4BWNA

Nemo cc2-lz domain
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
86
structure length
86
Chain Sequence
QLEDLKQQLQQAEEALVAKQEVIDKLKEEAEQHNIVMETVPVLKAQADIYKADFQAERQAREKLAEKKELLQEQLEQLQREYSKLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords NF-KAPPA-B ESSENTIAL MODULATOR
publication title High-Resolution of Crystal Structure of the Human Cc2-Lz Domain of Nemo by Protein Engineering
rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 35
structure length 86
sequence length 86
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-07-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.990 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Nemo cc2-lz domain - 1d5 darpin complex 4bwnA00
2ZVOB 4OWFA 2ZVNB 4BWNA 2V4HA 3FX0A 3JSVC 3F89A
chains in the Genus database with same CATH superfamily
1SQVG 2NPSB 4N6JA 1CI6B 1BCCG 1BDCA 1SQPK 2GA1A 2GUVA 4WY4D 1KQFB 3L71J 3VP9A 2Q5UA 2WSEH 3U1CA 1NU1K 3GHGC 1KB9E 4TLFA 1SQQD 1QEXA 1VQ4P 2OYHC 2PGDA 3TNUA 3L75G 2W6BA 3VMYA 1SQPD 3NTNA 2NRGA 1EDKA 5AVRB 1L4AC 4ASWA 1GZLA 1J1EC 1NU1D 3F5HA 3E1IA 4YXWH 4PJ0E 2HLOA 2KNCA 3V4WA 1AVOA 2JWDA 1ZV8A 4EIJA 1GU4A 3K5BA 1P84D 5DJTB 1ZN5A 3V2QA 1FBMA 2FXPA 2R3SA 4IFDK 5TISE 3I56P 3RL0C 1M1JC 4N78E 4C7NB 3U1AA 4PD4H 2WSFJ 1N86A 4Y99B 5CJ0A 1SFCC 3M91A 3CXHD 2V7QH 1SQBD 1JTHA 1FJKA 1CSBA 3FWLA 1DD4A 4U3FD 1DEBA 2YMKA 2LR2A 3B71A 1URQD 4DOJA 3H1JE 3VP8A 1VL2A 1PPJD 2IBZI 2QE7H 2KLUA 2WPQA 4JYBA 5GTIH 2IPPA 5TJHA 3CC7P 5M1BA 2KSJA 3E7KA 1VQ9P 3HD7A 1H0TA 1Y47A 1JB0J 1DX7A 4IL6X 2FY8A 2QRXA 3L74J 1KILB 3VN0A 5B5EH 3L4FA 1L0LE 3QWOC 1X8YA 5K5GB 3G3ZA 3H1HG 2LXCB 4H44B 2BCCD 5E79E 1N7SD 3W67A 2WT7B 5AW4B 1PFIA 2WSCJ 1NTZE 1KORA 3M0DA 3G6EP 2B9BA 2OYIB 3H1IG 3MIWA 1SQQJ 2CK3H 3HD7C 3UIAA 4I2LC 2YKOA 4ZKPA 1IFPA 1EDIA 2K9JA 2R44A 2N1TD 3TYYA 3U59A 1HUCA 3N7NA 1VQNP 2OYOA 2VRSA 1QVFO 1S1CX 4C7RA 5AW0B 1X9VA 5KJ7A 1KB9H 3P32A 2QVAA 1S5LX 3G9RA 5KLVG 2ZFCA 2POHA 3AE8C 2B87A 2HPCA 2A06E 1PZQA 3WUUA 2E74B 1LNQA 1VQ8P 1ZR2A 5AW1B 1EDLA 3HE5B 4PJ0H 1JY2P 5CMZA 5CCGD 1Q86Q 1JY3O 1LP1B 1KV4A 2NPSD 1KFMA 4OWFA 1N73A 2QJPC 2QJKC 3CXHI 2FYNC 3RK2B 3IFMA 4H0LB 3JCUE 4I7ZC 1KN7A 3C9IA 3H1KJ 1GL2B 4Z1MH 5TISH 3L70D 4GOEA 5H2FE 2AEMA 1S9KD 5APXA 1VQ5P 1ZP0C 4R4LA 1J2JB 3CCJP 5AVTB 3CI9A 2ZVNB 1YBKA 2XNDH 5CCHA 1NWQA 1SQVK 1Z56A 2RMZA 4RKUJ 4K3AA 1R5SA 3RK3C 3L72J 1X22A 3N4XA 3LW5H 3G71P 4H13B 1KZUB 1NO4A 2OQQA 1MZ9A 2WQYC 1AJYA 4DZOA 2BCCJ 1L2PA 1HJBA 4WY4A 1BCCD 3QH9A 1VQ7P 3GF3A 1QL2A 2Y0EA 1RF0C 4NPEA 3W68A 1USEA 1USDA 1ZRTE 3H1JG 2J58A 1IC2A 2WWWA 1MKMA 2OTLP 4KJMA 3CD6P 5CCHC 1XTGB 1JO5A 1RQVA 1NKNA 4HJGH 1M7LA 1DH3A 1QLED 1H8AA 1IJDB 4NPDA 3OW2O 1PP9E 2D2CC 2P7JA 4L76A 3RBZA 5KTBA 3A7OA 3FGAD 3TDKA 