA 2JI6A 5JRZA 2BCJQ 2OHHA 1SVNA 2PXHA 3R3JA 1WIWA 3MT7A 4XB1A 5IC6A 1N2OA 3BFJA 4W4TA 5FIUA 2J3LA 5DN6D 1TYCA 3H8JA 3MWJA 4KB5A 4ZVSA 2ZRFA 2C7VA 1GGHA 3EISA 4PC1A 4NZMA 4TRRA 1XE3A 1TRKA 3D4OA 4C4ZA 3T34A 1PV2A 1Y3AA 3Q5EA 5E1OA 1SWWA 4KR3A 5TY0A 4DSTA 3JVEA 3CO5A 2A0WA 4KP7A 5J9FA 3L7NA 3HJRA 1YZQA 5F5LA 1L4YA 3O4IA 1XQWA 2MDTA 4IJ5A 3GRPA 4IDHA 3HACA 3BDVA 2PNFA 3ZG6A 1EWQA 2JCSA 1SVLA 1ZUNA 1Z2CA 2VNSA 3EEFA 3LXMA 4J2TA 1OBVA 3VSEA 4Z0TA 3EPPA 3QXJA 1JZQA 3VPGA 2QTMA 3AB7A 1FF9A 2D59A 3HB7A 3ON5A 4JMLA 3KPWA 1ST3A 4HDMA 4K40A 3S99A 4EG8A 1RYYA 2C97A 3AV0B 3ZUPA 5K9ZA 1ZVQA 3TUJC 2W2LD 2JL1A 1EG7A 1YS6A 1GTJ1 2VPIA 3K0AA 1E1RD 3SK0A 3D3WB 1RI3A 4KDRA 2ZK7A 3ONVA 1C7RA 2CF6A 2PCJA 4WECA 4PG5A 3KZOA 4KQ9A 2WUDA 4LHWA 1LQTA 5C3UA 5AO9A 1LA2A 1X1BA 4KNYA 4CQMB 1V6CA 3O2SB 4QUJA 3D7NA 2HQRA 5TNXA 4JJEA 2IHYA 5EE5B 3IT1A 3FWPA 3R4VA 2YICA 3L06A 3T5DA 2RBKA 2W6CX 3ZWAA 3ESZA 3QX8A 4TVBA 1E8DA 2PWYA 3KYIB 2B8TA 2QRNA 3DOCA 4Y2SA 3WYNA 4EUEA 3L0ZA 4HO1X 3U0VA 3ZNOA 1IEQA 1HV8A 4RGQA 5E1DA 2AK3A 1SBZA 1WQ3A 2CD7A 4FFOA 1ZI9A 2OHOA 3ETDA 3QELB 1ZWLA 2PY6A 1HA3A 1YIDA 1QNLA 3QHPA 1SVSA 4JHLA 2UUAB 1L4FA 4L78A 4XGNA 4DDUA 4L4SA 1K98A 1PIWA 2FHSA 2JI9A 3M8KA 4L7QA 3D5EA 4I1PA 5B58T 2R96A 3FR7A 3KZMA 2QIOA 1Z15A 3COYA 3DCYA 3LX4A 2HDWA 3EUEA 3KXPA 2AI2A 3H4VA 1L1FA 2NQTA 1F06A 4MLZA 4A8TA 1P4AA 2ORWA 3QEMB 4D81A 5CCBA 2IXBA 4H4CA 3JWHA 1U7TA 2A3NA 1XDBA 4TT3A 4AJHA 1XNQB 3HHEA 3GFSA 1SHZA 1YFKA 3OTHA 2VWHA 4ZODA 1WVIA 2F7SA 3HWRA 3KYCA 4PS0A 5AJZA 5HF9A 4N18A 4JL5A 2H0AA 4QQFA 4DQLA 1K7SN 2HA6A 1XP5A 2JARA 3P52A 4FMBB 2QOEA 2OV4A 2FMUA 2ORVA 5EMLA 3GEPA 2YC4C 5FPTA 4OQDA 1WL8A 1XX6A 3AM5A 3ZHSA 3U44B 4BP3A 1B00A 2VJYA 1OOEA 5ECYA 5F64A 1MZPA 1NLUA 1JL3A 4C88A 4G1EB 1Z22A 1RJFA 2ECKA 1R8QA 1X7WB 3DMFA 4R98A 1U4OA 4WK0B 2GX6A 3U3MA 5K6RA 5THQA 4GMDA 1GNPA 4XWTA 5GPBA 2CNKA 4UUPA 1XYVA 3AZPA 3LM8A 1ZC4A 1IONA 2J08A 4EVSA 1K7CA 2LBPA 1V0JA 3ZDEA 2QQ5A 4NESA 4EO7A 1T5IA 2B8WA 3KV1A 1XRJA 3HEMA 3K9NA 5DK4A 2Z8ZA 3L43A 1L5GB 2VAMA 5IVKA 3E81A 3PICA 4R5MA 4AS1A 4QFCA 4NV3A 2SHKA 2D8AA 1EVKA 4DIEA 1Y9DA 2SCUB 1PT5A 4IG4A 4REMA 3JQDA 5FTNA 2DULA 3NM5A 5FOUA 4FWTA 4A26A 2DR3A 2C84A 4D74A 4EBFA 1G0OA 2SBTA 1R8XA 3DYBA 4L3WA 1TVKB 4JEUA 3AEUA 3SS7X 2ZT7A 5H1YA 4C43A 3KXLA 4EABA 4BVAA 2CZQA 1RNLA 1FMTA 1X7ZB 2PKYX 4KFTA 3RC2A 5GV7A 1I7SB 1G8HA 2A57A 2C5LA 2Q1YA 2Y4NA 4QLAA 3VTKA 3G9XA 4OTZA 1L7AA 4F60A 4ZT4A 2IBTA 2G5PA 3OD1A 3ZZMA 1BDJA 4NSNA 3BIWA 1F48A 4K05A 3UEOA 1UPTA 4UM7A 4EDFA 3CVVA 5KHAA 1P8JA 2JLXA 3MJVA 3Q5DA 2WOOA 4TS3A 2ZUEA 1ZOOA 3KKKA 4G9BA 2OBNA 4P1ZA 4CR7A 2WD8A 2Z3WA 3CH4B 2DYKA 4HX5A 2JFWA 1NL3A 2O8CB 3NHJA 4W5OA 3TUIC 3HKEA 3BEDA 1TCCA 3GQBB 4LQCA 4WZBA 4ZAZA 4EHLA 9ATCA 1LC3A 2I1QA 3UICA 2E1PA 3H11B 3B9QA 1GTMA 3BRCA 4PO8A 4B71A 2F1IA 4CKXA 5C32A 2MYNA 4HH0A 1T8UA 1PJSA 3DWEX 4MUHA 2FWRA 5CVUA 3DEJA 5D6OA 4S12A 8ADHA 4FJ2A 3H99A 4BX2A 4WXYB 4I1SA 3ELBA 4P32A 2QTVB 1GGJA 4H0CA 4RLHA 1A8HA 1EI9A 1ZNQO 2WJWA 3GGPA 2C2MA 3O0DA 3P9IA 3QVOA 2ZB7A 1IOZA 3C15C 4P93A 1VKOA 3HUTA 4MQBA 5LOVA 4AO8A 1E9FA 1TMKA 5GONF 5AVSA 1NXOA 2NU6A 1Z3IX 3D7LA 4QJ5A 3FOEC 5C18A 3CCFA 4ZGGA 2QSUA 3NNDA 4EJ6A 2FSFA 2P6NA 4A2QA 2YH2A 5JDCC 4B4KA 3AIKA 2FHPA 1E1NA 4TZ0A 2MYTA 3QMWA 2NU8A 4RF5A 2CFTA 3IIEA 4BCDA 5BNZA 1EXVA 4F4FA 1W46A 1DRWA 1XEAA 4K88A 4AI6A 3MGCA 4LWQA 2CHFA 2W4MA 3WBJA 9GPBA 2GAIA 1XXHB 3UMRA 2BEVA 3ZWNA 3UV6A 4DW8A 4MK4A 4CCWA 2YWFA 4QKQA 2YN0A 2J5XA 4MNTA 2DM6A 4EMTA 1LQUA 2P0EA 4BQOA 4B6EA 1NULA 1Q1ZA 5KDLA 2J0UA 1UJ6A 2P2NA 3K8QA 2PXXA 1H2ZA 2HEGA 8MHTA 1EH5A 4MWDA 1N1MA 5E3IA 1QHHB 1C7EA 5CEFA 3THXB 2VH2A 3KRTA 2ZRNA 3B6IA 5IDVA 3U3OA 1L7MA 1VJGA 4G8BA 2WAYA 2QW0X 3P9RA 2CF5A 2FPWA 3DZGA 4QNMA 3SZ3A 2P6MA 1KYTA 1YB5A 3KJEA 5IDWA 1FMLA 3UA4A 3BL8A 3TLZA 3LVFO 