4BX5B

Cis-divalent streptavidin
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
121
structure length
121
Chain Sequence
GITGTWYNQLGSTFIVTAGADGALTGTYESAVGNAESRYVLTGRYDSAPATDGSGTALGWTVAWKNNYRNAHSATTWSGQYVGGAEARINTQWLLTSGTTEANAWKSTLVGHDTFTKVKPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords STREPTAVIDIN
publication title Plug-and-Play Pairing Via Defined Divalent Streptavidins.
pubmed doi rcsb
source organism Streptomyces avidinii
molecule tags Biotin-binding protein
total genus 29
structure length 121
sequence length 121
chains with identical sequence D
ec nomenclature
pdb deposition date 2013-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01382 Avidin Avidin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.30 Mainly Beta Beta Barrel Lipocalin Avidin-like 4bx5B00
1KL5A 3SZIA 5L3YA 1SRGA 2RTEB 5IRUA 4GDAA 2OFAA 4BX7A 1VWNB 1Y55X 2RTRB 1SWCA 1N9MA 2C1SA 4GGRA 4YVBA 1VWDB 4DNEA 1MOYA 1SWEA 1Y52X 2RTJA 1Y53X 2IZLB 2ZSCA 3RY1A 1KL4A 4CPHB 1MM9A 3RDQA 3EW1A 3VHMA 3RE5A 2Y3EA 5CHKA 2IZEB 1SWFA 1RXJA 4GJVA 1LDOA 1DF8A 4BBOA 3RDMA 4BX5B 2RTFB 1I9HA 2RTMA 1SWTA 5IRWA 1VWPB 2WPUA 3PK2A 1NDJA 1SWAA 1HXLA 1IJ8A 3WZNA 4BX6B 1SLGB 2OFBA 4CPFA 1SREA 2OF9A 2RTCB 2RTNB 4BJ8A 2IZJA 1KL3A 1HXZA 2RTPB 1RSUB 3RDSA 1LCVA 1LUQA 4GJSA 3RDOA 3VHHA 2JGSA 1N4JA 1RSTB 1VWHB 2Y32A 3FDCA 4Z28A 4BX5A 4Z27A 1RXHA 1VYOA 2C1QA 2CAMA 2MF6A 4GGZA 3WYQA 4BX6A 3X00A 1SWLA 1VWBB 5F2BA 5B5FA 1SWKA 1HQQA 1VWOB 1LCWA 1VWRB 2OF8A 3T2XA 1AVDA 1SWPA 4CPEA 1LCZA 4OKAA 2A5CA 1VWIB 1SWDA 3SZHA 1SRFA 1STPA 3RE6A 1SRHA 2IZFB 2IZAA 3RY2A 4EKVA 3RDXA 3SZJA 1SWQA 2F01A 3WZOA 2QCBA 1RXKA 5B5GA 2RTBB 5JD2A 5K67A 2BC3A 2IZGB 2GH7A 1LELA 4CPHA 2FHLA 2RTGB 1SRJA 1SLFB 1SLDB 2IZHB 2A5BA 1LDQA 1VWQB 1VWMB 4GGTA 3RDUA 2RTQB 3WZPA 1STSB 4U46A 4CPIA 1SLEB 2RTAA 1HY2A 1KFFA 1MK5A 1SWBA 2RTHB 3MM0A 2FHNX 2UZ2A 4Y5DA 1SWRA 1PTSA 2UYWA 3MG5A 3VHIA 1SWOA 2IZCB 2RTOB 4JNJA 4Y59A 1RAVA 1NQNA 2IZBA 4Z2PA 3T6LA 4JO6A 5IRAA 1SRIA 1N7YA 1SWUA 1SWJA 2RTLA 4BCSA 3EW2A 1SWNA 1VWCB 2IZDB 2RTKA 1NQMA 4Z2OA 2C4IA 4GD9A 1N9YA 2IZKA 2IZIA 1VWAB 4JHQA 4IRWA 1VWEB 4I60A 1VWFB 2G5LA 3T2WA 1AVEA 1N43A 1SWHA 3WZQA 1SWSA 5CSEA 4BX7B 3T6FA 5K68A 3WYPA 2A8GA 1STRB 4Z6JA 1NBXA 1MEPA 3VGWA 1VWGB 2RTIB 1VWLB 1VWJB 1NC9A 1VWKB 1WBIA 2RTDB 2Y3FA 1SWGA 4Z2VA 2AVIA
chains in the Genus database with same CATH superfamily
5KHPA 4CK4A 2AT0X 2MWHA 4FBVA 1ZNKA 2DJGA 3SAOA 3MVFA 1EIOA 1HMSA 2ZSCA 4MVIA 1A57A 1KL4A 1VYGA 3VG3A 3RE5A 1LKEA 1SWFA 1YWCA 2G8CO 1KT3A 4OELA 1A2DA 4BX5B 2RTFB 5IRWA 1H91A 1SWTA 2WPUA 3BU1A 1BSQA 1SWAA 1GGLA 1HXLA 2FS6A 3HOEA 3OE3A 4FBOA 4BX6B 1JJXA 2OL8O 3EBWA 2RTCB 3WVMA 5FQ7E 1FENA 1KOIA 1OBQA 3FIDA 2RTPB 1RSUB 2A3FX 1JMZA 1LCVA 2NNDA 3Q34A 4O3YA 5D4AA 3VHHA 3ZW0B 4LZVA 1VWHB 1PBOA 1FJ1E 4R0BA 4XMHA 5H9NA 1X8OA 4I3DA 3HTYA 4YFQA 4Z28A 4BX5A 1SA8A 4DQ4A 2CAMA 2MF6A 1NGLA 1TVQA 4A1YA 3WJDA 3WYQA 5B2AO 3GE2A 4BX6A 1SWLA 4AZMA 5FQ8E 5LJBA 1NP1A 5HZ9A 4GETA 1MUPA 3FMZA 2OF8A 1UYNX 1AVGI 2AF5A 1VWIB 2HNXA 3EYCA 4WFVA 2OY5O 4L3RA 4YFPA 3ZW0A 2OY7A 1SRHA 2IZFB 2MM3A 4EKVA 1KT7A 1KXOA 1GT1A 2P8GA 3N91A 1YWBA 1DZJA 4NW4A 1DZPA 2F01A 4IBAA 2QCBA 1RXKA 5B5GA 2RTBB 4AZNA 1R0UA 1ZNLA 3QKGA 3CQNA 5EDCA 2RTGB 1IIUA 1QFVA 1X8UA 2AT8X 2L67A 1X8PA 1K3BA 3NQ9A 1I4UA 2OL7A 4IB9A 4UU3A 5H9LA 1LDQA 2LBVA 1VWQB 4GGTA 3STMX 3FA8A 2BS6A 1FELA 1QY1A 