4BWNA

Nemo cc2-lz domain
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
86
structure length
86
Chain Sequence
QLEDLKQQLQQAEEALVAKQEVIDKLKEEAEQHNIVMETVPVLKAQADIYKADFQAERQAREKLAEKKELLQEQLEQLQREYSKLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title High-Resolution of Crystal Structure of the Human Cc2-Lz Domain of Nemo by Protein Engineering
rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords NF-KAPPA-B ESSENTIAL MODULATOR
total genus 35
structure length 86
sequence length 86
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-07-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.990 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Nemo cc2-lz domain - 1d5 darpin complex 4bwnA00
2ZVNB 3F89A 3FX0A 2V4HA 4BWNA 4OWFA 3JSVC 2ZVOB
chains in the Genus database with same CATH superfamily
1FOSE 1Q86Q 2QSIA 2OGUA 1EZVD 4KJMA 4ASWA 1M7LA 2FKWB 3II6A 3GG2A 1H88A 3L73D 5KAFH 1FZAA 1A02J 2WSCH 1IFPA 2ZT9B 1HF9A 1YHQP 1NTKK 4C7RA 2QG4A 3L70E 4EYYQ 1KB9I 1ZMEC 2RN0A 1FZFA 1XTCC 1N73A 3H1IJ 5CCHC 1FZEA 4CPGA 1YBKA 2HODA 1UIXA 1S2EA 5GTIH 3PJSK 3AE8C 1G2CB 3D70A 1RQVA 1X22A 1VF5B 1FZCC 1SQXE 1JUNA 2C9LY 3T97B 3BCCE 1NYHA 2ZYAA 3C8VA 2OYHC 3KPEA 1M90Q 1XTGB 3SSUA 2ZYGA 1IC2A 2WWWA 2E5YA 2WVRA 2OYIB 1RH5B 2J59M 2KS1A 2CK3H 4HH2A 4YTPC 2N1TA 2ZYDA 3V5BA 1NO4A 4AUWA 1LP1A 1URQD 2FY8A 1Q7YQ 2K1AA 3GHGC 3H1LG 4GOFA 3TGUG 2HR3A 2ZJSE 4A7PA 3U1AA 2FYUD 5AVQB 5AW5B 4WWIA 2YIUC 1QL1A 1IFMA 3FXEA 4QMAA 1OW6A 1WMKA 2IBZG 4OWFA 3HRNA 1PGPA 4Y99B 3V2QA 3M0DC 1P84I 1T3JA 2A06E 2N1TB 3FX0A 3AE4C 3N7NA 3MP7B 1QVGO 1SP4A 2ZAEB 4PD4H 3WUTA 2VRSA 4JYCA 1R8EA 2KXPB 3ABVC 1FJKA 1GL2D 2WMMA 1EQ7A 1NU1D 1KILB 1BCCD 2QVAA 3KQGA 3T97A 3TK1A 2CPSA 3Q5SA 1FBMA 3AE3C 1L0ND 5AVYB 2E43A 1RE4A 2WPSA 1NU1J 2FYZA 1S72P 2BCCG 1M57D 1L2PA 1LT9A 3B5NC 3H1IG 1N73B 1NKZB 3B71A 3P7KA 3U1CA 1K05A 3H1KE 1P84D 1L0NE 1PGQA 1N7SD 1SQVK 3CWBG 4H44D 1SQXG 3TDKA 3FXDA 3H1IE 1KC8Q 5AW4B 1WRGA 2P7JA 4K35A 1VQKP 1AA0A 2M8RA 2O01H 3S9OA 2KLUA 2ZXEB 4I1LA 5CBOA 1MV8A 1NTZK 5AVWB 3KHUA 1JB0J 1JY2N 2E74C 3PH0A 4TLFA 5KLVK 1ZR4A 5L8RJ 4RKUJ 3LIEA 1EXJA 1CW5A 1LTJB 1NTZD 1FC2C 1PPJE 2A06D 3M06A 2D2CC 2RH0A 4PD4E 3L73J 3A2AA 1IFNA 1N7SA 3F89A 3HD7B 5APWA 1CI6A 2V7QJ 3CPWO 1VQPP 3P8CE 4RJTA 1DIPA 3S4RA 1GL2C 4I6MC 1YYCA 3WUUA 3Q2YA 1T3UA 1OVUA 2YO2A 4GT1A 5KTBA 1ZW0A 4R4MA 3CMEP 3A3YB 3MZWB 1H0TB 2E75D 1SFCB 2BEQD 3EFGA 2ZVOB 1LWUB 2FXOA 1SVFA 1W2BO 3JCUE 2A06G 3B4SA 3RK2C 5KKZB 4UB6H 3WMM0 1NWQA 3HUSA 4BWNA 3D71A 1GW3A 3BASA 2Z5IA 3IF4A 2JO1A 2HG5D 1ZP0C 4HJGH 3O6QA 1KYOI 2Q5UA 3Q1MA 2POHA 4IL6H 1HVVA 2E75C 1PP9J 1SQBE 2B88A 1GD2E 1JMMA 3A5TA 3AE2C 1LTJA 3OA7A 1URQC 1E5WA 3CX5E 4W80A 3TYYA 1IFJA 4L75A 2FYUE 2A45I 4WY4B 