4UNIA 4QEKA 3MQ4A 3DLHA 1WZUA 1M1YA 1M33A 4JMPA 4F86A 2ZIFA 3UAVA 3GFBA 3JALB 4AQDA 2PVCA 4LUCA 2A5JA 5KCMA 2WEKA 2FPUA 2R6ZA 1YONA 3N6RA 2QRQA 5EQTA 1LDNA 3TM4A 4OGLA 1Z5PA 2FJPA 3TLXA 4OQFA 1S7GA 3NTVA 5CAEB 4TYNA 5CBPA 2XQIA 2RAPA 1ZZEA 3NHBA 5CFZA 3K09C 1YQTA 3HB9A 4L4UA 2VLBA 1MD9A 2WM9B 4UBOA 2NYVA 5K0CA 4PO1A 4NJEA 1Z63A 1WZIA 2FW7A 1I94B 2ZJ8A 4DLUA 3M83A 1KSGA 5CDYA 4GM1A 1BFUA 1MBZA 2R6JA 2XMBA 2FOLA 3ROQA 4BWGA 3T5GA 3VSDA 1TF2A 2H6EA 1TO2E 3QM1A 3G8YA 4FTWA 4DRXA 1YAJA 2IPLA 2P5SA 3N2GB 3Q8XB 1HE3A 3R0XA 5H80A 3WNCA 1PR5A 3JQFC 3HDTA 1PZHA 1N32B 3AXSA 4IDPA 4LECA 1G8FA 2RGUA 4CRWB 1BCSB 2G1PA 4MQFB 5JDIA 4ZCQA 3F6RA 4R9VA 3OSUA 1E2LA 4KSYA 3FG9A 1ZY2A 3NMUF 5JECA 1EIZA 4KNVA 2Z8XA 1JR3D 1FSZA 5TEWA 2GTHA 4RSRA 4WPGA 3D6JA 4PYMA 5D3MA 4L6CA 4O29A 1E59A 3LBIA 4C78A 3A32A 2G7MC 1FIUA 2QU7A 1C1DB 3IP7A 2BEJA 3RC1A 1U5CA 1EGQA 1JT2A 4ZOQI 3M6UA 3O8QA 1NU6A 4Q1CA 1WQ1R 2O3SA 1G5QA 1TD1A 2WWHA 1V2HE 4RJLA 3I4LA 4YFVA 2FETA 4DUYB 2NVUA 2ZYWX 3GJRA 1G64A 3JU3A 1VL8A 4IRMA 4NULA 2BD0A 5G1OA 2W90A 1KJZA 4JR2A 2AEFA 2ZVDA 1XZPA 1ZM7A 4QODA 4YJFB 3RVBA 3P9PA 2HPVA 1AKWA 2XDAA 3ZGNA 4FMDF 3RS2A 2C94A 4KXYA 3FETA 4YCCA 1VP9A 1M6EX 1DJOA 4BNUA 4RIHA 5F3WB 1PEYA 4EQ6A 4NVRA 3E8MA 2J09A 4AUNA 2A5GA 4OOEA 3DEZA 2JBAA 3EY9A 1R2QA 1ICIA 4AKSA 4DBZA 2AN5A 1ZGJA 2PK3A 5EPUA 2BFOA 1E3IA 3BPSA 2FZ5A 1O08A 5AM3A 3I5AA 5IAJA 4BTVA 1AS2A 3I0MA 3DBIA 2JCBA 5EHXA 3QPDA 4Q4JA 2ZSUA 3DJFA 3FRHA 4QDJA 1RCUA 3KB1A 3TKYA 2ZSHA 3WL7A 5JC1A 1K9VF 1GN8A 1OXMA 1H42A 5FNVF 3D2AA 4BMDA 3R9WA 3H8VA 3I5YA 4HJXA 4Y9SA 4JP3A 3OQOA 3ZNNA 3BZWA 2F8SA 3KPUA 1GNQA 3A4YA 2C3UA 3GA5A 3RLIA 2A92A 1C7QA 3TSYA 2PG3A 2E4VA 3CUKA 2JFUA 3F7NA 4I36A 1XZQA 3K5PA 4ZPXA 3RARA 4MCHA 2ZS8A 3C8ZA 5GJCA 3QXCA 1XTRA 2ONKA 2DBVO 2XQJA 2B9EA 3EDRA 2WFZA 4GI1A 4B3JA 3HH8A 4N9QA 2Q4EA 4KX5A 2C4NA 2ATXA 1E2HA 6PFKA 2QW8A 1JNYA 5JSKA 4ZYXA 5C2JB 5BVGB 4WVFA 2J1LA 3RS4A 2FG7C 4XIIA 2WKQA 4KNWA 5CYFA 3F4KA 2OKGA 5FPSA 3LCRA 1Y5IA 1X92A 5AVOA 4Q9LA 1ZJWA 3E9CA 3COZA 3DB1A 2E4WA 2I4IA 2E2WA 2PX3A 1AMNA 4B84A 1O8CA 1VE9A 4O3FA 2DQ4A 3NTQA 1QLJA 1GSIA 1YBAA 5KU7A 3D4BA 5JR3A 3FCAA 4YQEA 1Y5MA 5IJAA 2FKAA 4GZ5A 1GL6A 1XXHE 3BJMA 3CONA 4U5XA 3GGSA 1EJ2A 2X23A 1ONNA 2N1BA 2HMVA 3KKNA 2AEMA 1QTRA 4ODIA 5LDDC 3NB0A 1APBA 1N6IA 2H59A 2PA3A 2HRCA 3QU4A 3W7BA 2CKMA 1J6UA 5L6LB 4C7VA 5JAUA 3U1VA 2HQ1A 4RO0A 2OCXA 3K8YA 3T7AA 2VNAA 2VWGA 1GDDA 1KFEB 4W9RA 4LYAA 4MPPA 1PJ3A 1KDYA 3K35A 3IR5A 4X20B 1DG9A 3WY9A 4YRDA 4UTRA 2W8ZA 4JQZA 5B2ZA 1U8ZA 2VPYA 4F6RB 1RKUA 2GKOA 2HLDD 1CQJA 2O8NA 3LG2A 5DSZA 2G40A 1YUNA 5AKKA 4K5QA 5I7OA 4X3OA 4HMPA 4ZVRA 4OK3A 1XR3A 1ZPDA 4RABA 1LTHR 1RKQA 2V7XA 5KJCA 4B85A 3EGXB 4HY3A 2IWRA 2J07A 4AO7A 1QYXA 3FNFA 4IMIB 4CYMA 4G36A 3GZTB 4D45A 4XR9A 4Q3BA 2WNSA 3GRCA 4BMOB 4K81B 2OEPA 1NWCA 3KK0A 3QWFA 1GCUA 2IPAB 2OV3A 3INYA 4M98A 3D6NB 4Q3AA 3DVSX 3IDAA 5E2BA 4FYIA 3UK6A 2FUCA 4JYZA 2G82A 1L6RA 4YP0A 4G4GA 4J9VA 4GR4A 4LI0A 3TQCA 1MMFB 1RRKA 1S2GA 3BWXA 3IDSA 4WCFC 3JS5A 5TXGA 3WYAA 1JQ3A 3HYLA 4RFSA 1T1GA 2PX8A 4B6QA 1E7YA 3ESYA 5BN4A 2QAGA 1RLIA 4BLQA 2Y1CA 3K72B 4KTVE 2CDCA 1IZ9A 1M67A 1XKLA 4X6UA 1I51A 4NJMA 1YRLA 4QTZA 4AWAA 4PIMA 4YCSA 2O54A 1RYEA 1WOMA 5C8YB 1XJCA 4OK5A 2Y77A 5DBFA 1IQ0A 1EP1B 3S5UA 5DGIA 4IHKA 2C4TA 2BV3A 2X1HA 4DR1B 4HLNA 4R84A 1PJZA 3Q3VA 3T5MA 4RTJA 4ACAA 2BKUA 3GDWA 4LTDA 1J23A 1E2EA 1ZGAA 3NAGA 1HDZA 2IVFA 3DDSA 3KKPA 4BUCA 4BJ6A 4D4GA 1H9CA 1CERA 4GSYA 4M76B 4X8OA 3WRVA 3MHTA 1E5LA 4IJVA 1W4CA 2WQ7A 3JQ7A 3STUA 1USKA 2NV0A 2Z3ZA 3EGCA 3K7EA 4EFNA 2BFBA 2ZCJA 4CM1A 3MINA 2P5UA 1WQ4A 3AR9A 3E22A 4NFLA 1WD5A 2PWZA 3TSWA 2B35A 4CKEA 1WBDA 1KK1A 4MDHA 1OHHD 4J3FA 4DMKA 1D2AA 4RM3A 1PW7A 1KVQA 4JR0A 5HQTA 1NDQA 2PBLA 1JTVA 3B8HA 3N53A 5ESWA 2D0OB 2FRVA 4HVLA 3RRBA 2JCGA 