1HWTC 3EQ2A 1IFDA 3VMAA 1BGYJ 3FWNA 2ZYDA 2CPBA 5DJUB 1VQLP 1IZNB 3L71E 1L0LG 1J1DB 2FFDB 2AXTH 1KILD 2QA4P 3BRTB 1A02J 2OTJP 2IYPA 5AW7B 1NAYA 1KFNA 5AVVB 3V4QA 2N9YB 1LWUA 4H44D 3Q5RA 2E43A 3V2NA 4A7PA 3JSVC 1AVYA 3AE4C 3G4SP 1VF5C 3HUSC 2YIUC 4D6TJ 1IFMA 3O8ZA 1HH0A 2H7HA 5C39A 1KYOH 1WRGA 3BRVB 3A0HH 1HBWA 4YTPC 5AW6B 3EFGA 4M3LA 2B89A 3H32A 2QM8A 1RF1B 2QM7A 2A45I 3NFQA 4PD4D 1UIXA 1S4XA 1OW6A 2IX7C 2YO3A 3KDPB 4ASVA 3S4RA 2PRRA 1LWUC 1NHLA 1W5CE 1JY2N 3JC22 3CCLP 2A06G 1WT6A 2KXPB 2JR8A 1LT9B 1L0NJ 4Y28J 3NMDA 2HG5D 3RK3E 2RH0A 2E74D 3BCCJ 1WMKA 3TK1A 1HJ0A 1N7SA 1YQ3C 2AEFA 3H1HD 1GD2E 1K05A 4GT1A 1NTKK 4RESB 2WPVB 1BSNA 3MUDA 2P67A 1PGOA 1GK6A 3AECC 3RK2D 4H0LD 1FDMA 1NVOA 2QJYC 1EZVE 1DEEG 3H1ID 1OVVA 3GHGB 2KS1B 3AEBC 1GL2D 3MD0A 5KAFE 4UB6E 2OYHB 3O6QB 1N7LA 2N1TA 1OWAA 3SSUA 1G1JA 2RN0A 1N8RQ 5KLVK 2KOGA 3B5NA 2R3CA 2XKMA 3B8EB 2P2UA 3LIEA 4EI2A 3HTKA 3L74E 1L4AB 3Q3DA 2O01H 3AEEC 4TT3H 1J1EB 2E42A 3V5BA 2OARA 3D6YA 2WSEJ 2WPSA 2WSSH 5KLVD 5APSA 4IL6E 1YYCA 4AUWA 1JEKA 1NJIQ 3AEGC 2P58A 1E5WA 4H13D 1EXIA 1SQQE 3RL0B 1QGKB 1M1JB 5CCGA 2NPSA 1G1IA 1G2CA 1SVFA 2ZJSE 3B5NC 5L8RJ 3CC2P 3V2PA 3HE4A 2ITAA 2MKVA 1SFCB 3D6ZA 1KB9D 5KAIE 1FZCC 3USSA 4OGQC 3MZWB 2KNCB 3H25A 3CC4P 2R5BA 3KPEA 3PTZA 1ZOYC 1FS0E 1P84E 1FZBA 1LTBC 2O01N 2Q3IA 1OIPA 3VMXA 1PP9G 1S72P 2KZIA 3P8MC 4PD4I 1SQXJ 1BE3J 1XTCC 2ZT9C 2Q3EA 1PGPA 1S5LE 4HYTB 1NTMJ 2HODA 3M06A 3CWBJ 3L71G 1MUUA 4GODA 4ZMDA 4U7JA 1JTHB 1R8EA 2GUSA 3H1LJ 4N78D 3TGUJ 3H1KE 5APYA 1R5LA 1M90Q 2QG4A 2E75C 3SWFA 4AQRD 1QVGO 1PV3A 1YJNP 2WSFH 2N9BA 4ZKUA 5BU8B 1MFTA 3V6IA 2OGUA 3PLNA 3H1JD 2W6JH 2FYUJ 2RKLA 3HD7B 2ZAEB 2M5AB 1YTZT 3LIDA 1HGVA 4HB1A 3CX5E 3L72E 1HTLC 1Q7YQ 1L0LK 2P1JA 1H88A 3P8CD 1IFJA 4BRYA 1LT1A 2KUBA 4GDOA 1AQTA 1GU5A 5KAFH 2BCCE 2K37A 4UB6H 2W83C 1T2KD 3ZDMA 1NTZK 2JWAA 1L0LD 2WMMA 2Y0CA 2PP6A 1LTAC 2PFXA 3C8VA 1NKZB 3S9OA 1NGMB 2NZ2A 2Y9YA 1SQPJ 1FDIA 5AVYB 3L73G 1NTKG 3CPWO 3V2RA 2QJPB 4JYCA 2FYNB 1EZVG 4IL6H 5GTHE 1KB9I 2OYIA 2WSCH 1NU1J 1YI2P 4I7ZB 3M9QA 3CLQA 4CPGA 4BWNA 2YNYA 4JBZA 3B4SA 1BGYE 3GLMA 1M1KQ 1Y9BA 1W2BO 3L74G 2HPCB 3IR9A 3M0DC 3MGNA 5AW8B 2OTKE 1RE3A 3AE5C 5CJ4A 4LLHA 1L4AD 1LGHB 1YIJP 4RO0A 5KAIH 2H89C 4IFMA 3L37A 3Q1MA 3FXEA 5AW9B 4LGDE 2H43A 2Q6QA 3A0BE 2A06D 2ZVOB 3RK3B 1SQBJ 1ZMEC 4D6TE 1IO4A 4U3FJ 1KYOD 3HE5A 5KJ7C 3RL0D 2WTYA 1LP1A 4DJGA 2HFED 3A5TA 2E76C 1S5LH 5AW3B 1AA0A 3WU2E 4C46A 1FZEA 1SFCD 3AE9C 1FU1A 1GL2A 1VPCA 2FKWB 4ZNCA 3PHLA 2JO1A 1EC5A 3LW5J 1N73C 1IFIA 3AE6C 1KQLA 1L0NE 3M9HA 2I1KA 2KB7P 2IYOA 2KSEA 3EFFK 2D2CB 3BCCE 2IZ0A 3VTPC 2YXRB 2PAJA 2C9NY 2K1AA 1SQVD 1HF9A 1OW8A 2J5UA 3A2AA 3R2PA 1JY3P 2LXBA 3BATA 4PV1C 1HVVA 2K88A 2W90A 3H1KG 5KLIC 3L75D 2K9YA 5E79H 1JNMA 4KHXA 