4BX8A

Human vps33a
Total Genus 214
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
214
sequence length
596
structure length
568
Chain Sequence
AAHLSYGRVNLNVLREAVRRELREFLDKCAGSKAIVWDEYLTGPFGLIAQYSLLKEHEVEKMFTLKGNRLPAADVKNIIFFVRPRLELMDIIAENVLSEDRRGPTRDFHILFVPRRSLLCEQRLKDLGVLGSFIHREEYSLDLIPFDGDLLSMESEGAFKECYLEGDQTSLYHAAKGLMTLQALYGTIPQIFGKGECARQVANMMIRMKREFTGSQNSIFPVFDNLLLLDRNVDLLTPLATQLTYEGLIDEIYGIQNSYVKLPPEKFALPTEAKKLQLNSAEELYAEIRDKNFNAVGSVLSKKAKIISAAFEERHNKQFVSQLPHMQAARGSLANHTSIAELIKDVTTSEDFFDKLTVEQEFMSGIDTDKVNNYIEDCIAQKHSLIKVLRLVCLQSVCNSGLKQKVLDYYKREILQTYGYEHILTLHNLEKAGLLKPQTGGRNNYPTIRKTLRLWMDDVNEQNPTDISYVYSGYAPLSVRLAQLLSRPGWRSIEEVLRILPGPHFEERQPLPNRVTLIFFLGGVTFAEIAALRFLSQLEDGGTEYVIATTKLMNGTSWIEALMEKPFH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords VACUOLAR PROTEIN SORTING-ASSOCIATED PROTEIN 33A
publication title Structural Basis of Vps33A Recruitment to the Human Hops Complex by Vps16.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
total genus 214
structure length 568
sequence length 596
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00995 Sec1 Sec1 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.850 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4bx8A04
3.40.50.1910 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4bx8A02
3.40.50.2060 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4bx8A01
3.90.830.10 Alpha Beta Alpha-Beta Complex Syntaxin Binding Protein 1; Chain A, domain 2 Syntaxin Binding Protein 1; Chain A, domain 2 4bx8A03
5BV0A 1FVHA 5BV1A 3PUKA 2XHEA 4BX8A 4CCAA 4JEUA 4JC8A 1EPUA 5BUZA 4KMOA 3C98A 4BX9A 1FVFA 3PUJA 1Y9JA 1MQSA 4JEHA
chains in the Genus database with same CATH superfamily
1RIFA 2QTZA 2C0PA 5DLPA 2Q1WA 3NIBA 3DLTA 2XHZA 4ZFHA 2F90A 4J0JA 1TMKA 1L5ZA 1NOIA 3U4AA 1Y48E 3G2UA 3Q10A 1EX7A 1WZIA 3EGWA 5BYAA 3QXHA 3VU9A 2Y99A 3VOTA 1I32A 2D59A 4ATZD 4N0QA 4GSLA 3L7YA 3SYLA 4I4TB 3KOZA 1QP4A 4FIZA 5H7PA 2HWWA 3ZBQA 4OHUA 1TM2A 1LFDB 1Q0QA 2DEUA 5IJWA 1F7VA 1O9BA 1I5EA 2E4VA 3TTUA 1RJWA 3T7AA 1YS1X 1UF9A 2HCBA 221PA 1EIZA 3DOEA 2GK6A 4CT5A 1P7CA 1VL0A 1TNUA 3A11A 3LIIA 1VGVA 2ZSDA 1O9HA 3AERA 5F4BA 4F1KA 1H6BA 4XQGA 2YFKA 4WJLA 1G19A 5JALA 1CHNA 4BNWA 4DR1B 1DEAA 2VZLA 1P60A 3A36A 1PW5A 4FDTA 2FZWA 1E98A 1U0RA 2JIRA 5SY9A 1WB5A 3U19A 1YZNA 4Q34A 4CM5A 4NZOA 3RTEA 3JATA 5AM0A 3SQMA 4ZJZA 3DXMG 4L5YA 1O7JA 2V7XA 4KI0A 5I7WA 1DQPA 1O6FA 3GZ2A 3URZA 1JDVA 4R71A 4YJFA 2IHYA 2EYUA 5ER6A 1D6SA 2SNIE 1X15A 3SC6A 1E9CA 2DBZA 3JQBC 1UBMS 1LRLA 3HSKA 4Q05A 2G0TA 3PTLA 3SX2A 1M0TA 1CYEA 3TFOA 4CU2A 4W5NA 3I4CA 3TRKA 3WLKX 4OYSA 3QVSA 4XYBA 3ZWAA 2QTBA 3OQNA 4ZT5A 3WV4A 4RENA 2D2FA 1C3XA 2XX3A 3ZVLA 4RA9B 3X2EA 4DILA 1RQ2A 4W6ZA 4WN9B 4Z4IA 