4BX6B

Trans-divalent streptavidin
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
119
structure length
119
Chain Sequence
b'GITGTWYNQLGSTFIVTAGADGALTGTYESAVGNAESRYVLTGRYDSAPATDGSGTALGWTVAWKNNYRNAHSATTWSGQYVGGAEARINTQWLLTSGTTEANAWKSTLVGHDTFTKVK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords STREPTAVIDIN
publication title Plug-and-Play Pairing Via Defined Divalent Streptavidins.
pubmed doi rcsb
source organism Streptomyces avidinii
molecule tags Biotin-binding protein
total genus 27
structure length 119
sequence length 119
chains with identical sequence C
ec nomenclature
pdb deposition date 2013-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01382 Avidin Avidin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.30 Mainly Beta Beta Barrel Lipocalin Avidin-like 4bx6B00
1LCZA 1I9HA 4GD9A 2RTNB 5B5GA 4I60A 1VWPB 1SWTA 3WZQA 3EW2A 1VWIB 3SZHA 1STPA 1VWLB 2IZFB 2Y3EA 2OFAA 2UYWA 4EKVA 4Z2OA 4CPEA 1VWFB 1VWMB 1VWKB 2WPUA 2FHLA 1WBIA 3WYPA 3RY2A 1NC9A 1AVEA 4BX7A 3WZNA 4CPFA 4Z28A 2IZAA 3WYQA 3SZJA 5B5FA 1SWGA 1N4JA 1SWKA 1SRJA 1Y53X 2ZSCA 1SRGA 1SWQA 3X00A 4GJSA 2IZGB 1VWCB 4Y59A 2RTOB 5JD2A 2OF8A 4JO6A 2RTKA 2OFBA 1NBXA 3WZOA 1VWJB 1PTSA 1KL5A 1SWAA 3RDSA 1HY2A 2RTGB 1Y55X 2RTIB 2QCBA 4JHQA 3VGWA 2RTDB 1SWRA 1NQMA 2UZ2A 1NQNA 1VWNB 1KL3A 1SRFA 1VWEB 2RTCB 2G5LA 2IZIA 1RXJA 1SWPA 2F01A 1STRB 2RTAA 2IZBA 2RTEB 2RTMA 3T2XA 4CPHB 1VWRB 5CSEA 1RSTB 5K68A 5L3YA 1HXZA 4CPIA 1LCWA 1SWLA 4JNJA 2OF9A 1NDJA 1KFFA 4U46A 1N9MA 2FHNX 1AVDA 1SLDB 2IZCB 1RSUB 1SWUA 5IRWA 1VWBB 2Y32A 5CHKA 5F2BA 2Y3FA 2BC3A 1HQQA 5IRUA 1MEPA 1SWBA 2IZDB 3VHIA 1SRIA 1N7YA 3EW1A 2RTRB 2C4IA 1VWAB 3WZPA 1LCVA 1LUQA 1MOYA 1LDQA 4BCSA 4BX6B 3RY1A 4GDAA 2RTJA 2RTQB 3VHMA 2IZEB 2A8GA 1RXHA 2CAMA 1MM9A 2C1SA 1SWEA 1RAVA 1HXLA 4Z6JA 2RTFB 1SWDA 3MM0A 1VWHB 3RDOA 3MG5A 1VWDB 1KL4A 1SREA 4Y5DA 4GGZA 3RDXA 3T6FA 1Y52X 2RTLA 3RE6A 2AVIA 1DF8A 5IRAA 3RDMA 1SWOA 1SWCA 2A5BA 4GJVA 5K67A 2RTHB 4BX5B 1STSB 4GGRA 4Z27A 3PK2A 1MK5A 1VWGB 2RTBB 2IZLB 1SWFA 3T2WA 4Z2PA 1VWOB 3VHHA 4DNEA 1RXKA 1SLFB 1SWSA 4BX6A 2RTPB 1SRHA 2A5CA 1N9YA 1LELA 4OKAA 4BBOA 4BJ8A 4Z2VA 1VWQB 1SWHA 2IZKA 3RDUA 4BX7B 3T6LA 2MF6A 4YVBA 4CPHA 1SLGB 1IJ8A 1SWNA 2IZHB 2JGSA 4GGTA 2C1QA 1VYOA 2IZJA 3RE5A 4IRWA 3RDQA 1N43A 1LDOA 2GH7A 3SZIA 1SWJA 1SLEB 3FDCA 4BX5A
chains in the Genus database with same CATH superfamily
1LCZA 1O1VA 1W6FA 4XMEA 2HNXA 1QWDA 2FWVA 1X8NA 1KT4A 1FELA 2FT9A 2GC9A 3TGCA 3GE2A 1FJ1E 1VWIB 4NV8A 3PQSA 1JZUA 1A3YA 4EKVA 3NP1A 4OELA 4CPEA 2FHLA 4OMWA 2DM5A 3WYPA 2CZUA 3JS1A 1AVEA 4QZTA 3WZNA 1X8UA 3BS2A 3CMPA 4Y0RA 4CPFA 1LIFA 4GRJA 3SZJA 5L8IA 3I0AA 4NLIA 1N4JA 1Y53X 3UEVA 3VG3A 5LJCA 3ZWEA 1A18A 1YP6A 4O9SA 2F73A 2IZGB 3N91A 1CBQA 2JW1A 2RTOB 4M7MA 1GKAB 1EI5A 1K3BA 3ZI8A 3HOLA 1T68X 4ES7A 3WZOA 1VWJB 3CKFA 2AT0X 3V8UA 2JOZA 3BSZE 2LBVA 3TZSA 3ZW0A 1HY2A 2RTGB 1GT3A 1Y55X 2ANSA 2OY8A 5HCEC 3WVMA 1KT3A 1UZ2X 2XSTA 3NADA 1YIVA 4ALBA 1VWEB 1YWDA 2HZQA 1R0UA 2G5LA 3FA9A 1RXJA 1CJ5A 4IAWA 1SY1A 3SAOA 4HPCA 2I5ZO 4JGLA 3PQUA 4KT5A 1VYGA 4I95A 2MM3A 1JBHA 4CDEA 1D3SA 1HXZA 1OBUA 2Z4HA 2FTBA 4JNJA 2MJIA 4FGIB 2QOMA 4O3WA 1SY3A 2HYSA 2KD2A 2MO5A 4ZH9A 4AW8A 1DFVA 3ZUIA 4CDDA 1GXAA 1SLDB 2QO4A 1EALA 1EPBA 1OBPA 4IB6A 1YUPA 5FQ6E 2CBRA 1FDQA 5F2BA 2MWHA 3TGAA 1TXLA 1HQQA 2AT8X 1SWBA 3VPJE 3G7XA 3EW1A 1N7YA 2X46A 1I4UA 1ZRYA 