3BASA 1LTJA 1VF5B 3HUSB 2YIUB 2O3JA 2J59M 4L73A 3CCMP 1Q82Q 2M8RA 4WY4C 3HD7D 2XNXA 1KMIZ 2XDJA 3L72G 2JJLA 2Y9ZA 3AEDC 1AQ5A 4GKGA 1PP9D 5GTHH 3F89A 2KYVA 1SLQA 4JPZB 2Y0DA 1LWUB 1N2DC 4AYCA 1U7JA 3VMZA 1NTZG 3L71D 1LTJC 4I6MC 1KYOI 3WMM0 1URQA 2WVRA 3L70J 3T97A 3CMAP 3IAOA 3D71A 2BEQD 3AEAC 3IF4A 1SQXE 2QJYB 2YXQB 3JCUH 3OJAB 1BE3E 1EQ7A 2ZXEB 1RQUA 1BGYG 2JP3A 1HGZA 1IK9A 3NXSA 1NTME 5H2FH 3CWBE 2W6AA 3S1KA 3KYQA 4JQ0D 1URQC 3WU2H 3CMEP 1YHQP 2YMYA 3H1LE 3D70A 3TGUE 5BVZA 4BXLA 3I55P 2FBWC 1PGJA 4DCKA 3KQGA 1SQVJ 1BCCJ 5AVSB 2IBZE 2QEXP 1LT9A 4D6TG 3R4YA 3WUVA 3RK3D 1NYHA 3CCSP 1QL1A 2L5GB 3L35A 1ZR4A 1RE4A 2FYUE 5APUA 3L75J 5AVZB 2XV5A 3GMAA 3L73D 1NTKD 2IFMA 1PIXA 3B5NB 2WITA 1EZVD 1MFZA 3GHGA 1OW7A 2KS1A 2FXOA 1D7MA 1FZCB 3O6QA 4OGQB 1N7SC 2Q7CA 2E5TA 3PH0A 5CCHD 3CCUP 3MUDC 1FZGA 3AE7C 1L0NG 1LTSC 1EDJA 1Q2NA 3L74D 1OX3A 1SQQK 2XZRA 3BCCG 1VQMP 1RE4C 5KKZC 2D2CD 2ZT9B 2XU6A 3TNUB 1CI6A 2N1TC 1G2CB 1OMIA 1SQPE 1E79H 1KD1Q 4EYYQ 3HE4B 3AE1C 2G3AA 3PRJA 1UIIA 2Z5IA 1NU1E 1M1JA 4I1LA 4LC1A 3OA7A 2E75B 1SFCA 1KC8Q 4WWIA 1VF5D 1IFNA 1FOSE 5CCGC 2NPSC 3VYIA 4L75A 2B88A 2HODB 2V7QJ 1S3JA 1SQBK 1FZAA 2KI7B 3CXHE 1Q81Q 1SQBE 1GTWA 4U3FE 3VOPA 5EFWB 2WZ7A 4C7NA 2ZYGA 1YJ9P 3H1HJ 3RBXA 4WBAA 1PPJE 2M3EA 3BVHA 2YKPA 2LKMA 1TU3F 1GW4A 1EXJA 4NPFX 3H1IJ 3H1KD 1W2EA 4WVZA 2AXCA 1YJWP 4DT0A 1FE6A 3PP5A 4OH8B 1GW3A 1H0TB 3L73J 2HYNA 1NTKJ 1M57D 1T3UA 4O9BA 1ZXGA 1VQPP 1EZVI 1SQXG 5AW5B 1BE3G 2IZ1A 3P8CE 2C0WA 4BRYB 2M5AA 2SPZA 4Y99C 1NTMG 3CWBG 3CX5D 2YKQA 1FOSF 3KZIE 1T3JA 3L72D 5KLVJ 3CCRP 5APVA 1KILA 3H1LG 3P7KA 1JY2O 3TGUG 1LTIC 5AVQB 3EWKA 5B66E 1NAFA 3PJSK 4K35A 3TF5A 1CW5A 1VDFA 2IBZG 2CPSA 2HR3A 3TSIA 2WT7A 1DD3A 2K9JB 3ABVC 1FZFA 1NTZD 2BEZF 2QJKB 3MP7B 3CCEP 2M0BA 1Q90D 4OVNF 2FYUG 4YPCA 1LTGC 1M8OB 1JOCA 5APWA 4HH2A 4IFFA 5AVXB 3AE3C 3GF7A 3MHVA 2E76B 2I8DA 3KXDA 2AXTE 1KILC 3B5ND 2B87B 2MJZA 1PGQA 4UB8E 3IN6A 1U57A 1JMMA 2K3RA 4IOIH 1LTTC 4H44C 1CZQA 3AE2C 4OGQD 1P84I 3OAKA 2KK7A 1ZW0A 1BGYD 1KQGB 1N73B 2C9LY 3E1RA 1P84H 4XFJA 4GOFA 4XA4A 2OYIC 1KYOE 3A0HE 1FDOA 1SQQG 2O1JA 4R4MA 2GM4A 3KHUA 2W27A 3L70E 1SQPG 5APQA 2ZT9D 2JDIH 1S9KE 3SFDC 1K9MQ 1K73Q 4W80A 2V4HA 4D6TD 3CCVP 2O1KA 3WUTA 1LJ2A 1NU1G 1RE3C 2BASA 3CXHH 4KT0J 4PV1B 4W7YA 3H1JJ 4W7ZA 2Z5HA 5KLIB 1VQKP 2E75D 5AW2B 1YITP 1YQ4C 2WPRA 1L0NK 1AV1A 2E74C 1T6AA 1SS1A 1RF0A 5AVWB 1GMJA 1K8AQ 4EDFA 3MTUE 1OVRA 2FYZA 4XE5B 2P10A 1PL5A 2Q1KA 2Z4EA 1JM0A 3CX5I 1YTZI 2JEEA 4WY4B 1SQVE 1BCCE 4JF7A 3RK2C 4H0LC 1K04A 1SQBG 1X0TA 1A02F 1OFCX 3GW6A 4GIFA 4U3FG 1L0ND 3A3YB 1L0LJ 2G8YA 3CX5H 3AEFC 4YXDC 1GL2C 3SWYA 2YO2A 3BCCD 1NOHA 1PPJG 3RGUA 5CBNA 1NH4A 3ITKA 3L75E 1DIPA 1OZHA 1NTZJ 5BU5A 3KZIH 1LTJB 3M9BA 1OXZA 4QMAA 1ZRTD 2IFNA 