4BX8A

Human vps33a
Total Genus 214
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
214
sequence length
596
structure length
568
Chain Sequence
b'AAHLSYGRVNLNVLREAVRRELREFLDKCAGSKAIVWDEYLTGPFGLIAQYSLLKEHEVEKMFTLKGNRLPAADVKNIIFFVRPRLELMDIIAENVLSEDRRGPTRDFHILFVPRRSLLCEQRLKDLGVLGSFIHREEYSLDLIPFDGDLLSMESEGAFKECYLEGDQTSLYHAAKGLMTLQALYGTIPQIFGKGECARQVANMMIRMKREFTGSQNSIFPVFDNLLLLDRNVDLLTPLATQLTYEGLIDEIYGIQNSYVKLPPEKFALPTEAKKLQLNSAEELYAEIRDKNFNAVGSVLSKKAKIISAAFEERHNKQFVSQLPHMQAARGSLANHTSIAELIKDVTTSEDFFDKLTVEQEFMSGIDTDKVNNYIEDCIAQKHSLIKVLRLVCLQSVCNSGLKQKVLDYYKREILQTYGYEHILTLHNLEKAGLLKPQTGGRNNYPTIRKTLRLWMDDVNEQNPTDISYVYSGYAPLSVRLAQLLSRPGWRSIEEVLRILPGPHFEERQPLPNRVTLIFFLGGVTFAEIAALRFLSQLEDGGTEYVIATTKLMNGTSWIEALMEKPFH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords VACUOLAR PROTEIN SORTING-ASSOCIATED PROTEIN 33A
publication title Structural Basis of Vps33A Recruitment to the Human Hops Complex by Vps16.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
total genus 214
structure length 568
sequence length 596
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00995 Sec1 Sec1 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.850 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4bx8A04
3.40.50.1910 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4bx8A02
3.40.50.2060 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4bx8A01
3.90.830.10 Alpha Beta Alpha-Beta Complex Syntaxin Binding Protein 1; Chain A, domain 2 Syntaxin Binding Protein 1; Chain A, domain 2 4bx8A03
4BX8A 4CCAA 1FVHA 4JEUA 1MQSA 4BX9A 1FVFA 4JC8A 1EPUA 5BV1A 4KMOA 1Y9JA 5BV0A 2XHEA 3C98A 3PUKA 5BUZA 4JEHA 3PUJA
chains in the Genus database with same CATH superfamily
3FDZA 1DOZA 4WZAB 3FOZA 3FG9A 1J33A 3P0EA 1NTOA 3JRNA 3WI7A 3MMSA 3UK1A 4LERA 5GGYA 3GBVA 2B1JA 4GIBA 2D4HA 4B48A 4MP3A 4IUYA 2JCBA 5DYTA 1IZ7A 1QFZA 5CGQB 1Z4IA 1P18A 4NDNE 2FLWA 1H8HA 1OW3B 5LXTB 2IELA 2JD1A 1C9EA 2AXEA 3ZYMA 3CKLA 3K8ZA 4IF6A 3N05A 5D87A 3RUHA 3LYLA 3CF2A 2MSNA 3ADOA 1UBNA 1E0DA 3VPGA 4CLEA 4BMDA 4CMJA 2DQSA 4PLHA 2YNMC 5HIAA 1FE8A 2X9QA 4QHTA 4C01A 3EXAA 2YN0A 4INZA 4OJYA 4XE5A 2X5KO 4HB4A 3LW8A 2PX8A 2X6IA 4GW3A 3V42A 1C8KA 2PRKA 4RKWA 2YV4A 5LQAA 1QYDA 2UVPA 4MQFA 1L4YA 3D0RA 4H77A 4UWFA 1D7AA 2HM8A 1F5SA 4OBXA 1EVKA 3AB7A 4BUJA 1A9YA 2OVBA 4F97A 4TXNA 3A4IA 4P3NA 1PQYA 4GEGA 4EA9A 2G17A 1HF8A 2I9KA 4OKIA 2BFPA 4LOKA 2MSDB 4EYQA 1NN3A 1OBFO 2QVXX 5BVGA 4CRWB 1ODTC 3D6TB 5AK5A 2PQMA 1ZKMA 3FBGA 4V39A 2WP8J 1BAPA 3N86A 1SG6A 5KTTA 1BS1A 4EJ2A 4N0QA 4NWIA 4BWVA 4KDCA 4J8PA 1D8DA 3OU7A 2VP5A 3SOPA 2IHBA 3D6FA 5BMOA 5DX0A 5DW3A 1ZHFA 2WMDA 3FPSA 4B0OA 1ULSA 1PU2A 2Q7FA 4ZAYA 2DPXA 4X0EA 4BRWA 2C5SA 1XA0A 4BX9A 2IYXA 4JS0A 2F3UA 2Q3JA 1CUCA 3HHEA 3INRA 1NUSA 2C5BA 1II8A 2LCFA 2WMOA 4JUDX 5IJ9B 3U6KA 4P8RA 5LDDC 4UREA 3R76A 3RF7A 4MRVA 1XZJA 3PFKA 3WR5A 2XWJI 2LSUA 1JG7A 4PZ9A 4JHLA 4D6PA 1YMPA 5T3YA 4E5KA 4FFMA 4A92A 3GFTA 1AKTA 2RGNC 5JJBA 3IP1A 5G2NA 4CMIB 1Y8RA 1DO0A 1DUVG 1YKGA 4BP3A 3GUUA 3NFYA 3ZNPA 4EB8A 3VOSA 3PNYA 2D1QA 3LF1A 6CHYA 5FBHA 4RADA 1JE1A 3NPMA 5CM8B 5AXBA 2CLKB 3DS8A 2F8LA 1D1SA 3GAAA 4LOJA 1VKHA 3FYUC 4DA9A 4BV9A 3GCWA 3R4VA 1X80B 2IYAA 4DABA 1T1GA 5AD1A 5J5VA 3KAQA 1ZGHA 1WX1A 2OO3A 1UXIA 2ZYHA 5BV0A 1T6XA 1YNOA 4MWZA 4NU0A 1A7KA 5FWXA 5KQLA 2NXEA 2H7YA 2HQOA 3CVUA 4ZT2A 1XO1A 3TX2A 3ED1A 1TIPA 1RW4A 1ACJA 3U37A 5JYEA 2FQYA 1MRZA 4KPFC 1V54E 3ILXA 3EFOA 3V2OA 1L5LA 3WRWA 4YR9A 3H5TA 4HXFB 2WINI 1ZSNA 5AVTA 4UHKA 2Q28A 4AZ0A 4A2PA 1V8DA 1CSEE 2YIDA 1J22A 3UIPC 3RROA 2Z08A 4Y7DA 4RSMA 1I2MA 2YIVX 1NI4B 1WB6A 4LSGA 1U0GA 5JCJA 4UD2A 1P4AA 3CR3A 4X8MA 4RETA 3NAGA 5F33A 5D2MC 1QWSA 3CH5A 1CCWA 5DHPA 3GFOA 5AI9A 4QVKA 3DEIA 3W5SA 2GJKA 4KODA 2XF8A 3QM1A 2KBFA 2XCOA 1L8OA 4YXWA 4NESA 2Y4TA 3EJ6A 1GVNB 1G3RA 3S8MA 4FZ5A 4XIJA 4YIKA 1VL5A 4LHSA 5HQ3A 2I9CA 1KNXA 4G6ZA 3VHQA 1U04A 1BMDA 5KCMA 3LOPA 3OLQA 4BN0A 2ZTMA 4WNEA 5ENVA 4NMHA 1JWBB 2HT6A 1XAIA 2I4TA 4HAYA 1GFZA 2EF0A 3U56A 3AF2A 3H4MA 4HDKB 4KNVA 2JIDA 3FI9A 2PFGA 1N5RA 1ECPA 2PL3A 2WOOA 1KPGA 3EEOA 2XQJA 4G5OA 3U39A 1LEHA 3UAYA 1E7QA 1CT9A 3WQRA 3FTVA 5FUWA 2PGDA 1NBAA 2CUZA 3DZ8A 5K0FA 1J23A 3DONA 2GRAA 2L82A 5DTRA 3B8HA 2G25A 3F1KA 1INLA 3BEDA 4YJGB 5K0SA 4Q1DA 1BFDA 2JIZD 3N53A 1XA4A 4KQMA 4E3ZA 3DV9A 2CBXA 3WKDA 4OMDA 3UJBA 2HIGA 4I19A 2IDZA 3DBRA 2AJ8A 2AXQA 3CE6A 1JFLA 1EWTA 4R0NA 4F8EA 8GPBA 2IQ5A 1NXTA 2XDQA 2X4IA 2E55A 3N0XA 3H4VA 3ANXA 4BQSA 4EATA 4JL0A 2AG1A 3IALA 2R6AA 4N8SA 4CCAA 4MS1A 4MICA 2X9LA 1G18A 1CC1S 1OUMA 5MDHA 2H7XA 5JO9A 3OQOA 4ZU1X 4EGSA 2Q5CA 4RV5A 2O14A 5C8YF 4OQLA 3N8HA 1BG6A 3DLHA 2HWUA 4KOAA 3MTAA 1K86A 3W6UA 2DBVO 1K6XA 1N4SA 4W5HA 3JSXA 3E0QA 1H0AA 3H17A 4FX2A 1ATIA 2AFIA 2F9MA 1XX6A 4LHXA 3W9FA 1E9AA 1UADA 4G3XA 4B8CB 5GJVC 4YRJA 1VKOA 1P2TA 1XRQA 5LBUA 3DOUA 3UHFA 3H2JA 1BSVA 1Y1RA 2QXUA 4QNNA 2IBSA 2YHAA 1XTQA 3NJ8A 1AM4D 1YVRA 3U3XA 4MYSA 2P9UG 2BEUA 3ESRA 3FI0A 1B23P 3U5ZB 4J29A 3WGLA 5C4MA 1YDGA 4ON9A 3DZHA 5DTIA 5DLQC 4ERXA 1V95A 2I8AA 2YQ5A 2J5KA 4UE2A 4XR4A 1OI2A 3OIWA 4I5EA 3MINB 5K8IA 1LJ8A 1C7JA 4CEMA 3UMCA 4UD6A 4ZVQA 3Q9NA 3QX3A 5FHRA 2YUTA 2O0LA 4D0SA 3OKCA 1UKCA 3GPLA 