3CI9A 3CCVP 2WSSH 1JTHA 1NU1G 3R2PA 3KDPB 4D6TG 2JKVA 2KUBA 1FU1A 3G4SP 2KNCA 1IFIA 1HGVA 3L70D 4JPZB 4OGQC 3QWOC 2WT7B 1ZOYC 5APXA 4Y99C 1JY2P 2XZRA 5DJUB 3RK3E 3TNUA 5TISH 1E79H 1LGHB 3GF7A 5APYA 2Y0CA 2A45G 3BATA 3W68A 4KT0J 1KQFB 4IOIH 4B86A 1SQPJ 4DCKA 3H1HG 3MGNA 2GM4A 1NAYA 1SQXD 1URQB 4YPCA 5CCHD 5GTHH 2DW3A 3A7OA 3AEBC 4EI2A 1RF1C 1VQLP 1JY3P 1MZ9A 3P8MC 2XV5A 3AE9C 1KILA 2KYVA 3RL0g 2A45H 5E79H 3CD6P 5AW1B 2J58A 2K9YA 1KB9D 1X79B 2KOGA 1OWAA 1USDA 3CX5D 1YI2P 1YITP 1EDJA 2LR2A 2KB7P 1AJYA 3MTUE 1U57A 1S1CX 4XE5B 4PD4I 3L73E 2QJPC 1N73C 3VMZA 4D6TE 3RK3D 1EZVE 2AXTH 3M0AA 4KHXA 3CWBJ 2Y0DA 3B8EB 4WY4A 5CCGC 2HPCA 3W67A 1SQXJ 3H1JE 4U7JA 2KP8A 2QJKB 3FWNA 3CC7P 2Z4EA 4JBZA 2O01J 4PJ0H 3H1LE 1LT9C 5KAFE 5AW7B 1YJNP 2NPSC 1SQBG 3BVHA 1FZCB 1HWTC 1OVRA 1PGJA 3AE5C 5AW0B 3MUDA 1FDMA 3HE5A 1PP9G 1Q81Q 3P8CD 1VQ7P 1SQQK 3O6QB 1NU1K 3IAOA 1WT6A 1NTMD 1KQSO 1T6AA 2OYIA 1QVFO 2P10A 1DEBA 5APVA 2PP6A 1PPJD 2YNYA 1T8ZA 1VQ8P 5H2FH 2E76C 1SQXK 4EIJA 3AE1C 1EDKA 2Q9IA 4D6TJ 2YIUB 5AVRB 2HFED 4UB8E 3K5BA 2XNDH 3LIDA 4HKZH 1PP9D 2SPZA 3NXSA 1L4AC 3RBXA 4NPDA 4U3FE 1VQ6P 2QIWA 4XFJA 2AEMA 1IK9A 1EC5A 1OW7A 2AEJA 2E74D 5APUA 4DT0A 2OQQA 1L0LD 1DD3A 1PPJG 2BASA 2R5BA 1OX3A 1L0LE 3NTNA 2JEEA 5AW3B 2KI7B 1RQUA 4JQ0D 2KIKA 2K9JA 3CX5I 1SQPE 3CC2P 3H1HD 4H13B 5KLVJ 2PFXA 3KZIE 1BE3E 3I56P 3KYQA 2OTJP 1SQPG 5GTIE 1SS1A 4H0LB 3EFFK 4IL6X 4OGQD 2QM7A 3LW5H 3GHGA 1L0LG 1GL2B 1LT9B 2Q1KA 2W6BA 3OAKA 5B66E 1GTWA 1EDIA 4K3AA 2P2UA 3L75D 1VQ5P 2KSJA 4TT3H 2OTLP 2P58A 1H89A 3NMDA 2ZT9C 2Q3IA 4W7YA 1M56D 4XA4A 1FE6A 2IFMA 2FXMA 2R5DA 4LC1A 3U59A 2W8ZA 1RF0A 1KYOH 4EOTA 1VL2A 1NH4A 4ASVA 2WSFJ 4UB6E 1PP9E 3AECC 2MJZA 2H7HA 3LW5J 2H88C 4HYTB 4I2LC 2P67A 1DH3A 5AVVB 2WZ7A 4BRYB 3RK2D 2W83C 1KMIZ 1KV4A 3VMYA 1FOSF 1HTLC 1PFIA 1EDLA 1M1JC 4IFFA 3V6IA 3VN0A 1NHLA 2OTKE 1PL5A 3UIAA 1RF1A 2H8PD 2W90A 3WU2H 1FS0E 4M3LA 2W6JH 3L35A 5CCGD 2GUSA 5AW8B 3CCUP 3AE7C 3VP9A 3CCQP 3Q5PA 2YMYA 1PIXA 1GMJA 1LTIC 1NTKE 1OMIA 2YXQB 4BRYA 1Q82Q 3BCCG 3A0BE 2KS1B 3F5HA 1TU3F 4OVNF 1T2KC 1VF5D 3MHVA 1MKMA 2K37A 1LP1B 2JP3A 3H1LD 2IBZI 2HLOA 1USEA 3AEFC 4JYBA 4DJGA 3PTZA 5APTA 3RL0B 2WSEH 4R4LA 2N1TC 2AEFA 3L73G 5KJ7A 2Y0EA 2N9YB 1VQ4P 5C39A 1MFZA 2M3BA 2WTYA 2IZ1A 4ZKUA 3P32A 1G1JA 4ZKPA 3TNUB 3NFQA 4ZNCA 1RY3A 1U7MA 2R44A 3VYIA 3AEAC 5KAIH 1VQ9P 4IFDK 5B5EE 1JM0A 2WQYC 3B5ND 3CL3D 4N78D 4H44C 1BCCJ 4EDFA 5B5EH 5APQA 1GU5A 1BDDA 1U7JA 4N3YB 3O8ZA 1LNQA 1LWUC 1SQBK 1FZGA 1NTKD 1HJ0A 2YO3A 3L72G 4L74A 4RO0A 1AQ5A 3PLNA 1L0NG 2ZXXA 4L73A 3USSA 1OW8A 2N1TD 1GW4A 2IX7C 1EZVI 1HGZA 1KFNA 2QRXA 4I7ZB 5AW6B 3GMAA 3D6YA 1SQVJ 1VPCA 5KAIE 1AV1A 1VF5C 3L74E 3RGUA 3TGUD 1JY3N 2JJLA 2FYUG 1J2JB 2K3RA 2IYPA 2KLVA 4Z1MH 1S3JA 1M8OB 1ZV8A 