4N3YB 1S2EA 4B86A 5B66H 2L91A 2KIKA 2KLVA 4MN4C 2AEJA 2IDBA 1T8ZA 3HRNA 1GDTA 4H13C 3HUSA 1FAVA 3L36A 1JCCA 1KILE 4EOTA 2I1JA 2BCCG 2QIWA 2H88C 3CCQP 2FFDA 3Q5SA 1URQB 4UB8H 2C0XA 3SFEC 3CL3D 1U7MA 3M0AA 5AVUB 3T97B 2FXMA 2W8ZA 1GK4A 2R5DA 1RHZB 2E5YA 2R32A 3H32B 3A0BH 1SQXK 1IK7A 2KP8A 4PD4E 2KZJA 1FJPA 2H8PD 5KJ7D 2Q9IA 3FXDA 1JCDA 5CBOA 1OVUA 1NTMK 1H89A 2DW3A 1MV8A 1J1DC 2E76D 1JMBA 2FFDC 2ZXXA 1RF1A 1SQXD 1BE3D 1JUNA 1X79B 2A45H 1RY3A 1N7SB 3H1HE 5GTIE 2QSIA 1NTMD 3CWBD 1M56D 5CHXA 3H1LD 1FC2C 3TGUD 1BDDA 2FYUK 3H1IE 3L70G 3I5CA 5KKZB 5APTA 1KQSO 2JKVA 2UWJE 3FX0A 2IBZD 3Q2YA 3Q5PA 2N1TB 3L73E 1QX8A 1NTKE 1RH5B 1RF1C 2O01J 5B5EE 3II6A 2A45G 3HTKB 4PV1D 3GG2A 2FYUD 4L74A 2OYHA 3H6PA 1BSHA 4HKZH 1T2KC 1Y8AA 2M3BA 3RL0g 2ZYAA 1LT9C 3C1LA 5KLVE 1ZLLA 1AFOA 1L4AA 1JY3N 1PP9J 3SWKA 1VQ6P 1FZCA 4WB4A 1VQOP 1KTMA 4RJTA 1SP4A
chains in the Genus database with same CATH topology
2ZVOB 4OWFA 2ZVNB 4BWNA 2V4HA 3FX0A 3JSVC 3F89A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZVO B;  4OWF A;  2ZVN B;  4BWN A;  2V4H A;  3FX0 A;  3JSV C;  3F89 A; 
#chains in the Genus database with same CATH topology
 1SQV G;  2NPS B;  4N6J A;  1CI6 B;  1BCC G;  1BDC A;  1SQP K;  2GA1 A;  2GUV A;  4WY4 D;  1KQF B;  3L71 J;  3VP9 A;  2Q5U A;  2WSE H;  3U1C A;  1NU1 K;  3GHG C;  1KB9 E;  4TLF A;  1SQQ D;  1QEX A;  1VQ4 P;  2OYH C;  2PGD A;  3TNU A;  3L75 G;  2W6B A;  3VMY A;  1SQP D;  3NTN A;  2NRG A;  1EDK A;  5AVR B;  1L4A C;  4ASW A;  1GZL A;  1J1E C;  1NU1 D;  3F5H A;  3E1I A;  4YXW H;  4PJ0 E;  2HLO A;  2KNC A;  3V4W A;  1AVO A;  2JWD A;  1ZV8 A;  4EIJ A;  1GU4 A;  3K5B A;  1P84 D;  5DJT B;  1ZN5 A;  3V2Q A;  1FBM A;  2FXP A;  2R3S A;  4IFD K;  5TIS E;  3I56 P;  3RL0 C;  1M1J C;  4N78 E;  4C7N B;  3U1A A;  4PD4 H;  2WSF J;  1N86 A;  4Y99 B;  5CJ0 A;  1SFC C;  3M91 A;  3CXH D;  2V7Q H;  1SQB D;  1JTH A;  1FJK A;  1CSB A;  3FWL A;  1DD4 A;  4U3F D;  1DEB A;  2YMK A;  2LR2 A;  3B71 A;  1URQ D;  4DOJ A;  3H1J E;  3VP8 A;  1VL2 A;  1PPJ D;  2IBZ I;  2QE7 H;  2KLU A;  2WPQ A;  4JYB A;  5GTI H;  2IPP A;  5TJH A;  3CC7 P;  5M1B A;  2KSJ A;  3E7K A;  1VQ9 P;  3HD7 A;  1H0T A;  1Y47 A;  1JB0 J;  1DX7 A;  4IL6 X;  2FY8 A;  2QRX A;  3L74 J;  1KIL B;  3VN0 A;  5B5E H;  3L4F A;  1L0L E;  3QWO C;  1X8Y A;  5K5G B;  3G3Z A;  3H1H G;  2LXC B;  4H44 B;  2BCC D;  5E79 E;  1N7S D;  3W67 A;  2WT7 B;  5AW4 B;  1PFI A;  2WSC J;  1NTZ E;  1KOR A;  3M0D A;  3G6E P;  2B9B A;  2OYI B;  3H1I G;  3MIW A;  1SQQ J;  2CK3 H;  3HD7 C;  3UIA A;  4I2L C;  2YKO A;  4ZKP A;  1IFP A;  1EDI A;  2K9J A;  2R44 A;  2N1T D;  3TYY A;  3U59 A;  1HUC A;  3N7N A;  1VQN P;  2OYO A;  2VRS A;  1QVF O;  1S1C X;  4C7R A;  5AW0 B;  1X9V A;  5KJ7 