1LUQA 2BS5A 4RUUA 5B2AO 2A0AA 1ERXA 1QY0A 3B2KA 3FA7A 4KC7A 4L1NA 1RBPA 1FTPA 4QAEA 4BCSA 3HWGA 1MUPA 3SOTA 1GX8A 2AL0X 2ZAIA 1EUOA 4GNWA 2IZEB 3LHNA 2A8GA 3RKGA 1RXHA 4IABA 2HZRA 1OBQA 1I78A 2L5PA 1G74A 2OVDA 3EBWA 4OS3A 5KICA 4YH0A 4MVEA 3AKMA 3ZW2A 3BRNA 1DC9A 3MM0A 3WOVA 1I04A 3MG5A 1HBQA 2FRSA 2I5VO 4WFVA 3RDXA 2W2BA 1JQPA 1Y52X 1CRBA 2AVIA 5EEEA 5BVQA 2X8SA 1SWOA 1YWBA 1IW2A 3NQ3A 5IO5A 1UYOX 4GZVA 3PK2A 1MK5A 1GX9A 1VWGB 2A3FX 3MX7A 3VG5A 2IZLB 3T2WA 3AEHA 1VWOB 2AT6X 4DNEA 5B29A 2RCQA 3UEXA 4WBKA 1QY2A 2WSJA 4I3CA 4I3DA 1JYDA 1DZMA 2CBSA 2OVSA 3VE1A 4I6SA 2NNDA 4PJ2A 1FENA 4N7DA 5F58A 4BX5A 1VWQB 3Q6LA 4OMXA 2IZKA 3RDUA 4QZUA 2PY1A 5IO7A 4I9SA 1KOIA 1PEEA 5L8OA 4O4SA 3VG6A 2G79A 2KTSA 3BX8A 1VYOA 4ORUA 4YFPA 3PH5A 5HA0A 1U0XA 1PMPA 2AT3X 1JJJA 5HZ8A 4AZMA 4ZGUA 1Y0GA 3WBGA 1ACDA 3H3IA 5IRWA 2Q39A 1U17A 1G5WA 5LJHA 1I9HA 2ACOA 2L68A 4ZR2A 1D2UA 3P6FA 3U03A 4QGWA 5JR8A 1AVGI 5CYBA 3L4RA 3BU9A 2FS6A 3BY0A 5CE4A 4MIRA 2X32A 4BQUA 2KT4B 2QO5A 1T8VA 3BDRA 1PM1X 4Y0QA 4Z2OA 1K24A 2WPUA 1VWMB 2X56A 4ZFXA 3BLGA 1BLRA 2RQ0A 1OPAA 1OPBA 1EIOA 1YP7A 4QRLA 3P24A 3CQNA 5B5FA 1KT7A 3NPOA 3NR3A 3FR2A 2OFRX 1SRJA 4BGFA 1EIIA 2EU7X 3CWKA 2BLGA 2PI3O 3I17A 1MX7A 1IKEA 1VWCB 2G78A 3CQRA 3UEUA 4ARHA 3FIQA 4JO6A 4INNA 5JD2A 5BYPA 2BT9A 2OFBA 3BU1A 3HOEA 5LJKA 1E2TA 1UREA 4WHIA 5DG4A 4GNYA 1YWAA 3P6GA 4BVMA 2VFCA 4IB7A 4ZJ0A 4YDAA 1SWAA 5EDCA 5BVTA 4R0BA 1B56A 2RTDB 1SWRA 3DSZA 4YFQA 3ELZA 3HK1A 1SY0A 4B55A 1U18A 1SRFA 2QM9A 2IZIA 4XMDA 2RTAA 5L8NA 1NP1A 2CM9A 5B27A 4U9CA 4C5PA 4MEEA 2KW1A 2RTMA 4CPHB 3C78X 1VWRB 4Y0SA 1RSTB 1SY2A 4CDCA 3S5VA 4YDBA 4CPIA 2HMBA 5HZ5A 4IMOA 4YBUA 1ZNDA 1KFFA 4YGHA 4M6SA 4U46A 2FHNX 2IZCB 2K23A 4HWMA 1RSUB 2RA6A 3DTQA 3OE3A 2OZQA 4O3YA 1SXXA 1DF3A 2Y3FA 3PPTA 5IRUA 4AZPA 3VHIA 2JU8A 1LKEA 1JYJA 4GDZA 2RTRB 4D6BA 2FS7A 5B11O 3MBTA 3FELA 1LFOA 1MOYA 3WJDA 3ZUOA 1T0VA 1VYFA 4BX6B 1W4TA 5D45A 1ZNHA 1HMSA 1P6PA 4GDAA 2FKGA 3FENA 4ML7B 4ORSA 4QNIA 4OEMA 2KTDA 3VHMA 1KXOA 3NX1A 4GU8A 1B4MA 2ASNX 2ZAGA 3NBXX 2C1SA 5C0NA 3U9PC 2DJFA 3ELXA 2X8FA 5D47A 1MVGA 1DZKA 3RDOA 2X34A 1CBIA 5F1EA 3UEWA 1O1UA 1SREA 2BHVA 2WWPA 3APXA 4FBVA 4GGZA 4KIIA 1MX8A 4U3QA 3T6FA 5HBSA 2RTLA 1G7NA 1BRPA 4U8UM 1EQDA 1DF8A 5IRAA 3C76X 5FQ8E 3WJEA 1JJXA 1EXSA 1GKAA 4GJVA 5K67A 2LKKA 1X8OA 2RTHB 4GGRA 4Z27A 2BS6A 4L3RA 1SWFA 3VHHA 3KFHA 1RXKA 1DZJA 4BX6A 3D9WA 3D96A 2A5CA 3AKNA 4TQ2A 4NYRA 4D6AA 2POAA 3F8AA 2ACPX 3ZW1B 3NQKA 2G8CO 4NNSA 1ICMA 4XMFA 1SXWA 4Z2VA 1A2DA 3P6CA 2XKLA 1I06A 2QMIA 3T6LA 1LIDA 2YG2A 5EEDA 4YVBA 5HZ9A 1BBPA 4Y0PA 2WEXA 2JGSA 4I9RA 2AT5X 5KHPA 1QQSA 4U8UN 1AELA 2IZJA 4IRWA 4TLJA 5LJBA 1LDOA 1SWJA 2JMBA 1ERBA 2JU7A 3FDCA 1HQPA 3D95A 5K06A 2A13A 4GD9A 1TVQA 1SWTA 4HPBA 1ALBA 5AQ6A 3WZQA 4NV7A 5F6ZA 2NP1A 1FE3A 1VWLB 2IZFB 2Y3EA 2OFAA 2UYWA 3P6EA 4LKTA 4ALOA 4YFRA 3ZW1A 4IMNA 1VWKB 5HAEA 2FR3A 2OY7A 1WBIA 1VPRA 2R56A 5LJEA 4O4UA 3RY2A 1NC9A 4CV7A 3ZZVA 4A1HA 1HBPA 1QFTA 4Z28A 2IZAA 1QABE 1SWGA 1SWKA 1KZXA 5FENA 2ZSCA 4IBAA 1BSOA 1UYNX 1SRGA 2K62A 4QYNA 4GJSA 4ZH6A 3X00A 1KGLA 4EXZA 3B2HA 3TGBA 4GKCA 2OF8A 4GUZA 3APVA 4ON1A 4LQZA 3RSWA 3FLLA 1DV9A 4NW4A 1OEKA 3PP6A 1BEBA 5EPQA 1PTSA 1GGLA 2JN3A 1AB0A 4A60A 3KFIA 4AYHA 1KL5A 3NQ9A 1KZWA 4YCEA 2RTIB 2OVAA 2M4LA 1XCAA 2QCBA 3D97A 4KC8A 3T1DA 2Z4IA 3OD9A 2UZ2A 4AZRA 2WUTA 1NQNA 4NP1A 3VE2A 4XMCA 1KL3A 4DQ4A 1SWPA 2AF5A 3FEPA 