1I1HA 2QP3A 5FYDA 4R0VA 2RGRA 2E5FA 4JVLA 1DIAA 5I7RA 2ICAA 4YTEA 1PNRA 2O7NA 4LDJA 3BH6A 5GV8A 1PR2A 2QLBA 1FLNA 3AP1A 2QMUA 2ZBPA 4IIYA 2P9BA 2G72A 1JH8A 1N1EA 5D5QA 3EUAA 2AJCA 3ZHUA 1COWD 4HUTA 3FJ1A 5AUNB 1AUPA 4HN9A 4YVFA 2REXB 1GQSA 1Z7BA 3W78A 1SXGA 1UEIA 4V2IA 5KQRA 3KVVA 3L7MA 3VDXA 4EVQA 3HN2A 2XCRB 4PHCA 1NF2A 2W2KA 1HT2E 2GPBA 3AW9A 1P0CA 3LNCA 1BTOA 1MC4A 2NQ2C 4FFLA 1N8TA 1FZQA 4L8LA 3JW8A 1FK8A 2JAXA 5HIKA 1YTUA 2IP4A 2XUDA 1G20A 3UOWA 4KLAA 3X3HA 4GKKB 5F9MA 4RS3A 1T13A 4C4PA 5EZYA 3MTQA 2D5AA 1CK4A 1D2GA 1NU8A 4A2CA 5KTMA 1NI5A 2ZR8A 1H9AA 1BOFA 3JZIA 1XTIA 2ERYA 5SYNA 4HWTA 1G8GA 1PWYE 1SBHA 2IY7A 4XDZA 1VGVA 3EDCA 3S3TA 3QYFA 5KQGA 1KNQA 2QJWA 3QYJA 4ZEVA 4NEGA 4TRJA 5KZMB 3KQLA 3IP1A 3LIIA 1S0UA 4F92B 3SVTA 5FL7A 2OCPA 2WF5A 1CRWG 2BF7A 2F8TA 4CDMA 2VQEB 4RLSA 3OZRA 5HKKD 1MPXA 5A9TA 3RUIA 3M6LA 4ZYWA 2XYGA 5HE8A 5CP8A 1F60A 3Q12A 2YFYA 4K6OA 4KO8A 4OHUA 1A50B 3GMIA 1W44A 4OM8A 4FMCF 3LRTA 3T1NA 4IUBS 3N2YA 3GT7A 1VHLA 2GN0A 5DSTA 3TMYA 4CLXA 3RO7A 4DR5B 2Q8QA 1EVLA 3HO6A 4LQLA 1LVHA 2HO4A 1KJYA 2E87A 1CQIB 2IE0A 3RC3A 1LPSA 1CJTC 1E4VA 2VCHA 1ZAKA 2VJOA 4ZOBA 4DR2B 1QRSA 4E12A 3GI1A 1KMHB 3LX8A 3FCEA 4QFMA 1HETA 1THMA 1A1SA 1EVYA 1SGWA 1J2JA 2GBIA 2I66A 1EVEA 2YXPX 3DOEA 4FGJA 5FUWA 4MV3A 4M37A 1H66A 3DSRA 4CDGA 4GVLA 5KNBD 3M6WA 1H5QA 5LZ5A 1QWOA 5A9SB 1JYSA 1FDTA 1HNNA 2GA9A 4PAQA 1XK6A 4ETMA 8OHMA 2YVUA 4IJ6A 2FZ4A 4BO0A 1JH9A 1MG0A 4LF4B 2Z83A 1UKZA 1IMJA 3P0RA 2A14A 3RK4A 5CGQB 4BCBA 4AKHA 3PIDA 4RIGA 2BDTA 1MW9X 4KQWA 5EJ5A 5L7YA 4QXPA 3UH1A 4NHOA 1ZJJA 2ID7A 3HJNA 5AK0A 4YXFA 5HQ3A 5IS2A 1YBFA 4WACA 4U9UA 3DL2A 3ONWA 4X91A 2QMZA 4QU0A 1A9XA 3D4PA 1MO5A 2WIAA 2BONA 1Z7EA 4WW0A 1DQNA 3GLQA 4YV1A 4YRGA 2C3YA 3DGEC 2F67A 4PZYA 4DLWA 4YQYA 3S7TA 3L04A 1KOGA 3DOJA 4N8SA 3GBSA 3MRXA 1DKMA 2R1TB 3ZXIA 1VHTA 1NMYA 2EZUA 1TVEA 1AZLA 3KLOA 4HAVA 2EFYA 1RI5A 4ID3A 1QC5B 2BE9A 4R05A 1N1GA 3TKAA 1V8FA 1E20A 1S3FA 4R4JA 2VT2A 1XNJA 3V1LA 3DC2A 3KC2A 3JQBC 4ZT3A 1WW8A 3K32A 5FOQA 3IGFA 2I91A 1I3KA 2HCJB 3LV8A 4LXIA 1AUOA 2WJAA 3M4YA 4HP8A 4NDAA 4TT8A 2EDCA 1XCGB 3A1TA 5H83A 4ENUA 4R5HA 2YWCA 1LWOA 2XQVA 1RXWA 3R3XA 1QTIA 3BIFA 1TUIA 3CGGA 1WMEA 1GFZA 4WINA 3D3QA 2A9PA 1SVMA 2GYWA 1WB9A 3IHLA 2C4KA 3IAEA 3MFQA 2O0KA 1GL3A 5T4EA 2AJLI 1B6GA 2O7VA 3UUFA 1J1ZA 3E4DA 1CUYA 3C1TA 4Z8XA 5KNDA 2I7XA 1U7HA 2AG8A 1B1CA 5BVGA 2WYWA 4LXUA 4M0FA 4Q16A 4HEA6 1V3UA 1BVYF 2E9SA 1IHUA 2HSWA 2IEBA 3T7CA 5LJLA 4BBPA 3UCFA 1KMNA 3KT0A 3UH0A 3GLFB 4S05A 1GFWA 1XDDA 5JALA 4D8YA 2VYNA 4AP9A 4A0GA 2WLTA 1GL9B 1L3IA 2WUFA 4Y1RB 3WNBA 3IUEA 3H1EA 1QKJA 4TUYB 2WTNA 4DUGD 5UKDA 3LGXA 2PE5A 2DETA 1RCFA 1SUEA 5JEDA 1O94C 2UZIR 5JH7A 2HU8A 1OX4A 1L7EA 4UU8A 3S1SA 1BGVA 2HRDA 3WQSB 1UAYA 2C4MA 2Q21A 3N2KA 4PFKA 2B2CA 3D3JA 3LXXA 3D7RA 4Z9XA 5EZYF 5TMEA 4BWVA 5M34A 4MVJP 1PFUA 4KVAA 3V4VB 2G5TA 2BGMA 2IXTA 3PNPA 3SLGA 2JKZA 2PBRA 2QUAA 2V59A 3J7TA 2GCOA 3U39A 4WNAA 1RM0A 1VMAA 2CFCA 2YCBA 4HPXB 1TL7C 3JQ9C 4ND6A 4R8MA 2X0FA 5KYWA 3QG5A 1JB9A 1QOPB 1AQLA 1XAGA 2EFEB 4IAOA 1XCBA 2XMRA 4LHYA 1HPLA 1YS9A 4LBWA 4DJAA 5K5EA 1FMFA 3GZ4A 5AW6A 1RCTE 1FNBA 3U40A 4PLCA 4ZQCB 1KYZA 1R15A 2QPAA 3QZUA 4FW9A 3WNVA 3ROGA 1VPTA 1G2PA 3FTFA 3TX2A 2B4AA 2XRYA 4YNBA 3TTSA 4YLYA 3WK7A 5K7SA 3KIPA 1AQJA 2JHGA 7REQA 9LDTA 2WI8A 3F96A 3FXAA 2BGKA 1FE8A 1XDSA 2VS1A 4MS4B 2GPTA 3SDZA 1AB5A 3UKOA 5REQB 1PT7A 3N0RA 2BLLA 2X42A 3IAFA 5LA6A 4DLYA 3TPCA 1Z39A 2EG5A 2J41A 2PU5A 4LBZA 4RD6A 1E9DA 4Y1GA 2AVNA 1XO1A 3GCGA 4QYSA 5TDHA 1D4OA 5DXFA 4YAFA 4FE7A 1J21A 3TN7A 1KH3A 3RT7A 4Z5XA 3QHAA 4XB6B 5J5VA 4BGVA 4IIHA 1T3HA 1DBVO 2GFHA 4HQKA 2R68A 3VR6D 2O1EA 2Z30A 4LZOA 4EW6A 3CIOA 1CPYA 3G17A 2ZRPA 1SXJB 5CNKA 2Z5LA 2FRDC 3A1NA 1GZ6A 1HOTA 1OA1A 2DR0A 2NACA 4MXDA 3GFFA 4ZAGA 4F1JA 2JIQA 1MR3F 4ZREA 