2IYOA 2UWJE 2J5UA 3M9HA 3S1KA 3HUSB 2E74B 1OFCX 3RL0D 3RK3B 3VOPA 5KLVE 1L0LJ 1IK7A 1QL2A 4PV1C 4BXLA 4JF7A 4W7ZA 1OVVA 2QM8A 1BDCA 3CC4P 4WVZA 1QGKB 1CI6B 4H13D 3HE5B 3SWYA 1IO4A 2IBZD 2V7QH 1FZCA 3L74J 1QLED 3CCJP 1SQVE 1AQTA 2M5AB 3M91A 2NPSA 4AQRD 3E7KA 2OYHB 3CMAP 1LTAC 2FFDA 1RHZB 1NGMB 3HTKB 1OZHA 2BCCD 1N8RQ 1KTMA 1Y8AA 2B9BA 2FBWC 2NZ2A 3BCCJ 3H1ID 5KKZC 1RF0C 1KILE 1FAVA 1QEXA 1P84E 2G3AA 2QEXP 1FDIA 1BGYJ 4PV1B 3CCEP 1ZN5A 3HD7D 4GIFA 1ZRTE 3GLMA 1VQMP 3FWLA 5KLIB 5APSA 3CXHD 2Y9YA 3MD0A 4IFMA 4L76A 3V2RA 1PGOA 1RE3C 3VMAA 1ZR2A 2FYNC 2G8YA 3VMXA 2BCCE 3L72J 4N6JA 1NU1E 3R4YA 3H1LJ 4WY4C 1KB9H 3HD7C 1Y47A 2WSFH 3CWBD 3PP5A 5CCGA 5BU5A 3CWBE 3GW6A 1SQVD 1KZUB 1NTMK 3H1JJ 1NTKG 3L72D 3PRJA 2B87A 3JC22 2QJKC 3CX5H 3ITKA 1LTTC 2AXCA 3L70G 2PRRA 1X0TA 5E79E 3PHLA 1SQQJ 1P84H 3H6PA 1X8YA 2W27A 1JY2O 3CLQA 3FGAD 5CCHA 1D7MA 1NTKJ 1ZRTD 2E76D 1NTZG 1PV3A 2IFNA 3CXHI 2AXTE 3L71E 3RK2B 4C7NB 1VQNP 4H44B 1KILD 5KLVD 1GK6A 1ZLLA 5DJTB 1RE4C 3IN6A 2R32A 2H43A 1BCCG 1L0LK 3MIWA 1J1EC 1SLQA 1JOCA 3C9IA 1BGYG 2MKVA 3BRTB 1NOHA 2OYHA 3V2NA 3L74D 3TGUE 2NPSD 4PJ0E 4PV1D 3Q3DA 1KFMA 1JEKA 1L4AA 1L0NJ 1Z56A 5AVSB 3VTPC 2YKQA 2E42A 3RL0C 1YJ9P 3H1KJ 3A0BH 2WPVB 5KLVG 1HBWA 5CJ4A 1DD4A 1FDOA 4OGQB 4GOEA 2KZJA 1BGYE 2B87B 1SFCA 1HUCA 2FYUJ 2WSEJ 1JCCA 2ZVNB 3AEDC 4WBAA 1J1DC 5KLIC 3HD7A 1JCDA 4YXDC 5BVZA 1QX8A 1YQ3C 1J1EB 1CSBA 1G2CA 3L74G 4GDOA 3SFEC 1SQBJ 1Y9BA 1MUUA 2P1JA 1GL2A 3I55P 4HB1A 3V4WA 5AVZB 3RBZA 1GDTA 2IPPA 1FJPA 3JCUH 3QH9A 1G1IA 1DEEG 2RKLA 1CZQA 2HODB 4RESB 4WY4D 4D6TD 2Q3EA 5BU8B 3Q5RA 1H8AA 2E76B 1J1DB 2K9JB 2KK7A 3L75J 1Q2NA 2WPRA 1KQLA 2FYUK 2R3SA 1LTSC 1S9KE 1JMBA 1YTZT 2YKPA 1KB9E 3A0HE 2M0BA 2BEZF 2Z5HA 1OXZA 1AVYA 3M9QA 1R5SA 4UB8H 3AEGC 2QJYC 1SQVG 2NPSB 5AW9B 3H32A 2XNXA 2O1JA 2E5TA 4U3FJ 2JDIH 2L91A 3E1RA 3OJAB 5K5GB 1L4AD 1T2KD 1JNMA 4H0LC 3TF5A 1M1JA 2XKMA 2QJYB 1UIIA 2C0WA 3EWKA 3KXDA 1SQQG 2K88A 3M0DA 4H13C 4O9BA 4U3FG 3GF3A 3E1IA 1AVOA 1NTZJ 2LKMA 3CCSP 3C1LA 4Y28J 2I1JA 1KQGB 1NTMG 4AYCA 1BGYD 1L0NK 2LXBA 3L71D 1FZBA 3AE6C 4NPEA 2O3JA 3VP8A 3IR9A 3L70J 2C9NY 1N86A 1SQBD 2JWAA 3M9BA 1K73Q 1OIPA 1S5LX 2GUVA 1IJDB 1VDFA 2WSCJ 1L4AB 1KILC 1KORA 4PD4D 1NTZE 2Q6QA 4H0LD 2HPCB 5TJHA 5GTHE 1S4XA 2CPBA 3B5NA 5H2FE 1JY3O 1LTBC 2FYNB 3HE4B 4NPFX 2PAJA 4DZOA 4LGDE 3V2PA 3CCLP 1JO5A 2HYNA 5AVTB 1KYOE 2D2CD 1GZLA 5KJ7D 3RK3C 4C7NA 1BE3D 3L71G 5B66H 3HUSC 1S5LE 2ZT9D 3CCRP 1SFCD 4DOJA 3L37A 1SQQE 1GU4A 3CXHH 1M1KQ 2QE7H 1BE3J 1IFDA 5AVXB 1LTGC 2WPQA 1NJIQ 3SFDC 1URQA 2YKOA 2KSEA 2L5GB 5M1BA 3H1KG 3G3ZA 4I7ZC 3SWKA 1N7SC 1ZXGA 2ITAA 2RMZA 3OW2O 1KN7A 3L75E 1BSHA 4ZMDA 3MUDC 1YQ4C 3G9RA 1MFTA 4MN4C 1EXIA 3BRVB 2BCCJ 3KZIH 3L72E 5CMZA 3V4QA 2JWDA 2B89A 3L75G 1HJBA 2OYIC 