3PDFA 2OFMX 2IZBA 4IB9A 4ZHDA 3JQOA 3KFGA 5LJDA 3T2XA 3WXQA 1S2PA 2DJGA 1QFVA 3NX2A 5CSEA 5K68A 5HCDC 1IKJA 5H8TA 4UU2A 3AUMO 3WJGA 1LCWA 2GTFX 5L3YA 3LV4A 2JU3A 3HWEA 1NDJA 1N9MA 3EBKA 3LTWA 2AMMX 1AVDA 5FFHA 2VDFA 3VU1A 3HTYA 1SWUA 3E3CA 4YBPA 5HTDA 5CHKA 2Y32A 3VG4A 5LKFA 3JSQA 2IZDB 4HPDA 3VG7A 2RCTA 1ZNEA 4HPAA 1LICA 1VWAB 3WZPA 3VGWA 2W2FA 1LPJA 4CDFA 3RY1A 4KCAA 2Q9SA 1KQWA 2RTQB 4MVKA 3KVNA 4KH8A 1ADLA 2P8GA 4WFUA 2CAMA 2LFOA 4NLJA 1HN2A 1MM9A 4EFGA 4EDEA 3FR4A 5B10O 1E00A 1ML7A 1G85A 1HMTA 3ZQ3A 4Z6JA 3CR6A 1VWHB 1BSYA 1VWDB 5LKEA 1ZNKA 3O22A 3FYFA 4YKMA 1KT6A 4ORXA 5HZ6A 4ZCBA 1SWCA 3FW5A 1E06A 1JMZA 4XMGA 2A2UA 3IFBA 1EPAA 1KQXA 1STSB 5AJCA 5DPQA 4ZHGA 3ZW0B 1CBRA 1TOUA 3SLOA 3KQ0A 3FA6A 1SRHA 4RUNA 4GH7A 1LF7A 4TKBA 2OL7A 1X71A 2WEWA 4K19A 5H9LA 4EEJA 3CBSA 2O62A 4BBOA 4A8ZA 1KT5A 4GK9A 3VG2A 4ZGFA 1H91A 1B8EA 3PH6A 1IFBA 1XKIA 3QQ2A 4HFOA 3O19A 4ODDA 4BX7B 3B2JA 1DZPA 4ORWA 5BVSA 4CPHA 1IJ8A 1GM6A 1RLBE 2N93A 2IZHB 2LB6A 3B2LA 4GGTA 4QGXA 2C1QA 2X45A 3FEKA 4ZHHA 2GJ5A 4ORYA 4QYPA 3RE5A 3TF6A 2NNEA 5KIDA 4GETA 1MDCA 4ORRA 1A57A 4O49A 3CBCA 2OY5O 2GTLM 2OVEA 3STMX 2AH7X 1BWYA 3D4RA 3HPEA 3EC5A 4TNNA 1JIWI 4EQAC 3HWDA 3O2YA 2LBAA 2RTNB 1ZNGA 5B5GA 2R74A 4I60A 4QQ1A 1VWPB 5D8JA 1GT4A 4CSBA 2RD7C 3EW2A 5FAZA 5H9NA 3SZHA 1STPA 3Q34A 5HWZA 1FEMA 1JMXA 1L6MA 1OEJA 2OY1O 3F6ZB 1VWFB 1JJUA 2X4MA 4PSQA 5EDBA 4LKPA 3OJYC 2OL8O 2FR2A 3FW4A 1S44A 5B3MO 4COTA 1Y9TA 4BX7A 4DCBA 2X55A 1PBYA 3IA8A 1IIUA 3C77X 4OS0A 1X8QA 3WYQA 3P02A 4ZHFA 4TKJA 1BSQA 1SWQA 1Z24A 3PECA 2GTLN 4FQBB 4Y59A 1Y9LA 3BX7A 2L67A 2RTKA 2VFBA 4GE1A 5D4AA 2YMSA 3SLTA 2NNQA 2HLVA 3EM0A 1NBXA 5AJBA 4AZOA 2E4JA 5H9AA 3STKA 5AEOA 3F9DA 3MVFA 3RDSA 2OL6O 4JHQA 1TW4A 5IO6A 3APUA 1NQMA 5HZQA 1BM5A 3S26A 1SXUA 1VWNB 2RTCB 1CBSA 1LNMA 1GT5A 4TKHA 2F01A 1STRB 4LZVA 3RBYA 2F09A 2X8TA 5LJGA 4MVLA 2RTEB 5HTEA 2QOSC 1WUBA 2R73A 4U8UO 4BOEA 4NNTA 2GTLO 3EYCA 3P6DA 3WJCA 1SWLA 3STNA 3WJFA 2OF9A 1OEEA 3EMMA 2OYBO 4DQ3A 1IFCA 2HKDA 4O4OA 4QGVA 1LIBA 2Q2PA 1X8PA 1N0SA 4OS8A 1HMRA 1VWBB 4ZHCA 2BC3A 4I3BA 1MEPA 2LA7A 2WQ9A 4FBOA 2WQAE 1SRIA 3S5XA 2FLJA 2C4IA 1OSPO 4FBRA 1LCVA 3FR5A 1LDQA 1E5PA 4IAXA 1QY1A 2CZTA 1AQBA 3KFFA 1GT1A 2W2AA 2G7BA 2MHDA 4YKOA 2WR6A 2Q2MA 2RTJA 4IB8A 3WJBA 4YCHA 4N7CA 1BJ7A 1SXYA 5F6BA 3B2IA 1SWEA 3K3LA 5H9KA 4YGGA 1RAVA 1HXLA 2ALLX 5HCCC 3FA8A 2RTFB 1SWDA 4YGZA 1GX3A 1SMPI 2FKJA 4AZQA 1KL4A 4O3ZA 4ID2A 4Y5DA 4MVIA 1SA8A 2A2GA 3KZAA 1X89A 3RE6A 1YWCA 2FGSA 3P6HA 3HWFA 3RWXA 1B0OA 3RDMA 2A5BA 4UU3A 1JV4A 1O8VA 4BX5B 3PEDA 4YMYA 3U0DA 2RTBB 4Z2PA 3OBLA 5D48A 1I05A 2BSZA 1EW3A 1SLFB 2L9CA 1SWSA 2RN4A 4O3XB 2RTPB 5HA1A 3UAQA 1N9YA 1LELA 1W5RA 4OKAA 5FQ7E 2AKQA 2CM4A 1ICNA 1NGLA 4BJ8A 1SWHA 3S60A 2Q4NA 1NP4A 1BRQA 4CK4A 2MF6A 4NYQA 4O4XA 1S7DA 1TOWA 1SLGB 3FIDA 1SWNA 1ZNLA 4XMHA 3RZYA 3GAQA 1PBOA 3SLJA 1LIEA 4LZUA 3QKGA 2IFBA 5EZ2A 5IXGA 3RDQA 1N43A 3FMZA 4TJZA 3APWA 1QG5A 2GH7A 3SZIA 4A1YA 1E02A 4AZNA 1SLEB 5F7GA 2QO6A 3CKGA 4MISA
chains in the Genus database with same CATH topology