3I2GA 2GM9A 1IWOA 1JBKA 1ULZA 2WW8A 1P45A 2YWXA 1J25A 2F2TA 1B14A 3LT1A 2X0JA 4HFNA 4M55A 3EGOA 4HC4A 2BFPA 3LKVA 2WHYA 1XQ6A 3NFRA 4LISA 1K7XB 3LUKA 2JRLA 5TARA 4H1VA 3S7ZA 1UFRA 4P4SB 1N9GB 4GD3Q 4Q3NA 2QIPA 3M1IA 4YDSA 1JW9B 3NHAA 1QX3A 2XA1A 3OH8A 1V1MB 2GEUA 3V42A 4B7ZA 4ENPA 3K6SB 3L6UA 3TJZA 2AXQA 4A6DA 3DWFA 1UKEA 1WXWA 1WY7A 2HDOA 2V6JA 3KR2A 3WFJA 2BUBA 4CKCA 1SA0B 5J1TB 4E5NA 1FW8A 2LIPA 1H2FA 5KAMA 1PT6A 3FZGA 2VTVA 3CURA 3KX2A 2HMUA 1P9NA 1FQOA 2CY0A 3B6MA 4Q66C 2BMAA 5B1IA 3HUEA 5AM1A 1PW5A 4AG6A 2CMHA 4TXJA 5IG2A 3A4VA 1U3CA 4WASA 4OMDA 4N7RA 4JUDX 2CLEB 2VTBA 1X8JA 2IYVA 1D2EA 1XVLA 3E9ZA 1GZUA 2QX7A 1CUUA 1P5ZB 4R8RA 3UWPA 4N3AA 2OCLA 2HQOA 4CUZA 1ADYA 1IRXA 1PX2A 2ZWOA 1F2TB 3NJRA 1JIXA 2CZGA 4QDUA 2CXOA 4JJAA 1F2UB 4MI3A 1K75A 2W48A 1ECGA 3A11A 4NE2A 4CT4B 4HR7A 5CCDA 4L95C 1UZLA 3EQ8A 1MIOA 5IJ0B 4KZKA 1E2MA 4H9GA 4JBHA 4PTZA 5LQDA 3PGXA 5ILGA 4ARZB 3L7IA 3LHDA 3IV7A 1GUDA 1S01A 4GU5A 2A59A 3FTDA 1TU3A 1DXHA 1W5TA 3FYUA 4JGBA 5GAJA 4XGQA 3IRVA 2HF2A 1RZVA 3M0EA 1N4DA 1T9CA 2NXWA 3I2HA 1GY8A 4FJ0A 4L9AA 3BVPA 3AB8A 1LDYA 5EWLA 1Z6ZA 2C8JA 4X60A 2ZSFA 1PGQA 1FNNA 3RVSA 3CNNA 5LVAA 5ALFA 1ECPA 4BJHB 1VG1A 1XZLA 3V7NA 2UZ0A 1JVNA 1EJBA 3F74A 4OB6A 2AJDA 5FLEX 1SQSA 5T7BA 1Q1QA 1NRJB 5KYUB 2GHTA 3OA0A 4JI1B 3TBFA 1VL0A 1X3LA 3FTCA 4MAAA 4Q6BA 5KTTA 3LC1O 1I6WA 3ED5A 4HB0A 4C6HA 4ZV4A 3QITA 2B8JA 1AK1A 1T3LA 4PY2A 4JVNA 1ZFNA 2VDJA 4H7FA 2XADA 1JIIA 1JKMA 2A0KA 2GZAA 3LPMA 1M7HA 4KV9A 5D8DA 1UDXA 2ZETA 1DWOA 1ZJYA 3H2JA 5FA8A 3VX4A 3E3AA 4ZT7A 3MSXA 3C3PA 1G2OA 2XNSA 4CF7A 3FSGD 4YCJA 3AG6A 1QYDA 3UW3A 4PC6A 3GLFE 1MIHA 3L8HA 4QUAA 2Z6AA 2BI7A 2REOA 3MSCA 1HUQA 1SHKA 1X0XA 3V4SA 5KPDA 4RD0A 3S27A 1VE5A 4KN8A 3ADPA 1E1CA 1ECFA 2JAWA 4L76A 1ZGZA 1IK4A 3HCBA 3Q2KA 1QG0A 3AINA 1T8WA 3I6IA 4JEMA 1TADA 4UVEA 3WSTA 4EFMA 4XVQA 6Q21A 4INOA 3AFOA 4FGZA 2QRVA 4C89A 3MELA 1T4CA 4XIJA 2HA3A 2ISCA 5JNVA 4MIKA 1Z8HA 1JEYB 2AC2A 1YHYA 1IWBB 1RYFA 2I62A 4TMVA 1Y80A 5DHQA 4UEJA 3PGJA 3PDJA 1DO0A 1BMQA 4BRZA 1HE1C 1G8AA 1ZSYA 3GV0A 5ESXA 4DA6A 2HK9A 5LA6F 3GRZA 4P53A 2VR1A 4OHWA 1NG9A 3C6BA 4MB2A 1JN0A 1HKHA 3ZCXA 3ZWKA 4EAAA 1C0PA 1EVIA 1OV6A 1S4QA 1AKNA 1NSFA 2GERA 1GUFA 2OD9A 3LVQE 5FBLB 3VH3A 2NZJA 1QANA 1D6SA 3IAM1 3PFGA 4R69A 1D6MA 3RNOA 3UHAA 4LZAA 2ZUFA 2B6NA 1RLMA 4UOZA 4PBRA 5HQJA 4LNHA 4XE5A 1VCOA 1GTZA 1Z0JA 3HKBB 1BWSA 4FEYA 3RTAA 1SG0A 3INNA 4FYPA 5DYTA 1UOQA 3KKLA 2OO5C 5FTMA 1PEAA 2GJ9A 1Q14A 3VZRA 3HP7A 3HZRA 1W4RA 1CBUA 2RI1A 1OAKA 1UAGA 1XIVA 5DW0A 5IC4A 4ALKA 3FOAA 4CODB 2IW3A 3VO1A 1E2PA 3UXHA 2I4MA 4YDQA 1C50A 4Y2JA 3N0XA 1MOPA 3U7QA 4PPGA 2O5RA 2QLTA 5FR2A 3PPWA 1BFDA 4IQ0A 2G6TA 1AUQA 3R5XA 1CF2O 5AWFC 2WSSA 4YRBA 5AHXA 3WK4A 1AF7A 5JCOC 4F3RA 2V7EA 1DQZA 4AF8A 4BRSA 2WT4A 1P2FA 3F9RA 3GXOA 3H8WA 4GI5A 4A4DA 2NADA 4DA7A 4IRXA 4UM5A 5KYNA 1SXJE 2WABA 5FOVA 4PC7A 1Y1QA 5IAOA 3ANNA 3ZBTA 1JDTA 4HAWA 4EEKA 1QO0A 1AV7A 2XGGA 2PMCA 2YASA 5JISA 1T2FA 3E84A 3EEBA 2R0QC 3TQIA 1SBYA 2VUTA 1JFSA 2X3FA 1QM5A 1AXRA 3SG0A 1Z17A 3E15A 4RGYA 5FT9A 2WOJA 4QYWA 5K2OA 3NRCA 2YDYA 1U7ZA 3TFWA 4G0OA 4CV1A 1PR3A 2E18A 3W5CA 4KRYA 1Q12A 1O6ZA 1Y5LA 1NBWB 2ZYHA 3SM3A 4F84A 5MN6A 2CCJA 2HJRA 2QM0A 2DMRA 1Y89A 3K2EA 3UJCA 3BF7A 4O4JA 2OGWA 1U7OA 4HXEB 4Q5IA 2OKCA 1KKMA 2HCBA 2YZMA 2COKA 2O1XA 2PS3A 2HJ9A 3M4XA 3N1UA 1RR6A 3X43A 5LMNB 1HXHA 4H1UA 5CX1B 5DE3A 4UTPA 4EYSA 4RQUA 4BNIA 3GFTA 5KEIA 3EIHA 3FDZA 4G84A 5KMGA 3DTVB 4ILKA 4K9LA 2OZLB 4Q1DA 1KQOA 2DPMA 4O08A 1GFIA 4LOHA 5EIWA 1BSVA 4AJ2A 5B1DA 4TKVA 2QZ4A 4YPVA 1X9IA 1GZ4A 4YUVA 4LDZA 1LTKA 3W7VA 2FG6C 3D2CA 4IRUB 4KPUB 2KPOA 2QLJA 4NZZA 4DXAA 3KJGA 4Z0NA 3K9GA 1QPGA 3B6KA 1SHJA 2J30A 4RS4A 1SCIA 2NSLA 1PWXA 2LD4A 1H22A 5AXBA 1LWNA 1Q50A 3AKEA 3ZWWA 5CITA 3BZBA 1GRQA 3AQ4A 3QE2A 4X95A 6REQB 4RXMA 