2OARA 3G6EP 3N4XA 2W6AA 4YXWH 2N9BA 2OYOA 1A02F 2V4HA 2M3EA 3ZDMA 3SWFA 5AW2B 3D6ZA 2C0XA 4OH8B 3EQ2A 1LT1A 1JTHB 1SQPD 3H1HE 2WT7A 3B5NB 1SFCC 3H1KD 4GODA 2KNCB 2JR8A 3CXHE 1RE3A 2IDBA 3HE4A 1SQPK 1W2EA 5EFWB 1IZNB 5KJ7C 5CHXA 1S5LH 2IZ0A 1N7LA 2FFDB 5CJ0A 1NKNA 1NVOA 1RF1B 1SQQD 2O1KA 3HTKA 2M5AA 1HH0A 1N2DC 2H89C 2I8DA 2D2CB 3I5CA 2NRGA 3H1HJ 4U3FD 5AVUB 1LTJC 3WUVA 3H25A 1BCCE 1KD1Q 5TISE 1AFOA 1KYOD 2Q7CA 3H1JD 2R3CA 2KZIA 2FFDC 1YJWP 1DX7A 3TSIA 2YMKA 2Y9ZA 1GK4A 3TGUJ 4LLHA 2I1KA 3AEEC 2IBZE 1Q90D 3WU2E 2LXCB 1BSNA 2GA1A 3A0HH 3G71P 3L36A 2XU6A 1LWUA 1YTZI 2QJPB 1NTME 2XDJA 1EZVG 1X9VA 3BCCD 4GKGA 4WB4A 4C46A 2ZFCA 1VQOP 2FXPA 1H0TA 1YIJP 3L71J 2WITA 1LJ2A 3JSVC 5CBNA 1M1JB 3H32B 1K04A 1NAFA 2YXRB 3CCMP 1K9MQ 4IL6E 2PGDA 3GHGB 1PZQA 3H1JG 1K8AQ 2QA4P 2O01N 4N78E 1S9KD 1BE3G 2E75B 3L4FA 1R5LA 3IFMA 1N7SB 1NTMJ 1W5CE
chains in the Genus database with same CATH topology
2ZVNB 3F89A 3FX0A 2V4HA 4BWNA 4OWFA 3JSVC 2ZVOB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZVN B;  3F89 A;  3FX0 A;  2V4H A;  4BWN A;  4OWF A;  3JSV C;  2ZVO B; 
#chains in the Genus database with same CATH topology
 1FOS E;  1Q86 Q;  2QSI A;  2OGU A;  1EZV D;  4KJM A;  4ASW A;  1M7L A;  2FKW B;  3II6 A;  3GG2 A;  1H88 A;  3L73 D;  5KAF H;  1FZA A;  1A02 J;  2WSC H;  1IFP A;  2ZT9 B;  1HF9 A;  1YHQ P;  1NTK K;  4C7R A;  2QG4 A;  3L70 E;  4EYY Q;  1KB9 I;  1ZME C;  2RN0 A;  1FZF A;  1XTC C;  1N73 A;  3H1I J;  5CCH C;  1FZE A;  4CPG A;  1YBK A;  2HOD A;  1UIX A;  1S2E A;  5GTI H;  3PJS K;  3AE8 C;  1G2C B;  3D70 A;  1RQV A;  1X22 A;  1VF5 B;  1FZC C;  1SQX E;  1JUN A;  2C9L Y;  3T97 B;  3BCC E;  1NYH A;  2ZYA A;  3C8V A;  2OYH C;  3KPE A;  1M90 Q;  1XTG B;  3SSU A;  2ZYG A;  1IC2 A;  2WWW A;  2E5Y A;  2WVR A;  2OYI B;  1RH5 B;  2J59 M;  2KS1 A;  2CK3 H;  4HH2 A;  4YTP C;  2N1T A;  2ZYD A;  3V5B A;  1NO4 A;  4AUW A;  1LP1 A;  1URQ D;  2FY8 A;  1Q7Y Q;  2K1A A;  3GHG C;  3H1L G;  4GOF A;  3TGU G;  2HR3 A;  2ZJS E;  4A7P A;  3U1A A;  2FYU D;  5AVQ B;  5AW5 B;  4WWI A;  2YIU C;  1QL1 A;  1IFM A;  3FXE A;  4QMA A;  1OW6 A;  1WMK A;  2IBZ G;  4OWF A;  3HRN A;  1PGP A;  4Y99 B;  3V2Q A;  3M0D C;  1P84 I;  1T3J A;  2A06 E;  2N1T B;  3FX0 A;  3AE4 C;  3N7N A;  3MP7 B;  1QVG O;  1SP4 A;  2ZAE B;  4PD4 H;  3WUT A;  2VRS A;  4JYC A;  1R8E A;  2KXP B;  3ABV C;  1FJK A;  1GL2 D;  2WMM A;  1EQ7 A;  1NU1 D;  1KIL B;  1BCC D;  2QVA A;  3KQG A;  3T97 A;  3TK1 A;  2CPS A;  3Q5S A;  1FBM A;  3AE3 C;  1L0N D;  5AVY B;  2E43 A;  1RE4 A;  2WPS A;  1NU1 J;  2FYZ A;  1S72 P;  2BCC G;  1M57 D;  1L2P A;  1LT9 A;  3B5N C;  3H1I G;  1N73 B;  1NKZ B;  3B71 A;  3P7K A;  3U1C A;  1K05 A;  3H1K E;  1P84 D;  1L0N E;  1PGQ A;  1N7S