1LCZA 1I9HA 4GD9A 2RTNB 5B5GA 4I60A 1VWPB 1SWTA 3WZQA 3EW2A 1VWIB 3SZHA 1STPA 1VWLB 2IZFB 2Y3EA 2OFAA 2UYWA 4EKVA 4Z2OA 4CPEA 1VWFB 1VWMB 1VWKB 2WPUA 2FHLA 1WBIA 3WYPA 3RY2A 1NC9A 1AVEA 4BX7A 3WZNA 4CPFA 4Z28A 2IZAA 3WYQA 3SZJA 5B5FA 1SWGA 1N4JA 1SWKA 1SRJA 1Y53X 2ZSCA 1SRGA 1SWQA 3X00A 4GJSA 2IZGB 1VWCB 4Y59A 2RTOB 5JD2A 2OF8A 4JO6A 2RTKA 2OFBA 1NBXA 3WZOA 1VWJB 1PTSA 1KL5A 1SWAA 3RDSA 1HY2A 2RTGB 1Y55X 2RTIB 2QCBA 4JHQA 3VGWA 2RTDB 1SWRA 1NQMA 2UZ2A 1NQNA 1VWNB 1KL3A 1SRFA 1VWEB 2RTCB 2G5LA 2IZIA 1RXJA 1SWPA 2F01A 1STRB 2RTAA 2IZBA 2RTEB 2RTMA 3T2XA 4CPHB 1VWRB 5CSEA 1RSTB 5K68A 5L3YA 1HXZA 4CPIA 1LCWA 1SWLA 4JNJA 2OF9A 1NDJA 1KFFA 4U46A 1N9MA 2FHNX 1AVDA 1SLDB 2IZCB 1RSUB 1SWUA 5IRWA 1VWBB 2Y32A 5CHKA 5F2BA 2Y3FA 2BC3A 1HQQA 5IRUA 1MEPA 1SWBA 2IZDB 3VHIA 1SRIA 1N7YA 3EW1A 2RTRB 2C4IA 1VWAB 3WZPA 1LCVA 1LUQA 1MOYA 1LDQA 4BCSA 4BX6B 3RY1A 4GDAA 2RTJA 2RTQB 3VHMA 2IZEB 2A8GA 1RXHA 2CAMA 1MM9A 2C1SA 1SWEA 1RAVA 1HXLA 4Z6JA 2RTFB 1SWDA 3MM0A 1VWHB 3RDOA 3MG5A 1VWDB 1KL4A 1SREA 4Y5DA 4GGZA 3RDXA 3T6FA 1Y52X 2RTLA 3RE6A 2AVIA 1DF8A 5IRAA 3RDMA 1SWOA 1SWCA 2A5BA 4GJVA 5K67A 2RTHB 4BX5B 1STSB 4GGRA 4Z27A 3PK2A 1MK5A 1VWGB 2RTBB 2IZLB 1SWFA 3T2WA 4Z2PA 1VWOB 3VHHA 4DNEA 1RXKA 1SLFB 1SWSA 4BX6A 2RTPB 1SRHA 2A5CA 1N9YA 1LELA 4OKAA 4BBOA 4BJ8A 4Z2VA 1VWQB 1SWHA 2IZKA 3RDUA 4BX7B 3T6LA 2MF6A 4YVBA 4CPHA 1SLGB 1IJ8A 1SWNA 2IZHB 2JGSA 4GGTA 2C1QA 1VYOA 2IZJA 3RE5A 4IRWA 3RDQA 1N43A 1LDOA 2GH7A 3SZIA 1SWJA 1SLEB 3FDCA 4BX5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LCZ A;  1I9H A;  4GD9 A;  2RTN B;  5B5G A;  4I60 A;  1VWP B;  1SWT A;  3WZQ A;  3EW2 A;  1VWI B;  3SZH A;  1STP A;  1VWL B;  2IZF B;  2Y3E A;  2OFA A;  2UYW A;  4EKV A;  4Z2O A;  4CPE A;  1VWF B;  1VWM B;  1VWK B;  2WPU A;  2FHL A;  1WBI A;  3WYP A;  3RY2 A;  1NC9 A;  1AVE A;  4BX7 A;  3WZN A;  4CPF A;  4Z28 A;  2IZA A;  3WYQ A;  3SZJ A;  5B5F A;  1SWG A;  1N4J A;  1SWK A;  1SRJ A;  1Y53 X;  2ZSC A;  1SRG A;  1SWQ A;  3X00 A;  4GJS A;  2IZG B;  1VWC B;  4Y59 A;  2RTO B;  5JD2 A;  2OF8 A;  4JO6 A;  2RTK A;  2OFB A;  1NBX A;  3WZO A;  1VWJ B;  1PTS A;  1KL5 A;  1SWA A;  3RDS A;  1HY2 A;  2RTG B;  1Y55 X;  2RTI B;  2QCB A;  4JHQ A;  3VGW A;  2RTD B;  1SWR A;  1NQM A;  2UZ2 A;  1NQN A;  1VWN B;  1KL3 A;  1SRF A;  1VWE B;  2RTC B;  2G5L A;  2IZI A;  1RXJ A;  1SWP A;  2F01 A;  1STR B;  2RTA A;  2IZB A;  2RTE B;  2RTM A;  3T2X A;  4CPH B;  1VWR B;  5CSE A;  1RST B;  5K68 A;  5L3Y A;  1HXZ A;  4CPI A;  1LCW A;  1SWL A;  4JNJ A;  2OF9 A;  1NDJ A;  1KFF A;  4U46 A;  1N9M A;  2FHN X;  1AVD A;  1SLD B;  2IZC B;  1RSU B;  1SWU A;  5IRW A;  1VWB B;  2Y32 A;  5CHK A;  5F2B A;  2Y3F A;  2BC3 A;  1HQQ A;  5IRU A;  1MEP A;  1SWB A;  2IZD B;  3VHI A;  1SRI A;  1N7Y A;  3EW1 A;  2RTR B;  2C4I A;  1VWA B;  3WZP A;  1LCV A;  1LUQ A;  1MOY A;  1LDQ A;  4BCS A;  4BX6 B;  3RY1 A;  4GDA A;  2RTJ A;  2RTQ B;  3VHM A;  2IZE B;  2A8G A;  1RXH A;  2CAM A;  1MM9 A;  2C1S A;  1SWE A;  1RAV A;  1HXL A;  4Z6J A;  2RTF B;  1SWD A;  3MM0 A;  1VWH B;  3RDO A;  3MG5 A;  1VWD B;  1KL4 A;  1SRE A;  4Y5D A;  4GGZ A;  3RDX A;  3T6F A;  1Y52 X;  2RTL A;  3RE6 A;  2AVI A;  1DF8 A;  5IRA A;  3RDM A;  1SWO A;  1SWC A;  2A5B A;  4GJV A;  5K67 A;  2RTH B;  4BX5 B;  1STS B;  4GGR A;  4Z27 A;  3PK2 A;  1MK5 A;  1VWG B;  2RTB B;  2IZL B;  1SWF A;  3T2W A;  4Z2P A;  1VWO B;  3VHH A;  4DNE A;  1RXK A;  1SLF B;  1SWS A;  4BX6 A;  2RTP B;  1SRH A;  2A5C A;  1N9Y A;  1LEL A;  4OKA A;  4BBO A;  4BJ8 A;  4Z2V A;  1VWQ B;  1SWH A;  2IZK A;  3RDU A;  4BX7 B;  3T6L A;  2MF6 A;  4YVB A;  4CPH A;  1SLG B;  1IJ8 A;  1SWN A;  2IZH B;  2JGS A;  4GGT A;  2C1Q A;  1VYO A;  2IZJ A;  3RE5 A;  4IRW A;  3RDQ A;  1N43 A;  1LDO A;  2GH7 A;  3SZI A;  1SWJ A;  1SLE B;  3FDC A;  4BX5 A; 