1AH2A 3SC2B 3JYHA 1T0BA 3VSBA 1UOEA 2HUPA 4REQB 2WZBA 4U2EA 3W4IA 1H3EA 2ZJ0A 4Z4FA 3UXMA 4QM6A 4MEJA 2P0AA 1XZCA 4KGXA 1YJBA 3OICA 4DJ5X 2PX5A 3BDAA 4MUFA 4CNQA 5G0SA 4ND8B 4IHQA 1L5FA 1HQYE 1WHTB 3D1JA 1G3QA 1BHO1 2ZRCA 1GZVA 3DV9A 1YC5A 1L7XA 1UINA 3IUJA 4JDPA 3UENA 3LY8A 3WMGA 1YCFA 4ZVQA 3ZCUA 5EZ6B 6LDHA 5JJBA 4RTMA 5F73A 1ULBA 2DCMA 1FS5A 3VV3A 1IHYA 3JXEA 2HGZA 4DG9A 1Z83A 1GVHA 1G4AE 1R0ZA 3DXZA 1Q5PA 3QWAA 2IXDA 3H5RA 4RH3A 1UM8A 2WHXA 3BGVA 4DA9A 1LRJA 2FVYA 3QVGA 1FMJA 4K26A 3P94A 5AI8A 1IY0A 2RI6A 4F3NA 5KNDD 4Y9UA 2H3HA 2KWIA 5JSUA 1H94A 4PPFA 4L28A 5IASA 3ORYA 2IUTA 4PM4A 3GROA 3L8EA 4IVQA 2WP0A 2IS4A 5TGTA 2XKAA 3VR4D 5FKJA 1ZJ4A 3MTIA 4OI2A 5EHNA 5LCXA 1E2KA 4M8IA 3U60B 2CBXA 1E9VA 3ZLJA 4RM2A 1NPTO 1JSRA 1U8XX 4RQAA 2VDWB 4PCLA 4RL6A 4ZOLA 2LUOA 5JSYA 3DNMA 3VHLB 5DHTA 3R2JA 4R71A 3BEOA 4C0BA 5E4FA 1U8TA 1WCIA 1VJTA 1P0IA 4AL4A 2ZRIA 3HCCA 5EXTA 4KPEC 1AO3A 3QF4A 3B7GA 5CNIA 1U2DA 1YVPA 3UG6A 1CUBA 1PK7A 1ID1A 1XZFA 1Q22A 2OESA 3PG5A 1RBZA 3CH7A 1WUHS 1RPNA 5DH9A 1WR8A 1IE3A 221PA 3FIJA 4EG7A 1J5PA 4Y9TA 3V8RA 4JCCA 5CIYA 3I45A 2VBGA 3D59A 2CYAA 2QM8A 2R5FA 1MGPA 3N8NA 1NW9B 3UWMA 1P2UA 5T6MA 4I66A 4B5KA 1RQNA 1ZA1A 4R6XA 3R5TA 2CHQA 1FXWF 3DZFA 2HSZA 4UZEA 2IZOA 1C1YA 5CT6A 5JXGA 5KCZA 4ZAFA 2XZDA 1OWOA 3DEYX 3QHQA 5A5GA 1SRQA 1NZJA 3UHPA 5JV5A 3PUYA 2Q3EA 2I1WA 1KEZA 4PSCA 5DTMA 1O3YA 1UR5A 4GMKA 4ALIA 1I32A 1U7WA 1Z0KA 1FYDA 3GAFA 3IOYA 4GVXA 4PONA 5AKHA 5EI5A 3HR8A 1G5PA 3V4PB 3WGIA 4XQ9A 1OI2A 2GBLC 5HF6A 4EYGA 1YFJA 4V0NA 1O6CA 4CKEB 1JE1A 3QA3E 5HKLA 2DBZA 3WYCA 3RFTA 1IY8A 3F5MA 1MO6A 3W05A 2BVNA 4LPKA 1JEQA 3LCMA 3F5SA 5ESDA 1P73A 1W6RA 4GBJA 1YRYE 2LR0A 2VNIA 1J5XA 2F3UA 4ZXFA 1M8GA 4F4JA 4HAXA 3IT0A 1NUTA 3O73A 5IT0A 1K6MA 2OAGA 2PXAA 4Q1BA 4CM4B 2AR7A 3ROEA 5BUZA 3WLSA 5KTOA 4DB4A 1PNOA 1XPRA 3CXUA 3GRRA 2R6FA 4V0MA 1IZ7A 5LP6B 4B6JA 3W5VA 3K1AB 3ECAA 3PFWO 3WWDA 2MSKA 2CNBA 2G5CA 3MWEA 4PGAA 4BFVA 3G5LA 1U0NA 5J2TA 5F76A 2ATEA 1BJRE 1H2AS 2FKNA 4HZUA 4YFYA 1V1RA 1NXPA 4PTLA 3Q11A 1FNCA 4IZHA 1E6UA 2Q2NA 1A9PA 3GIDA 4FHFA 1H2WA 1MCZA 1WEHA 1MO3A 3Q98A 4JLPA 3RIGA 2LDBA 2V7PA 2HPZA 3RSOA 5JZ9A 5BT9A 4D3XA 4IIXA 4ZQEA 2VSYA 3G1TA 3TQTA 3Q87B 2I2XB 3QJ5A 1WO8A 1VA5A 4RHUA 2Q5CA 3AYZB 4B3BA 1GA4A 1U3GA 3MUFA 1UKVY 3NUQA 4I7EA 4U0JA 1DC7A 1S02A 4OYYA 4UU7A 5JG7A 5LYJA 5T67A 4GGPA 2CNDA 3ZH2A 1Z2NX 1JG2A 5BOSA 3PNSA 2BHLA 5MHTA 5HZKA 1RM4A 4GXRA 1H23A 4XQGA 4WUVA 3KE9A 1BNCA 2JI8A 2Q2OA 3GNSA 4ZGBA 4DR3B 4WN9A 1CYDA 3KSUA 1XDZA 1NKVA 2R1ZA 3QUSA 2XBUA 1Q6YA 3E61A 3E9NA 1U9JA 5ECDA 5CT8A 1Z7WA 5G4KB 3QJGA 5JO0A 2JHPA 1DTSA 3CNHA 1QYCA 1TM2A 4C4OA 3ER9A 1OT3A 2Q5HA 1LVGA 3K6RA 5IF9A 1JA0A 2X7JA 1CZNA 3FJOA 5L4LA 2IHBA 4M21A 4JGIA 2IUYA 1T9ZA 3B13B 4TV9B 2QLMA 1T8PA 2FSVC 3UMBA 1BXKA 1II0A 2IEIA 1TA0A 2J3MA 3KVNA 3KWJA 3Q0IA 3BD8A 1UBLS 4LYGA 2QR2A 4RY9A 1QGED 5ALEA 1YI8A 2PQ2A 5SY6A 4TYMA 4EYOA 3VVBA 1F20A 1W4BA 2BC9A 3LY9A 4MCAA 1O94D 3K5WA 1T1IA 3H2KA 5ULLA 4JLOA 1G5TA 4EWLA 4B32A 2VTKA 3R5KA 1LFAA 2I2CA 4QL3A 5FA6A 2NXNA 2IUFA 1OZGA 4QDXA 1RAIA 2HNKA 2GXAA 2HXGA 4HTFB 4TSKA 5C4IA 4CIAA 5KSPA 2HSEA 3TR6A 4DV1B 3BK7A 1T6XA 3K0CC 1A8PA 2EEZA 4K9RA 3N74A 1C9MA 4NMXB 1I24A 1JGTA 4YP9A 1PJ8A 3UF0A 4NBKA 1U2GA 3ZWDA 2PUDA 1GN9A 1UC8A 2PPVA 3PD0A 2ETVA 3HXPA 3SZGA 4U3JB 4BBAA 1X86B 5DP1A 5C80A 1GU0A 3NWBA 4EEXA 3N2IA 1O77A 3M9WA 4JA2A 2LCQA 4II2A 2AV6A 4IEIA 1MF7A 1YZHA 2ZM6B 1QQAA 1YOVB 2C9BA 1WLYA 4RD4A 3IEXA 2PRIA 2Z9CA 1T5DX 3EMVA 2AN4A 3TR0A 2Q2VA 4WXMA 2PT9A 5FR1A 1YRWA 2WSIA 3OM9A 8LDHA 3W6PA 1G1MA 1ZVKA 4YACA 1YC2A 1AY0A 1W73A 2WNIA 4B6SA 4GDMA 3S2IA 2QRMA 3P0JA 4P8RA 1W49A 1N2GA 1Y82A 4MJ7A 1UKAA 5H4HA 4ED9A 4EBBA 2H1LA 2VJKA 3CY6A 3HLKA 3H1TA 4B7AA 4CQMA 2B61A 4CU5A 5JRDS 3THWB 2V65A 1XKTA 5THXA 2QTTA 1D5WA 3R5SA 4G5HA 