1QABE 2GTFX 4Y5DA 2OVAA 3MM0A 3O22A 3QQ2A 3S26A 4RUUA 1QWDA 3PPTA 3WBGA 3ZQ3A 4IB8A 5AEOA 1ZRYA 3FIQA 3MG5A 4TLJA 3EC5A 2RTOB 4EQAC 2JU7A 2FR2A 4Y59A 1NQNA 2QOMA 4Y0SA 3VG2A 3WOVA 1OEKA 2G78A 1IKEA 3BDRA 5HZ6A 5LKEA 1OEJA 1DF3A 4WBKA 5IRAA 2AT3X 3VPJE 1JZUA 1HN2A 5FQ6E 1SWJA 3WJFA 3BX8A 3FR5A 3NX2A 3VG4A 4ES7A 1SWNA 4KC7A 4RUNA 1A18A 1JV4A 2RD7C 4OMWA 4TKHA 2X46A 4U9CA 4DCBA 2R56A 4NYRA 5D45A 4YFRA 1E00A 5EDBA 1I05A 2RA6A 3F8AA 1JBHA 3HWGA 4U8UO 1RLBE 4ZHDA 1YWDA 1KZWA 3WJBA 2WQ9A 2MO5A 2CZTA 4LZUA 4EEJA 3KFHA 5F6ZA 4I3CA 1VWAB 4OS3A 3DTQA 5F7GA 1BEBA 1D3SA 1PM1X 2G5LA 3NX1A 4MVEA 3P6CA 3TF6A 4YBUA 3PH6A 2O62A 2Q2MA 3KZAA 5L8OA 1S2PA 1LICA 2CBSA 3BSZE 3T6FA 5JR8A 1GX8A 1YP6A 5HZQA 1XKIA 3FELA 4YGZA 1NBXA 1OSPO 4O4OA 3VGWA 3P24A 5FAZA 1P6PA 2FRSA 3F6ZB 1JJJA 1VYFA 1WBIA 2Y3FA 3EBKA 3KQ0A 1BM5A 3PQUA 4O4UA 5EEEA 1KL5A 3SZIA 3P6FA 3AUMO 4YGGA 4QGVA 1O1UA 2OFAA 2HMBA 4GDAA 2LKKA 2RTRB 1G85A 1SWCA 3ZUOA 4CDCA 4HPCA 4YVBA 5HCEC 2WQAE 4TKBA 1Y9TA 4I9RA 1QFTA 1W4TA 3STKA 3PH5A 5HTEA 5B3MO 1B56A 4DNEA 1PMPA 2CBRA 4ZHHA 1DV9A 2QMIA 4O9SA 1CRBA 4OS8A 1FEMA 3RDQA 2KTSA 4ZGUA 1RXJA 1I06A 4KIIA 1DF8A 3PECA 1I9HA 3EMMA 1VWPB 3BS2A 2GJ5A 3MX7A 2KW1A 1U17A 2JW1A 2MHDA 3CKFA 4ORXA 2EU7X 2FWVA 4BJ8A 3VG7A 1BRPA 4LKTA 4K19A 2IZJA 3NQKA 1Z24A 5B29A 1UZ2X 4ZH9A 3G7XA 2X32A 4YKOA 1RSTB 4FQBB 5KICA 1G7NA 3CWKA 4Z27A 1RXHA 1VYOA 2C1QA 5LJDA 4BGFA 5KIDA 4XMEA 3X00A 4ZFXA 1ALBA 1SWKA 2LBAA 2POAA 3O19A 2AT6X 4NLIA 1GX3A 1L6MA 2FS7A 2NNEA 3FA7A 4NNSA 1AQBA 1MDCA 4OEMA 4ZHGA 2A5CA 4HWMA 1SWDA 2FT9A 3S5XA 4Y0QA 4YGHA 1QY2A 4GZVA 4AW8A 1BSYA 3HWEA 3JQOA 1KQWA 3RDXA 3SZJA 5HBSA 2OY8A 4IB6A 5JD2A 3D97A 2F73A 1U0XA 2IZGB 2GH7A 3EM0A 3FEPA 4O4SA 3U0DA 1SRJA 1ZNGA 2JU8A 5B11O 2IZHB 5H9AA 2AMMX 1QQSA 4YH0A 1OEEA 4ORSA 2FKJA 5LKFA 1STSB 3WZPA 4AZOA 1SLEB 1BWYA 5LJHA 2RTHB 3KFFA 3TGAA 4I3BA 2WEWA 4NYQA 4HPAA 1HBQA 3ZW1B 4GU8A 4JNJA 4U3QA 1RAVA 4Z2PA 3UAQA 3T6LA 4ALBA 5HAEA 2DM5A 3KVNA 4GNWA 4ID2A 4N7CA 1ERXA 1N7YA 1SWUA 1T0VA 2HKDA 2QM9A 4KT5A 2AH7X 1EIIA 4FGIB 3I17A 1CBRA 3OJYC 3NPOA 5EZ2A 5F1EA 1IFCA 1GT4A 3ZZVA 1T68X 3FR2A 1DFVA 4O3XB 3ZW1A 2OZQA 3FA6A 1E06A 4YKMA 2I5ZO 2BT9A 2IZIA 4GNYA 2R73A 4I60A 3SLTA 1D2UA 4INNA 1AVEA 4LQZA 4CDEA 1QG5A 5DPQA 3B2JA 4U8UN 1SY2A 2CM9A 2JOZA 5HCDC 4ODDA 2WR6A 3ELZA 2FKGA 3AKMA 2WSJA 2QO5A 4JGLA 2JN3A 3P6DA 2A2GA 4N7DA 3RBYA 1VWGB 3WJGA 5LJEA 1VWLB 1SXUA 1VWJB 2GTLM 3S5VA 1VWKB 1KT4A 1ICNA 3B2LA 4Z2VA 1TW4A 4IMNA 4WHIA 5LJKA 1BLRA 4ARHA 2AVIA 2RQ0A 1ADLA 1SRGA 2RTEB 5IRUA 1SY1A 1VWNB 1Y55X 2CZUA 2X8TA 4ZR2A 1A3YA 1GT5A 2ZAGA 2FGSA 2GC9A 4D6AA 4YMYA 2LA7A 1OBPA 3U9PC 1VWDB 1EPBA 3IA8A 4ML7B 4ZHCA 1MOYA 1SWEA 2RTJA 1Y53X 5HA1A 1EALA 3BU9A 4YCHA 5LJGA 4IAXA 1MM9A 2X8SA 1YP7A 3PEDA 4A8ZA 1O8VA 1U18A 4GJVA 4Y0PA 1CBIA 1YWAA 4BBOA 1MX7A 2IFBA 4OMXA 3AEHA 3P6GA 4ZJ0A 4KH8A 4QYPA 4TQ2A 5F6BA 1NDJA 1T8VA 2NNQA 3B2KA 4PJ2A 3WZNA 5IO6A 1SLGB 2ALLX 2QO4A 5C0NA 3D9WA 2OF9A 2RTNB 5HTDA 3FR4A 3NP1A 1ZNDA 4O3ZA 1UYOX 1JYDA 1KL3A 3NR3A 2BHVA 4QYNA 3RDOA 1LUQA 4GJSA 4A1HA 2FR3A 1DZMA 2JGSA 1JQPA 1LIFA 3JSQA 2Y32A 4ORYA 3U03A 3SOTA 4FBRA 1RBPA 2VFCA 5D48A 3WXQA 2QO6A 1CBQA 4GGZA 5EPQA 2I5VO 1DC9A 4QAEA 4AZPA 2X45A 1VWOB 3D95A 1VWRB 5L8IA 1SWPA 4CPEA 1LCZA 4ORUA 1PEEA 1IKJA 1GXAA 1LIDA 2ACOA 2FTBA 2OL6O 4OKAA 4QRLA 1WUBA 3CMPA 1STPA 4MEEA 4NV7A 3OBLA 3RE6A 3VE2A 4AYHA 4IAWA 3RY2A 1I78A 4CDFA 