#chains in the Genus database with same CATH topology
 1LCZ A;  1O1V A;  1W6F A;  4XME A;  2HNX A;  1QWD A;  2FWV A;  1X8N A;  1KT4 A;  1FEL A;  2FT9 A;  2GC9 A;  3TGC A;  3GE2 A;  1FJ1 E;  1VWI B;  4NV8 A;  3PQS A;  1JZU A;  1A3Y A;  4EKV A;  3NP1 A;  4OEL A;  4CPE A;  2FHL A;  4OMW A;  2DM5 A;  3WYP A;  2CZU A;  3JS1 A;  1AVE A;  4QZT A;  3WZN A;  1X8U A;  3BS2 A;  3CMP A;  4Y0R A;  4CPF A;  1LIF A;  4GRJ A;  3SZJ A;  5L8I A;  3I0A A;  4NLI A;  1N4J A;  1Y53 X;  3UEV A;  3VG3 A;  5LJC A;  3ZWE A;  1A18 A;  1YP6 A;  4O9S A;  2F73 A;  2IZG B;  3N91 A;  1CBQ A;  2JW1 A;  2RTO B;  4M7M A;  1GKA B;  1EI5 A;  1K3B A;  3ZI8 A;  3HOL A;  1T68 X;  4ES7 A;  3WZO A;  1VWJ B;  3CKF A;  2AT0 X;  3V8U A;  2JOZ A;  3BSZ E;  2LBV A;  3TZS A;  3ZW0 A;  1HY2 A;  2RTG B;  1GT3 A;  1Y55 X;  2ANS A;  2OY8 A;  5HCE C;  3WVM A;  1KT3 A;  1UZ2 X;  2XST A;  3NAD A;  1YIV A;  4ALB A;  1VWE B;  1YWD A;  2HZQ A;  1R0U A;  2G5L A;  3FA9 A;  1RXJ A;  1CJ5 A;  4IAW A;  1SY1 A;  3SAO A;  4HPC A;  2I5Z O;  4JGL A;  3PQU A;  4KT5 A;  1VYG A;  4I95 A;  2MM3 A;  1JBH A;  4CDE A;  1D3S A;  1HXZ A;  1OBU A;  2Z4H A;  2FTB A;  4JNJ A;  2MJI A;  4FGI B;  2QOM A;  4O3W A;  1SY3 A;  2HYS A;  2KD2 A;  2MO5 A;  4ZH9 A;  4AW8 A;  1DFV A;  3ZUI A;  4CDD A;  1GXA A;  1SLD B;  2QO4 A;  1EAL A;  1EPB A;  1OBP A;  4IB6 A;  1YUP A;  5FQ6 E;  2CBR A;  1FDQ A;  5F2B A;  2MWH A;  3TGA A;  1TXL A;  1HQQ A;  2AT8 X;  1SWB A;  3VPJ E;  3G7X A;  3EW1 A;  1N7Y A;  2X46 A;  1I4U A;  1ZRY A;  1LUQ A;  2BS5 A;  4RUU A;  5B2A O;  2A0A A;  1ERX A;  1QY0 A;  3B2K A;  3FA7 A;  4KC7 A;  4L1N A;  1RBP A;  1FTP A;  4QAE A;  4BCS A;  3HWG A;  1MUP A;  3SOT A;  1GX8 A;  2AL0 X;  2ZAI A;  1EUO A;  4GNW A;  2IZE B;  3LHN A;  2A8G A;  3RKG A;  1RXH A;  4IAB A;  2HZR A;  1OBQ A;  1I78 A;  2L5P A;  1G74 A;  2OVD A;  3EBW A;  4OS3 A;  5KIC A;  4YH0 A;  4MVE A;  3AKM A;  3ZW2 A;  3BRN A;  1DC9 A;  3MM0 A;  3WOV A;  1I04 A;  3MG5 A;  1HBQ A;  2FRS A;  2I5V O;  4WFV A;  3RDX A;  2W2B A;  1JQP A;  1Y52 X;  1CRB A;  2AVI A;  5EEE A;  5BVQ A;  2X8S A;  1SWO A;  1YWB A;  1IW2 A;  3NQ3 A;  5IO5 A;  1UYO X;  4GZV A;  3PK2 A;  1MK5 A;  1GX9 A;  1VWG B;  2A3F X;  3MX7 A;  3VG5 A;  2IZL B;  3T2W A;  3AEH A;  1VWO B;  2AT6 X;  4DNE A;  5B29 A;  2RCQ A;  3UEX A;  4WBK A;  1QY2 A;  2WSJ A;  4I3C A;  4I3D A;  1JYD A;  1DZM A;  2CBS A;  2OVS A;  3VE1 A;  4I6S A;  2NND A;  4PJ2 A;  1FEN A;  4N7D A;  5F58 A;  4BX5 A;  1VWQ B;  3Q6L A;  4OMX A;  2IZK A;  3RDU A;  4QZU A;  2PY1 A;  5IO7 A;  4I9S A;  1KOI A;  1PEE A;  5L8O A;  4O4S A;  3VG6 A;  2G79 A;  2KTS A;  3BX8 A;  1VYO A;  4ORU A;  4YFP A;  3PH5 A;  5HA0 A;  1U0X A;  1PMP A;  2AT3 X;  1JJJ A;  5HZ8 A;  4AZM A;  4ZGU A;  1Y0G A;  3WBG A;  1ACD A;  3H3I A;  5IRW A;  2Q39 A;  1U17 A;  1G5W A;  5LJH A;  1I9H A;  2ACO A;  2L68 A;  4ZR2 A;  1D2U A;  3P6F A;  3U03 A;  4QGW A;  5JR8 A;  1AVG I;  5CYB A;  3L4R A;  3BU9 A;  2FS6 A;  3BY0 A;  5CE4 A;  4MIR A;  2X32 A;  4BQU A;  2KT4 B;  2QO5 A;  1T8V A;  3BDR A;  1PM1 X;  4Y0Q A;  4Z2O A;  1K24 A;  2WPU A;  1VWM B;  2X56 A;  4ZFX A;  3BLG A;  1BLR A;  2RQ0 A;  1OPA A;  1OPB A;  1EIO A;  1YP7 A;  4QRL A;  3P24 A;  3CQN A;  5B5F A;  1KT7 A;  3NPO A;  3NR3 A;  3FR2 A;  2OFR X;  1SRJ A;  4BGF