3ZN2A 4YMHA 1DG1G 1JUDA 3BSWA 2P9YA 3RS8A 4KQ6A 4WBNB 1SR8A 1ZW6A 1JG6A 4FNOA 5IVIA 1OGIA 3QLEA 4M1KA 4JLUA 2C8LA 3AWIA 5FYQA 4N7MA 3T0GA 1BH2A 3RUPA 3G2LA 1YRAA 2KM1A 4PNPA 2HMTA 2B8EA 2EXXA 4B9EA 2XDQB 1H6AA 3V9PA 2VJPA 4BDSA 2RH9B 4FOPA 3KT6A 1IPFA 3EH1A 5CVTA 3GLIE 4RADA 4JB0A 5IBQA 4XPIA 4XAQA 4TM7A 4DRYA 4DTIA 2OAEA 1YQGA 3KEFA 4I4NA 1F8XA 4FB5A 5L3VA 3AK4A 3IQDB 2O8DA 3CE6A 4G3XA 4E3ZA 2C31A 3PU6A 4JENA 2PR2A 1O9HA 3HVIA 3OM1A 2A3RA 4XJTA 5FUQA 4NG5A 4BV3A 5J2TF 4ZI5A 4BB5A 2YZ2A 3P0FA 3M9XA 5CB8A 4HYTA 1OFUX 2JAOA 2B1QA 1XZIA 4JASB 3FGNA 1GEEA 1D03A 2Q6VA 5AW1A 5JNUA 1FYWA 3DHWC 4Z9YA 4RANA 1QNFA 4GC5A 5DTQA 4DM7A 2DJIA 3VR5A 3OQPA 1UBNA 2VOEA 4DLZA 4EFDA 1L4BA 5C4GB 1Y1PA 4XUGB 2EWMA 4BNDB 4LIPD 1OBCA 1QO0D 1SD5A 3CNOA 4FIZA 2R8XA 2OZEA 2ZJ7A 5H3CA 1XVAA 4C4YA 5KVAA 3X1XA 3BAFA 3PEVA 5EG5A 3DZJA 4OQNA 3A14A 4GRDA 3X1ZA 3B1KA 1HF3A 1MH1A 2XTNA 2ZTMA 2ZXEA 2EQAA 5K0EA 5DBOA 1RM3A 1T5LA 4JLVA 4R9RA 4CEIB 2PMWB 4QTXA 5JBQA 5D84A 3PHCA 4HWRA 4L5AA 3RANA 2RHDA 2O3QA 2QZZA 3MG9A 2WDPA 1Y7HA 4ZTUB 1SPXA 1ENZA 1P61B 1U0TA 1WP4A 2WJIA 1EQUA 1P7WA 2UZ1B 2UV8A 4OH7A 4WKNA 3GJZA 4PVCA 1ZCBA 4L07A 3C3WA 3I23A 4XDYA 1D8AA 1J56A 2ZDHA 3UOAB 1FEZA 1P7PA 3ZD8A 4CM5A 4M1MA 5CXSA 3RS5A 5E2IA 1G41A 1R74A 1YZUA 4MA4A 2QRHA 1CX9B 2IBMA 2CNOA 3ZGVA 2I8AA 1IIBA 1U2SA 3T3DA 4F2DA 2VJMB 3BXGA 2V4UA 2X9NA 1KARA 3LQ1A 1YQUA 3EVNA 1PWHA 3QVTA 3GH1A 4WFIA 1ZU5A 1ZHFA 5FPQA 4C0WA 5ELXA 1QCCA 2ZJ2A 3M6FA 3T61A 3QLVC 3QUAA 1SRRA 3QOWA 4S1WA 4UEWA 3M4JA 1G5HA 4IJMA 1XVUA 3GO4A 2R66A 3R77A 2H2GA 4FKMA 1S5PA 4H0FA 4RE6A 2P3QA 1XHFA 2YBEA 4PICA 4WZAA 3KR1A 2FDXA 3EF1A 1VRVA 1M1UA 1XQXA 3N2LA 4CKWB 1CUFA 4B3IA 4C7XA 3N7AA 2JVKA 4ANFA 3RIYA 3H11A 4OREX 3PYMA 2GVNA 3EMDA 3DE4X 2IHJA 4B3RB 5JSZB 4UNNA 4R16A 5DWVA 3S55A 3VRHA 5J58A 3WXBA 4EY7A 4Y3UA 4JI4B 3S2EA 1KEPA 1DINA 4N6NA 4OHOA 4F56A 1ZR2A 3PGKA 3A0UA 4NU6A 1P7VA 1CUXA 1GZ5A 1QZXA 3VR5H 2P9GA 5I9BA 1K3TA 4ISBA 1E61A 3PQ2A 1Y9JA 1R4MA 4D3SA 4OO3A 2Q8NA 1VYHA 4E08A 5EUBA 5H59A 3AKCA 1HYGA 2A9KA 2HT6A 4LFAB 4Q24A 2ODAA 2WYHA 4B6FA 4FS8A 4D3FA 3VJLA 5DWDA 1EK0A 1GTL1 1U5BB 2NO5A 3OY7A 4E46A 4YHHB 1U7PA 5LN1A 5LQKA 3STYA 5HZGA 2CLIB 5I45A 3MUNA 4M9UA 3DFZA 3OIFA 2J46A 2QKYA 1DWUA 1ZW1A 2WWIA 2A7XA 3QLTA 4HZIA 4E15A 2IQ5A 5LP1A 3N86A 5EUQB 4M83A 3ITNA 3ZXXA 3B3GA 2AC4A 5F78A 1UFQA 1B43A 1Q1NA 3GEGA 4BV2A 1VBNA 2XOXA 1YR9A 1IOVA 4IV8A 4BXOA 5E8RA 4QVGA 2ZXFA 1X1RA 3IMCA 2P8SA 4NC9A 4H7JA 1TUBB 5K3DA 1W2WB 1ZUWA 2GRAA 1DNPA 3A6FA 1Z5UA 3THXA 3TI9A 1U2PA 1NY6A 3GAMA 3KFXA 1PJAA 4JEHA 1M34B 3QEAZ 4AJ1A 3R6DA 2DPLA 3SBXA 4C1BA 5HDQA 3GDGA 2FPSA 4OLHA 2FMFA 1QIGA 3U2QA 2C20A 1K8XB 4OQ4A 2ZIWB 5HA5A 4MB0A 4UVDA 5KVVA 4JU8A 1JHQA 3E9YA 1ECJA 3BHIA 3FVTA 5I7VA 3ZWMA 2CT8A 4QOHA 1GPMA 1Z8NA 4L3VA 1HL3A 1GUYA 2FUNB 3AJ9A 2V55B 4LVCA 2Q27A 3O8RA 4BLWA 4WOJA 2P6RA 4P2GA 4MRMB 2O8EB 2P79A 2F1KA 5K3FA 3DHNA 3IQZA 2X76A 1V5WA 2YZNA 4HQLA 3NTRA 3CINA 1YB2A 3MRTA 4KAFA 5BSEA 1ZWKA 3ER8A 3PXXA 3ZR4B 2WWWA 5I5GA 4D9KA 3GH3A 3GYGA 2D06A 1XFAA 3T4PA 5D3KA 1W8DA 3KVYA 4GP9A 3ML1A 5FJIA 1QTQA 3G49A 3DZHA 3IBYA 5AW0A 4FOTA 3OCWA 5DX8A 2REBA 4ARIA 1B2LA 2CJWA 1ZEMA 3EWIA 2WR8A 4BKMA 3ESDA 4V3CA 4DARA 5ADHA 3IUNA 3K4PA 4GQBA 5IYZA 2QJFA 2K4MA 3HC7A 2AC7A 1FX1A 1F9AA 3RYIA 4E2YA 1LRLA 3CR8A 1FP4A 2JK0A 1CUZA 2RI0A 3EMKA 3DEIA 1LDGA 3LPDA 5AJVB 4IIJF 3SZOA 3VO9A 3WTBA 1I3LA 2CUNA 5DNYB 3LUPA 2QTBA 3IUYA 4M0DA 1ZIOA 5A1JA 4KRXA 2X19A 4YUXA 2N75A 3HEAA 4C2UA 2B36A 1ZIXA 3IR6A 3CW8X 3T5TA 1GCGA 4HQ0A 5SZKB 5C53B 4HB2A 1EU1A 3P2YA 2ZI4A 4JLNA 2DFNA 2VKTA 3BWEA 5ICSA 1H1DA 2AG6A 1TZMA 4PRKA 4U1RA 1BD4A 3FWKA 3TRJA 2DJ5A 5ENZA 5U9CA 3KLMX 1PTJC 2X58A 4Z4QA 3BMXA 1KY3A 4P2BA 3DMHA 4C5CA 1RJWA 2JCXA 2WAOA 1ZVJA 3Q41A 4G4IA 1VQ1A 2AA3A 2WJPA 3BCHA 1VDZA 1ZSVA 3OWHA 