D;  1SQV K;  3CWB G;  4H44 D;  1SQX G;  3TDK A;  3FXD A;  3H1I E;  1KC8 Q;  5AW4 B;  1WRG A;  2P7J A;  4K35 A;  1VQK P;  1AA0 A;  2M8R A;  2O01 H;  3S9O A;  2KLU A;  2ZXE B;  4I1L A;  5CBO A;  1MV8 A;  1NTZ K;  5AVW B;  3KHU A;  1JB0 J;  1JY2 N;  2E74 C;  3PH0 A;  4TLF A;  5KLV K;  1ZR4 A;  5L8R J;  4RKU J;  3LIE A;  1EXJ A;  1CW5 A;  1LTJ B;  1NTZ D;  1FC2 C;  1PPJ E;  2A06 D;  3M06 A;  2D2C C;  2RH0 A;  4PD4 E;  3L73 J;  3A2A A;  1IFN A;  1N7S A;  3F89 A;  3HD7 B;  5APW A;  1CI6 A;  2V7Q J;  3CPW O;  1VQP P;  3P8C E;  4RJT A;  1DIP A;  3S4R A;  1GL2 C;  4I6M C;  1YYC A;  3WUU A;  3Q2Y A;  1T3U A;  1OVU A;  2YO2 A;  4GT1 A;  5KTB A;  1ZW0 A;  4R4M A;  3CME P;  3A3Y B;  3MZW B;  1H0T B;  2E75 D;  1SFC B;  2BEQ D;  3EFG A;  2ZVO B;  1LWU B;  2FXO A;  1SVF A;  1W2B O;  3JCU E;  2A06 G;  3B4S A;  3RK2 C;  5KKZ B;  4UB6 H;  3WMM 0;  1NWQ A;  3HUS A;  4BWN A;  3D71 A;  1GW3 A;  3BAS A;  2Z5I A;  3IF4 A;  2JO1 A;  2HG5 D;  1ZP0 C;  4HJG H;  3O6Q A;  1KYO I;  2Q5U A;  3Q1M A;  2POH A;  4IL6 H;  1HVV A;  2E75 C;  1PP9 J;  1SQB E;  2B88 A;  1GD2 E;  1JMM A;  3A5T A;  3AE2 C;  1LTJ A;  3OA7 A;  1URQ C;  1E5W A;  3CX5 E;  4W80 A;  3TYY A;  1IFJ A;  4L75 A;  2FYU E;  2A45 I;  4WY4 B;  3CI9 A;  3CCV P;  2WSS H;  1JTH A;  1NU1 G;  3R2P A;  3KDP B;  4D6T G;  2JKV A;  2KUB A;  1FU1 A;  3G4S P;  2KNC A;  1IFI A;  1HGV A;  3L70 D;  4JPZ B;  4OGQ C;  3QWO C;  2WT7 B;  1ZOY C;  5APX A;  4Y99 C;  1JY2 P;  2XZR A;  5DJU B;  3RK3 E;  3TNU A;  5TIS H;  1E79 H;  1LGH B;  3GF7 A;  5APY A;  2Y0C A;  2A45 G;  3BAT A;  3W68 A;  4KT0 J;  1KQF B;  4IOI H;  4B86 A;  1SQP J;  4DCK A;  3H1H G;  3MGN A;  2GM4 A;  1NAY A;  1SQX D;  1URQ B;  4YPC A;  5CCH D;  5GTH H;  2DW3 A;  3A7O A;  3AEB C;  4EI2 A;  1RF1 C;  1VQL P;  1JY3 P;  1MZ9 A;  3P8M C;  2XV5 A;  3AE9 C;  1KIL A;  2KYV A;  3RL0 g;  2A45 H;  5E79 H;  3CD6 P;  5AW1 B;  2J58 A;  2K9Y A;  1KB9 D;  1X79 B;  2KOG A;  1OWA A;  1USD A;  3CX5 D;  1YI2 P;  1YIT P;  1EDJ A;  2LR2 A;  2KB7 P;  1AJY A;  3MTU E;  1U57 A;  1S1C X;  4XE5 B;  4PD4 I;  3L73 E;  2QJP C;  1N73 C;  3VMZ A;  4D6T E;  3RK3 D;  1EZV E;  2AXT H;  3M0A A;  4KHX A;  3CWB J;  2Y0D A;  3B8E B;  4WY4 A;  5CCG C;  2HPC A;  3W67 A;  1SQX J;  3H1J E;  4U7J A;  2KP8 A;  2QJK B;  3FWN A;  3CC7 P;  2Z4E A;  4JBZ A;  2O01 J;  4PJ0 H;  3H1L E;  1LT9 C;  5KAF E;  5AW7 B;  1YJN P;  2NPS C;  1SQB G;  3BVH A;  1FZC B;  1HWT C;  1OVR A;  1PGJ A;  3AE5 C;  5AW0 B;  3MUD A;  1FDM A;  3HE5 A;  1PP9 G;  1Q81 Q;  3P8C D;  1VQ7 P;  1SQQ K;  3O6Q B;  1NU1 K;  3IAO A;  1WT6 A;  1NTM D;  1KQS O;  1T6A A;  2OYI A;  1QVF O;  2P10 A;  1DEB A;  5APV A;  2PP6 A;  1PPJ D;  2YNY A;  1T8Z A;  1VQ8 P;  5H2F H;  2E76 C;  1SQX K;  