A;  1EII A;  2EU7 X;  3CWK A;  2BLG A;  2PI3 O;  3I17 A;  1MX7 A;  1IKE A;  1VWC B;  2G78 A;  3CQR A;  3UEU A;  4ARH A;  3FIQ A;  4JO6 A;  4INN A;  5JD2 A;  5BYP A;  2BT9 A;  2OFB A;  3BU1 A;  3HOE A;  5LJK A;  1E2T A;  1URE A;  4WHI A;  5DG4 A;  4GNY A;  1YWA A;  3P6G A;  4BVM A;  2VFC A;  4IB7 A;  4ZJ0 A;  4YDA A;  1SWA A;  5EDC A;  5BVT A;  4R0B A;  1B56 A;  2RTD B;  1SWR A;  3DSZ A;  4YFQ A;  3ELZ A;  3HK1 A;  1SY0 A;  4B55 A;  1U18 A;  1SRF A;  2QM9 A;  2IZI A;  4XMD A;  2RTA A;  5L8N A;  1NP1 A;  2CM9 A;  5B27 A;  4U9C A;  4C5P A;  4MEE A;  2KW1 A;  2RTM A;  4CPH B;  3C78 X;  1VWR B;  4Y0S A;  1RST B;  1SY2 A;  4CDC A;  3S5V A;  4YDB A;  4CPI A;  2HMB A;  5HZ5 A;  4IMO A;  4YBU A;  1ZND A;  1KFF A;  4YGH A;  4M6S A;  4U46 A;  2FHN X;  2IZC B;  2K23 A;  4HWM A;  1RSU B;  2RA6 A;  3DTQ A;  3OE3 A;  2OZQ A;  4O3Y A;  1SXX A;  1DF3 A;  2Y3F A;  3PPT A;  5IRU A;  4AZP A;  3VHI A;  2JU8 A;  1LKE A;  1JYJ A;  4GDZ A;  2RTR B;  4D6B A;  2FS7 A;  5B11 O;  3MBT A;  3FEL A;  1LFO A;  1MOY A;  3WJD A;  3ZUO A;  1T0V A;  1VYF A;  4BX6 B;  1W4T A;  5D45 A;  1ZNH A;  1HMS A;  1P6P A;  4GDA A;  2FKG A;  3FEN A;  4ML7 B;  4ORS A;  4QNI A;  4OEM A;  2KTD A;  3VHM A;  1KXO A;  3NX1 A;  4GU8 A;  1B4M A;  2ASN X;  2ZAG A;  3NBX X;  2C1S A;  5C0N A;  3U9P C;  2DJF A;  3ELX A;  2X8F A;  5D47 A;  1MVG A;  1DZK A;  3RDO A;  2X34 A;  1CBI A;  5F1E A;  3UEW A;  1O1U A;  1SRE A;  2BHV A;  2WWP A;  3APX A;  4FBV A;  4GGZ A;  4KII A;  1MX8 A;  4U3Q A;  3T6F A;  5HBS A;  2RTL A;  1G7N A;  1BRP A;  4U8U M;  1EQD A;  1DF8 A;  5IRA A;  3C76 X;  5FQ8 E;  3WJE A;  1JJX A;  1EXS A;  1GKA A;  4GJV A;  5K67 A;  2LKK A;  1X8O A;  2RTH B;  4GGR A;  4Z27 A;  2BS6 A;  4L3R A;  1SWF A;  3VHH A;  3KFH A;  1RXK A;  1DZJ A;  4BX6 A;  3D9W A;  3D96 A;  2A5C A;  3AKN A;  4TQ2 A;  4NYR A;  4D6A A;  2POA A;  3F8A A;  2ACP X;  3ZW1 B;  3NQK A;  2G8C O;  4NNS A;  1ICM A;  4XMF A;  1SXW A;  4Z2V A;  1A2D A;  3P6C A;  2XKL A;  1I06 A;  2QMI A;  3T6L A;  1LID A;  2YG2 A;  5EED A;  4YVB A;  5HZ9 A;  1BBP A;  4Y0P A;  2WEX A;  2JGS A;  4I9R A;  2AT5 X;  5KHP A;  1QQS A;  4U8U N;  1AEL A;  2IZJ A;  4IRW A;  4TLJ A;  5LJB A;  1LDO A;  1SWJ A;  2JMB A;  1ERB A;  2JU7 A;  3FDC A;  1HQP A;  3D95 A;  5K06 A;  2A13 A;  4GD9 A;  1TVQ A;  1SWT A;  4HPB A;  1ALB A;  5AQ6 A;  3WZQ A;  4NV7 A;  5F6Z A;  2NP1 A;  1FE3 A;  1VWL B;  2IZF B;  2Y3E A;  2OFA A;  2UYW A;  3P6E A;  4LKT A;  4ALO A;  4YFR A;  3ZW1 A;  4IMN A;  1VWK B;  5HAE A;  2FR3 A;  2OY7 A;  1WBI A;  1VPR A;  2R56 A;  5LJE A;  4O4U A;  3RY2 A;  1NC9 A;  4CV7 A;  3ZZV A;  4A1H A;  1HBP A;  1QFT A;  4Z28 A;  2IZA A;  1QAB E;  1SWG A;  1SWK A;  1KZX A;  5FEN A;  2ZSC A;  4IBA A;  1BSO A;  1UYN X;  1SRG A;  2K62 A;  4QYN A;  4GJS A;  4ZH6 A;  3X00 A;  1KGL A;  4EXZ A;  3B2H A;  3TGB A;  4GKC A;  2OF8 A;  4GUZ A;  3APV A;  4ON1 A;  4LQZ A;  3RSW A;  3FLL A;  1DV9 A;  4NW4 A;  1OEK A;  3PP6 A;  1BEB A;  5EPQ A;  1PTS A;  1GGL A;  2JN3 A;  1AB0 A;  4A60 A;  3KFI A;  4AYH A;  1KL5 A;  3NQ9 A;  1KZW A;  4YCE A;  2RTI B;  2OVA A;  2M4L A;  1XCA A;  2QCB A;  3D97 A;  4KC8 A;  3T1D A;  2Z4I A;  3OD9 A;  2UZ2 A;  4AZR A;  2WUT A;  1NQN A;  4NP1 A;  3VE2 A;  4XMC A;  1KL3 A;  4DQ4 A;  1SWP A;  2AF5 A;  3FEP A;  3PDF A;  2OFM X;  2IZB A;  4IB9 A;  4ZHD A;  3JQO A;  3KFG A;  5LJD A;  3T2X