4JA7A 1H69A 1OI3A 4C5BA 3GGSA 5KSWB 1XNFA 1UJ2A 1Z6ZA 1YBHA 4ZOBA 4ISBA 4BN5A 2DU8A 2G28A 5H3HA 4K86A 4M37A 3WA6A 3LQRA 3AU4A 2OMEA 2GBCA 2XZDA 1NFIE 5DVZA 4MDHA 3LDFA 3TQIA 1TCBA 1P5QA 3K1JA 1B00A 4X3OA 2BMEA 1I5RA 2WILA 5LYJF 1FS4A 4TXJA 3ZHEA 3QXJA 1CWUA 1MJHA 3WLJA 3LPLA 5M7EA 1W5AA 3N2YA 4KO1S 3GRRA 1IZZA 4B5KA 1XTPA 2R4QA 2JGRA 2WQHA 3TSWA 3NNNA 3ITKA 3SLRA 1CVRA 3VDXA 1QTNA 1U2DA 3R0JA 3O2NA 5AXAA 1ZJJA 1RI5A 4C87A 3GRZA 4MAAA 1H0SA 1EX1A 4QTTB 3QXCA 3SU8A 4DLQA 1IYZA 3HXFA 2VHYA 4MXDA 1E4VA 4GCNA 1QMPA 2B0JA 4MV8A 3Q7IA 3KALA 4HWTA 5BN1A 5C1IA 3EIWA 4RORA 4TV8A 1ADFA 3JD3A 2FSSA 4BNDB 2GF2A 1ZUNB 4H1UA 1KI6B 4JYZA 1NV9A 3PDWA 4FD2A 3WS7A 5DX8A 3W8RA 1SHZA 3EGDB 1PQWA 3EMDA 2OUIA 4OXIA 2TMGA 3KQVA 2V97A 3IEXA 3EEYA 3MJHA 3SFZA 2F37A 2RGWA 4LYJA 1UZUA 1C7RA 3OOJA 3P0IA 1JKJB 3B36A 2OZKA 1DQYA 1IN8A 5ICEA 2WK1A 1B8UA 2C7PA 2XCSB 1V9LA 4I5IA 2CXSA 1W30A 3EXFB 4TKVB 3B2NA 4J94A 4PC1A 2NMVA 2ST1A 3B6KA 1E3TA 2FW8A 2E49A 2ACWA 1XA3A 4OHUA 2O3QA 3F46A 4XGIA 1UEIA 4FKMA 1P6QA 3GCXA 3NCTA 1TTHA 5KPJA 1Z17A 2B2XA 1GZ7A 1NJ1A 2VUHB 1MKYA 4COKA 1BQ4A 2YFQA 1IFXA 1X7WA 3WL5A 4ALKA 1ZM7A 4Y9RA 4XUGB 4D7AA 3IEVA 3NHFA 4QU8A 1KAGA 3KZMA 4NC9A 1LBIA 5P21A 1OBVA 2OXTA 4PIMA 4TLBA 2WLSA 3D8SA 2Q7OE 2QTCA 3ELYA 1K7CA 1NJ8A 1CQZA 5EQFA 4QLOA 1RXWA 2RG8A 1KEZA 4U02A 4E22A 4R4JA 3BMNB 2E4WA 1GZHB 3CUWA 1QBQA 2J7KA 5J2UB 5TF0A 3RH0A 3S1AB 3MKQA 1M2FA 5AM5A 4RAQA 4HDMA 1MTZA 1PJ4A 1ELKA 2IE8A 3L0CA 1D2HA 3CVVA 4B3FX 3CIAA 1DTSA 4CKZA 1BWPA 2O5VA 2QU7A 3MJFA 4D0GA 3LCMA 3WYAA 3DWIA 4B0ZA 3FTYA 1XRMA 3P2JA 2YV3A 5FPHA 1JDZA 5I01A 4K2HA 2PMKA 1GJRA 2P6PA 4F2PA 4G8CA 3TLGA 4RIHA 2I6SA 5BR4A 1IVSA 1MDBA 1X1AA 5EUBA 3TG4A 5KNBH 1RZ4A 4U95D 3FE2A 2IT1A 4G1UC 3KBBA 2ORED 3G79A 3SIRA 1K66A 3K0SA 4C03A 3A1WA 1R16A 2YDYA 3JRWA 2QPAA 1Z73A 2EVWX 1MBZA 4JL6A 2QAIA 3R7FA 2BEVB 2CVFA 5WRFA 3LJNA 3SE0A 4ZEVA 2ZI9A 5EQTA 1T2UA 1VHQA 3FJ1A 3U80A 1G8SA 2BHSA 1O6GA 3WXBA 3L0YA 3OM1A 1RLIA 3W2TA 1ZGGA 5KWSA 2ZPTX 2IX9A 1I1OA 3BJIC 3RLIA 4LCTA 2RCNA 3PC6A 2WNSA 6REQA 5LA6B 1WQ1R 4DLSA 1QHFA 3UUEA 4G0OA 2VWHA 1UKYA 1TNOA 1XRNA 5FLYA 4II2A 1KEEB 2X8WA 2ZSAA 3KJIA 1IUNA 1ENZA 3LS2A 2EGHA 3RNOA 3ZE9A 3FYUB 1XAJA 5BSRA 4OGWA 4EITA 3C6BA 1YVDA 5LKRA 3QUQA 2YYYA 4CM3A 5F1OA 3IIJA 2CNOA 3MTGA 4JI3B 3GT0A 1SJ9A 1TM1E 2EKLA 2B4YA 2ODWA 5IT5A 3B12A 1Q2XA 2HDNB 3PUWA 2F00A 1K97A 2JGNA 5B2FA 3SBEA 1VJ0A 1I2ZA 4YO7A 1RWPA 2AFHB 3H9QA 2PCLA 2C9DA 3MXOA 3KL2A 1WHSA 5B6IA 2IEAA 1RWBA 2QJOA 4WXEA 2NADA 1VHTA 1Z35A 1KAOA 3PNSA 4GYOA 1ZJWA 3N2KA 2XGOA 4UOQA 4L7TA 5CNMA 3F74A 1ESMA 3C7TA 1Q0QA 3LXRA 3H11B 3E4CA 4KE9A 4EQZA 1Z6PA 3DBIA 5CLFA 3PHGA 2V74B 3RD5A 1UPXA 3FNQA 2PZFA 2IS4A 4B82A 3H1EA 3PVZA 1L4MA 1V2HE 3LX6A 2P30A 3OOYA 1T9HA 3KZKA 2KC7A 1TTQB 3RJ9A 1IJEA 2A3RA 5EJMA 3QW2A 2F1KA 4FBMA 1VECA 4V0MA 2Y77A 3KYIB 3PDJA 1A9XB 4G63A 2QL5A 2FY8A 2EEZA 1N8SA 3X2QE 2Q21A 3LP6A 2WT4A 4RF4A 2EL9A 5EWJB 5JPCA 4RFSB 1IDN1 3ZJ5A 3LC0A 3VRHA 2XGJA 2ZJBA 5DK6A 1R0BA 2NPFA 4O4IA 1KJIA 2VCYA 4M0EA 3EDQA 4EFLA 3K1ZA 1NVGA 3HCCA 1KTVA 4P35A 4YX9A 3JXJA 3WMWA 1M2VB 3DVRX 1YS2X 3G23A 3F96A 4JXTA 4LBZA 1ULTA 2PE5A 1SVUA 4NONA 4X84A 2FU5C 3FMGA 2IHJA 1KKMA 3B9PA 1Y9EA 4NMWA 3TXNA 4NBVA 3IBTA 1X1RA 3B1WA 1IHDA 1HEYA 4G0YA 3QWVA 1QR2A 2ZISA 2QN6A 4Z51A 4IICA 1L5WA 3M5DA 4HFNA 2Q3EA 5GZ3A 1Z06A 3PFCA 1OV4A 3H7AA 2QPOA 2XCQA 5K0TA 1R18A 2KBEA 1BDMA 1XZHA 2FMIA 2XWQA 3D4LA 2ZRKA 4EUEA 3UYKA 5C1DA 3ABZA 2JAPA 4CQNA 3IV7A 1VLJA 4UATA 5CEAA 4N03A 3R9AB 5BR1A 2V3WA 2JCVA 4H0FA 4QDZA 3QVUA 5IAGA 4MWBA 5BRAA 1S2IA 2DT5A 5JROA 1T6NA 4NOKA 1SQSA 4JVLA 3O4VA 4IP0A 1AMOA 2X2PA 2UUCB 2JDID 4S0ZA 4OQYA 3UHJA 3P9YA 4ENRA 3GA5A 3WA7A 4GZCA 5CDHA 4BNZA 4U0SA 1GPNA 4Q4DA 4MGIR 3FVVA 1I13A 2WKWA 2O5CA 2ZR0A 5F23A 1HZ4A 3I37X 4QIHA 3TJPA 3JVEA 4L7QA 3LGSA 1BRMA 3RTAA 4C4SA 3INTA 3UO8B 1F6BA 4IJMA 4RL4A 1FVFA 2F3QA 3FXAA 2IUEA 3O1JC 2OZPA 4C2AA 4Q12A 4J7XA 1LPOA 3O8QB 1RMTA 4RMGA 4DSAA 2M1XA 1UFQA 2W6CX 1N9AA 4RD6A 3NRBA 5FUMA 3AJEA 3D6JA 5EX0A 3B5EA 5EEGA 1SN7A 2RHWA 5F2KA 2QV0A 1PN3A 3LZDA 4Y1RB 4E5PA 3HRIA 2AQIA 1V1RB 4DQDA 1SA5A 3TTWA 4GC9A 2XCLA 2BMAA 5CW2A 2B94A 3EZFA 1LI4A 5FFNA 1WLYA 3AFHA 1KYTA 4PLGA 3UAZA 2XMCA 3V7UA 2QVCA 4ZPJA 1FZQA 2CHZA 1H2WA 5BQ3A 2MSEB 2QTRA 3AFGA 4FWBA 2JCXA 2R11A 1JGTA 3CLHA 3AR8A 3OICA 4Y2JA 3EVFA 4K28A 4K87A 1FS5A 3CFYA 1DWOA 4OX9B 2OUKA 3PRYA 2I4RA 2BI8A 2ZCVA 3PUHA 1JJFA 2AYXA 2VUTA 3GLHA 2WAMA 4KQGA 1JKFA 4F3CA 5TMBA 1LC3A 1Z63A 1I33A 2WYWA 2WXGA 5CHEE 5JQGA 1JI0A 1LBQA 5KWDA 5L4LA 3ZW7A 2Q29A 5JCOC 2UKDA 3AOEC 2V03A 3B7SA 4IXTA 2VHZA 5A62A 1REQA 1P7VA 1PGQA 2WW8A 3B9RA 5AIAA 3JWGA 1LZLA 4XYMA 1VIVA 1XHFA 4D4HA 3CC8A 5D2CA 3I3NA 4OQPA 4BP8A 3BFPA 3IVCA 2OM6A 5BT8A 3A1TA 3R0VA 5FWQA 1Z8NA 2AG5A 4Q4JB 4H9GA 4MQ5A 4Z4EA 4QFVA 2O50A 4DLRA 5F78A 3D54D 3W1WA 1AY0A 2ZSKA 3MWEB 4XOUA 4BMYA 4L4XA 1NZNA 4W4TA 2J3LA 4K3UA 4Z4GA 1W96A 1P2UA 1ORDA 3BMCB 3P97A 1EWKA 4CEIB 2AH5A 3QFTA 4RQBA 4GPKA 4NECA 4XQ9A 4N5HX 1DDOA 4JQZA 5G1OA 2BFDB 1U63A 1UOOA 4HDNB 1J2TA 1MH9A 4MW0A 3BE8A 4TQAA 2OV8A 2A7QA 4I5FA 1T1EA 3JQBA 3E7WA 4J1QA 1WMEA 4XRRA 2HHJA 3WLSA 1YCDA 3NI2A 3LX5A 4GBGA 2L0XA 2XZDG 4XZ3A 4UUQA 1M5TA 2POCA 2YTZA 4TTAA 