1UJ5A 3HSSA 3ESQA 3AM1A 1D7OA 3AEXA 3LT0A 5CLHA 1A2BA 3V1UA 1RE0A 1UXJA 2YMMA 2UYOA 4YONB 3GJ0A 3BRSA 1CE8B 4EHDA 3ZNPA 3EGWA 4JK3A 3U3JA 1Z12A 2FFAA 1YBMA 4GPAA 1CY6A 3RBZA 4JYAB 1E1QA 1EE1A 1ZD2P 1YL7A 1F8YA 3EXHA 5IEJA 4EEZA 3TTWA 4F5WA 3LRXA 4KQGA 4MMYB 2ATCA 1QK4A 3UHJA 2RB5A 3TLCA 3FAKA 1X7GA 1DX4A 1BMFD 4MR8A 1W75A 5B3JC 1QH9A 1DPFA 1BE1A 1J9ZA 3NHMA 2NUTA 4G0VA 1NW7A 5LQAA 4F4IA 2MR6A 1T36A 3HPQA 1A7JA 1AGRA 2ZVQX 3A1CA 2HKIA 3H9EO 4HWKA 1J8VA 2OCDA 2FSSA 3VU9A 3ETEA 3OJCA 4NXMB 3TR5A 1RC0A 3LQFA 1Z3CA 4QAQA 1DSSG 3KLBA 4DVJA 3U7IA 1KEEB 3VMMA 3U4CA 2R2GA 5BRJA 3KJHA 3TB6A 3TZBA 2B1JA 5FWYB 4D9HA 5ALOA 1B3RA 2O20A 1WPQA 2ANBA 3A04A 1WBJB 2NTNA 1UKYA 2UZ3A 2O8VA 2PLAA 3CZQA 3NANA 2HLNA 4JFAA 3S1AB 2QP4A 4ZHSA 3GVIA 3NOXA 5JYBA 1IBMB 1JI0A 1S89A 3GJXC 4C3UA 4QATA 2B69A 3GRKA 4N82A 1Q7RA 1PFQA 2JFPA 4OXYA 3T15A 2XW6A 2VXOA 1IZYA 3OZBA 1BDHA 1V43A 2CEKA 1LGYA 1S3GA 2I55A 5JHGB 2X2EA 5GVRA 4PN7A 3QSYA 3LNTA 1LH0A 1AGPA 3NBQA 4B17A 2H29A 3QPWA 1CR0A 2YZGA 3VNSA 1O03A 3B53X 5I9SA 5B5SA 1RADA 3B12A 1NUAA 1DRJA 2H1SA 4KLCA 5PGMA 2IOFA 5M5BA 1IK6A 3BE4A 1PKXA 4L8FA 4DWVA 4EX6A 1KL7A 5EVCA 1N34B 3DLPX 3D7KA 4ZHQB 2P90A 1CD5A 1TQ2A 1V7CA 4OHBA 3ELUA 5KYYA 4ZZ1A 2IT1A 1CQXA 1W4AA 4CQMD 3IKMB 1FU8A 4S04A 4X54A 1FVOA 1K8YB 2Q5FA 3NOVA 5JAOA 1X2EA 3A70A 3O8CA 3BTVA 4WA7A 4Q4DA 2W2NA 1OLUB 3HJAA 1SUFA 4QASA 4RWZA 2H1RA 2C99A 2D1SA 2F17A 2EFHB 1Q17A 1U0SY 1N2XA 3EY4A 1YR8A 4H6WA 3FKSD 4Q02A 4XLZA 1FOEB 1DG3A 1QDEA 4F6RA 2ZU0C 4RAQA 3RYFA 5BR4A 2CKDA 1N1DA 2L18A 2OFPA 3EVZA 1BZYA 4MAFA 4NCIA 1MORA 4EGSA 1C3XA 1XFDA 1MW8X 5AKLA 3C5EA 1HX7A 5LWHA 4AMVA 1JT9A 4WAUA 2B5WA 1VLVA 3IO3A 4UBIA 1MEOA 3OC0A 3VYRB 5IYZF 2FW1A 3G2IA 4DMRA 5KOHA 1D04A 4FYVA 1NVTA 4GKVA 4LYEA 4PX5A 4CMHA 1NATA 4J0JA 3O8DA 4C0JA 4G5GA 4LKOA 1LLCA 2I7TA 2UVQA 5JMWA 1U0OC 4XYBA 5FLKA 3FUCA 4B40A 3OIYA 3FZQA 4OSPA 1P3JA 3ZJ4A 4AF6A 5IZ4A 1OH5A 4IDOA 1AF4A 2O8BB 4FDLA 2XDWA 1RWQA 3I3SR 3ZU5A 4IDFA 3ZY5A 1XTSA 2HV8A 3DW3X 4V0QA 4PNEA 1EDBA 5JYDA 2YOGA 1SVUA 1GXSA 4ADSG 1ZGBA 5T8KC 1NXXA 3A28A 3K4QA 5SZHB 2TMDA 5JJKA 3CNEA 3GGGA 3KG2A 2P2SA 4S2EA 5EPEA 5GJWC 1N6OA 2ZYIA 5KTYA 2ZI7A 5B58C 1BX0A 1CXZA 3IIJA 3RFXA 3ZIUA 1U3DA 3NDIA 2XSZD 2WHPB 1Q15A 1WKVA 2IEAA 2Q6IA 3I9KA 4ZJZA 1TKAA 5B7PA 5HBGA 3KYJB 3THYA 2R25B 1RZRA 2OCYC 3ZTTA 3ZDZB 1Y33E 3CVWA 1BX1A 3HXOA 3C3JA 5I4CA 2NLOA 4MVJI 1FS6A 3PFBA 3AL2A 4ZDJA 1GCIA 4TWIA 5AUPB 2XZLA 2ZI3A 4BFWA 2OORC 3HR4A 4MOWA 5JPIA 2Z2IA 3INRA 1ZD5A 1S1CA 2A1IA 2E4YA 3KJZA 5BP7A 1X13A 1TOAA 1WU7A 2W6ZA 2X5JO 2YWEA 1OROA 2D1QA 1TD9A 1UP6A 3BB4A 2P30A 3IPXA 4MQ4A 3T9CA 3OQIB 4B09A 3T1QA 4EPRA 3FY4A 5L53A 3RYCB 4TTIA 1GAXA 3BXHA 3WL5A 4DQVA 3OUZA 3UGTA 1B3BA 2Y1KA 3GCXA 3TQRA 1JWBB 1SUDA 3A4IA 4KQ1A 4K3VA 5CMLA 4DFDA 5JQGF 3BXOA 1NKSA 1DHRA 4YN3A 1KK2A 2FGJA 4G81A 2IYTA 1PTKA 1V6SA 4GE0A 2L42A 1EYZA 2Y0BA 2XBLA 4LRQA 4HT3B 4IOKA 4EP1A 3EPHA 3LPAA 1HLFA 2ZRMA 1ST2A 3CZMA 2VK8A 3DL4A 3TLEA 4IEEA 4Z7QB 1TTTA 2M2IA 1RWKA 3IVAA 1PHPA 2QYSA 3ND7A 4ARSA 1CQWA 1JAIA 2HU2A 2JCVA 4KE9A 1I13A 1YHNA 1YZYA 2X4GA 2X6QA 3FB4A 1P8AA 4PSDA 3RSCA 3TCNA 5LQSA 4R6WA 3C5VA 1I33A 3K94A 1SZCA 3CSUA 2Z95A 3ZPXA 1GAJA 3OFKA 4EA7A 2ZB3A 1GA1A 4QSHA 3H1AA 1PR9A 1A04A 1J20A 3BN3A 2A6PA 5FF9A 3FLEA 4HN4B 3R9KA 3IB3A 4DAOA 4ZRNA 3W7AA 4ARVA 3HLTA 3T7TA 5A4FS 2EHDA 1CR1A 1O8BA 3OZTA 4KO1S 2NT4A 1VCIA 4L57A 3D8BA 4DC1A 5BQFA 1CB7A 4NPCA 1L4UA 3KTDA 4YUWA 1EESA 4ZO6A 3ORHA 4XWKA 1DI0A 1T9BA 5A02A 4ZQIA 1JDZA 1U0RA 4QU5A 5EESA 3ZE1B 4F21A 4HPWA 3LP8A 2Y4OA 2ZRKA 4V24A 4B6GA 1RQRA 2GI4A 2XYHA 5K45A 1BO6A 3LY5A 3ZD9A 4NZYA 4HGPA 1SKYB 3EDOA 3SHVA 2WV7A 2JFQA 3SHQA 3PHBE 1MX3A 2F59A 4BEJA 2XIJA 5J4YA 1QB7A 4LOLA 3SYMA 3K15A 4N47A 3PFCA 5HK8A 3U3KA 3RBXA 1Y7IA 2AFHE 2CWDA 3ZDYB 1JIJA 1KMHA 1XSEA 4HH3C 