A;  1KB9 H;  3P32 A;  2QVA A;  1S5L X;  3G9R A;  5KLV G;  2ZFC A;  2POH A;  3AE8 C;  2B87 A;  2HPC A;  2A06 E;  1PZQ A;  3WUU A;  2E74 B;  1LNQ A;  1VQ8 P;  1ZR2 A;  5AW1 B;  1EDL A;  3HE5 B;  4PJ0 H;  1JY2 P;  5CMZ A;  5CCG D;  1Q86 Q;  1JY3 O;  1LP1 B;  1KV4 A;  2NPS D;  1KFM A;  4OWF A;  1N73 A;  2QJP C;  2QJK C;  3CXH I;  2FYN C;  3RK2 B;  3IFM A;  4H0L B;  3JCU E;  4I7Z C;  1KN7 A;  3C9I A;  3H1K J;  1GL2 B;  4Z1M H;  5TIS H;  3L70 D;  4GOE A;  5H2F E;  2AEM A;  1S9K D;  5APX A;  1VQ5 P;  1ZP0 C;  4R4L A;  1J2J B;  3CCJ P;  5AVT B;  3CI9 A;  2ZVN B;  1YBK A;  2XND H;  5CCH A;  1NWQ A;  1SQV K;  1Z56 A;  2RMZ A;  4RKU J;  4K3A A;  1R5S A;  3RK3 C;  3L72 J;  1X22 A;  3N4X A;  3LW5 H;  3G71 P;  4H13 B;  1KZU B;  1NO4 A;  2OQQ A;  1MZ9 A;  2WQY C;  1AJY A;  4DZO A;  2BCC J;  1L2P A;  1HJB A;  4WY4 A;  1BCC D;  3QH9 A;  1VQ7 P;  3GF3 A;  1QL2 A;  2Y0E A;  1RF0 C;  4NPE A;  3W68 A;  1USE A;  1USD A;  1ZRT E;  3H1J G;  2J58 A;  1IC2 A;  2WWW A;  1MKM A;  2OTL P;  4KJM A;  3CD6 P;  5CCH C;  1XTG B;  1JO5 A;  1RQV A;  1NKN A;  4HJG H;  1M7L A;  1DH3 A;  1QLE D;  1H8A A;  1IJD B;  4NPD A;  3OW2 O;  1PP9 E;  2D2C C;  2P7J A;  4L76 A;  3RBZ A;  5KTB A;  3A7O A;  3FGA D;  3TDK A;  1HWT C;  3EQ2 A;  1IFD A;  3VMA A;  1BGY J;  3FWN A;  2ZYD A;  2CPB A;  5DJU B;  1VQL P;  1IZN B;  3L71 E;  1L0L G;  1J1D B;  2FFD B;  2AXT H;  1KIL D;  2QA4 P;  3BRT B;  1A02 J;  2OTJ P;  2IYP A;  5AW7 B;  1NAY A;  1KFN A;  5AVV B;  3V4Q A;  2N9Y B;  1LWU A;  4H44 D;  3Q5R A;  2E43 A;  3V2N A;  4A7P A;  3JSV C;  1AVY A;  3AE4 C;  3G4S P;  1VF5 C;  3HUS C;  2YIU C;  4D6T J;  1IFM A;  3O8Z A;  1HH0 A;  2H7H A;  5C39 A;  1KYO H;  1WRG A;  3BRV B;  3A0H H;  1HBW A;  4YTP C;  5AW6 B;  3EFG A;  4M3L A;  2B89 A;  3H32 A;  2QM8 A;  1RF1 B;  2QM7 A;  2A45 I;  3NFQ A;  4PD4 D;  1UIX A;  1S4X A;  1OW6 A;  2IX7 C;  2YO3 A;  3KDP B;  4ASV A;  3S4R A;  2PRR A;  1LWU C;  1NHL A;  1W5C E;  1JY2 N;  3JC2 2;  3CCL P;  2A06 G;  1WT6 A;  2KXP B;  2JR8 A;  1LT9 B;  1L0N J;  4Y28 J;  3NMD A;  2HG5 D;  3RK3 E;  2RH0 A;  2E74 D;  3BCC J;  1WMK A;  3TK1 A;  1HJ0 A;  1N7S A;  1YQ3 C;  2AEF A;  3H1H D;  1GD2 E;  1K05 A;  4GT1 A;  1NTK K;  4RES B;  2WPV B;  1BSN A;  3MUD A;  2P67 A;  1PGO A;  1GK6 A;  3AEC C;  3RK2 D;  4H0L D;  1FDM A;  1NVO A;  2QJY C;  1EZV E;  1DEE G;  3H1I D;  1OVV A;  3GHG B;  2KS1 B;  3AEB C;  1GL2 D;  3MD0 A;  5KAF E;  4UB6 E;  2OYH B;  3O6Q B;  1N7L A;  2N1T A;  1OWA A;  3SSU A;  1G1J A;  2RN0 A;  1N8R Q;  5KLV K;  2KOG A;  3B5N A;  2R3C A;  2XKM A;  3B8E B;  2P2U A;  3LIE A;  4EI2 A;  3HTK A;  3L74 E;  1L4A B;  3Q3D A;  2O01 H;  3AEE C;  4TT3 H;  1J1E B;  2E42 A;  3V5B A;  2OAR A;  3D6Y A;  2WSE J;  2WPS A;  