4EIJ A;  3AE1 C;  1EDK A;  2Q9I A;  4D6T J;  2YIU B;  5AVR B;  2HFE D;  4UB8 E;  3K5B A;  2XND H;  3LID A;  4HKZ H;  1PP9 D;  2SPZ A;  3NXS A;  1L4A C;  3RBX A;  4NPD A;  4U3F E;  1VQ6 P;  2QIW A;  4XFJ A;  2AEM A;  1IK9 A;  1EC5 A;  1OW7 A;  2AEJ A;  2E74 D;  5APU A;  4DT0 A;  2OQQ A;  1L0L D;  1DD3 A;  1PPJ G;  2BAS A;  2R5B A;  1OX3 A;  1L0L E;  3NTN A;  2JEE A;  5AW3 B;  2KI7 B;  1RQU A;  4JQ0 D;  2KIK A;  2K9J A;  3CX5 I;  1SQP E;  3CC2 P;  3H1H D;  4H13 B;  5KLV J;  2PFX A;  3KZI E;  1BE3 E;  3I56 P;  3KYQ A;  2OTJ P;  1SQP G;  5GTI E;  1SS1 A;  4H0L B;  3EFF K;  4IL6 X;  4OGQ D;  2QM7 A;  3LW5 H;  3GHG A;  1L0L G;  1GL2 B;  1LT9 B;  2Q1K A;  2W6B A;  3OAK A;  5B66 E;  1GTW A;  1EDI A;  4K3A A;  2P2U A;  3L75 D;  1VQ5 P;  2KSJ A;  4TT3 H;  2OTL P;  2P58 A;  1H89 A;  3NMD A;  2ZT9 C;  2Q3I A;  4W7Y A;  1M56 D;  4XA4 A;  1FE6 A;  2IFM A;  2FXM A;  2R5D A;  4LC1 A;  3U59 A;  2W8Z A;  1RF0 A;  1KYO H;  4EOT A;  1VL2 A;  1NH4 A;  4ASV A;  2WSF J;  4UB6 E;  1PP9 E;  3AEC C;  2MJZ A;  2H7H A;  3LW5 J;  2H88 C;  4HYT B;  4I2L C;  2P67 A;  1DH3 A;  5AVV B;  2WZ7 A;  4BRY B;  3RK2 D;  2W83 C;  1KMI Z;  1KV4 A;  3VMY A;  1FOS F;  1HTL C;  1PFI A;  1EDL A;  1M1J C;  4IFF A;  3V6I A;  3VN0 A;  1NHL A;  2OTK E;  1PL5 A;  3UIA A;  1RF1 A;  2H8P D;  2W90 A;  3WU2 H;  1FS0 E;  4M3L A;  2W6J H;  3L35 A;  5CCG D;  2GUS A;  5AW8 B;  3CCU P;  3AE7 C;  3VP9 A;  3CCQ P;  3Q5P A;  2YMY A;  1PIX A;  1GMJ A;  1LTI C;  1NTK E;  1OMI A;  2YXQ B;  4BRY A;  1Q82 Q;  3BCC G;  3A0B E;  2KS1 B;  3F5H A;  1TU3 F;  4OVN F;  1T2K C;  1VF5 D;  3MHV A;  1MKM A;  2K37 A;  1LP1 B;  2JP3 A;  3H1L D;  2IBZ I;  2HLO A;  1USE A;  3AEF C;  4JYB A;  4DJG A;  3PTZ A;  5APT A;  3RL0 B;  2WSE H;  4R4L A;  2N1T C;  2AEF A;  3L73 G;  5KJ7 A;  2Y0E A;  2N9Y B;  1VQ4 P;  5C39 A;  1MFZ A;  2M3B A;  2WTY A;  2IZ1 A;  4ZKU A;  3P32 A;  1G1J A;  4ZKP A;  3TNU B;  3NFQ A;  4ZNC A;  1RY3 A;  1U7M A;  2R44 A;  3VYI A;  3AEA C;  5KAI H;  1VQ9 P;  4IFD K;  5B5E E;  1JM0 A;  2WQY C;  3B5N D;  3CL3 D;  4N78 D;  4H44 C;  1BCC J;  4EDF A;  5B5E H;  5APQ A;  1GU5 A;  1BDD A;  1U7J A;  4N3Y B;  3O8Z A;  1LNQ A;  1LWU C;  1SQB K;  1FZG A;  1NTK D;  1HJ0 A;  2YO3 A;  3L72 G;  4L74 A;  4RO0 A;  1AQ5 A;  3PLN A;  1L0N G;  2ZXX A;  4L73 A;  3USS A;  1OW8 A;  2N1T D;  1GW4 A;  2IX7 C;  1EZV I;  1HGZ A;  1KFN A;  2QRX A;  4I7Z B;  5AW6 B;  3GMA A;  3D6Y A;  1SQV J;  1VPC A;  5KAI E;  1AV1 A;  1VF5 C;  3L74 E;  3RGU A;  3TGU D;  1JY3 N;  2JJL A;  2FYU G;  1J2J B;  2K3R A;  2IYP A;  2KLV A;  4Z1M H;  1S3J A;  1M8O B;  1ZV8 A;  2IYO A;  2UWJ E;  2J5U A;  3M9H A;  3S1K A;  3HUS B;  2E74 B;  1OFC X;  3RL0 D;  3RK3 B;  3VOP A;  5KLV E;  1L0L J;  1IK7 