2C7PA 3I9OA 1UJBA 1EAYA 2NTEA 1ZS9A 1X2BA 2BKEA 2JS7A 3W0LB 4HXGA 3QFTA 5CVEA 5C8VA 1C3OB 5A9SA 4X94A 1YVUA 3FSEA 1GWNA 2AIRA 2YY6A 1NW3A 1R5NA 1T10A 3RVPA 4U2BA 3LXRA 2R8RA 2GMWA 2UVDA 4IS2A 3SXPA 4JJ8A 4YIHA 2ZT8A 1CETA 1Z4NA 4MYCA 4PEVA 3RIHA 3UV7A 2YYAA 1OWMA 3I0NA 3LVBA 1Z18A 1M0WA 2V0CA 3W1VA 3P2JA 3SYNA 3D0QA 1Z28A 4LE0A 4MITA 1JPNA 4NPAA 4ND1A 1KOFA 2IYWA 3CPHA 5DZSA 3U4DA 2I6FA 5KKNB 1SXJC 2OOKA 3DUWA 3PIRA 5K8LA 3R1IA 2WJ6A 4P80A 2CE2X 3BQ9A 4JKOA 4UHBA 4OA5A 3X2SA 4ZIRB 5LZ8A 2ZBGA 1D4FA 5EMKA 1D0IA 3RVOA 2WF8A 4G8CA 4IIFA 2AZMA 2XMZA 1M1NA 3R5FA 5GM1A 2XI4A 3QEKA 4LJ8A 3DKRA 4FEAA 3RJ5A 1XPOA 1TW3A 3EIFA 3DOUA 4HDRA 2DPXA 1QC5A 5LQUA 1H3NA 4ZEWA 4YCLA 2BDUA 3LDHA 5EJAA 2GTIA 2V3WA 1A69A 4WK6A 5D1HA 3BMNA 4PE5B 4PXSA 1MQ9A 2FCAA 3L49A 3NWJA 5F1OA 1WKCA 5CT9A 1QU3A 4AC9A 1RAEA 2G4CA 4MICA 4DT1A 5DM60 1L7QA 2CMGA 2PMEA 1HFJA 2VRBA 4FVTA 4KE7A 4DNXA 4TRMA 3NBAA 3PR1A 4YWHA 4BC1A 4Y6LA 2JA1A 4RENA 5LUAA 3ZHOA 4CCYB 3WFZA 1CF9A 1EUDA 1Q74A 2E4AA 3N0WA 4Z4EA 3AM3A 3HCFA 4FOOA 5ALGA 2YY7A 4E2ZA 1DWPA 1EVJA 1SOUA 1NBHA 4X6LA 4YR9A 4LJYA 4F2GA 2JPDA 1G1AA 3L8FA 5BSRA 2X13A 2QSJA 3CSDA 1TVMA 1QKKA 2XUKA 1JHOA 4N7JA 2Q9UA 1BWQA 2VJDA 3HJGA 1ML3A 2NAFA 1QRRA 4FYYA 1ZHHA 2IPOA 1PT9A 1NUSA 3OCZA 2GJAA 4AULA 2FXVA 1PR6A 2OG1A 2VF5X 4RJ2A 4R9NA 4KPGA 4Y1RA 2ZBUA 4ZRMA 4AMYA 2DXIA 4L5JA 3HV0A 3FDXA 4GUAA 4AN1A 3NT2A 2BCEA 1RHRA 1L7BA 1RU3A 4IDGA 4MQMA 3WIVA 2QQGA 1FJGB 3DBVO 3IUSA 3NT5A 4BKUA 5KWJA 4ASUD 4MR7B 3ICEA 3I39X 2O2JA 2Q3DA 4CQLA 1JU9A 3E9RA 2ADOA 4UBLA 1N78A 3AF5A 1BXZA 2CUZA 3D0OA 1TJNA 2PGLA 3D1VA 3SNHA 1TKCA 1D1PA 1I14A 2VDKB 3G23A 3I37X 4DHEA 1NVDA 4TM8A 3TJRA 3WNDA 5C51B 2IYZA 2YTZA 3OJXA 1MJNA 2V4ZA 1IEWA 3EZYA 2B4KA 3P32A 4LSMA 1K4YA 3UQZA 1YF3A 3K53A 1U65A 3MAAC 3G2PA 1U6KA 2NP7A 3QWBA 3NEYA 3T7EA 4OKIA 4MHSA 1BGXT 2XMDA 4K86A 2IYSA 3ACBA 2GN9A 2DTEA 5KX5B 4LXTA 2BMDA 3RHFA 2PWAA 4YRRA 4U2KA 4E13A 1DMRA 4UMEA 5E1MA 4RYLA 5JVDA 3A1VA 3D6FA 5REQA 1CNFA 3SXUB 4A92A 1T2AA 3AG5A 1BDMA 3AR2A 3P96A 4I8IA 3I72A 2LZ0A 1QIEA 2FFQA 3FUVA 2QM7A 3SJUA 2PFSA 2VUSA 4B8WA 2PJZA 2OQRA 1W581 2VHEA 2GRUA 3A1EA 5CFLA 1AIPA 2BM9A 1G2QA 2QMEA 3C7DB 2GUGA 4IL5A 1FDWA 4HNHA 2UU9B 3DL0A 4R83A 1GNSA 1G9SA 2ZSKA 4YJ2A 1I5EA 4YXWA 3K16A 2HU5A 3HYRA 2A0UA 2WFLA 1G3MA 1HMYA 2H7CA 3L0YA 3G2NA 4QHTA 4ESHA 5K4HA 3P7MA 5IZCA 1J07A 2F3PA 2HJWA 3RGGA 4P58A 3LQQA 4E5UA 1BN7A 3VISA 5B3LA 1EXDA 3L7KA 3O75A 1MAAA 1G18A 1ECLA 4EM6A 1NDHA 4QPCA 2YJZA 2DCUA 4Y2XA 2MMCA 2EATA 2JJ1A 4YREA 1OI3A 2B3DA 1WUTA 3CUEF 3OE4A 1SJ9A 4Q93A 2Y8EA 2FPRA 4NL4H 3E23A 1E0DA 5KNLA 3FPKA 4XWGA 1T35A 2G04A 3KAQA 4RD2A 4RY8A 1GG8A 2GJ4A 1GPDG 3GIWA 4QPJC 4RF3A 5LZ4A 1QS0A 1XP8A 4NLLA 4R8SA 1F3OA 4R2JA 1E3EA 3WRXA 4NRDA 2XLBA 1I0ZA 2V3CC 3O8OB 4X9XA 1L2TA 1QFZA 3H6KA 3HN6A 2VZ9A 4IF4A 4NNOA 5T4BA 2PUEA 3TRHA 2MINB 2Q4TA 2VP0A 4L4XA 3USZA 3RE1A 2JFVA 2GO7A 5IT4A 2ZWIA 2H54A 3CTMA 3JYQA 3NWOA 4YC7A 4EA9A 2GNAA 1TJ5A 1F2TA 3MA0A 3MT9A 4B4WA 5FTJA 1F2UA 1FTNA 5G3ZA 1E89A 2GARA 2LXNA 1SULA 4EY3A 2AG5A 3CJQA 2GCIA 2NSJA 1XLVA 2QQ0A 4DIOA 5B55A 3BRWA 3LUFA 2MR5A 3DBRA 4LC0A 1CS4C 2WUVA 2OSVA 2IUUA 5IJ0A 1W1UA 1YS4A 3L4EA 2XNCA 3F6YA 4NMMA 4QFBA 4RTSA 2FUG6 3EFBA 4MRPA 4BY9E 4D26A 2AI3A 2WYVA 3WIDA 4DM3A 4BOYA 1PQUA 1CIJA 1BXRB 3E8SA 3OG9A 5K8JB 4HAIA 3Q8KA 2L2QA 3H2ZA 4YLEA 3LFHA 3VDNB 5ISMA 4C21A 2ZRDA 3AVUA 2GLUA 4QLOA 3O21A 2V54A 2WU4A 3OLWA 4PNHA 4QYIA 1I3OA 2FZWA 3M70A 3MMXA 2H5EA 3NIDB 3W6OA 3KQPA 5EUMA 3FW1A 5FBKA 5B7QA 4ABTA 3U4MA 4R1LA 5K4AA 2ZRHA 1XXLA 4TXMA 1Z4KA 1SK8A 3RGWS 1JAZA 5FP0A 5AVRA 3BE8A 1DFGA 3QI7A 3PNLA 1E5QA 3OX3A 2QROA 5L7WA 1I0IA 4P3XA 4BQRA 1ZX1A 4YYZA 5LBTA 3AL3A 3E6AA 5C1OA 5IKXA 4OHPA 1VGRA 3H2HA 2NYRA 1UMDA 4KO3S 4LGYA 3PX7A 1RZRD 4BNWA 4HRAA 5CHEA 5E3JA 3RTGA 3I2FA 4G0UA<