2WSS H;  5KLV D;  5APS A;  4IL6 E;  1YYC A;  4AUW A;  1JEK A;  1NJI Q;  3AEG C;  2P58 A;  1E5W A;  4H13 D;  1EXI A;  1SQQ E;  3RL0 B;  1QGK B;  1M1J B;  5CCG A;  2NPS A;  1G1I A;  1G2C A;  1SVF A;  2ZJS E;  3B5N C;  5L8R J;  3CC2 P;  3V2P A;  3HE4 A;  2ITA A;  2MKV A;  1SFC B;  3D6Z A;  1KB9 D;  5KAI E;  1FZC C;  3USS A;  4OGQ C;  3MZW B;  2KNC B;  3H25 A;  3CC4 P;  2R5B A;  3KPE A;  3PTZ A;  1ZOY C;  1FS0 E;  1P84 E;  1FZB A;  1LTB C;  2O01 N;  2Q3I A;  1OIP A;  3VMX A;  1PP9 G;  1S72 P;  2KZI A;  3P8M C;  4PD4 I;  1SQX J;  1BE3 J;  1XTC C;  2ZT9 C;  2Q3E A;  1PGP A;  1S5L E;  4HYT B;  1NTM J;  2HOD A;  3M06 A;  3CWB J;  3L71 G;  1MUU A;  4GOD A;  4ZMD A;  4U7J A;  1JTH B;  1R8E A;  2GUS A;  3H1L J;  4N78 D;  3TGU J;  3H1K E;  5APY A;  1R5L A;  1M90 Q;  2QG4 A;  2E75 C;  3SWF A;  4AQR D;  1QVG O;  1PV3 A;  1YJN P;  2WSF H;  2N9B A;  4ZKU A;  5BU8 B;  1MFT A;  3V6I A;  2OGU A;  3PLN A;  3H1J D;  2W6J H;  2FYU J;  2RKL A;  3HD7 B;  2ZAE B;  2M5A B;  1YTZ T;  3LID A;  1HGV A;  4HB1 A;  3CX5 E;  3L72 E;  1HTL C;  1Q7Y Q;  1L0L K;  2P1J A;  1H88 A;  3P8C D;  1IFJ A;  4BRY A;  1LT1 A;  2KUB A;  4GDO A;  1AQT A;  1GU5 A;  5KAF H;  2BCC E;  2K37 A;  4UB6 H;  2W83 C;  1T2K D;  3ZDM A;  1NTZ K;  2JWA A;  1L0L D;  2WMM A;  2Y0C A;  2PP6 A;  1LTA C;  2PFX A;  3C8V A;  1NKZ B;  3S9O A;  1NGM B;  2NZ2 A;  2Y9Y A;  1SQP J;  1FDI A;  5AVY B;  3L73 G;  1NTK G;  3CPW O;  3V2R A;  2QJP B;  4JYC A;  2FYN B;  1EZV G;  4IL6 H;  5GTH E;  1KB9 I;  2OYI A;  2WSC H;  1NU1 J;  1YI2 P;  4I7Z B;  3M9Q A;  3CLQ A;  4CPG A;  4BWN A;  2YNY A;  4JBZ A;  3B4S A;  1BGY E;  3GLM A;  1M1K Q;  1Y9B A;  1W2B O;  3L74 G;  2HPC B;  3IR9 A;  3M0D C;  3MGN A;  5AW8 B;  2OTK E;  1RE3 A;  3AE5 C;  5CJ4 A;  4LLH A;  1L4A D;  1LGH B;  1YIJ P;  4RO0 A;  5KAI H;  2H89 C;  4IFM A;  3L37 A;  3Q1M A;  3FXE A;  5AW9 B;  4LGD E;  2H43 A;  2Q6Q A;  3A0B E;  2A06 D;  2ZVO B;  3RK3 B;  1SQB J;  1ZME C;  4D6T E;  1IO4 A;  4U3F J;  1KYO D;  3HE5 A;  5KJ7 C;  3RL0 D;  2WTY A;  1LP1 A;  4DJG A;  2HFE D;  3A5T A;  2E76 C;  1S5L H;  5AW3 B;  1AA0 A;  3WU2 E;  4C46 A;  1FZE A;  1SFC D;  3AE9 C;  1FU1 A;  1GL2 A;  1VPC A;  2FKW B;  4ZNC A;  3PHL A;  2JO1 A;  1EC5 A;  3LW5 J;  1N73 C;  1IFI A;  3AE6 C;  1KQL A;  1L0N E;  3M9H A;  2I1K A;  2KB7 P;  2IYO A;  2KSE A;  3EFF K;  2D2C B;  3BCC E;  2IZ0 A;  3VTP C;  2YXR B;  2PAJ A;  2C9N Y;  2K1A A;  1SQV D;  1HF9 A;  1OW8 A;  2J5U A;  3A2A A;  3R2P A;  1JY3 P;  2LXB A;  3BAT A;  4PV1 C;  1HVV A;  2K88 A;  2W90 A;  3H1K G;  5KLI C;  3L75 D;  2K9Y A;  5E79 H;  1JNM A;  4KHX A;  3BAS A;  1LTJ A;  1VF5 B;  3HUS B;  2YIU B;  2O3J A;  2J59 M;  4L73 A;  3CCM P;  1Q82 Q;  2M8R A;  4WY4 C;  3HD7 D;  