3C77X 3NADA 3PP6A 2RCTA 1BJ7A 1MX8A 1GX9A 3I0AA 1NP4A 3O2YA 5AQ6A 3UEVA 4LKPA 3LTWA 3B2HA 1BRQA 1HMTA 3WZOA 4B55A 3ZI8A 3TZSA 1MVGA 5K67A 1GT3A 3LHNA 4KCAA 4QGWA 4MVKA 3D4RA 4TKJA 2OVSA 3FENA 1SLFB 1JYJA 1SLDB 5AJBA 5HZ8A 1X89A 1HQPA 2Q2PA 1ERBA 3KFGA 3RDUA 2KT4B 2RTQB 2N93A 4U46A 4CPIA 1S44A 2RTAA 2X56A 2R74A 1HY2A 1KFFA 4YCEA 1SWBA 3RKGA 4NV8A 1OPAA 2K62A 2UZ2A 1EXSA 1PTSA 5FFHA 1LPJA 4COTA 1EPAA 4XMFA 2UYWA 2X4MA 1SWOA 2IZCB 1BSOA 1LF7A 1YIVA 3C78X 3D96A 3FEKA 1LFOA 4U8UM 1G74A 2IZBA 2L9CA 3P6EA 3RWXA 1EUOA 5BVTA 2MJIA 2Q9SA 3Q6LA 4JO6A 2VFBA 1GKAB 2F09A 2Z4HA 2NP1A 2M4LA 5BVSA 2G7BA 1VWCB 3KFIA 1NQMA 4ZCBA 3VE1A 3AKNA 1B8EA 3E3CA 5LJCA 5B10O 1N0SA 2OYBO 1KT5A 3CKGA 2HYSA 4WFUA 4YDAA 1BBPA 2L5PA 1N9YA 4Y0RA 4HPDA 4CDDA 1SMPI 2GTLO 4GH7A 4ORWA 4JHQA 4IRWA 1VWEB 2OFMX 5EEDA 1GKAA 1ML7A 2KD2A 1N43A 3APXA 1OBUA 4ZGFA 5CSEA 4BX7B 4CV7A 5IXGA 2PY1A 1EQDA 3DSZA 4I9SA 2JMBA 3WYPA 1I04A 1S7DA 3HWDA 2A8GA 1STRB 3UEWA 3UEUA 4GRJA 4AZRA 4KC8A 5H8TA 5IO7A 3P6HA 4M7MA 2XKLA 3BRNA 3NQ3A 2WWPA 1SWGA 4XMDA 2AT5X 3UEXA 4QGXA 4GK9A 4O4XA 2FLJA 4I95A 4IMOA 4UU2A 1OPBA 5L3YA 4BX7A 1E2TA 5L8NA 1W5RA 1N9MA 1X8QA 2C1SA 3HK1A 2OVEA 4GGRA 3FA9A 4O49A 1TXLA 3JS1A 4MIRA 5HCCC 1ACDA 1Y52X 2RN4A 3PQSA 2DJFA 4ORRA 3LV4A 2IZLB 3CBCA 3RY1A 1SXWA 4CPHB 4TNNA 2WEXA 2XSTA 3EW1A 5D8JA 2E4JA 3VHMA 4EFGA 2Y3EA 5CHKA 2IZEB 4EDEA 4EXZA 1EI5A 5B27A 1LDOA 3RDMA 4I6SA 2RTMA 3PK2A 3F9DA 5DG4A 3RDSA 4TJZA 1SXYA 3STNA 1IJ8A 1TOUA 1KQXA 3CBSA 3L4RA 3RSWA 3VG6A 1SY0A 2OFBA 4CPFA 1SREA 4MVLA 4YBPA 1CJ5A 3CR6A 4ON1A 4CSBA 4GUZA 1LIEA 1HBPA 1O1VA 1HXZA 4CPHA 2JU3A 1KT6A 1N4JA 4AZQA 4BQUA 3IFBA 2W2BA 4NP1A 3C76X 3HWFA 3FDCA 2OFRX 2Q4NA 1FE3A 3HOLA 4L1NA 4ALOA 3HPEA 5BYPA 1AELA 1EW3A 1ZNEA 1ICMA 5B5FA 1VWBB 2X8FA 5F2BA 2ACPX 1HQQA 2AKQA 5AJCA 3WJCA 3FW4A 1LCWA 3T2XA 1X8NA 3APWA 1AVDA 3PDFA 4NNTA 1FDQA 4O3WA 1LNMA 2QOSC 2A2UA 4QQ1A 1QY0A 2HZRA 3SZHA 1SRFA 2HLVA 3FLLA 1HMRA 3BY0A 4ZH6A 2PI3O 1G5WA 2IZAA 2W2FA 1SY3A 3SLOA 3V8UA 1B0OA 1JJUA 1B4MA 3ZWEA 5H9KA 2OY1O 1VPRA 2CM4A 2Q39A 1IFBA 1TOWA 2AL0X 2LB6A 2YMSA 4HPBA 1SWQA 2RCQA 4XMGA 4YDBA 5BVQA 2KTDA 1IW2A 5HWZA 3S60A 5K06A 2BSZA 2BC3A 1LELA 4QZUA 2FHLA 4C5PA 1FTPA 4IABA 2A0AA 2BS5A 4D6BA 2A5BA 2X34A 4QZTA 4A60A 1VWMB 3GAQA 1PBYA 4BVMA 4IB7A 2Z4IA 3APVA 1KZXA 2ANSA 1AB0A 2LFOA 3NBXX 3SLJA 1MK5A 3ZUIA 2FHNX 1UREA 5F58A 1SWRA 2L68A 1XCAA 2WUTA 4XMCA 3WJEA 3VHIA 1ZNHA 3ELXA 5CYBA 4ZHFA 3VG5A 1JIWI 1GM6A 2K23A 1W6FA 2X55A 1SXXA 1SRIA 1JMXA 4MISA 5D47A 2RTLA 3APUA 4BCSA 5CE4A 1K24A 3EW2A 5FENA 2RTKA 2IZDB 2G79A 4OS0A 1DZKA 2YG2A 3K3LA 4Z2OA 3CQRA 2C4IA 4QNIA 3T1DA 3MBTA 1CBSA 5HA0A 2W2AA 1E02A 4HFOA 4GD9A 1X71A 3ZW2A 2IZKA 3TGBA 1KGLA 3FW5A 3BLGA 4GDZA 1VWFB 3T2WA 2OVDA 1SWHA 5IO5A 2HZQA 3WZQA 3H3IA 3VU1A 1SWSA 4DQ3A 5HZ5A 2ASNX 2BLGA 2ZAIA 3P02A 1Y9LA 5K68A 4NLJA 1YUPA 2GTLN 4Z6JA 3TGCA 3BX7A 3FYFA 4GE1A 2A13A 4BOEA 1MEPA 3B2IA 2RTIB 3OD9A 1LIBA 4GKCA 3RZYA 1NC9A 4M6SA 2RTDB 2VDFA 4PSQA 1E5PA 1Y0GA
chains in the Genus database with same CATH topology