A;  3WXQ A;  1S2P A;  2DJG A;  1QFV A;  3NX2 A;  5CSE A;  5K68 A;  5HCD C;  1IKJ A;  5H8T A;  4UU2 A;  3AUM O;  3WJG A;  1LCW A;  2GTF X;  5L3Y A;  3LV4 A;  2JU3 A;  3HWE A;  1NDJ A;  1N9M A;  3EBK A;  3LTW A;  2AMM X;  1AVD A;  5FFH A;  2VDF A;  3VU1 A;  3HTY A;  1SWU A;  3E3C A;  4YBP A;  5HTD A;  5CHK A;  2Y32 A;  3VG4 A;  5LKF A;  3JSQ A;  2IZD B;  4HPD A;  3VG7 A;  2RCT A;  1ZNE A;  4HPA A;  1LIC A;  1VWA B;  3WZP A;  3VGW A;  2W2F A;  1LPJ A;  4CDF A;  3RY1 A;  4KCA A;  2Q9S A;  1KQW A;  2RTQ B;  4MVK A;  3KVN A;  4KH8 A;  1ADL A;  2P8G A;  4WFU A;  2CAM A;  2LFO A;  4NLJ A;  1HN2 A;  1MM9 A;  4EFG A;  4EDE A;  3FR4 A;  5B10 O;  1E00 A;  1ML7 A;  1G85 A;  1HMT A;  3ZQ3 A;  4Z6J A;  3CR6 A;  1VWH B;  1BSY A;  1VWD B;  5LKE A;  1ZNK A;  3O22 A;  3FYF A;  4YKM A;  1KT6 A;  4ORX A;  5HZ6 A;  4ZCB A;  1SWC A;  3FW5 A;  1E06 A;  1JMZ A;  4XMG A;  2A2U A;  3IFB A;  1EPA A;  1KQX A;  1STS B;  5AJC A;  5DPQ A;  4ZHG A;  3ZW0 B;  1CBR A;  1TOU A;  3SLO A;  3KQ0 A;  3FA6 A;  1SRH A;  4RUN A;  4GH7 A;  1LF7 A;  4TKB A;  2OL7 A;  1X71 A;  2WEW A;  4K19 A;  5H9L A;  4EEJ A;  3CBS A;  2O62 A;  4BBO A;  4A8Z A;  1KT5 A;  4GK9 A;  3VG2 A;  4ZGF A;  1H91 A;  1B8E A;  3PH6 A;  1IFB A;  1XKI A;  3QQ2 A;  4HFO A;  3O19 A;  4ODD A;  4BX7 B;  3B2J A;  1DZP A;  4ORW A;  5BVS A;  4CPH A;  1IJ8 A;  1GM6 A;  1RLB E;  2N93 A;  2IZH B;  2LB6 A;  3B2L A;  4GGT A;  4QGX A;  2C1Q A;  2X45 A;  3FEK A;  4ZHH A;  2GJ5 A;  4ORY A;  4QYP A;  3RE5 A;  3TF6 A;  2NNE A;  5KID A;  4GET A;  1MDC A;  4ORR A;  1A57 A;  4O49 A;  3CBC A;  2OY5 O;  2GTL M;  2OVE A;  3STM X;  2AH7 X;  1BWY A;  3D4R A;  3HPE A;  3EC5 A;  4TNN A;  1JIW I;  4EQA C;  3HWD A;  3O2Y A;  2LBA A;  2RTN B;  1ZNG A;  5B5G A;  2R74 A;  4I60 A;  4QQ1 A;  1VWP B;  5D8J A;  1GT4 A;  4CSB A;  2RD7 C;  3EW2 A;  5FAZ A;  5H9N A;  3SZH A;  1STP A;  3Q34 A;  5HWZ A;  1FEM A;  1JMX A;  1L6M A;  1OEJ A;  2OY1 O;  3F6Z B;  1VWF B;  1JJU A;  2X4M A;  4PSQ A;  5EDB A;  4LKP A;  3OJY C;  2OL8 O;  2FR2 A;  3FW4 A;  1S44 A;  5B3M O;  4COT A;  1Y9T A;  4BX7 A;  4DCB A;  2X55 A;  1PBY A;  3IA8 A;  1IIU A;  3C77 X;  4OS0 A;  1X8Q A;  3WYQ A;  3P02 A;  4ZHF A;  4TKJ A;  1BSQ A;  1SWQ A;  1Z24 A;  3PEC A;  2GTL N;  4FQB B;  4Y59 A;  1Y9L A;  3BX7 A;  2L67 A;  2RTK A;  2VFB A;  4GE1 A;  5D4A A;  2YMS A;  3SLT A;  2NNQ A;  2HLV A;  3EM0 A;  1NBX A;  5AJB A;  4AZO A;  2E4J A;  5H9A A;  3STK A;  5AEO A;  3F9D A;  3MVF A;  3RDS A;  2OL6 O;  4JHQ A;  1TW4 A;  5IO6 A;  3APU A;  1NQM A;  5HZQ A;  1BM5 A;  3S26 A;  1SXU A;  1VWN B;  2RTC B;  1CBS A;  1LNM A;  1GT5 A;  4TKH A;  2F01 A;  1STR B;  4LZV A;  3RBY A;  2F09 A;  2X8T A;  5LJG A;  4MVL A;  2RTE B;  5HTE A;  2QOS C;  1WUB A;  2R73 A;  4U8U O;  4BOE A;  4NNT A;  2GTL O;  3EYC A;  3P6D A;  3WJC A;  1SWL A;  3STN A;  3WJF A;  2OF9 A;  1OEE A;  3EMM A;  2OYB O;  4DQ3 A;  1IFC A;  2HKD A;  4O4O A;  4QGV A;  1LIB A;  2Q2P A;  1X8P A;  1N0S A;  4OS8 A;  1HMR A;  1VWB B;  4ZHC A;  2BC3 A;  4I3B A;  1MEP A;  2LA7 A;  2WQ9 A;  4FBO A;  2WQA E;  1SRI A;  3S5X A;  2FLJ A;  2C4I A;  1OSP O;  4FBR A;  1LCV A;  3FR5 A;  1LDQ A;  1E5P A;  4IAX A;  1QY1 A;  2CZT A;  1AQB A;  3KFF A;  1GT1 A;  2W2A A;  2G7B A;  2MHD A;  4YKO A;  2WR6 A;  2Q2M A;  2RTJ A;  4IB8 A;  3WJB A;  4YCH A;  4N7C A;  1BJ7 A;  1SXY A;  5F6B A;  3B2I A;  