A;  1QL2 A;  4PV1 C;  4BXL A;  4JF7 A;  4W7Z A;  1OVV A;  2QM8 A;  1BDC A;  3CC4 P;  4WVZ A;  1QGK B;  1CI6 B;  4H13 D;  3HE5 B;  3SWY A;  1IO4 A;  2IBZ D;  2V7Q H;  1FZC A;  3L74 J;  1QLE D;  3CCJ P;  1SQV E;  1AQT A;  2M5A B;  3M91 A;  2NPS A;  4AQR D;  3E7K A;  2OYH B;  3CMA P;  1LTA C;  2FFD A;  1RHZ B;  1NGM B;  3HTK B;  1OZH A;  2BCC D;  1N8R Q;  1KTM A;  1Y8A A;  2B9B A;  2FBW C;  2NZ2 A;  3BCC J;  3H1I D;  5KKZ C;  1RF0 C;  1KIL E;  1FAV A;  1QEX A;  1P84 E;  2G3A A;  2QEX P;  1FDI A;  1BGY J;  4PV1 B;  3CCE P;  1ZN5 A;  3HD7 D;  4GIF A;  1ZRT E;  3GLM A;  1VQM P;  3FWL A;  5KLI B;  5APS A;  3CXH D;  2Y9Y A;  3MD0 A;  4IFM A;  4L76 A;  3V2R A;  1PGO A;  1RE3 C;  3VMA A;  1ZR2 A;  2FYN C;  2G8Y A;  3VMX A;  2BCC E;  3L72 J;  4N6J A;  1NU1 E;  3R4Y A;  3H1L J;  4WY4 C;  1KB9 H;  3HD7 C;  1Y47 A;  2WSF H;  3CWB D;  3PP5 A;  5CCG A;  5BU5 A;  3CWB E;  3GW6 A;  1SQV D;  1KZU B;  1NTM K;  3H1J J;  1NTK G;  3L72 D;  3PRJ A;  2B87 A;  3JC2 2;  2QJK C;  3CX5 H;  3ITK A;  1LTT C;  2AXC A;  3L70 G;  2PRR A;  1X0T A;  5E79 E;  3PHL A;  1SQQ J;  1P84 H;  3H6P A;  1X8Y A;  2W27 A;  1JY2 O;  3CLQ A;  3FGA D;  5CCH A;  1D7M A;  1NTK J;  1ZRT D;  2E76 D;  1NTZ G;  1PV3 A;  2IFN A;  3CXH I;  2AXT E;  3L71 E;  3RK2 B;  4C7N B;  1VQN P;  4H44 B;  1KIL D;  5KLV D;  1GK6 A;  1ZLL A;  5DJT B;  1RE4 C;  3IN6 A;  2R32 A;  2H43 A;  1BCC G;  1L0L K;  3MIW A;  1J1E C;  1SLQ A;  1JOC A;  3C9I A;  1BGY G;  2MKV A;  3BRT B;  1NOH A;  2OYH A;  3V2N A;  3L74 D;  3TGU E;  2NPS D;  4PJ0 E;  4PV1 D;  3Q3D A;  1KFM A;  1JEK A;  1L4A A;  1L0N J;  1Z56 A;  5AVS B;  3VTP C;  2YKQ A;  2E42 A;  3RL0 C;  1YJ9 P;  3H1K J;  3A0B H;  2WPV B;  5KLV G;  1HBW A;  5CJ4 A;  1DD4 A;  1FDO A;  4OGQ B;  4GOE A;  2KZJ A;  1BGY E;  2B87 B;  1SFC A;  1HUC A;  2FYU J;  2WSE J;  1JCC A;  2ZVN B;  3AED C;  4WBA A;  1J1D C;  5KLI C;  3HD7 A;  1JCD A;  4YXD C;  5BVZ A;  1QX8 A;  1YQ3 C;  1J1E B;  1CSB A;  1G2C A;  3L74 G;  4GDO A;  3SFE C;  1SQB J;  1Y9B A;  1MUU A;  2P1J A;  1GL2 A;  3I55 P;  4HB1 A;  3V4W A;  5AVZ B;  3RBZ A;  1GDT A;  2IPP A;  1FJP A;  3JCU H;  3QH9 A;  1G1I A;  1DEE G;  2RKL A;  1CZQ A;  2HOD B;  4RES B;  4WY4 D;  4D6T D;  2Q3E A;  5BU8 B;  3Q5R A;  1H8A A;  2E76 B;  1J1D B;  2K9J B;  2KK7 A;  3L75 J;  1Q2N A;  2WPR A;  1KQL A;  2FYU K;  2R3S A;  1LTS C;  1S9K E;  1JMB A;  1YTZ T;  2YKP A;  1KB9 E;  3A0H E;  2M0B A;  2BEZ F;  2Z5H A;  1OXZ A;  1AVY A;  3M9Q A;  1R5S A;  4UB8 H;  3AEG C;  2QJY C;  1SQV G;  2NPS B;  5AW9 B;  3H32 A;  2XNX A;  2O1J A;  2E5T A;  4U3F J;  2JDI H;  2L91 A;  3E1R A;  3OJA B;  5K5G B;  1L4A D;  1T2K D;  1JNM A;  4H0L C;  3TF5 A;  1M1J A;  2XKM A;  2QJY B;  1UII A;  2C0W A;  3EWK