1KL5A 3SZIA 5L3YA 1SRGA 2RTEB 5IRUA 4GDAA 2OFAA 4BX7A 1VWNB 1Y55X 2RTRB 1SWCA 1N9MA 2C1SA 4GGRA 4YVBA 1VWDB 4DNEA 1MOYA 1SWEA 1Y52X 2RTJA 1Y53X 2IZLB 2ZSCA 3RY1A 1KL4A 4CPHB 1MM9A 3RDQA 3EW1A 3VHMA 3RE5A 2Y3EA 5CHKA 2IZEB 1SWFA 1RXJA 4GJVA 1LDOA 1DF8A 4BBOA 3RDMA 4BX5B 2RTFB 1I9HA 2RTMA 1SWTA 5IRWA 1VWPB 2WPUA 3PK2A 1NDJA 1SWAA 1HXLA 1IJ8A 3WZNA 4BX6B 1SLGB 2OFBA 4CPFA 1SREA 2OF9A 2RTCB 2RTNB 4BJ8A 2IZJA 1KL3A 1HXZA 2RTPB 1RSUB 3RDSA 1LCVA 1LUQA 4GJSA 3RDOA 3VHHA 2JGSA 1N4JA 1RSTB 1VWHB 2Y32A 3FDCA 4Z28A 4BX5A 4Z27A 1RXHA 1VYOA 2C1QA 2CAMA 2MF6A 4GGZA 3WYQA 4BX6A 3X00A 1SWLA 1VWBB 5F2BA 5B5FA 1SWKA 1HQQA 1VWOB 1LCWA 1VWRB 2OF8A 3T2XA 1AVDA 1SWPA 4CPEA 1LCZA 4OKAA 2A5CA 1VWIB 1SWDA 3SZHA 1SRFA 1STPA 3RE6A 1SRHA 2IZFB 2IZAA 3RY2A 4EKVA 3RDXA 3SZJA 1SWQA 2F01A 3WZOA 2QCBA 1RXKA 5B5GA 2RTBB 5JD2A 5K67A 2BC3A 2IZGB 2GH7A 1LELA 4CPHA 2FHLA 2RTGB 1SRJA 1SLFB 1SLDB 2IZHB 2A5BA 1LDQA 1VWQB 1VWMB 4GGTA 3RDUA 2RTQB 3WZPA 1STSB 4U46A 4CPIA 1SLEB 2RTAA 1HY2A 1KFFA 1MK5A 1SWBA 2RTHB 3MM0A 2FHNX 2UZ2A 4Y5DA 1SWRA 1PTSA 2UYWA 3MG5A 3VHIA 1SWOA 2IZCB 2RTOB 4JNJA 4Y59A 1RAVA 1NQNA 2IZBA 4Z2PA 3T6LA 4JO6A 5IRAA 1SRIA 1N7YA 1SWUA 1SWJA 2RTLA 4BCSA 3EW2A 1SWNA 1VWCB 2IZDB 2RTKA 1NQMA 4Z2OA 2C4IA 4GD9A 1N9YA 2IZKA 2IZIA 1VWAB 4JHQA 4IRWA 1VWEB 4I60A 1VWFB 2G5LA 3T2WA 1AVEA 1N43A 1SWHA 3WZQA 1SWSA 5CSEA 4BX7B 3T6FA 5K68A 3WYPA 2A8GA 1STRB 4Z6JA 1NBXA 1MEPA 3VGWA 1VWGB 2RTIB 1VWLB 1VWJB 1NC9A 1VWKB 1WBIA 2RTDB 2Y3FA 1SWGA 4Z2VA 2AVIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KL5 A;  3SZI A;  5L3Y A;  1SRG A;  2RTE B;  5IRU A;  4GDA A;  2OFA A;  4BX7 A;  1VWN B;  1Y55 X;  2RTR B;  1SWC A;  1N9M A;  2C1S A;  4GGR A;  4YVB A;  1VWD B;  4DNE A;  1MOY A;  1SWE A;  1Y52 X;  2RTJ A;  1Y53 X;  2IZL B;  2ZSC A;  3RY1 A;  1KL4 A;  4CPH B;  1MM9 A;  3RDQ A;  3EW1 A;  3VHM A;  3RE5 A;  2Y3E A;  5CHK A;  2IZE B;  1SWF A;  1RXJ A;  4GJV A;  1LDO A;  1DF8 A;  4BBO A;  3RDM A;  4BX5 B;  2RTF B;  1I9H A;  2RTM A;  1SWT A;  5IRW A;  1VWP B;  2WPU A;  3PK2 A;  1NDJ A;  1SWA A;  1HXL A;  1IJ8 A;  3WZN A;  4BX6 B;  1SLG B;  2OFB A;  4CPF A;  1SRE A;  2OF9 A;  2RTC B;  2RTN B;  4BJ8 A;  2IZJ A;  1KL3 A;  1HXZ A;  2RTP B;  1RSU B;  3RDS A;  1LCV A;  1LUQ A;  4GJS A;  3RDO A;  3VHH A;  2JGS A;  1N4J A;  1RST B;  1VWH B;  2Y32 A;  3FDC A;  4Z28 A;  4BX5 A;  4Z27 A;  1RXH A;  1VYO A;  2C1Q A;  2CAM A;  2MF6 A;  4GGZ A;  3WYQ A;  4BX6 A;  3X00 A;  1SWL A;  1VWB B;  5F2B A;  5B5F A;  1SWK A;  1HQQ A;  1VWO B;  1LCW A;  1VWR B;  2OF8 A;  3T2X A;  1AVD A;  1SWP A;  4CPE A;  1LCZ A;  4OKA A;  2A5C A;  1VWI B;  1SWD A;  3SZH A;  1SRF A;  1STP A;  3RE6 A;  1SRH A;  2IZF B;  2IZA A;  3RY2 A;  4EKV A;  3RDX A;  3SZJ A;  1SWQ A;  2F01 A;  3WZO A;  2QCB A;  1RXK A;  5B5G A;  2RTB B;  5JD2 A;  5K67 A;  2BC3 A;  2IZG B;  2GH7 A;  1LEL A;  4CPH A;  2FHL A;  2RTG B;  1SRJ A;  1SLF B;  1SLD B;  2IZH B;  2A5B A;  1LDQ A;  1VWQ B;  1VWM B;  4GGT A;  3RDU A;  2RTQ B;  3WZP A;  1STS B;  4U46 A;  4CPI A;  1SLE B;  2RTA A;  1HY2 A;  1KFF A;  1MK5 A;  1SWB A;  2RTH B;  3MM0 A;  2FHN X;  2UZ2 A;  4Y5D A;  1SWR A;  1PTS A;  2UYW A;  3MG5 A;  3VHI A;  1SWO A;  2IZC B;  2RTO B;  4JNJ A;  4Y59 A;  1RAV A;  1NQN A;  2IZB A;  4Z2P A;  3T6L A;  4JO6 A;  5IRA A;  1SRI A;  1N7Y A;  1SWU A;  1SWJ A;  2RTL A;  4BCS A;  3EW2 A;  1SWN A;  1VWC B;  2IZD B;  2RTK A;  1NQM A;  4Z2O A;  2C4I A;  4GD9 A;  1N9Y A;  2IZK A;  2IZI A;  1VWA B;  4JHQ A;  4IRW A;  1VWE B;  4I60 A;  1VWF B;  2G5L A;  3T2W A;  1AVE A;  1N43 A;  1SWH A;  3WZQ A;  1SWS A;  5CSE A;  4BX7 B;  3T6F A;  5K68 A;  3WYP A;  2A8G A;  1STR B;  4Z6J A;  1NBX A;  1MEP A;  3VGW A;  1VWG B;  2RTI B;  1VWL B;  1VWJ B;  1NC9 A;  1VWK B;  1WBI A;  2RTD B;  2Y3F A;  1SWG A;  4Z2V A;  2AVI A; 