4RPLA 5D7NA 4LTDA 3OD1A 2XW6A 5CURA 1PW7A 1FFWA 1X92A 3JQQA 4K5AB 1JR2A 4HX9A 1Q1BA 3ODGA 2QUKA 2BGTA 3INGA 5T64A 3DMFA 3AY0A 2DPHA 5BSHA 4M8LA 4RK6A 3ENZA 3QVSA 1KR2A 5K05A 1JR3A 2J0QA 4QYSA 2QVGA 3EYWA 1SVKA 2JW5A 2FRXA 3OJEA 2XEXA 3MA5A 2XODA 1R27A 2ZJ7A 4QGFA 3LOUA 1U3TA 4XJVA 1PJCA 4M7CA 4BX2A 4PQGA 4CLRA 5ALQA 5HFNA 3TSAA 1IXRC 1IC6A 3E4BA 2QRHA 1PW5A 4KMSA 2Y92A 1AF7A 1CLEA 1RYBA 3D9KA 3JWHA 2Y6UA 3IMEA 2BC9A 3W5VA 5LMUB 2ZVJA 3UOWA 3C3RA 4HFJA 4IMIB 3WE7A 3A9VA 3OP1A 1Q83A 4HDAA 1P62B 5FO0A 1YZTA 4LJLA 7YASA 1HM5A 3ZGZA 3VAYA 1TF5A 4OB6A 3KVVA 3MUOA 1XQ9A 4IFIA 3E9MA 3RFTA 4XGKA 4U5XA 4H3KB 3I5MA 4LJ8A 1FDIA 3QLVA 3SZRA 3N0WA 3SKXA 3WRVA 1CE8A 3C8MA 4Y2RA 3AHEA 3GJRA 4E5MA 3L6UA 4BNIA 4OFWA 4B31A 4I1VA 1U2SA 1M8JA 4B93B 1KZGB 1OV6A 1M3SA 1P7CA 2WM2A 2Q0HA 3B52X 5A05A 3EJWA 3IX7A 1Y4ZA 5THXA 1UWKA 3FCEA 2V0CA 2BGJA 3HO6A 3HMKA 4RS4A 4YMWA 3CRVA 4GMLA 2FPRA 3I6IA 5DHTA 1KEWA 3PFWO 3AJ8A 4YY3B 2ZREA 3R0IA 3UPDA 3OTOB 1FNCA 1UF9A 4DEVA 4QODA 2QI9C 3RFXA 4LJAA 4XQCA 4X7BA 4AW9A 1M1NA 5ALNA 1MC5A 1H2TC 2CGEA 1GGHA 3EZLA 3MQFA 1D1QA 1CPYA 4OYRA 2O2JA 1ZXBA 5A0VA 3JQCA 2HA0A 2AZ4A 1H6CA 2XJ4A 4U7EB 5EJ7A 1GY8A 2OFPA 1WXQA 4B7CA 3W3ZB 3ZE1B 2B0CA 3U17A 1JL3A 4DS3A 1L5JA 3UC5A 1XD2A 2AV6A 3DPIA 5BQFA 4DG5A 3EGEA 4N3NA 5KYKA 4IG4A 2GEDA 2QLTA 1XDZA 4WOCA 3WG7E 4BBJA 1JR6A 1DX4A 2DQKA 4ER0A 3V1MA 5B3LA 5K3EA 1CHDA 5CLHA 2QX4A 4LCBA 4CCWA 3UKDA 3IERA 1TAQA 1QB7A 1YT5A 3IUMA 1ENOA 2H2FA 1OH5A 3B9QA 2GFQA 1CP3A 1G3QA 3W6ZA 2IBTA 5J1TB 1B42A 5HI7A 5LR6A 1C1XB 4EY3A 4LJSA 3KWLA 4KN9S 3DSVA 1SU4A 1IVYA 4HRNA 1KVSA 1S8FA 3DYIA 3W04A 3AZOA 1RVDA 5JQWA 3BMQB 2D5IA 3FNRA 3FR7A 4IDEA 2C1XA 5C3MA 4RPCA 4K3VA 4DGSA 4JT4A 2UZ0A 4KZPA 5H7XA 1ZOLA 1T0BA 5BNWA 3ZCUA 3DP9A 1P72A 1CX9B 3WDKA 3T5XA 4HRVA 3Q0TA 3DXYA 1JZSA 4EJSC 4LF8B 4GA2A 3ZLUA 1Z75A 4QRIA 2EF1A 2GN1A 1N6HA 2JFFA 3W5DA 3EC2A 3AESB 2EIKE 2O3JA 5HDBB 1QU2A 4PXSA 2V4HC 1C9NA 3ZY3A 5EMNA 2R7KA 2YKGA 5KYYB 2WZQA 2HAEA 4A1GA 3BFXA 2ABWA 8ATCA 3HPQA 3MLAA 3TLEA 3TZLA 5FKJA 3M9LA 1E1YA 1OF1A 2VPPA 3IPXA 5JMWA 5HA5A 1EIWA 3CF6R 1BH6A 4EHNA 3L18A 3HCPA 1WZUA 1KO7A 4YIHA 2BYTA 5IVPA 2XUAA 2GYWA 4ZYUA 3PEUB 3FUVA 2C4WA 4PSUA 3LQQA 2R2GA 3RUFA 3OG9A 2NT3A 3M4JA 1BE0A 2ZIRA 1PX2A 1KJYA 4DF3A 4OBWA 4FFDA 2OEPA 3DXMG 1VE6A 4Z9XA 1XMVA 2NP6A 2VH1A 3ZGNA 3UW3A 4A3TA 3FD8A 4MKZA 1LA2A 4MVJI 3NW9A 2I2DA 4HZUB 4D96A 2ZBPA 3FR8A 5AXCA 3BJRA 2CEKA 1KC3A 2ZWVA 5KNDH 3TH5A 5TIIA 2EFCB 3KYDB 4FC6A 1G9SA 4LYDA 4QICA 1XTUA 2IC5A 1XF1A 4PRYA 1E5DA 3R7DA 1E96B 1X74A 3W7AA 4O2RA 1UL1X 1II0A 2QLNA 2QY7A 4MLPA 5IJ9A 4RY0A 4QTZA 1E1NA 4D9JA 2IYEA 2XB8A 3H83A 3ZHOA 3H97A 3AJIA 3FOBA 1US8A 4JC0A 3KS9A 1ZFNA 4W7SA 3WNBA 2HU8A 4K5BA 7AT1A 2DWZA 4CUZA 1G16A 3TBFA 4GRAA 1KZ9A 3W5IA 4DJTA 3FHCB 3NUQA 1HL7A 2Z8XA 1TI7A 1EYZA 4IUBS 4EUKA 2Z8ZA 4JROA 4A91A 3CGWA 2AA3A 1JJIA 4OGLA 1Y1LA 3D81A 4YRCA 4FJ1A 1RPNA 3T5AA 5BWNA 3B78A 1AK2A 4LDAA 3V8NA 3LLUA 3JQFC 2JIZA 1D4FA 3BA1A 4FQ7A 1JHYA 3HYCA 3G0IA 3RYCA 5EI5A 1U0RA 1IB6A 3C6ZA 4YWHA 4C76A 2M1ZA 2PGJA 2AHRA 1QONA 4H2DA 2ACEA 3PNTB 4QPNA 2HCTA 2WT9A 2BDUA 4F3RA 2Y9MB 2X0RA 5K8JB 4JNCA 3ZI7A 4H60A 1IBLB 2HRRA 1CVLA 4V0QA 1I2DA 2WIFA 2P9QA 4TTTS 5C7LO 2A5JA 6YASA 1TDJA 2YOHA 4D8VA 1K3FA 1QIJA 1LLCA 1W8DA 1XCLA 2JD0A 1GNTA 4ZDIA 5IBCA 2MSKA 5C1OA 3D2CA 1E7UA 1Y6IA 4KIGA 5H9VA 3ZHZA 3RVOA 1BW9B 1DJQA 3T3DA 2CXPA 4GKVA 4CG1A 2Q1UA 4C0KA 1R00A 1YR1A 1NI4A 5FFMA 2G5CA 4PVDA 4DDWA 1ZAYA 2I1WA 2D06A 5BW4A 4GKAA 1WAMA 4AXBA 1UJ5A 5KYTA 1T5OA 3QQPA 3I8OA 4YRQA 1N36B 2H2IA 2P9EA 3KHTA 1PAUA 2QGZA 4ED9A 3SIWA 5C4GB 2R8ZA 4Z1OA 4D8XA 1K8XB 4NOJA 3QARA 4BRSA 2XOEA 4S1WA 5COAA 4M3NA 3KLBA 1CEEA 1KVTA 2VQ6A 4FPXA 5DBGA 4DI4A 2GRLA 4PHGA 2IYWA 3U1TA 2TMYA 4XPZA 4PFQA 2XT9A 1BYIA 4Q9KA 2BELA 2GM9A 1UC5B 1HU3A 1NVUQ 1A4IA 3QU9A 3QLUA 2P2YA 1X7ZB 1QTRA 1CRLA 3AIOA 2KQUA 1LPBB 2XMDA 4JT9A 4U8YD 3MN1A 1KEPA 3HXMA 4TXQA 2W6OA 1J8VA 3S6JA 5LMZA 5KX5B 4YRZA 1MHPA 2H3EA 5JTUA 1U9YA 2FE1A 4B09A 3GZNB 1I1NA 3NGLA 4I9HA 1KFKB 5B58C 4ZEMA 1GG2A 5EXEA 2D4AA 5FF9A 2P1ZA 3ESLA 1BC5A 2IVZA 5IVIA 1GZUA 3IJ5A 3VZPA 2NO1A 1UPBA 4Y2SA 4AZVA 2EDAA 1MHTA 1AO0A 1UJ4A 3CV3A 2JEOA 2UUOA 4M4SA 4QVGA 2Q7XA 5HQ8A 1QZ3A 1RBMA 2PZ8A 3CV0A 1R6XA 4JB3A 3RTEA 1HURA 1Z18A 5CBKA 4BKPA 4LZAA 1EDOA 4IDBA 2X3MA 1STOA 2L0IA 1AXGA 3OLWA 4DTCA 3HFRA 3H7IA 2RAPA 4Z4HA 1E98A 4JJFA 1AKRA 1VHWA 3VJLA 2G3YA 1TM2A 3IFSA 3BSWA 3V2HA 3ET5A 3V4SA 2IYQA 4EJ0A 4QU0A 1NTRA 1PDVA 4CN9A 4U6SA 4ML3A 2DUUA 1V47A 1OXJA 1UN8A 1BKDR 3ZOZA 4A2QA 1J8MF 3D6MA 1AF4A 2EFGA 3UH0A 4N76A 3GJZA 3HKEB 2FZWA 3RU3A 3I2IA 5KWIA 2D0DA 2I2WA 3DAGA 5DM60 2QROA 2Z58A 5ICSA 1A4UA 4TVOA 1Y8AA 1O3YA 5FQOA 5J2TF 4RPJA 1ES9A 2ZRCA 3PQCA 2QAGA 2R8OA 2QYUA 4KO4S 3QVOA 1O58A 1E8YA 1P33A 4ZAZA 1YS7A 3ML8A 4RENA 4PX5A 4F06A 3BE4A 3EIXA 4KQ6A 1CHNA 2IOFK 3QXGA 2WKSA 1D6MA 4RULA 2V7TA 4J8DA 3RRMB 2YNQA 5AK3A 3OQIB 4QC2A 4O60A 1QRSA 2FUEA 5KDDA 3RVKA 5BW5A 5DCWA 2BH2A 2VJMA 3EZ6A 1OTYA 4OK3A 1X13A 3CM0A 4MKFA 4G5FA 3K96A 4YQYA 3ERCA 3EN0A 2ETXA 2FJPA 2HXSA 2HI0A 1JHOA 5KYWB 5HGXA 3PCXA 5C9ZA 4UPDA 1I0ZA 2IU4A 3USCS 3FHJA 3VHRA 1AV6A 1RYYA 2CLCX 4QELA 2JFUA 1PWEA 1YQGA 2OQ2A 1PZNA 2BUBA 4WESB 4RH0A 3P2IA 