A;  3KXD A;  1SQQ G;  2K88 A;  3M0D A;  4H13 C;  4O9B A;  4U3F G;  3GF3 A;  3E1I A;  1AVO A;  1NTZ J;  2LKM A;  3CCS P;  3C1L A;  4Y28 J;  2I1J A;  1KQG B;  1NTM G;  4AYC A;  1BGY D;  1L0N K;  2LXB A;  3L71 D;  1FZB A;  3AE6 C;  4NPE A;  2O3J A;  3VP8 A;  3IR9 A;  3L70 J;  2C9N Y;  1N86 A;  1SQB D;  2JWA A;  3M9B A;  1K73 Q;  1OIP A;  1S5L X;  2GUV A;  1IJD B;  1VDF A;  2WSC J;  1L4A B;  1KIL C;  1KOR A;  4PD4 D;  1NTZ E;  2Q6Q A;  4H0L D;  2HPC B;  5TJH A;  5GTH E;  1S4X A;  2CPB A;  3B5N A;  5H2F E;  1JY3 O;  1LTB C;  2FYN B;  3HE4 B;  4NPF X;  2PAJ A;  4DZO A;  4LGD E;  3V2P A;  3CCL P;  1JO5 A;  2HYN A;  5AVT B;  1KYO E;  2D2C D;  1GZL A;  5KJ7 D;  3RK3 C;  4C7N A;  1BE3 D;  3L71 G;  5B66 H;  3HUS C;  1S5L E;  2ZT9 D;  3CCR P;  1SFC D;  4DOJ A;  3L37 A;  1SQQ E;  1GU4 A;  3CXH H;  1M1K Q;  2QE7 H;  1BE3 J;  1IFD A;  5AVX B;  1LTG C;  2WPQ A;  1NJI Q;  3SFD C;  1URQ A;  2YKO A;  2KSE A;  2L5G B;  5M1B A;  3H1K G;  3G3Z A;  4I7Z C;  3SWK A;  1N7S C;  1ZXG A;  2ITA A;  2RMZ A;  3OW2 O;  1KN7 A;  3L75 E;  1BSH A;  4ZMD A;  3MUD C;  1YQ4 C;  3G9R A;  1MFT A;  4MN4 C;  1EXI A;  3BRV B;  2BCC J;  3KZI H;  3L72 E;  5CMZ A;  3V4Q A;  2JWD A;  2B89 A;  3L75 G;  1HJB A;  2OYI C;  2OAR A;  3G6E P;  3N4X A;  2W6A A;  4YXW H;  2N9B A;  2OYO A;  1A02 F;  2V4H A;  2M3E A;  3ZDM A;  3SWF A;  5AW2 B;  3D6Z A;  2C0X A;  4OH8 B;  3EQ2 A;  1LT1 A;  1JTH B;  1SQP D;  3H1H E;  2WT7 A;  3B5N B;  1SFC C;  3H1K D;  4GOD A;  2KNC B;  2JR8 A;  3CXH E;  1RE3 A;  2IDB A;  3HE4 A;  1SQP K;  1W2E A;  5EFW B;  1IZN B;  5KJ7 C;  5CHX A;  1S5L H;  2IZ0 A;  1N7L A;  2FFD B;  5CJ0 A;  1NKN A;  1NVO A;  1RF1 B;  1SQQ D;  2O1K A;  3HTK A;  2M5A A;  1HH0 A;  1N2D C;  2H89 C;  2I8D A;  2D2C B;  3I5C A;  2NRG A;  3H1H J;  4U3F D;  5AVU B;  1LTJ C;  3WUV A;  3H25 A;  1BCC E;  1KD1 Q;  5TIS E;  1AFO A;  1KYO D;  2Q7C A;  3H1J D;  2R3C A;  2KZI A;  2FFD C;  1YJW P;  1DX7 A;  3TSI A;  2YMK A;  2Y9Z A;  1GK4 A;  3TGU J;  4LLH A;  2I1K A;  3AEE C;  2IBZ E;  1Q90 D;  3WU2 E;  2LXC B;  1BSN A;  2GA1 A;  3A0H H;  3G71 P;  3L36 A;  2XU6 A;  1LWU A;  1YTZ I;  2QJP B;  1NTM E;  2XDJ A;  1EZV G;  1X9V A;  3BCC D;  4GKG A;  4WB4 A;  4C46 A;  2ZFC A;  1VQO P;  2FXP A;  1H0T A;  1YIJ P;  3L71 J;  2WIT A;  1LJ2 A;  3JSV C;  5CBN A;  1M1J B;  3H32 B;  1K04 A;  1NAF A;  2YXR B;  3CCM P;  1K9M Q;  4IL6 E;  2PGD A;  3GHG B;  1PZQ A;  3H1J G;  1K8A Q;  2QA4 P;  2O01 N;  4N78 E;  1S9K D;  1BE3 G;  2E75 B;  3L4F A;  1R5L A;  3IFM A;  1N7S B;  1NTM J;  1W5C E; 
#chains in the Genus database with same CATH homology
 2ZVN B;  3F89 A;  3FX0 A;  2V4H A;  4BWN A;  4OWF A;  3JSV C;  2ZVO B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...