#chains in the Genus database with same CATH topology
 5KHP A;  4CK4 A;  2AT0 X;  2MWH A;  4FBV A;  1ZNK A;  2DJG A;  3SAO A;  3MVF A;  1EIO A;  1HMS A;  2ZSC A;  4MVI A;  1A57 A;  1KL4 A;  1VYG A;  3VG3 A;  3RE5 A;  1LKE A;  1SWF A;  1YWC A;  2G8C O;  1KT3 A;  4OEL A;  1A2D A;  4BX5 B;  2RTF B;  5IRW A;  1H91 A;  1SWT A;  2WPU A;  3BU1 A;  1BSQ A;  1SWA A;  1GGL A;  1HXL A;  2FS6 A;  3HOE A;  3OE3 A;  4FBO A;  4BX6 B;  1JJX A;  2OL8 O;  3EBW A;  2RTC B;  3WVM A;  5FQ7 E;  1FEN A;  1KOI A;  1OBQ A;  3FID A;  2RTP B;  1RSU B;  2A3F X;  1JMZ A;  1LCV A;  2NND A;  3Q34 A;  4O3Y A;  5D4A A;  3VHH A;  3ZW0 B;  4LZV A;  1VWH B;  1PBO A;  1FJ1 E;  4R0B A;  4XMH A;  5H9N A;  1X8O A;  4I3D A;  3HTY A;  4YFQ A;  4Z28 A;  4BX5 A;  1SA8 A;  4DQ4 A;  2CAM A;  2MF6 A;  1NGL A;  1TVQ A;  4A1Y A;  3WJD A;  3WYQ A;  5B2A O;  3GE2 A;  4BX6 A;  1SWL A;  4AZM A;  5FQ8 E;  5LJB A;  1NP1 A;  5HZ9 A;  4GET A;  1MUP A;  3FMZ A;  2OF8 A;  1UYN X;  1AVG I;  2AF5 A;  1VWI B;  2HNX A;  3EYC A;  4WFV A;  2OY5 O;  4L3R A;  4YFP A;  3ZW0 A;  2OY7 A;  1SRH A;  2IZF B;  2MM3 A;  4EKV A;  1KT7 A;  1KXO A;  1GT1 A;  2P8G A;  3N91 A;  1YWB A;  1DZJ A;  4NW4 A;  1DZP A;  2F01 A;  4IBA A;  2QCB A;  1RXK A;  5B5G A;  2RTB B;  4AZN A;  1R0U A;  1ZNL A;  3QKG A;  3CQN A;  5EDC A;  2RTG B;  1IIU A;  1QFV A;  1X8U A;  2AT8 X;  2L67 A;  1X8P A;  1K3B A;  3NQ9 A;  1I4U A;  2OL7 A;  4IB9 A;  4UU3 A;  5H9L A;  1LDQ A;  2LBV A;  1VWQ B;  4GGT A;  3STM X;  3FA8 A;  2BS6 A;  1FEL A;  1QY1 A;  1QAB E;  2GTF X;  4Y5D A;  2OVA A;  3MM0 A;  3O22 A;  3QQ2 A;  3S26 A;  4RUU A;  1QWD A;  3PPT A;  3WBG A;  3ZQ3 A;  4IB8 A;  5AEO A;  1ZRY A;  3FIQ A;  3MG5 A;  4TLJ A;  3EC5 A;  2RTO B;  4EQA C;  2JU7 A;  2FR2 A;  4Y59 A;  1NQN A;  2QOM A;  4Y0S A;  3VG2 A;  3WOV A;  1OEK A;  2G78 A;  1IKE A;  3BDR A;  5HZ6 A;  5LKE A;  1OEJ A;  1DF3 A;  4WBK A;  5IRA A;  2AT3 X;  3VPJ E;  1JZU A;  1HN2 A;  5FQ6 E;  1SWJ A;  3WJF A;  3BX8 A;  3FR5 A;  3NX2 A;  3VG4 A;  4ES7 A;  1SWN A;  4KC7 A;  4RUN A;  1A18 A;  1JV4 A;  2RD7 C;  4OMW A;  4TKH A;  2X46 A;  4U9C A;  4DCB A;  2R56 A;  4NYR A;  5D45 A;  4YFR A;  1E00 A;  5EDB A;  1I05 A;  2RA6 A;  3F8A A;  1JBH A;  3HWG A;  4U8U O;  1RLB E;  4ZHD A;  1YWD A;  1KZW A;  3WJB A;  2WQ9 A;  2MO5 A;  2CZT A;  4LZU A;  4EEJ A;  3KFH A;  5F6Z A;  4I3C A;  1VWA B;  4OS3 A;  3DTQ A;  5F7G A;  1BEB A;  1D3S A;  1PM1 X;  2G5L A;  3NX1 A;  4MVE A;  3P6C A;  3TF6 A;  4YBU A;  3PH6 A;  2O62 A;  2Q2M A;  3KZA A;  5L8O A;  1S2P A;  1LIC A;  2CBS A;  3BSZ E;  3T6F A;  5JR8 A;  1GX8 A;  1YP6 A;  5HZQ A;  1XKI A;  3FEL A;  4YGZ A;  1NBX A;  1OSP O;  4O4O A;  3VGW A;  3P24 A;  5FAZ A;  1P6P A;  2FRS A;  3F6Z B;  1JJJ A;  1VYF A;  1WBI A;  2Y3F A;  3EBK A;  3KQ0 A;  1BM5 A;  3PQU A;  4O4U A;  5EEE A;  1KL5 A;  3SZI A;  3P6F A;  3AUM O;  4YGG A;  4QGV A;  1O1U A;  2OFA A;  2HMB A;  4GDA A;  2LKK A;  2RTR B;  1G85 A;  1SWC A;  3ZUO A;  4CDC A;  4HPC A;  4YVB A;  5HCE C;  2WQA E;  4TKB A;  1Y9T A;  4I9R A;  1QFT A;  1W4T A;  3STK A;  3PH5 A;  5HTE A;  5B3M O;  1B56 A;  4DNE A;  1PMP A;  2CBR A;  4ZHH A;  1DV9 A;  2QMI A;  4O9S A;  1CRB A;  4OS8 A;  1FEM A;  3RDQ A;  2KTS A;  4ZGU A;  1RXJ A;  1I06 A;  4KII A;  1DF8 A;  3PEC A;  1I9H A;  3EMM A;  