1USIA 4RTRA 4BFLA 3BWBA 4C07A 4R01A 1LTXA 1DIAA 5B1YA 3OIFA 4XW2A 2WFAA 4K81B 3Q7AA 1L4BA 2Z43A 4OHZA 4OL9A 4IZHA 3GGJA 3VR5D 1RMQA 1G20A 2ZETA 4ZO7A 5TLSA 5C31A 2D7CA 1LPAB 4GO1A 3SO8A 1HE1C 2OAEA 3RRZA 1BXGB 2IXEA 4EHLA 3CBQA 4PV7A 1BVRA 1F51E 2OFOA 2VF7A 2PFKA 2NZYA 3EGVA 4IDOA 4HX5A 2PL5A 1R12A 1YR6A 2VTEA 1Q5PA 4OJNA 4I6GA 3EC7A 4GVLA 3V6MA 4RH3A 5JD5A 4J7CA 1MX1A 5CGZA 1E9SA 2A9JA 4NSNA 4L8FA 4XR9A 3IEIA 3OY7A 1E6EA 5GJWC 5ES3A 2HYIC 5FO1A 3MJWA 1X2BA 4WNIA 5LZ8A 2EW1A 4FGLA 1MIOB 4GS5A 4S1VA 3UW1A 1G5RA 2B3TA 3ZNGA 2RKOA 1ONPA 3LNTA 3NO4A 4OO3A 3CVNA 4G1CA 2OBBA 1KP2A 1U2GC 3N8IA 2RCYA 4U8HA 1SWWA 5TQ0A 3A1UA 4KQKA 3G5TA 5EIDA 4RA9B 3EXFA 4TKVA 1A50B 2UZ1B 1HLPA 2ATCA 1N6PA 2J9QA 1ZK2A 4NS4A 1S4QA 3PQFA 1C80A 3HGQA 2J5RA 4KO8A 2R751 4PPQA 3KK0A 4C43A 2ZK7A 1OAAA 1JLLB 4UTZA 1IAVA 5HM8A 4JYCA 1A72A 4M7RA 4XE0A 4IJVA 5KOHA 4PUCA 5B7NA 5CNIA 2ZM5A 3EDYA 4LYFA 2VFAA 3VSDA 4B76A 3U3WA 3Q15C 4FXPA 1QOZA 3D2LA 4PC6A 5IKPA 4EJSB 1AG9A 2PM8A 2XNHA 5C32A 2OKGA 2NSYA 3LAWA 5AI6A 5LP1A 3I2FA 3RO2A 3WMEA 3OJWA 1K8QA 3G0GA 4TXLA 2FVYA 1FYFA 4MROA 1FP6A 3DEPA 2XVAA 4P4SB 3F7TA 1YZQA 2Z56A 4EPXA 4GLOA 2JGKA 2XTMA 1FFXA 2VHWA 2CYAA 5C5DA 2YNMA 1NKSA 1PV2A 3BMNA 1N6NA 4JLJA 5F12A 1KI8A 3SX4A 1ZH2A 4B3RB 4F92B 4ZV7A 4PHHA 4CF7A 1CRQA 2X6RA 2DMRA 4NE7A 4GX1A 4DLZA 2Z5LA 1NOIA 1KVUA 4LNAA 2QENA 3SNHA 1NWCA 4OA8A 3LMKA 4ZAGA 4LYAA 2O1XA 2HRBA 3B2EA 3DA8A 3AS4A 2XUPA 1EJ2A 1J9GA 1LBTA 1H2HA 1W87A 5EVCA 4A6XA 4IUDS 4MJ7A 4PLYA 3ZCTA 2AUNA 2ZYGA 2HLNA 2V6MA 3RU7A 3W77A 1E2JA 2RGAA 2D2VA 5EMLA 1KZ7B 2JIMA 2TSYB 5KAMA 1YRWA 3TFQA 4RA6B 2FQ1A 5FPKA 3NG1A 2GRQB 4AK9A 2PK3A 1E8ZA 1ITZA 1ZW1A 3ZTWA 3GBPA 2D1RA 1QHHB 5CVCA 5CDTA 4KXMA 4GNRA 4B84A 2PKQP 4HI0E 1IRXA 3N7AA 3Q7SA 3EEIA 4DCOA 3PPVA 4DOMA 4U6QA 4K0KB 2KCKA 5BSGA 1SCBA 3T5DA 2P9JA 3UA3A 4WLFA 5KQRA 1JFFA 1RI4A 4GEKA 4FJYA 3MV2B 4F9FA 1XOIA 2CE2X 1MF7A 5FINA 3BH0A 3MCZA 1KDTA 3SJBA 1K4MA 1F4VA 3VNSA 3COWA 5IM4F 5KVAA 3WX0A 1XJCA 4GH5A 5CB4F 4HFRA 3H5WA 3P2MA 1TT5A 2CDNA 1MV8A 2IHNA 3TQOA 3HLTA 1U0JA 1KSFX 3LT0A 5LA6A 1YDFA 4IFEA 2EJBA 1K06A 4NIMA 5I3CA 5IKEA 2HLHA 2F3RA 4GMXA 2WABA 1D2NA 3QLTA 1SW6A 5LP6F 4Q48A 4HYQA 1T6BY 3GLIA 1CR2A 4LZNA 4EHAA 1FVHA 1J0BA 3E81A 5K3DA 3C1AA 5L40A 2PL1A 3DFMA 3ZDBA 3I2KA 3NEJA 3SSAA 3P0JA 3UMSA 3T0FA 3KOUA 2W6PA 4DQKA 4JNKA 3KPUA 3UUXA 3ROTA 2D1SA 2JLYA 3FCSB 2C8KA 4ME2A 2J5BA 4CKXA 3UA4A 4GYYA 5TQ2B 2VTBA 4AZ3B 4MUKA 1H6DA 3FUTA 3MYYA 4ME6A 5CIYA 4BLSA 2CBGA 4PNPA 1YZUA 1LDEA 1J21A 3IMGA 2JDIA 1JG3A 3TW4A 1DI0A 1FFSA 1DKOA 1XU7A 3AEYA 1NNSA 3U7RA 3CE9A 3K0FB 3O9MA 5I9SA 2GBGA 2I54A 4MV1A 2XMQA 3R4CA 3BTOA 3EHRA 4URZR 2WXJA 5I5EA 1DC7A 4AG6A 4L1KA 2O05A 4QAQA 4KRGA 3MXTA 3OOEA 3EVBA 4Q69A 1E1CA 5G0TA 1L4NA 2OVFA 4B3DA 4LRXA 4DDMA 2KCVA 3ZWVA 2DSTA 4BE4A 4O25A 1PX0A 3ZWMA 4D9BA 3FPCA 2ETCA 5D3QA 5CTAA 4YVOA 1GZDA 1N2CE 4II3A 2WT8A 3GJ6A 3RK1A 3IAXA 1IHYA 2R97A 1ZY2A 4X6LA 1A9XA 1R4MB 4J16A 2OCKA 3HKCB 2YYZA 1DADA 3MRTA 4OYYA 3IIIA 3DW3X 3GFRA 2J09A 4EA6A 5L51A 3TOCA 2Q41A 2TYSB 2DUMA 2P78A 3R3SA 1FJHA 1B0ZA 1FT1A 5EWJA 4RFSA 2IV3A 3TAXA 1BFUA 1ZA2A 1U7TA 3ZDRA 4OVUA 4LIPD 1OX4B 3WIOA 1FL9A 4MWGA 1QIHA 3WAGA 5KNCD 3A2LA 1JHDA 4AUEA 3TE7A 1M7GA 3F3YA 3MCUA 4BZXA 1H5UA 3NHMA 5E7IA 1ZU4A 1OLSB 3CN9A 3KUXA 2QTVB 3QBJA 4OX9Y 1YR9A 1NG1A 4HC4A 3PBKA 4WA8A 3T5TA 1JIQA 2F6RA 5JIBA 4Q9LA 4MRSA 4FOSA 4OPMA 4BNMA 4W7HA 5JVDA 2H1CA 1Q95A 4Z7NB 1PWZA 3Q8XB 3NHRA 1BN6A 4E30A 2AWNA 3SM3A 1NLUA 5IYZB 3NYQA 5EUCA 1KR5A 1S2LA 4LDNA 2DHDA 4OBEA 3FCOA 4LDPA 1I4TD 2ADFA 1K6JA 1R6VA 4QPJC 2IPXA 3KBOA 3QA9A 3FMOB 5AWFC 1SCIA 3CLJA 4IIUA 4D57A 1FDUA 2CMGA 2XXAB 2HC9A 4KN6A 4MSUA 2Z6UA 2FULA 1R8YA 2VHTA 2JJ1D 3DKVA 4C1NA 4F85A 2ZEJA 3I92A 4OAVB 3CUTA 3I4CA 2QL9A 2XB2A 5A3VA 1FP4A 3IHLA 1JPUA 4CHTA 4F0JA 4BSXA 5FAXA 2VSFA 2ZSFA 1QIEA 2J67A 4YRBA 1LTQA 2N0SA 2XB9A 1KYYA 3A26A 1Z6XA 2R47A 3VPFA 4B5LA 1H9CA 4FXOA 5LLDA 3TM5A 4IXMA 5LDGA 1HWYA 1KVQA 2X2OA 3U1VA 1S8NA 1UZNA 1XU4A 3KKKA 5CA0F 2OL4A 1VLLA 2JC3A 2ZBUA 5E9JA 5AW0A 2HGSA 3A6JA 4G41A 1NF8A 5JZVA 1NJGA 3A4YA 4CL8A 5KU7A 4EABA 1JTFA 3TR5A 1OHHA 1OIXA 2JFQA 4MARA 5EIBE 3WDSA 3ES9A 4O3FA 2I3ZA 1L6IA 4LBVA 4Y1RA 4E0BA 5CVJA 3EXHA 2IHKA 2FEPA 4MKIA 1JDTA 4KX3A 3GC6A 5CRVA 4KXWA 4F96A 1WUJS 3UFXB 3F6YA 4JJ7A 4S05A 4FVTA 2BSQA 4NF2A 4FEAA 3TX6A 2VXCA 1BE1A 1K8YB 5DDIP 4ZYTA 4MVJD 4AUMA 3GRUA 4P2BA 5BYJA 2VOJA 4I50A 3FCAA 4B8YA 2G8NA 4GXNA 1QH1B 2HL6A 1VL6A 1K6IA 2GBIA 4J0GA 5DNVA 5EYPB 3ZKWB 1A2QA 1XZNA 4RIEA 3KUUA 4QE3A 5C46F 1F60A 4MWTA 1QGYA 1KK0A 1N9ZA 3D3WB 1T15A 1MGPA 4BGIA 1BN7A 4EPYA 1RPTA 5B3SE 5EXTA 4C7KA 1VJTA 1LI7A 5D0OD 4DDTA 3NT4A 1NBWB 3V1UA 1E1RD 2F48A 1EP9A 1E2MA 2CVPA 1DAGA 7ADHA 2P65A 4B6GA 3R6WA 2DH5A 1SOUA 3EBPA 2BR3A 1RM4A 4QTXA 2PO7A 3CS3A 4X94A 4P36A 1L7QA 3C4JA 4RLFA 3ZHVA 4MO9A 3D8NA 3V1KA 4OP3A 4MA0A 3NTOA 4X62B 1GP2A 1BEEA 3GJ3A 1GTMA 3PWTA 2FW6A 4YALA 1T9DA 2MCFA 3S8EA 4LW8A 3B2QA 4JYMA 3BMOB 3WWYA 3D43A 3QMPA 3HJNA 3E9QA 1QX4A 2QDXA 4MWEA 4DA8A 5CT4A 3KUCA 1AH2A 4ZVOA 3PU6A 4C78A 4LYHA 4AJKA 3PF9A 4QDTA 1FY2A 1V1MB 1CUIA 2L19A 3T7EA 5FWNA 2AN9A 1RAFA 2ZTUA 1Z6AA 4MRPA 4WH0A 3KOZA 5BW8A 2QVLA 3L9XA 4D10C 2V58A 4UQYA 3BCHA 3FDHA 2G77B 