2XNX A;  1KMI Z;  2XDJ A;  3L72 G;  2JJL A;  2Y9Z A;  3AED C;  1AQ5 A;  4GKG A;  1PP9 D;  5GTH H;  3F89 A;  2KYV A;  1SLQ A;  4JPZ B;  2Y0D A;  1LWU B;  1N2D C;  4AYC A;  1U7J A;  3VMZ A;  1NTZ G;  3L71 D;  1LTJ C;  4I6M C;  1KYO I;  3WMM 0;  1URQ A;  2WVR A;  3L70 J;  3T97 A;  3CMA P;  3IAO A;  3D71 A;  2BEQ D;  3AEA C;  3IF4 A;  1SQX E;  2QJY B;  2YXQ B;  3JCU H;  3OJA B;  1BE3 E;  1EQ7 A;  2ZXE B;  1RQU A;  1BGY G;  2JP3 A;  1HGZ A;  1IK9 A;  3NXS A;  1NTM E;  5H2F H;  3CWB E;  2W6A A;  3S1K A;  3KYQ A;  4JQ0 D;  1URQ C;  3WU2 H;  3CME P;  1YHQ P;  2YMY A;  3H1L E;  3D70 A;  3TGU E;  5BVZ A;  4BXL A;  3I55 P;  2FBW C;  1PGJ A;  4DCK A;  3KQG A;  1SQV J;  1BCC J;  5AVS B;  2IBZ E;  2QEX P;  1LT9 A;  4D6T G;  3R4Y A;  3WUV A;  3RK3 D;  1NYH A;  3CCS P;  1QL1 A;  2L5G B;  3L35 A;  1ZR4 A;  1RE4 A;  2FYU E;  5APU A;  3L75 J;  5AVZ B;  2XV5 A;  3GMA A;  3L73 D;  1NTK D;  2IFM A;  1PIX A;  3B5N B;  2WIT A;  1EZV D;  1MFZ A;  3GHG A;  1OW7 A;  2KS1 A;  2FXO A;  1D7M A;  1FZC B;  3O6Q A;  4OGQ B;  1N7S C;  2Q7C A;  2E5T A;  3PH0 A;  5CCH D;  3CCU P;  3MUD C;  1FZG A;  3AE7 C;  1L0N G;  1LTS C;  1EDJ A;  1Q2N A;  3L74 D;  1OX3 A;  1SQQ K;  2XZR A;  3BCC G;  1VQM P;  1RE4 C;  5KKZ C;  2D2C D;  2ZT9 B;  2XU6 A;  3TNU B;  1CI6 A;  2N1T C;  1G2C B;  1OMI A;  1SQP E;  1E79 H;  1KD1 Q;  4EYY Q;  3HE4 B;  3AE1 C;  2G3A A;  3PRJ A;  1UII A;  2Z5I A;  1NU1 E;  1M1J A;  4I1L A;  4LC1 A;  3OA7 A;  2E75 B;  1SFC A;  1KC8 Q;  4WWI A;  1VF5 D;  1IFN A;  1FOS E;  5CCG C;  2NPS C;  3VYI A;  4L75 A;  2B88 A;  2HOD B;  2V7Q J;  1S3J A;  1SQB K;  1FZA A;  2KI7 B;  3CXH E;  1Q81 Q;  1SQB E;  1GTW A;  4U3F E;  3VOP A;  5EFW B;  2WZ7 A;  4C7N A;  2ZYG A;  1YJ9 P;  3H1H J;  3RBX A;  4WBA A;  1PPJ E;  2M3E A;  3BVH A;  2YKP A;  2LKM A;  1TU3 F;  1GW4 A;  1EXJ A;  4NPF X;  3H1I J;  3H1K D;  1W2E A;  4WVZ A;  2AXC A;  1YJW P;  4DT0 A;  1FE6 A;  3PP5 A;  4OH8 B;  1GW3 A;  1H0T B;  3L73 J;  2HYN A;  1NTK J;  1M57 D;  1T3U A;  4O9B A;  1ZXG A;  1VQP P;  1EZV I;  1SQX G;  5AW5 B;  1BE3 G;  2IZ1 A;  3P8C E;  2C0W A;  4BRY B;  2M5A A;  2SPZ A;  4Y99 C;  1NTM G;  3CWB G;  3CX5 D;  2YKQ A;  1FOS F;  3KZI E;  1T3J A;  3L72 D;  5KLV J;  3CCR P;  5APV A;  1KIL A;  3H1L G;  3P7K A;  1JY2 O;  3TGU G;  1LTI C;  5AVQ B;  3EWK A;  5B66 E;  1NAF A;  3PJS K;  4K35 A;  3TF5 A;  1CW5 A;  1VDF A;  2IBZ G;  2CPS A;  2HR3 A;  3TSI A;  2WT7 A;  1DD3 A;  2K9J B;  3ABV C;  1FZF A;  1NTZ D;  2BEZ F;  2QJK B;  3MP7 B;  3CCE P;  2M0B A;  1Q90 D;  4OVN F;  2FYU G;  4YPC A;  1LTG C;  1M8O B;  1JOC A;  5APW A;  4HH2 A;  4IFF A;  5AVX B;  3AE3 C;  3GF7 A;  3MHV A;  2E76 B;  2I8D A;  3KXD A;  2AXT E;  1KIL C;  3B5N D;  2B87 B;  2MJZ A;  1PGQ A;  4UB8 E;  3IN6 A;  1U57 A;  1JMM A;  2K3R A;  4IOI H;  1LTT C;  4H44 C;  1CZQ A;  3AE2 C;  4OGQ D;  1P84 I;  3OAK A;  2KK7 A;  1ZW0 A;  1BGY D;  1KQG B;  1N73 B;  2C9L Y;  3E1R A;  1P84 H;  4XFJ A;  4GOF A;  4XA4 A;  2OYI C;  1KYO E;  3A0H E;  1FDO A;  1SQQ G;  2O1J A;  4R4M A;  2GM4 A;  3KHU A;  2W27 A;  3L70 E;  1SQP G;  5APQ A;  2ZT9 D;  2JDI H;  1S9K E;  3SFD C;  1K9M Q;  1K73 Q;  4W80 A;  2V4H A;  4D6T D;  3CCV P;  2O1K A;  3WUT A;  1LJ2 A;  1NU1 G;  1RE3 C;  2BAS A;  3CXH H;  4KT0 J;  4PV1 B;  4W7Y A;  3H1J J;  4W7Z A;  2Z5H A;  5KLI B;  1VQK P;  2E75 D;  5AW2 B;  1YIT P;  1YQ4 C;  2WPR A;  1L0N K;  1AV1 A;  2E74 C;  1T6A A;  1SS1 A;  1RF0 A;  5AVW B;  1GMJ A;  1K8A Q;  4EDF A;  3MTU E;  1OVR A;  2FYZ A;  4XE5 B;  2P10 A;  1PL5 A;  2Q1K A;  2Z4E A;  1JM0 A;  3CX5 I;  1YTZ I;  2JEE A;  4WY4 B;  1SQV E;  1BCC E;  4JF7 A;  3RK2 C;  4H0L C;  1K04 A;  1SQB G;  1X0T A;  1A02 F;  1OFC X;  3GW6 A;  4GIF A;  4U3F G;  1L0N D;  3A3Y B;  1L0L J;  2G8Y A;  3CX5 H;  3AEF C;  4YXD C;  1GL2 C;  3SWY A;  2YO2 A;  3BCC D;  1NOH A;  1PPJ G;  3RGU A;  5CBN A;  1NH4 A;  3ITK A;  3L75 E;  1DIP A;  1OZH A;  1NTZ J;  5BU5 A;  3KZI H;  1LTJ B;  3M9B A;  1OXZ A;  4QMA A;  1ZRT D;  2IFN A;  4N3Y B;  1S2E A;  4B86 A;  5B66 H;  2L91 A;  2KIK A;  2KLV A;  4MN4 C;  2AEJ A;  2IDB A;  1T8Z A;  3HRN A;  1GDT A;  4H13 C;  3HUS A;  1FAV A;  3L36 A;  1JCC A;  1KIL E;  4EOT A;  2I1J A;  2BCC G;  2QIW A;  2H88 C;  3CCQ P;  2FFD A;  3Q5S A;  1URQ B;  4UB8 H;  2C0X A;  3SFE C;  3CL3 D;  1U7M A;  3M0A A;  5AVU B;  3T97 B;  2FXM A;  2W8Z A;  1GK4 A;  2R5D A;  1RHZ B;  2E5Y A;  2R32 A;  3H32 B;  3A0B H;  1SQX K;  1IK7 A;  2KP8 A;  4PD4 E;  2KZJ A;  1FJP A;  2H8P D;  5KJ7 D;  2Q9I A;  3FXD A;  1JCD A;  5CBO A;  1OVU A;  1NTM K;  1H89 A;  2DW3 A;  1MV8 A;  1J1D C;  2E76 D;  1JMB A;  2FFD C;  2ZXX A;  1RF1 A;  1SQX D;  1BE3 D;  1JUN A;  1X79 B;  2A45 H;  1RY3 A;  1N7S B;  3H1H E;  5GTI E;  2QSI A;  1NTM D;  3CWB D;  1M56 D;  5CHX A;  3H1L D;  1FC2 C;  3TGU D;  1BDD A;  2FYU K;  3H1I E;  3L70 G;  3I5C A;  5KKZ B;  5APT A;  1KQS O;  2JKV A;  2UWJ E;  3FX0 A;  2IBZ D;  3Q2Y A;  3Q5P A;  2N1T B;  3L73 E;  1QX8 A;  1NTK E;  1RH5 B;  1RF1 C;  2O01 J;  5B5E E;  3II6 A;  2A45 G;  3HTK B;  4PV1 D;  3GG2 A;  2FYU D;  4L74 A;  2OYH A;  3H6P A;  1BSH A;  4HKZ H;  1T2K C;  1Y8A A;  2M3B A;  3RL0 g;  2ZYA A;  1LT9 C;  3C1L A;  5KLV E;  1ZLL A;  1AFO A;  1L4A A;  1JY3 N;  1PP9 J;  3SWK A;  1VQ6 P;  1FZC A;  4WB4 A;  1VQO P;  1KTM A;  4RJT A;  1SP4 A; 
#chains in the Genus database with same CATH homology
 2ZVO B;  4OWF A;  2ZVN B;  4BWN A;  2V4H A;  3FX0 A;  3JSV C;  3F89 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...