1VWP B;  3BS2 A;  2GJ5 A;  3MX7 A;  2KW1 A;  1U17 A;  2JW1 A;  2MHD A;  3CKF A;  4ORX A;  2EU7 X;  2FWV A;  4BJ8 A;  3VG7 A;  1BRP A;  4LKT A;  4K19 A;  2IZJ A;  3NQK A;  1Z24 A;  5B29 A;  1UZ2 X;  4ZH9 A;  3G7X A;  2X32 A;  4YKO A;  1RST B;  4FQB B;  5KIC A;  1G7N A;  3CWK A;  4Z27 A;  1RXH A;  1VYO A;  2C1Q A;  5LJD A;  4BGF A;  5KID A;  4XME A;  3X00 A;  4ZFX A;  1ALB A;  1SWK A;  2LBA A;  2POA A;  3O19 A;  2AT6 X;  4NLI A;  1GX3 A;  1L6M A;  2FS7 A;  2NNE A;  3FA7 A;  4NNS A;  1AQB A;  1MDC A;  4OEM A;  4ZHG A;  2A5C A;  4HWM A;  1SWD A;  2FT9 A;  3S5X A;  4Y0Q A;  4YGH A;  1QY2 A;  4GZV A;  4AW8 A;  1BSY A;  3HWE A;  3JQO A;  1KQW A;  3RDX A;  3SZJ A;  5HBS A;  2OY8 A;  4IB6 A;  5JD2 A;  3D97 A;  2F73 A;  1U0X A;  2IZG B;  2GH7 A;  3EM0 A;  3FEP A;  4O4S A;  3U0D A;  1SRJ A;  1ZNG A;  2JU8 A;  5B11 O;  2IZH B;  5H9A A;  2AMM X;  1QQS A;  4YH0 A;  1OEE A;  4ORS A;  2FKJ A;  5LKF A;  1STS B;  3WZP A;  4AZO A;  1SLE B;  1BWY A;  5LJH A;  2RTH B;  3KFF A;  3TGA A;  4I3B A;  2WEW A;  4NYQ A;  4HPA A;  1HBQ A;  3ZW1 B;  4GU8 A;  4JNJ A;  4U3Q A;  1RAV A;  4Z2P A;  3UAQ A;  3T6L A;  4ALB A;  5HAE A;  2DM5 A;  3KVN A;  4GNW A;  4ID2 A;  4N7C A;  1ERX A;  1N7Y A;  1SWU A;  1T0V A;  2HKD A;  2QM9 A;  4KT5 A;  2AH7 X;  1EII A;  4FGI B;  3I17 A;  1CBR A;  3OJY C;  3NPO A;  5EZ2 A;  5F1E A;  1IFC A;  1GT4 A;  3ZZV A;  1T68 X;  3FR2 A;  1DFV A;  4O3X B;  3ZW1 A;  2OZQ A;  3FA6 A;  1E06 A;  4YKM A;  2I5Z O;  2BT9 A;  2IZI A;  4GNY A;  2R73 A;  4I60 A;  3SLT A;  1D2U A;  4INN A;  1AVE A;  4LQZ A;  4CDE A;  1QG5 A;  5DPQ A;  3B2J A;  4U8U N;  1SY2 A;  2CM9 A;  2JOZ A;  5HCD C;  4ODD A;  2WR6 A;  3ELZ A;  2FKG A;  3AKM A;  2WSJ A;  2QO5 A;  4JGL A;  2JN3 A;  3P6D A;  2A2G A;  4N7D A;  3RBY A;  1VWG B;  3WJG A;  5LJE A;  1VWL B;  1SXU A;  1VWJ B;  2GTL M;  3S5V A;  1VWK B;  1KT4 A;  1ICN A;  3B2L A;  4Z2V A;  1TW4 A;  4IMN A;  4WHI A;  5LJK A;  1BLR A;  4ARH A;  2AVI A;  2RQ0 A;  1ADL A;  1SRG A;  2RTE B;  5IRU A;  1SY1 A;  1VWN B;  1Y55 X;  2CZU A;  2X8T A;  4ZR2 A;  1A3Y A;  1GT5 A;  2ZAG A;  2FGS A;  2GC9 A;  4D6A A;  4YMY A;  2LA7 A;  1OBP A;  3U9P C;  1VWD B;  1EPB A;  3IA8 A;  4ML7 B;  4ZHC A;  1MOY A;  1SWE A;  2RTJ A;  1Y53 X;  5HA1 A;  1EAL A;  3BU9 A;  4YCH A;  5LJG A;  4IAX A;  1MM9 A;  2X8S A;  1YP7 A;  3PED A;  4A8Z A;  1O8V A;  1U18 A;  4GJV A;  4Y0P A;  1CBI A;  1YWA A;  4BBO A;  1MX7 A;  2IFB A;  4OMX A;  3AEH A;  3P6G A;  4ZJ0 A;  4KH8 A;  4QYP A;  4TQ2 A;  5F6B A;  1NDJ A;  1T8V A;  2NNQ A;  3B2K A;  4PJ2 A;  3WZN A;  5IO6 A;  1SLG B;  2ALL X;  2QO4 A;  5C0N A;  3D9W A;  2OF9 A;  2RTN B;  5HTD A;  3FR4 A;  3NP1 A;  1ZND A;  4O3Z A;  1UYO X;  1JYD A;  1KL3 A;  3NR3 A;  2BHV A;  4QYN A;  3RDO A;  1LUQ A;  4GJS A;  4A1H A;  2FR3 A;  1DZM A;  2JGS A;  1JQP A;  1LIF A;  3JSQ A;  2Y32 A;  4ORY A;  3U03 A;  3SOT A;  4FBR A;  1RBP A;  2VFC A;  5D48 A;  3WXQ A;  2QO6 A;  1CBQ A;  4GGZ A;  5EPQ A;  2I5V O;  1DC9 A;  4QAE A;  4AZP A;  2X45 A;  1VWO B;  3D95 A;  1VWR B;  5L8I A;  1SWP A;  4CPE A;  1LCZ A;  4ORU A;  1PEE A;  1IKJ A;  1GXA A;  1LID A;  2ACO A;  2FTB A;  2OL6 O;  4OKA A;  4QRL A;  1WUB A;  3CMP A;  1STP A;  4MEE A;  4NV7 A;  3OBL A;  3RE6 A;  3VE2 A;  4AYH A;  4IAW A;  3RY2 A;  1I78 A;  4CDF A;  3C77 X;  3NAD A;  3PP6 A;  2RCT A;  1BJ7 A;  1MX8 A;  1GX9 A;  3I0A