3GZ1A 5FOUA 3DWEX 3IIKA 2XBMA 3CUYA 3ZU6A 4PPFA 3U3DA 3RYTC 1XBTA 3ZFWA 2GQ0A 3R9XB 5KJCA 3KWJA 4D41A 5ALZA 4YRRA 4A63B 3LVFO 3P0FA 1T2NA 5I4IA 4LRWA 3PDNA 5BXQC 1SHTX 2YNMD 1U6KA 4U2GA 4TQUS 2TMKA 2NU9B 3UGJA 3NIFB 4XQEA 3BH7A 3IR5A 1OXBB 2ZQYA 3ZZNA 3AWDA 1JAXA 3C6MA 1JG6A 3QXSA 4V2IA 2HMWA 5BNTA 2EYQA 4A16A 4S0XA 1XG5A 3K0AB 4CDGA 1RKXA 3RRUA 4GKBA 2BJVA 1Q0SA 5DEOA 4M86A 1R4NB 4KQCA 3TWRA 2P2CP 2FSGA 5BWBA 3HXEA 2P9YA 4Q3NA 1SIBE 1AGYA 3LIPA 3F97A 4KN8A 3KVOA 3JRXA 1AGPA 1UJBA 5DYNA 3DEOA 3LKUA 4HQDA 2G08A 4A0RA 4ANVA 1H93A 1VZ3A 4X92A 4H0NA 1DQNA 2QRNA 2JLZA 3ACBA 2O4CA 4WFQA 2PLAA 5F9FA 3PLNA 3L92A 1CDDA 4U9UA 1GO2A 4XCVA 2HE0A 5JRDS 3FJYA 1TVKA 1T91A 1G60A 4HGZA 3PDIB 2WDPA 4YI5A 4R8KA 1Q22A 2ILVA 5FFFA 4BLTA 3PUVA 1MNAA 3PGVA 5AVRA 2GEVA 4L1BA 2PUJA 4WXYB 3THOA 1SCNE 4KU4A 1ADGA 4MRNA 4G0XA 2PAAA 4CGYA 1Z6GA 1L5VA 3ZHRA 3GWZA 1DV2A 5I47A 1VI2A 3UG6A 4EEKA 3R1IA 4FU3A 4HQNA 3RT1A 1GR1A 1R9NA 1MVLA 4AMYA 1KZ6A 1OVGA 4W1QA 1JA9A 5ED0A 3MJRA 2IO3C 4L9WA 2WHPB 3GFGA 3WLOA 5JDIC 4ZHQF 1W36C 2RGYA 3F5SA 1HTTA 4O29A 3JXIA 2X7HA 4JLVA 4FE3A 2I9PA 2F8YA 4AO6A 2RC6A 1QV7A 5D84A 4R2XA 4KSBA 4OFXA 2WF6A 1JIIA 2OV4A 3PHJA 4BV8A 2WM9A 4LHZA 1UC4B 2HSDA 1GNSA 5TV2A 4A1SA 5IASA 3I3OA 3OOSA 2W98A 1SXQA 2BE7A 4BFTA 2C9CA 1OZAA 5AN8A 4XWYA 5LQCA 2FPIB 4KR7A 4IVRA 1TM4E 4F4HA 1QTQA 1OIWA 4NEQA 4XZ4A 4KQEA 3EYAA 4G4IA 3KKEA 3HJUA 4C20A 5T3UA 4Q00A 2JIBA 2J6CA 4YT2A 4RTOA 2VP4A 1HE5A 3RWMB 5C52B 4BCCA 4E6EA 4EECA 4OK5A 1VA4A 4RHTA 1N0HA 3AFNA 3THYB 1YC5A 3F6RA 2NU7A 4PLCA 4C0SA 2MYOA 2RB5A 3SC4A 1P2FA 2IYLD 3DYVA 1PUIA 4ACKA 4KVZA 4XD7D 4P29A 4BNLA 5HE9A 4A0SA 4ILKA 2CZGA 3U7IA 5I8WA 3UT0A 3TW0A 2OKCA 5K6AC 2WJJA 3B6EA 1E3SA 4FGKA 1BS9A 1UP7A 3W90A 1XJWA 1YTLA 3T9BA 4YDRA 4G1TA 1N8TA 2WD7A 3M1IA 4OCZA 1V5FA 3BMQA 4JXZA 4XM2A 3QHAA 1RYZA 1WDLA 4EM6A 2CW5A 1X38A 3VPXA 2B9VA 4KQJA 2XCTB 3GUZA 4WKGA 3IOEA 1Z37A 1Y6GA 1ZMXA 5IY5E 2GAAA 3O74A 4HTAA 1VLMA 5HKBA 4MMZB 1OJ7A 2OD9A 2E6KA 2F4VB 1JIJA 4UXHA 2BHLA 4DA7A 1UJMA 3TCXB 3R75A 2VT7A 1IBKB 1BA2A 3PUKA 3UWKA 3IE1A 3BX1A 3CHPA 3LW7A 3MBOA 4PWYA 3WGUA 4G67A 2JGIA 1SBNE 4N1AA 1G63A 4Q34A 3OXGA 2VT2A 5IDWA 4GQAA 3JAMA 1C0IA 1SVLA 5IANA 1JTVA 4M8NE 1I0IA 3G6KA 4HLQB 3MUNA 4D8UA 5KYYA 1BX1A 3GD5A 4M1OA 1H8ED 5B37A 3RSOA 3AVVA 2I6GA 5AKKA 3HYSA 2JBWA 5F98A 4YMSA 2R84A 4RLHA 2OBFA 3OJFA 4K9SA 4RK4A 1VGRA 3ZKAA 1H3NA 2RG7A 4ZQBA 3BXZA 5BSTA 3PDHA 3PRJA 3ZLBA 4MKRA 4B40A 5KJFA 3EOZA 3AR2A 5DX1A 2IPNA 2XLCA 4HVTA 2RH8A 4XA8A 1Q7BA 3GDGA 2JKYA 3ND9A 4QU5A 4TWAA 5KBAA 3V7WA 3ZQUA 3R7LA 4BQQA 4OLBA 2XADA 3U9LA 4AVYA 1ECFA 3ND5A 3ASYA 4RHCA 4LF9B 1Z5VA 4FI3F 5J90A 5LVAA 4HZUA 4GE0A 4KXYA 5A5GA 3AUUA 2X4GA 3VU3A 5CVDA 5CBPA 1S5PA 4IRUA 4AN1A 4YBRA 3T9CA 2XOXA 1VA5A 3A9WA 1TOAA 4JGBA 3LXUX 4EZKA 4CM5A 2D7DA 3IV6A 1YZGA 1WZCA 1AKUA 4B3GA 3RW9A 1XYYA 3L1KA 3AYZB 1IXZA 2IZ6A 5EPUA 4TWJA 5I9IA 1XRJA 3M2TA 1GW6A 2JKVA 2X14A 1XZCA 5D0QD 5JA4D 2ZDHA 2I34A 4ZCTA 4TMFA 2ALJA 4HSEA 3R5SA 1JN0A 3C7AA 2BF7A 2Q8NA 2DIWA 4S3MA 2UYCA 2C78A 2FPWA 4NACA 2BKEA 1I7DA 1CR4A 1FLDA 2WSMA 1Q0RA 5B1BE 1OHHD 1CD5A 3EY9A 1SR8A 1JLMA 5LKAA 2MR5A 1PDWA 1D1PA 2X8LA 3QGMA 4HF7A 1LQUA 3OC6A 4ZT7A 4BEBA 1KDPA 4ZKDA 1T5SA 2VEDA 5J40A 2WICA 3KKQA 2Z3ZA 4P7GA 1PTKA 3GJTA 1HR0B 1NVBA 1YZYA 5EJ2A 3THXB 3IV9A 2FEXA 2HMUA 2D2EA 1UPCA 4D80A 2G1KA 1QNLA 3FFWA 1R64A 2ZT5A 4JXXA 1JJVA 2ZIWB 1YVUA 4K05A 5IARA 2OV3A 2E3JA 3OIVA 5BO5A 2YZ7A 3AB3A 2BFEA 3TCNA 4Z68A 1UDAA 3H2GA 1JU9A 3PJRA 2FPSA 3N28A 2Q6OA 2H2WA 4MGEA 3BWYA 4GVXA 3IHWA 2J30A 5IBQA 4C2TA 2JI9A 3ME5A 3I04M 4M99A 4DCPA 2V7BA 1PR6A 3VLDA 5A6CA 3OCZA 4F3VA 3RSEG 4HRXA 2C0LA 5DXJA 3NHPA 1F06A 3ETGA 5DM0A 2PJUA 4KSYA 2H18A 4BY9E 1DBPA 3IAUA 4ETIA 4R0MA 3H2YA 1EP2B 1WLSA 2ZSIA 3IAEA 2XKKA 4RTSA 2B98A 2J41A 4IKPA 3ZVMA 1O0BA 5LJIA 3TL5A 1NLZA 4RDCA 3HXLA 2OK7A 3QJ5A 2V7XA 1N5LA 4UNQA 4V0LA 1Y6ZA 2J7PD 1T29A 2OQVA 3JAKB 4EX6A 3TB6A 3ISVA 3RBVA 2ZZKA 4GWKA 4LV8B 1NBME 3VPDA 4FADA 2RC5A 2DEUA 1H2YA 1SCUB 1Z88A 4YUZA 5FLXA 3H9CA 2EZ9A 5M2QA 2H1SA 2WAOA 4CKCB 4R9SA 2BDEA 1X7ZA 3VNQA 2IYTA 2P9BA 2I76A 1U0TA 2QM8A 3W5HA 3EG9B 5AKHA 1CUXA 3G85A 3STUA 1F2TB 2Y0PA 2XTAA 4XVUA 3KO8A 5KX5A 4DMMA 3RARA 4QSMA 4MQ4A 2LSVA 3T7IA 1VRCA 4DNOA 4J76A 3H8VA 2H8GA 4TXRA 1XEXA 3GZNA 5FTKA 2ZRAA 3MAAC 1G21E 1AHNA 2EV9A 2R2LA 5CP8A 1NASA 2ZRJA 4B6OA 2QRQA 3RKVA 3Q4GA 5BN5B 3S2FA 1O7JA 1RHJA 1ENYA 3UKUG 4E21A 2V0PA 5AKZA 4KQ2A 1CQIB 1DEAA 1W4ZA 1LLFA 1LNSA 4UQLA 4TWZA 4BRUA 2R68A 4RIIA 1YB4A 3TIVA 3VR5A 2VNHA 1SXPA 5HS0A 2WWGA 3CB4A 1ZMTA 2AOXA 4XB2A 3FYHA 1H9AA 4JLBA 3IAHA 3M81A 1U4NA 2VBFA 2ODEA 2BKAA 3RUAA 3VR1A 1ZITA 1JZTA 2BGNA 4K1XA 2GVNA 2B35A 3MB8A 2A92A 4NV0A 2HZBA 1ECGA 1XTTA 4YAGA 1TL7C 5K4AA 5F4BA 4ENUA 3M5PA 2Z30A 5HK9A 3V8MA 1ODSA 1N33B 5A9SA 4Q4LA 3INNA 1XP5A 3TXMA 3CHRA 1IQRA 3EPLA 1RADA 3K2QA 2DERA 421PA 3VKGA 1GGVA 1TUGA 3LHSA 1KIAA 2ZTLA 3OHSX 2C8JA 2QSYA 1YJ8A 1EE9A 3AXTA 4IM7A 3QOXA 1IY1A 1KPHA 2VN8A 1HORA 1UBGA 3ZCPA 1ECLA 2YL2A 2V4MA 1M74A 2V7QD 3AO0B 3WGJA 2RHRA 5BQOA 4C30A 2WXKA 3SXUA 2QMUA 3FWKA 4DPLA 4QZVA 1A27A 4P3PA 2ACVA 4J8SA 3BM5A 3B1ZA 3DBHB 1YS9A 4WZAA 3DHVA 3WO0A 2I03A 3PVSA 3ELDA 4YWJA 2F2TA 1C3OB 1Z5PA 4DV3B 1U5AA 4V1CI 2ROQA 1ABBA 4QDJA 1IUOA 1I7PA 3MT7A 5T4HA 3QPAA 3WYDA 5FQ6A 3VLFA 1T3TA 3SWWA 1K3TA 2D5AA 1A9RA 3ZH9B 1UDWA 2QQ0A 1XU9A 4H7IA 4WEQA 5EJ6A 2P9HA 3NS7A 3JALB 4C6RA 4FYPA 3UOAB 1E77A 1LQ2A 1ZICA 3GROA 5LXTA 3HEMA 3OQIA 5T8IA 3NBKA 4EKNB 2GXAA 3DV2A 4YCAA 1PR2A 2IGTA 3D9HA 3D7LA 1TIKA 4CJXA 5KYWA 3AHIA 4M1KA 4R54A 5D1NA 4UMFA 1ZG3A 3B7RL 4EPZA 5H0IA 4D3XA 1UEJA 1GUBA 2P2SA 2PYDA 1HYBA 1W36B 1YJQA 1S02A 2RD2A 5DT9A 1PYGA 3RIHA 4F1KA 3WYGA 1N7IA 5CYPA 1N52A 4KWTA 1DL5A 3PC3A 4S1NA 3VOAA 4RZHA 4TTVA 5HCUA 3KQSA 1LTKA 3M8KA 4F2DA 4XWWA 3F6PA 1BU8A 4R1TA 3OOHA 4CIVA 1BX3A 2JARA 2ON6A 4CRWA 1FB5A 4I1OB 5EFZA 2EGUA 3OZCA 5B36A 2I6UA 2HDOA 3EA4A 5KNGA 5IG2A 1BXGA 5L3ZA 3L7JA 1H4TA 2DJIA 1EIZA 3S8YA 2QUAA 3A1NA 5GJBA 2OHHA 2FR0A 5BW6B 5F1KA 2PXXA 1FTWA 2WTAA 4MOWA 1I9GA 1IN5A 4PH4B 3I09A 5LWQA 1K7SN 1ZK0A 4N6GA 4UQXA 1K27A 5I4BA 2JLBA 1FFAA 2DWQA 3IQXA 1D7OA 2RK4A 1LUAA 1F2VA 2Q8QA 3KYBA 2WXMA 5FI5A 1ZN7A 4NLLA 1EXNA 2F90A 5IXJA 1H66A 2JAUA 4BEWA 3G68A 2HRCA 4FDMA 1XDUA 1D4AA 5JBIA 2ORIA 4EKEA 2WG1A 4CMIA 2DH6A 2OZLB 2B25A 2H29A 3C74A 2RHGB 4RA9A 3PD0A 3GAZA 3BREA 2UZ1A 3OLCX 4LC9A 2R6ZA 1WMDA 3PQ2A 3URKA 3OBIA 4JVOA 3DULA 1V4NA 4M0KA 1SRQA 4U07A 3AV0B 3EF0A 1MO6A 2NNLD 3R0ZA 4N3BA 1MAWA 2P2NA 1XYGA 2D7JA 1RD4A 5KO2A 3TJZA 4AZTA 1X80A 4D79A 3OTWA 1EU1A 3IOYA 4NICA 5D51S 1Y5RA 1GARA 3M6LA 4AY4A 1WXDA 1QPBA 3PZ4A 2Y0DA 3HWSA 4AUKA 2OGTA 4EJSA 4LOHA 1NJFA 4HDQB 1AQIA 3L40A 2GEBA 3JARB 1TQ2A 4NU6A 5ALPA 5HCNA 2I0FA 1W36D 1G0OA 4KBGA 2AKAB 2LRHA 2Z5VA 4LC1A 1PV1A 1U8YA 1YACA 2VHCA 2VNSA 2X2FA 3HB5X 5C18A 5LZ7A 2YWJA 4WBXC 3L08A 3ZQJA 2AVDA 4YP7A 3L79A 4RDXA 5B6JA 1IPEA 2OHXA 3U3ZA 4ETMA 4O5OA 3KPVA 2IEBA 2JD2A 4FFVA 1P5FA 2VSXA 5ENDA 2VJKA 3PHHA 4CV0A 3W9GA 4NH4A 3O3MB 2Q5EA 1KH2A 1Z7WA 1A8SA 3MMPA 2EXXA 3H1FA 3H5OA 2YIMA 3IP8A 2PX4A 4UCWA 4FYKA 3NWPA 2X5JO 3RRBA 5LOVB 1IY8A 1NWHA 3P94A 1T4DA 1J2JA 2CUTA 3MNFA 3C3EA 3ENEA 1Z9BA 3DL4A 5B2EA 5HBRA 3EVEA 3PFBA 4PFSA 1MOSA 2Z8YM 2CMKA 2GJ9A 4HDKA 4HLUC 1G8YA 2Y0BA 4HVLA 2YY6A 3DNFA 5F21A 2F67A 2FHSA 4O4HF 4TVBA 3PQEA 3CX4A 2VQEB 4QJIA 5HHTA 1QC5B 4LV6A 1DBQA 3PFGA 3KSQA 1V11B 4LMRA 3LY9A 3A11A 3DV0B 4LOAA 3NRCA 4K1LA 4YJGA 4DY4A 1KOJA 2GRJA 3WGKA 2OBXA 3IKLA 4RZQA 1YZKA 1XK6A 5KNCA 3PJEA 3VVMA 1Q14A 4KDFA 4XUEA 3IBEA 3D9QX 2NSLA 3O03A 4JZYA 1MB9A 3DUWA 3ZXYA 1ZL2A 3E7FA 2O7SA 3CSSA 2O7NA 3ETHA 3CR7A 2AMVA 4JB2A 2J3MA 3AKDA 2DLCX 3CU5A 4DIBA 3BG1B 3E9RA 4AJNA 4G09A 1DG1G 4HCJA 1P75A 1MJ0A 4HNVA 1MQSA 3TB4A 5C7OO 2XJ9A 3G7SA 2OCYC 1EE1A 3F7OA 4QPCA 2ZQZA 2DM6A 2UWJG 3JX9A 5FCDA 3RAPR 4HQKA 3RAFC 2JLWA 1Z5NA 1FRNA 5K4HA 4YUYA 3CNQS 1W85B 2IHZA 4OL0A 4AZ3A 3UJCA 3FLBA 3BL6A 3A4LA 4NQ0A 1X3LA 3HY3A 1GWNA 3AEZA 2QE7D 2H52A 3OU6A 2Q0XA 4AJ9A 5GONB 4TVSA 1GIAA 2JJ1A 3SCZA 2J4BA 4DMRA 1B8OA 4YACA 4WZZA 2PS3A 4EVIA 1ZP6A 4NQZA 3UFBA 3MJ4A 1LDBA 4B4DA 3O7WA 2F9LA 1J4AA 1B6SA 3IP6A 4MS6A 3RBXA 1AD2A 3MINA 1VE3A 3CHYA 3SC6A 5K8CA 1WPQA 3F9IA 5CK5A 1U28C 3IKMB 1VI6A 2B78A 1YR8A 2QX9A 1JA1A 1P74A 2VAXA 2C5GA 4XM0A 3DT8A 1M8FA 2D00A 4TTIA 3DT6A 1XQYA 4DG9A 1UP6A 3ICCA 5FI0B 4OSEA 3EAGA 2VSOA 2QLBA 3HKCA 1CDZA 4QUBA 2JANA 2DP4E 3V9PA 2L0TB 3F90A 1W0CA 3WJ1A 4GMGA 4NARA 2R8BA 4HWKA 2JZCA 3C48A 4C0WA 5CTJA 3CIFA 1G5QA 4F8JA 1ZJ4A 2C82A 3T4UA 3U60B 3MPUA 1OX4A 2ECFA 1FQWA 5IHPA 1RM0A 3FDFA 5CXUA 5UKDA 1E4OA 3FNBA 5AJLA 2Q1SA 1J8QA 3QF7A 5FBWB 5I5GA 3N3AC 2ZYUX 5EJ4A 3H4TA 4IIJB 1XDWA 2GETA 2XAUA 3U7HB 2P9IG 4YTEA 4MVJA 3DEAA 3DEZA 3NBYC 1L5SA 1AV7A 4KN5A 2G6BA 1OXSC 2QTVA 1CF9A 4JL5A 5EXSA 3IDQA 3GP3A 1M0WA 1KWKA 3TQHA 1GDHA 3BAZA 4YJ2B 2I3BA 3G2QA 2VUUA 4PVCA 1JEQB 4BJ1A 1SHLA 3WRYC 5ADWA 2YMLA 5JSHA 4R3NA 2OO5A 1MU0A 2XVMA 4LSZE 2C00A 3SR0A 1SOMA 1PR4A 4BNDA 1NSTA 1ZUNA 4JSTA 1KI6A 4IF4A 1E1RA 1A4XA 3EGDA 3KDSE 2C83A 3KZNA 1G9TA 2XB6A 2QRPA 1GPYA 1UOEA 3D5EA 1V1JA 2DULA 5K20A 1O08A 1X39A 1N5OX 4O1OA 1YE8A 1WHTB 4UDYX 4J0JA 3A6HA 3OXLA 4HJRA 3ESYA 4Q3KA 1JKJA 5C4IA 1J2EA 3IHTA 4F1SA 5AJVB 5KNBD 1YCGA 3CZQA 2GZRA 1C1DB 4E3WA 3STTA 2Y4UA 5CA1B 1E63A 2DY0A 2AI2A 2DBZA 5K3OA 1PHRA 4WY5A 2I65A 1TW3A 3CR8A 3CLTC 2FPGB 5IX8A 3GN2A 2F4NA 4BO5A 4L9AA 1G3IA 4ND8B 4F3KA 3Q87B 4HG2A 1A88A 4OI0A 4Q7LA 2FBNA 1FVOA 4C22A 3E48A 2NVUB 4AP5A 4HP8A 4OJKA 4FDUA 1NE2A 3KT8A 4I4TF 4C0HA 3PNBA 4UCXA 1P0CA 3DQZA 4NOLA 3LWZA 1TZMA 2J08A 2QD4A 1SRRA 2I4LA 4ZAXA 2BTEA 1Z4KA 5MFPA 3TECE 1UBHS 3PK0A 4GPBA 5DE3A 1QYRA 1XN1A 2YWHA 1GD1O 4B3JA 3GQBB 4G0VA 5CAEB 1PT6A 2OPHA 1L1QA 2BZ0A 2CMHA 1FDRA 3D3JA 1IN1A 4L4SA 5CXXA 3S1AA 5J2UA 3C6QA 3D6UA 2X8AA 2PSJA 2QNRA 1TYBE 1F0YA 4KNYA 2QQFA 1F2DA 4PC3A 1AMNA 4COOA 3A4MA 5M5BA 1U0LA 1QH1A 3D8TA 3VOTA 3IHVA 4XUDA 1FSSA 3AU5A 2PX5A 1P6UA 2W6QA 3MAGA 5LZ9A 4FR0A 2P58C 2JH3A 2X3YA 4GTQA 4C5AA 4A1FA 5FZQA 5E1DA 3NHZA 4IFTA 2XQFA 1PZHA 3UJHA 1AB5A 3R7RA 3M49A 4CIYA 4GM0A 2E4ZA 1KETA 1QP0A 5JC8A 1RQ7A 3ZX5A 4FOPA 4ZCPA 3C15C 3SVLA 3CZMA 4PCLA 4JHXA 4R8VA 5C8DA 1NOJA 4YYZA 2V55B 3BN3A 3EWAA 2X15A 3BDVA 10MHA 3GRAA 4TZ6A 4TXHA 3K35A 4YP0A 3ANSA 3P96A 2WU0A 4PYJA 1B89A 3ID6C 4F1WA 1YAJA 2VEOA 1N2EA 4PCUA 5BN4B 2BEVA 1YL5A 4UHJA 3DM5A 4GRIA 4HMQA 2IPAB 3MJEA 5EUMA 3W06A 1U1CA 3MX3A 4Y2XA 2ERXA 2ZB3A 4XEIG 3FA2A 4IZIA 1XQVA 