1SWE A;  3K3L A;  5H9K A;  4YGG A;  1RAV A;  1HXL A;  2ALL X;  5HCC C;  3FA8 A;  2RTF B;  1SWD A;  4YGZ A;  1GX3 A;  1SMP I;  2FKJ A;  4AZQ A;  1KL4 A;  4O3Z A;  4ID2 A;  4Y5D A;  4MVI A;  1SA8 A;  2A2G A;  3KZA A;  1X89 A;  3RE6 A;  1YWC A;  2FGS A;  3P6H A;  3HWF A;  3RWX A;  1B0O A;  3RDM A;  2A5B A;  4UU3 A;  1JV4 A;  1O8V A;  4BX5 B;  3PED A;  4YMY A;  3U0D A;  2RTB B;  4Z2P A;  3OBL A;  5D48 A;  1I05 A;  2BSZ A;  1EW3 A;  1SLF B;  2L9C A;  1SWS A;  2RN4 A;  4O3X B;  2RTP B;  5HA1 A;  3UAQ A;  1N9Y A;  1LEL A;  1W5R A;  4OKA A;  5FQ7 E;  2AKQ A;  2CM4 A;  1ICN A;  1NGL A;  4BJ8 A;  1SWH A;  3S60 A;  2Q4N A;  1NP4 A;  1BRQ A;  4CK4 A;  2MF6 A;  4NYQ A;  4O4X A;  1S7D A;  1TOW A;  1SLG B;  3FID A;  1SWN A;  1ZNL A;  4XMH A;  3RZY A;  3GAQ A;  1PBO A;  3SLJ A;  1LIE A;  4LZU A;  3QKG A;  2IFB A;  5EZ2 A;  5IXG A;  3RDQ A;  1N43 A;  3FMZ A;  4TJZ A;  3APW A;  1QG5 A;  2GH7 A;  3SZI A;  4A1Y A;  1E02 A;  4AZN A;  1SLE B;  5F7G A;  2QO6 A;  3CKG A;  4MIS A; 
#chains in the Genus database with same CATH homology
 1LCZ A;  1I9H A;  4GD9 A;  2RTN B;  5B5G A;  4I60 A;  1VWP B;  1SWT A;  3WZQ A;  3EW2 A;  1VWI B;  3SZH A;  1STP A;  1VWL B;  2IZF B;  2Y3E A;  2OFA A;  2UYW A;  4EKV A;  4Z2O A;  4CPE A;  1VWF B;  1VWM B;  1VWK B;  2WPU A;  2FHL A;  1WBI A;  3WYP A;  3RY2 A;  1NC9 A;  1AVE A;  4BX7 A;  3WZN A;  4CPF A;  4Z28 A;  2IZA A;  3WYQ A;  3SZJ A;  5B5F A;  1SWG A;  1N4J A;  1SWK A;  1SRJ A;  1Y53 X;  2ZSC A;  1SRG A;  1SWQ A;  3X00 A;  4GJS A;  2IZG B;  1VWC B;  4Y59 A;  2RTO B;  5JD2 A;  2OF8 A;  4JO6 A;  2RTK A;  2OFB A;  1NBX A;  3WZO A;  1VWJ B;  1PTS A;  1KL5 A;  1SWA A;  3RDS A;  1HY2 A;  2RTG B;  1Y55 X;  2RTI B;  2QCB A;  4JHQ A;  3VGW A;  2RTD B;  1SWR A;  1NQM A;  2UZ2 A;  1NQN A;  1VWN B;  1KL3 A;  1SRF A;  1VWE B;  2RTC B;  2G5L A;  2IZI A;  1RXJ A;  1SWP A;  2F01 A;  1STR B;  2RTA A;  2IZB A;  2RTE B;  2RTM A;  3T2X A;  4CPH B;  1VWR B;  5CSE A;  1RST B;  5K68 A;  5L3Y A;  1HXZ A;  4CPI A;  1LCW A;  1SWL A;  4JNJ A;  2OF9 A;  1NDJ A;  1KFF A;  4U46 A;  1N9M A;  2FHN X;  1AVD A;  1SLD B;  2IZC B;  1RSU B;  1SWU A;  5IRW A;  1VWB B;  2Y32 A;  5CHK A;  5F2B A;  2Y3F A;  2BC3 A;  1HQQ A;  5IRU A;  1MEP A;  1SWB A;  2IZD B;  3VHI A;  1SRI A;  1N7Y A;  3EW1 A;  2RTR B;  2C4I A;  1VWA B;  3WZP A;  1LCV A;  1LUQ A;  1MOY A;  1LDQ A;  4BCS A;  4BX6 B;  3RY1 A;  4GDA A;  2RTJ A;  2RTQ B;  3VHM A;  2IZE B;  2A8G A;  1RXH A;  2CAM A;  1MM9 A;  2C1S A;  1SWE A;  1RAV A;  1HXL A;  4Z6J A;  2RTF B;  1SWD A;  3MM0 A;  1VWH B;  3RDO A;  3MG5 A;  1VWD B;  1KL4 A;  1SRE A;  4Y5D A;  4GGZ A;  3RDX A;  3T6F A;  1Y52 X;  2RTL A;  3RE6 A;  2AVI A;  1DF8 A;  5IRA A;  3RDM A;  1SWO A;  1SWC A;  2A5B A;  4GJV A;  5K67 A;  2RTH B;  4BX5 B;  1STS B;  4GGR A;  4Z27 A;  3PK2 A;  1MK5 A;  1VWG B;  2RTB B;  2IZL B;  1SWF A;  3T2W A;  4Z2P A;  1VWO B;  3VHH A;  4DNE A;  1RXK A;  1SLF B;  1SWS A;  4BX6 A;  2RTP B;  1SRH A;  2A5C A;  1N9Y A;  1LEL A;  4OKA A;  4BBO A;  4BJ8 A;  4Z2V A;  1VWQ B;  1SWH A;  2IZK A;  3RDU A;  4BX7 B;  3T6L A;  2MF6 A;  4YVB A;  4CPH A;  1SLG B;  1IJ8 A;  1SWN A;  2IZH B;  2JGS A;  4GGT A;  2C1Q A;  1VYO A;  2IZJ A;  3RE5 A;  4IRW A;  3RDQ A;  1N43 A;  1LDO A;  2GH7 A;  3SZI A;  1SWJ A;  1SLE B;  3FDC A;  4BX5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...