A;  1NP4 A;  3O2Y A;  5AQ6 A;  3UEV A;  4LKP A;  3LTW A;  3B2H A;  1BRQ A;  1HMT A;  3WZO A;  4B55 A;  3ZI8 A;  3TZS A;  1MVG A;  5K67 A;  1GT3 A;  3LHN A;  4KCA A;  4QGW A;  4MVK A;  3D4R A;  4TKJ A;  2OVS A;  3FEN A;  1SLF B;  1JYJ A;  1SLD B;  5AJB A;  5HZ8 A;  1X89 A;  1HQP A;  2Q2P A;  1ERB A;  3KFG A;  3RDU A;  2KT4 B;  2RTQ B;  2N93 A;  4U46 A;  4CPI A;  1S44 A;  2RTA A;  2X56 A;  2R74 A;  1HY2 A;  1KFF A;  4YCE A;  1SWB A;  3RKG A;  4NV8 A;  1OPA A;  2K62 A;  2UZ2 A;  1EXS A;  1PTS A;  5FFH A;  1LPJ A;  4COT A;  1EPA A;  4XMF A;  2UYW A;  2X4M A;  1SWO A;  2IZC B;  1BSO A;  1LF7 A;  1YIV A;  3C78 X;  3D96 A;  3FEK A;  1LFO A;  4U8U M;  1G74 A;  2IZB A;  2L9C A;  3P6E A;  3RWX A;  1EUO A;  5BVT A;  2MJI A;  2Q9S A;  3Q6L A;  4JO6 A;  2VFB A;  1GKA B;  2F09 A;  2Z4H A;  2NP1 A;  2M4L A;  5BVS A;  2G7B A;  1VWC B;  3KFI A;  1NQM A;  4ZCB A;  3VE1 A;  3AKN A;  1B8E A;  3E3C A;  5LJC A;  5B10 O;  1N0S A;  2OYB O;  1KT5 A;  3CKG A;  2HYS A;  4WFU A;  4YDA A;  1BBP A;  2L5P A;  1N9Y A;  4Y0R A;  4HPD A;  4CDD A;  1SMP I;  2GTL O;  4GH7 A;  4ORW A;  4JHQ A;  4IRW A;  1VWE B;  2OFM X;  5EED A;  1GKA A;  1ML7 A;  2KD2 A;  1N43 A;  3APX A;  1OBU A;  4ZGF A;  5CSE A;  4BX7 B;  4CV7 A;  5IXG A;  2PY1 A;  1EQD A;  3DSZ A;  4I9S A;  2JMB A;  3WYP A;  1I04 A;  1S7D A;  3HWD A;  2A8G A;  1STR B;  3UEW A;  3UEU A;  4GRJ A;  4AZR A;  4KC8 A;  5H8T A;  5IO7 A;  3P6H A;  4M7M A;  2XKL A;  3BRN A;  3NQ3 A;  2WWP A;  1SWG A;  4XMD A;  2AT5 X;  3UEX A;  4QGX A;  4GK9 A;  4O4X A;  2FLJ A;  4I95 A;  4IMO A;  4UU2 A;  1OPB A;  5L3Y A;  4BX7 A;  1E2T A;  5L8N A;  1W5R A;  1N9M A;  1X8Q A;  2C1S A;  3HK1 A;  2OVE A;  4GGR A;  3FA9 A;  4O49 A;  1TXL A;  3JS1 A;  4MIR A;  5HCC C;  1ACD A;  1Y52 X;  2RN4 A;  3PQS A;  2DJF A;  4ORR A;  3LV4 A;  2IZL B;  3CBC A;  3RY1 A;  1SXW A;  4CPH B;  4TNN A;  2WEX A;  2XST A;  3EW1 A;  5D8J A;  2E4J A;  3VHM A;  4EFG A;  2Y3E A;  5CHK A;  2IZE B;  4EDE A;  4EXZ A;  1EI5 A;  5B27 A;  1LDO A;  3RDM A;  4I6S A;  2RTM A;  3PK2 A;  3F9D A;  5DG4 A;  3RDS A;  4TJZ A;  1SXY A;  3STN A;  1IJ8 A;  1TOU A;  1KQX A;  3CBS A;  3L4R A;  3RSW A;  3VG6 A;  1SY0 A;  2OFB A;  4CPF A;  1SRE A;  4MVL A;  4YBP A;  1CJ5 A;  3CR6 A;  4ON1 A;  4CSB A;  4GUZ A;  1LIE A;  1HBP A;  1O1V A;  1HXZ A;  4CPH A;  2JU3 A;  1KT6 A;  1N4J A;  4AZQ A;  4BQU A;  3IFB A;  2W2B A;  4NP1 A;  3C76 X;  3HWF A;  3FDC A;  2OFR X;  2Q4N A;  1FE3 A;  3HOL A;  4L1N A;  4ALO A;  3HPE A;  5BYP A;  1AEL A;  1EW3 A;  1ZNE A;  1ICM A;  5B5F A;  1VWB B;  2X8F A;  5F2B A;  2ACP X;  1HQQ A;  2AKQ A;  5AJC A;  3WJC A;  3FW4 A;  1LCW A;  3T2X A;  1X8N A;  3APW A;  1AVD A;  3PDF A;  4NNT A;  1FDQ A;  4O3W A;  1LNM A;  2QOS C;  2A2U A;  4QQ1 A;  1QY0 A;  2HZR A;  3SZH A;  1SRF A;  2HLV A;  3FLL A;  1HMR A;  3BY0 A;  4ZH6 A;  2PI3 O;  1G5W A;  2IZA A;  2W2F A;  1SY3 A;  3SLO A;  3V8U A;  1B0O A;  1JJU A;  1B4M A;  3ZWE A;  5H9K A;  2OY1 O;  1VPR A;  2CM4 A;  2Q39 A;  1IFB A;  1TOW A;  2AL0 X;  2LB6 A;  2YMS A;  4HPB A;  1SWQ A;  2RCQ A;  4XMG A;  4YDB A;  5BVQ A;  2KTD A;  1IW2 A;  5HWZ A;  3S60 A;  5K06 A;  2BSZ A;  2BC3 A;  1LEL A;  4QZU A;  2FHL A;  4C5P A;  1FTP A;  4IAB A;  2A0A A;  2BS5 A;  4D6B A;  2A5B A;  2X34 A;  4QZT A;  4A60 A;  1VWM B;  3GAQ A;  1PBY A;  4BVM A;  4IB7 A;  2Z4I A;  3APV A;  1KZX A;  