3RODA 3KTOA 1XLUA 3PR1A 2I4NA 2RGNA 5KZMB 1TYAE 1Q0LA 1V8ZA 3D9IA 1V1MA 1YZVA 1HKUA 4MUGA 4Z3DA 1H9BA 1KEEA 1DDGA 2HMTA 1USGA 3IMKA 2H5EA 1MG5A 3D6AA 2WJWA 4KE7A 3FYUA 4LZJA 4MJXA 3R9XA 3HCEA 1WCWA 1Q57A 1UBCA 3LTEA 1HEUA 4NI5A 2FP4B 2WXIA 4Y67A 1GL7A 3GYZA 3U4QB 1MC1A 2ZAIA 2ZI4A 3UXMA 1XRRA 2RKBA 2HM7A 2PGAA 2IDJA 3TWWA 3DCNA 1I5EA 1L7XA 3FUWA 1WKVA 1JV2B 4L5CA 3U66A 3PLRA 1QJCA 1XVVA 1KJQA 1N2XA 3EZNA 2B4TO 1QLJA 2AFHA 3C24A 3K0AA 3R09A 2ZGDA 2QRUA 1NZDA 1X5BA 3ICQB 3L1VA 1OZFA 4S2EA 1Z0DA 4KKXB 5IVHA 3SZLA 4EMBA 4DCSA 2H1HA 4V1CB 1B41A 4KLNA 3ZTTA 1WWKA 4KRFA 3WB9A 2GN0A 3P2KA 3EQ2A 3WLTA 4XQ0A 2EZ8A 4PSDA 2XRMA 5C2JB 1SVIA 4X1IB 4UEWA 1COZA 4XD7A 3A8TA 1A9QA 1UFVA 3CVPA 4ZMRA 4L8GA 3H11A 4KDRA 4C88A 3F6BX 3QKIA 4IAOA 4I55B 1Z0ZA 3VYUB 4FHJA 4UVDA 2PZBA 2JFBA 1E0JA 2WC1A 2M32A 1A9SA 1VL1A 3FZEA 2PV0A 2YS6A 3E9ZA 5C5EA 1EI9A 1B6TA 1RWNA 5K0CA 2E9SA 3AK4A 1A7UA 5E2BA 3EC1A 3JQ0A 1PS0A 3H3XA 3AZQA 2A4KA 2G83A 1PJBA 4OOEA 3S55A 5KEIA 5E4TA 1HGXA 1XYVA 3B9BA 3V8BA 1NM5C 4HWGA 4GMKA 2FFJA 1PKEA 1T5BA 4BFWA 1J2RA 5SY4A 4BNFA 1W1UA 4HAOA 4HX2A 4ARVA 3U7QB 2JPDA 4M1MA 4J3FA 2GESA 4MGZR 4US0R 3ZIMA 4BX3A 1AQ6A 4ND6A 3T0GA 4CKBB 3L7DA 3W05A 4QQKA 1FFYA 4TRRA 1PR1A 3W3AD 1H8EA 2P7HA 2WUFA 13PKA 1M2VA 4UAVA 4DXDA 3GF4A 2JATA 3HUDA 5AENA 3IXLA 5EQDA 3E5RA 2NYUA 1R5BA 2WDZA 4JL8A 2E1PA 2AF3C 1WBBA 2BHRA 4FR2A 5LYYA 4EY5A 3S7FA 1AVTA 4Q3OA 2X77A 2TMDA 2IUSA 3V2GA 3F47A 1EGQA 2PX2A 1Q17A 3QHPA 2K6GA 1WEKA 5EGSA 1DEOA 1OOEA 3VLEA 3WLPA 4FHZA 2H2DA 3ABIA 3VU1A 3GRYA 1L5HB 4DMFA 4G89A 3IHKA 4WK2B 2XUGA 4X8OA 1JLRA 4WBSA 2JGDB 3VUEA 4JYAB 2L6BA 3VKVA 3SF8B 4N5QA 1J97A 5CLQA 4HXYA 2AMFA 3GCGA 2NTJA 4LC0A 4X41A 3ELWA 3CT4A 4URFA 4B33A 1MB0A 2YY7A 4P0QB 4DM4A 4EAQA 1TZ2A 3ILVA 5A4FS 4URHA 4YEDA 1Y1KE 1XZDA 1E2KA 1DAMA 3OX4A 4IHQA 4NENB 2H6EA 1E2HA 2C98A 5H81A 2FPUA 4PSKA 4BFUA 2YHBA 1JHQA 2VO1A 4X97A 1DC6A 2BFFB 3TZKA 1F8UA 2EYUA 1XVIA 3PG5A 3E37A 5BRJA 1KGSA 4QGBA 1DUSA 3JZMA 2PQNA 1N5KA 1MB4A 3RVSA 5HMLA 1Z5SC 1GLVA 2Z3WA 3CNNA 4GYWA 2VYQA 3A06A 5LBIA 1WG8A 4QYXA 2ATXA 4ZFHA 3HZZA 4DBLC 1VMKA 4KFCA 4M9RA 4E12A 3O8QA 3PL5A 5LNK6 4ER5A 4YDWA 5J59A 3HXPA 4PPGA 4RY2A 3N8NA 5GM2A 2Y0BG 3CQ9A 5AI5A 2H07A 2H4WA 1PBTA 3RC7A 4C3VA 5KJ1A 1XZAA 4GL2A 4OAQA 4HXGA 5AUPB 1V1RA 1ZR4A 1C29B 1T8YA 5KTOA 1G7RA 4DE5A 2JF0A 1ZZGA 4YT4A 2X58A 3RASA 4F6LA 1EHCA 3NQ41 3PI7A 2G70A 3M6VA 3DUFB 3I30X 2Y2UA 1E6LA 2H4FA 1W0KD 3IUYA 1WB4A 3R3WA 5DW0A 3UPUA 2VBIA 1JU3A 5AKEA 1CUUA 1U2EA 3DZDA 2BN4A 5MGNA 1MNQA 3AONB 4A03A 1OI4A 3C70A 2C96A 5IKOA 1JEYB 2H2GA 4RCYA 3P32A 2Q07A 3P4UA 3IQFA 3DAOA 2ECOA 4RY9A 2VYIA 4I2NA 5GIOE 5AP9A 2INGX 2CXUA 2KLHA 2HCJB 1QHYA 3EUAA 3ZI4A 4EG4A 3IEUA 4EO7A 2I1KA 1B73A 2KLBA 4CR7A 2EBUA 1W49A 3KZ1E 4OEHA 2YHEA 2OCCE 4WFKA 3N87A 5C34B 1X8JA 3CSDA 4BXOB 3HE3A 1Y98A 4E4RA 1Y42X 1ML4A 3GFQA 2I2XB 3TLCA 2WJ6A 2J7PA 5JNTA 1LF0A 1FPPA 1PG2A 4X63A 3OPNA 3V8EA 2ZIXB 4Q4JA 5CFMA 1FMFA 2J46A 1ZM2A 3GEBA 4LJ5A 3MWEA 1S0UA 2ZPUA 1TYZA 3EUEA 1GPJA 2FUNB 2EIME 1ZD5A 1XHEA 3BMCA 3C3XA 4DMCA 1FVXA 4CEIA 4TROA 4DB2A 4J9VA 1JWFA 3LUCA 4YGYA 2VYVA 4WE3A 3VI4B 3C3OA 1E9DA 2BFDA 1FSZA 3FAZA 2ZPAA 4HDNA 3BWVA 2VSYA 2FWPA 3UXHA 2BUAA 4Y6QA 1QKKA 4JB8A 1MEEA 3ZCXA 2C3YA 5JLJA 2OSVA 3IB3A 3IH5A 4A2WA 3TVTA 5CIQA 2P62A 4V0KA 1MXHA 5IVKA 1P8AA 1NVTA 1NUAA 2UXDB 4F1PA 3A32A 4GB9A 3THXA 1K6MA 3GFFA 4W7IA 3DPUA 3GLFE 4BJ5A 3IO5A 2J8SD 1CJBA 5DH9A 2Z2YA 3HXCA 4JJ4A 2WTMA 1WU7A 4QTUB 2IOFA 1DCFA 4EKDA 3L1HA 3EF3A 2AQ8A 4PONA 2XX3A 2OV2A 4OHMA 4L5JA 2JGJA 3HZRA 4MVJG 3ETCA 2EEPA 4YAOA 2PT6A 4QEKA 3PNPA 1B0PA 3PKZA 3MOGA 3PRKE 2BJHA 1JJAA 5GV8A 4E6HA 2PA3A 3UWOA 2VCHA 3LYAA 2WD9A 2P0EA 3QAQA 4OHCA 4KXQA 3UB4A 2HO5A 3FZYA 1GGMA 4OHKA 2UYGA 2FEAA 1VE1A 4JCOA 1YR3A 5KKAA 3PS9A 2FPMA 2REQB 2R17C 2Z57A 2VZ8A 1QUFA 4H59A 1N4PA 4EHKA 1GL9B 4OKSA 5KAPA 3NC4A 2WJIA 4CF6A 2AFVA 2KS6A 3D8HA 2V7QA 3I6MA 4UTXA 3ZUVB 1D0IA 3H9EO 3OUUA 3CPHA 5CEDB 1A17A 4TSFD 3R74A 1TADA 2UXCB 5E3HA 3CINA 5JOQA 3VDNB 3FKJA 2PR2A 3JAKA 2ZUVA 3QV1A 2EX1A 3AY6A 2Q6KA 2RH5A 3P9CA 2IUUA 1I7SB 2IQIA 1L7EA 4E33A 4NJOA 5F3DA 4Y6SA 4PPYA 2R7MA 4ZOLF 2CY0A 5KYNA 4HRAA 3G2SA 3IKJA 3HM9A 3EG9A 4JY7A 1F1JA 1XI2A 5J4HA 5AVOA 3D8BA 3L7KA 3T3NA 1F2TA 3GGOA 4NRHB 2REXB 3W1VA 2J0UB 4IX1A 4MUXA 2NUTB 1DGQA 2XKJE 2MSWA 2QQGA 2O2HA 3LEWA 2IYRA 3CLTD 2PZGA 4WACA 3O21A 1KE1A 1FLAA 3K0HA 3IRVA 4DMUB 1SUDA 4L3WA 4XKJA 1O2DA 1K5PA 2EWVA 1BVHA 1R6TA 5BN5A 4U2CA 2WYUA 3KR2A 2V7VA 1CQIA 3Q85A 4NVRA 1A97A 4H7XA 3AVWA 1QCDA 1ZGZA 2A1TR 4EQFA 3KKMA 2XRYA 3FLAA 4YRGA 1T8WA 5LD2C 4M22A 2LPMA 2JIQA 4GICA 4O2LA 3OVMA 2FN9A 5IMBA 4IR7A 1EDZA 3DZIA 2RGBA 3AP2A 2N1BA 3LH5A 1BMTA 5KI6A 4RTPA 3HNPA 4JA9A 1KXZA 3GD7A 4WIAA 2PZEA 3GWGA 4PNEA 1LPSA 4NBSA 1WP9A 1OCRE 2M6LA 3I39X 1DIGA 1HFWA 4US2R 2LBPA 5ALKA 3ZWKA 3MMNA 4BP9A 3AUAA 3LBFA 3S0JA 3DTVB 3QU7A 3TRIA 1JU4A 5ITZB 1FX1A 3IUNA 1WDKA 3WSTA 3I73A 3HBFA 1C1XA 5JWRA 2C7GA 5BUSA 2A9OA 4AXHA 3DJYA 2WVHA 4J0QA 1F7UA 3EZYA 3GVXA 1QVRA 2FPOA 1N57A 1K88A 1DV1A 4I7EA 1JVBA 3QY9A 3DAFA 3HYMB 5TB5A 4OUKX 2Q1TA 5JS7A 4EWLA 3C43A 3TQTA 1YQUA 4U3JB 3LM8A 3KJHA 4BY6A 3T4XA 1D0VA 3HDTA 2OCBA 4TMWA 4KEAA 4ZI5A 3RPEA 2QLJA 2B20A 4IDQA 1I3OA 