2ANS A;  1AB0 A;  2LFO A;  3NBX X;  3SLJ A;  1MK5 A;  3ZUI A;  2FHN X;  1URE A;  5F58 A;  1SWR A;  2L68 A;  1XCA A;  2WUT A;  4XMC A;  3WJE A;  3VHI A;  1ZNH A;  3ELX A;  5CYB A;  4ZHF A;  3VG5 A;  1JIW I;  1GM6 A;  2K23 A;  1W6F A;  2X55 A;  1SXX A;  1SRI A;  1JMX A;  4MIS A;  5D47 A;  2RTL A;  3APU A;  4BCS A;  5CE4 A;  1K24 A;  3EW2 A;  5FEN A;  2RTK A;  2IZD B;  2G79 A;  4OS0 A;  1DZK A;  2YG2 A;  3K3L A;  4Z2O A;  3CQR A;  2C4I A;  4QNI A;  3T1D A;  3MBT A;  1CBS A;  5HA0 A;  2W2A A;  1E02 A;  4HFO A;  4GD9 A;  1X71 A;  3ZW2 A;  2IZK A;  3TGB A;  1KGL A;  3FW5 A;  3BLG A;  4GDZ A;  1VWF B;  3T2W A;  2OVD A;  1SWH A;  5IO5 A;  2HZQ A;  3WZQ A;  3H3I A;  3VU1 A;  1SWS A;  4DQ3 A;  5HZ5 A;  2ASN X;  2BLG A;  2ZAI A;  3P02 A;  1Y9L A;  5K68 A;  4NLJ A;  1YUP A;  2GTL N;  4Z6J A;  3TGC A;  3BX7 A;  3FYF A;  4GE1 A;  2A13 A;  4BOE A;  1MEP A;  3B2I A;  2RTI B;  3OD9 A;  1LIB A;  4GKC A;  3RZY A;  1NC9 A;  4M6S A;  2RTD B;  2VDF A;  4PSQ A;  1E5P A;  1Y0G A; 
#chains in the Genus database with same CATH homology
 1KL5 A;  3SZI A;  5L3Y A;  1SRG A;  2RTE B;  5IRU A;  4GDA A;  2OFA A;  4BX7 A;  1VWN B;  1Y55 X;  2RTR B;  1SWC A;  1N9M A;  2C1S A;  4GGR A;  4YVB A;  1VWD B;  4DNE A;  1MOY A;  1SWE A;  1Y52 X;  2RTJ A;  1Y53 X;  2IZL B;  2ZSC A;  3RY1 A;  1KL4 A;  4CPH B;  1MM9 A;  3RDQ A;  3EW1 A;  3VHM A;  3RE5 A;  2Y3E A;  5CHK A;  2IZE B;  1SWF A;  1RXJ A;  4GJV A;  1LDO A;  1DF8 A;  4BBO A;  3RDM A;  4BX5 B;  2RTF B;  1I9H A;  2RTM A;  1SWT A;  5IRW A;  1VWP B;  2WPU A;  3PK2 A;  1NDJ A;  1SWA A;  1HXL A;  1IJ8 A;  3WZN A;  4BX6 B;  1SLG B;  2OFB A;  4CPF A;  1SRE A;  2OF9 A;  2RTC B;  2RTN B;  4BJ8 A;  2IZJ A;  1KL3 A;  1HXZ A;  2RTP B;  1RSU B;  3RDS A;  1LCV A;  1LUQ A;  4GJS A;  3RDO A;  3VHH A;  2JGS A;  1N4J A;  1RST B;  1VWH B;  2Y32 A;  3FDC A;  4Z28 A;  4BX5 A;  4Z27 A;  1RXH A;  1VYO A;  2C1Q A;  2CAM A;  2MF6 A;  4GGZ A;  3WYQ A;  4BX6 A;  3X00 A;  1SWL A;  1VWB B;  5F2B A;  5B5F A;  1SWK A;  1HQQ A;  1VWO B;  1LCW A;  1VWR B;  2OF8 A;  3T2X A;  1AVD A;  1SWP A;  4CPE A;  1LCZ A;  4OKA A;  2A5C A;  1VWI B;  1SWD A;  3SZH A;  1SRF A;  1STP A;  3RE6 A;  1SRH A;  2IZF B;  2IZA A;  3RY2 A;  4EKV A;  3RDX A;  3SZJ A;  1SWQ A;  2F01 A;  3WZO A;  2QCB A;  1RXK A;  5B5G A;  2RTB B;  5JD2 A;  5K67 A;  2BC3 A;  2IZG B;  2GH7 A;  1LEL A;  4CPH A;  2FHL A;  2RTG B;  1SRJ A;  1SLF B;  1SLD B;  2IZH B;  2A5B A;  1LDQ A;  1VWQ B;  1VWM B;  4GGT A;  3RDU A;  2RTQ B;  3WZP A;  1STS B;  4U46 A;  4CPI A;  1SLE B;  2RTA A;  1HY2 A;  1KFF A;  1MK5 A;  1SWB A;  2RTH B;  3MM0 A;  2FHN X;  2UZ2 A;  4Y5D A;  1SWR A;  1PTS A;  2UYW A;  3MG5 A;  3VHI A;  1SWO A;  2IZC B;  2RTO B;  4JNJ A;  4Y59 A;  1RAV A;  1NQN A;  2IZB A;  4Z2P A;  3T6L A;  4JO6 A;  5IRA A;  1SRI A;  1N7Y A;  1SWU A;  1SWJ A;  2RTL A;  4BCS A;  3EW2 A;  1SWN A;  1VWC B;  2IZD B;  2RTK A;  1NQM A;  4Z2O A;  2C4I A;  4GD9 A;  1N9Y A;  2IZK A;  2IZI A;  1VWA B;  4JHQ A;  4IRW A;  1VWE B;  4I60 A;  1VWF B;  2G5L A;  3T2W A;  1AVE A;  1N43 A;  1SWH A;  3WZQ A;  1SWS A;  5CSE A;  4BX7 B;  3T6F A;  5K68 A;  3WYP A;  2A8G A;  1STR B;  4Z6J A;  1NBX A;  1MEP A;  3VGW A;  1VWG B;  2RTI B;  1VWL B;  1VWJ B;  1NC9 A;  1VWK B;  1WBI A;  2RTD B;  2Y3F A;  1SWG A;  4Z2V A;  2AVI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...