3QI7A 2R05A 5CVEA 3EB9A 2AXVA 2ZYDA 3Q6IA 1VP3A 2BCGY 3HNRA 3QBDA 1EZZA 1FRZA 3L1JA 3PC7A 3HDJA 4Y6LA 2IF4A 1QO9A 1ZAKA 4KR9A 2HA5A 1X3SA 1U3GA 1EX6A 1QBKC 2ZR8A 2FI1A 1ZL0A 2OR3A 3AESA 3VC1A 1IZ9A 1P4SA 3L5OA 4UOEA 1CB7A 3BKWA 3AI3A 4K6OA 4KPGA 1U7HA 3KB2A 5JECA 2YBDA 5T4BA 1RP7A 2GRMA 4EMUA 4RTJA 2B4KA 2C5FA 2CMDA 5CD9A 5MF6A 3LO5A 1UR5A 1JPLA 2JEZA 3T61A 1SG0A 1YS4A 5CH3A 1II9A 3HVHA 1O5OA 3BTUA 1Q21A 4OJTA 1TZCA 1QH8B 4E5VA 2GN6A 4RTNA 2ZLBA 1PYDA 5AUQA 1EK1A 1YR7A 3NORA 3H19A 5BOVA 2ECKA 3L22A 3AKEA 2JIOA 4D25A 3PEUA 3HV0A 4O08A 2G8LA 3L7CA 3Q8MA 3F3KA 2PKEA 4WVFA 3QLEA 4DK5A 1EXMA 2O1WA 4KYTA 4I1OA 4DIKA 2UZ4A 2W7TA 5JJ7A 4KGVA 3DAPA 2WWIA 3I0NA 1KBQA 3ULEG 5HFAA 3SQMA 5FH9A 2ODPA 3GY0A 1YMUA 3NOXA 4L8VA 4ZJUA 3TKYA 1LS1A 2WYVA 5TXGA 3M5CA 1VIMA 3C3KA 1K5GA 2VK8A 5EQJB 4RHUA 1Q20A 5AT1A 4L27A 3KYDA 4EF4A 2O0MA 4LWZA 5K7SA 3DTVD 2DTEA 4RJLA 5COBA 1E96A 3TEJA 4I1AA 4EFKA 3QHQA 5U9CA 3ECSA 3HWRA 1KS2A 1DKRA 1NJ5A 3FYDA 3CURA 5IZCC 1FXWA 5TE9A 3WB2A 4AJIA 2OGZA 4F5WA 1E7SA 2I7XA 3UX4A 2PXHA 1VRWA 2X6KA 4GX0A 2GRRB 2OZLA 5H5JA 1JFVA 1WSDA 4TZKA 2NZWA 1J1UA 2AUTA 2XCCA 4FILA 4JGGA 1S2GA 1XPUA 2CG2A 2FGKA 2QNBA 4MI6A 4YBZA 2IKQA 1E58A 4GBMA 3I52A 3EBLA 3HB9A 2YVLA 3NIDB 2OYRA 4EH1A 2F3SA 4M1WA 1OXTA 1VDYA 1AHHA 3RJMA 3O47A 1HF3A 4BNYA 4QWWA 1DOAA 4X1KB 3S4YA 4PBTA 4JX8A 3NWEA 4F45A 4V24A 3QVVA 4GLLA 2H5JA 4F53A 3V9AA 2WWWA 2QP9X 1XXHE 4X60A 2F1HA 4RW0A 4WOKA 4K9PA 3CO0S 1G1MA 1PWXA 3HVRA 4Q37A 1OKKD 2VK2A 4R7TA 2DFVA 3LVBA 3ONNA 5F52A 5IC6A 3WFIA 2XNCA 3CONA 3A04A 3GDWA 4E2ZA 2IXDA 1A5EA 1WXGA 2ZSJA 1U0OC 2QG6A 2PMBA 1BW9A 3JZIA 2P3LA 2AW5A 2DCMA 4DCVA 3Q10A 2DBQA 3Q3EA 3MBKA 1M5UA 5DYWA 3D7SA 1IHOA 1CY0A 3P4YA 4WJKB 1TLLA 4URWR 5K3SA 2CF5A 3ECAA 1UMBB 4RUKA 1HH4A 2H59A 2QE7A 4GSKA 2Q8PA 1NYTA 5ARBA 2H7VA 1W7AA 1KT1A 1T8RA 4U0ZA 4KMMA 3UK0A 4J7WA 2O57A 1R8QA 3PJGA 3A9CA 1RRPA 5JCOA 3AOEA 2DWUA 5JH7B 4RK7A 2FZKA 1M1ZA 1MX5A 3ZWYA 3IR7A 4DQVA 2QX6A 1WW8A 5CCLA 2QZ9A 1L4EA 1V48A 2Y76A 4TS9A 3I61A 4D9GA 4RYDA 3OM8A 5BPHA 4AURA 4FR5A 3GELA 2GZHA 5F51A 1Y34E 3K32A 1E3WB 3FHTA 3HNOA 1X7YB 1Z2OX 4PS1A 2VYVD 4LPSA 1ISJA 2IYPA 4FHCA 1Z5UA 1QC5A 3Q7EA 4Q4AB 3B6MA 4I1IA 4I46A 1ZUHA 5EEHA 2NV6A 4LJYA 3SC2B 1SVSA 1SUEA 3MJTA 5K51A 2AVPA 3TVYA 1RHMA 3E33A 1SU7A 3NDIA 3ZDEA 4B73A 4ABYA 2FRDC 3QBEA 1VHJA 1FRQA 3C6KA 3OQBA 4CYMD 4WGFA 1E61A 2PBLA 4KAFA 3U4AA 1ZN8A 2G7ZA 1L8XA 1KQOA 3SEAA 3UTDA 5DGXA 1GG9A 3AW9A 2FX5A 2APJA 3ZD7A 4BX0A 1T25A 1HK7A 3WGNA 3S1SA 2JLUA 4FC7A 3LWDA 3N5CA 2DSNA 4ARSA 1L5GB 4P4LA 2E48A 4HDSB 4OP2A 4QECA 4OJQA 4YCNA 3KOOA 3OKPA 1YONA 2J3KA 3BC1A 4GU5A 2CXQA 1SURA 1Y8QB 2FK7A 4HOQA 4HVAA 1EESA 1GAQA 1KWGA 1N1MA 1Y5NA 1CJKC 3DGFC 1S3GA 1QYCA 3MGGA 3OF5A 2RHDA 3V1LA 3GW4A 3UMFA 4RBNA 4LYEA 3HKEA 3A6PC 5FAKA 2CN1A 4C06A 1DSSG 3O9ZA 1QDUA 1DTWB 3LQFA 3M4XA 4I1PA 4DYHA 5KNBA 1KOLA 2CL7X 1KS9A 4IDCA 3SI7A 2ZIZA 3IDSA 1Y6JA 1LW6E 4DAEA 4E5DA 4JI4B 2HPAA 3M6IA 1SVMA 3WK4A 3GR6A 5JJ5A 3UJ3X 2B36A 2J4FA 1BD4A 1NQTA 3ANTA 1L7AA 1VB5A 4NFYA 4LJ7A 2EDCA 4CKYA 1NXPA 5INTA 2G6TA 5EJAA 2P27A 1Y8MA 3RRMA 4L4ZA 1P7ZA 2C77A 3PIDA 2CLSA 4ND7A 4NL4H 4AQ7A 4ACBA 4NATA 1OH7A 3QNUA 5AJHA 4KQFA 2UYYA 3VYSB 3OESA 5LQMA 1UJKA 5I7FA 1IJBA 5G1NA 1U1EA 1PP4A 1HDIA 3WLHA 4WESA 4RCVA 5JMND 3QENA 3LDHA 4B4KA 4J2TA 5G40A 4ZCLA 2CEAA 1LBSA 3ESBA 2ORVA 2FPXA 3S7JA 1TKAA 2FUG1 4KLRA 2DUNA 4D9HA 3R9KA 2IIPA 5KVQA 4O1PA 4HOUA 1F0PA 1G1AA 5KJKA 2CDRA 2HK7A 3QFFA 4OAUC 4QBHA 3EIOA 2P5UA 3TL3A 3FYSA 4AZSA 3CCCA 1EA5A 4CV3A 5AI8A 4CIWA 3KT3A 1OX5A 3U4MA 3SBTB 5FXMA 3UCEA 3ZGLA 2GSDA 1FDSA 1SEPA 1P7YA 1LPMA 3U4HA 4YJ2A 2WIKA 4J0IA 1W5BA 4JLKA 4JVSB 3ZPJA 1JSLA 5HK8A 4CM7A 3TW8B 3AG5A 1O57A 3NFRA 5LD2B 2B1QA 1H2UA 5T7BA 4OHPA 5JZOA 5C37A 4HXIA 1T9CA 3ZBUA 2XXJA 5HW0A 3NTXA 4EMSA 5FTLA 4JA2A 3T5CA 3T3EA 4OB7A 4IUCS 5ALFA 1ZXXA 3MLEA 1MIOA 1SC1A 4RHFA 4LRQA 5JDCC 2Q99A 4OH7A 1ESDA 4MP8A 3G13A 4C0JA 2P2ZA 4FS8A 1Y5MA 1XJQA 1OU0A 3L8GA 2ACKA 2N47A 3R40A 2Q9BA 3EXEB 2CNKA 2XF2A 3PXXA 4BS9A 3BGDA 3MT0A 3A6KA 3FFAA 3KFLA 4D0NA 4RWZA 2GPWA 4DY6A 5KTPA 3AGQA 4XAQA 2FPGA 1HXIA 2I7CA 3E2PA 1JLLA 5LU9A 1W35A 4LAFA 3A9UA 3DDSA 4AN4A 1QUEA 5E6SB 2ENUA 8ADHA 2QM0A 3WGHA 1I3CA 1MJGM 4N8EA 2XQGA 2D3TA 3C97A 3EEFA 4FNMA 2VDOB 3FRIA 4MJLA 1SVWA 4XM1A 1RNLA 2FZ5A 2GUGA 1OCOE 1Z47A 4ESHA 3MC1A 3FF4A 4P4SA 4UFOA 3LV8A 1MTOA 6Q21A 2H9IA 3GQBA 1VL8A 4H7KA 3KPYA 4MCHA 5KNHD 1ISMA 5LP0A 1G19A 1E66A 3I4RB 1E7RA 3QP9A 2BKXA 5HKAA 1W44A 3BULA 2BTDA 3TPFA 4N7JA 3I58A 4ZCQA 1KYVA 3G89A 1GAJA 1QH0A 4DIOA 4B2LA 2PMWB 2RKWA 5JXGA 2VRWA 3P1JA 3GUCA 2Y4NA 1KRHA 5FUYA 4YRLA 2ZI6A 1DBIA 3HI4A 4OVKA 2BSAA 7GPBA 2C5AA 2P2LA 1N3IA 1QGZA 3EVNA 4OAOA 2Q45A 2OCDA 3UIEA 1G5TA 1XALA 4X3CA 1T10A 4ZICA 5TMDA 1QR6A 3OCCA 2IHUA 5SY6A 4UKDA 1KQNA 1ZHOA 4RA6A 4WFJA 3CKMA 4XUCA 1NQAO 4Q96A 3L4SO 3SOZA 3ASNE 4O2AF 1DHTA 1QVVA 4CVNA 3QWAA 3SS8A 3L3BA 1QHHA 3N6RA 4HAVA 4DARA 2A0XA 4UQZA 5J43A 3UICA 4F3TA 5EIBC 1J24A 2WE7A 1VBMA 2EP7A 5FV7A 2RBKA 5BN4A 4Z8YA 4MULA 2DC1A 4F8YA 3GNTA 4V0SA 2ISSD 2O20A 1G8KA 1RJ9B 1GILA 5K0NA 4AP2A 5AKIA 4ZRNA 3DEKA 2HKIA 2D54A 4AMUA 3I9V1 2D0OB 4EG1A 2FUCA 3W3AA 1N92A 4RVOA 2IY0C 3GGGA 4JMLA 5IT0A 4F04A 3KSRA