3LWBA 1TIPA 3GDWA 1QQ6A 1IXYA 3KQHA 1CUUA 5TB5A 5IVDA 5M5BA 4Y0AA 4JENA 2EX0A 2ENUA 4KR2A 1SVOA 4KQMA 2F55A 5EWJA 2Y0BG 3QVTA 5IT4A 4DA4A 3GDHA 4QUGA 5C8XA 5C9ZA 2WNIA 3L1IA 1UKYA 5DM70 4WOPA 2XDWA 3WIUA 1B15A 3VOBA 4MPRA 4RS3A 2Q0XA 2J5RA 5BWOA 1Y42X 4IJVA 4ENPA 3HA7A 3FTVA 3QDNA 3BZBA 4BNNA 1PTJC 1QU3A 4MWCA 5JLAA 1GKYA 3LLSA 4ETMA 4OQPA 1RWQA 3R9MA 1XQVA 4BV8A 2CG2A 1X1DA 2EFGA 2CE7A 1PR5A 2AL7A 1B42A 1CDDA 3EA0A 5CAEB 3FPFA 4CWAA 2WB4A 1SVMA 3HA3A 5EE3A 2FVYA 2XI4A 1E0AA 3DDUA 2NVUB 4L0MA 1O95A 2XSZA 1U2EA 4RZXA 3Q0IA 4Z3KA 3M2PA 3JQ1A 1M1YA 1V9SA 4BQPA 5LUAA 1XAGA 1WR8A 2IK8A 2BVNA 1FFGA 3GY0A 4HCJA 1B6SA 3L01A 4FSHA 1VBKA 4KO8A 2Q5EA 2JEOA 4W9NC 3OX2A 2RK6A 2DBYA 1O6ZA 3MJDA 3MX3A 2EIHA 3QHPA 2G9ZA 4OG2A 1K0FA 2ZJFA 4NFHA 1NTRA 1KEEB 3O93A 3EMKA 1W5SA 1NDUA 4LUCA 3LS8A 1B6TA 4UXIA 4PCUA 3V2IA 4Y6GB 3RVQA 2P9ZA 1E3SA 3G2HA 4AXBA 3BXGA 5DX0A 3E2PA 5JJ5A 4PO9A 2XPCA 5LMNB 1TAQA 2PUDA 2ZSIA 1V5EA 4YY3B 2I2CA 1BGWA 2EFYA 2LZ0A 3H2KA 1TKBA 3GJYA 1H0HA 2YXLA 3IEMA 2AXZA 4ND4A 4ALMA 4WCDA 1LNZA 2C77A 3O2QB 3KHSA 4HVAA 3A3OA 3CONA 2R59A 4BTBA 3QX9A 1WAMA 1D2MA 1X1AA 2WUEA 2K4MA 1IM5A 4Y9TA 1FDRA 3AJ8A 5JD3A 3WGMA 2CUTA 4K3UA 2M9MA 1EK5A 3T3PB 2WSMA 1QQEA 2WAOA 4D43A 2COEA 2X0KA 3ILVA 3C74A 2BONA 1VKJA 4HAOA 5GWXA 4UHFA 2H3HA 3AU8A 5D5QA 2REOA 4QDTA 1DBIA 2K2QB 4JLJA 1DRVA 2W93A 1NURA 4YRBA 3BTOA 4Z7NB 1PVDA 5KNLA 5FWYB 2HPVA 1ZGGA 1BWSA 1QK5A 1UQRA 4TVBA 5FBQB 2DGDA 3A6DA 4CW7A 4W1QA 2IDZA 3D7RA 2Q6OA 2JFVA 1X0VA 2VDPB 3VA7A 3RM3A 1MJ5A 1U2TA 3LUJA 5SZJA 1JYFA 3DE0X 1CUDA 2QVBA 2NAFA 5H16A 1VA4A 4XEUA 3EQ2A 4NJMA 4IIDA 4FYKA 4RELA 4D4KA 3AZPA 1CY0A 1OGJA 2VYVD 2J4DA 3G2SA 1UMBA 4KBGA 2QUAA 4I3FA 3KZKA 2WIJA 4MNTA 1HT2E 3AWIA 3FCOA 1UEJA 3WB2A 4C0LA 4CCWA 1SVXA 4HLCA 2YDXA 1I5OA 1Y8RA 4ZGBA 3V32A 3LWZA 3WZMA 3BG1B 3K4HA 4JQZA 3E9CA 2VNIA 2JAQA 1S2GA 1NASA 5HUHA 1BXRA 3DULA 2XITA 4HBDA 3ASNE 2HCRA 4QZVA 1TXGA 5DHQA 5L3VA 2XLCA 3FMPB 1LWOA 1T9HA 1VP9A 2OV8A 5KCMA 2EU8A 4R9SA 2ZGVA 2XBMA 1HT3A 3GGOA 1NYTA 4M89A 1QJ4A 5JNTA 4PLWA 4W99A 2HRQA 1SG9A 4YLEA 3GD7A 2A4MA 3VNSA 3AT1A 4C5CA 3P2YA 2V7GA 2X6HA 2JKVA 1FDUA 3TSCA 5AK4A 4YJHA 5IBQA 4E5UA 2WF8A 3OZBA 3V1MA 1PGQA 5CIYA 4R5HA 3S2FA 5I9TA 4E4RA 4JA0A 1WO8A 1J49A 4QEKA 2NLOA 1YQTA 2W83A 1U8XX 3CF4A 1D07A 3PRHA 2A9FA 1KZPA 2G9RA 1G3IA 2X1MA 4YJ2F 4I9EA 5CRVA 2CXXA 2HJ9A 4YAWA 3B6MA 3PPVA 3OOEA 4LXGA 2PKWA 3HO6A 2K87A 4EG3A 4B4OA 4LNAA 2NN3C 1DWPA 3IV6A 2AEFA 3WJ1A 3O48A 4KMOA 2IZ0A 1V6AA 3JVUA 4QPPA 2JA1A 3HJNA 4F86A 1ZCBA 3OZXA 3HCOA 5TJ9A 2NP6A 1ZMXA 3PG5A 3S4YA 1NQOA 1CP2A 1SHUX 3UATA 1EPUA 1TNOA 4G2NA 4IDCA 5AO9A 2MYOA 1CULC 2J0UB 3N53A 1QAMA 1I1NA 4DBLC 5LXTA 3FUJA 1DTSA 3CKLA 3FHEA 2DY1A 4XE5A 4TKVA 3L13A 4LOJA 3KQVA 3OZTA 2ETBA 5ARFA 4LC9A 3V4SA 1MFPA 4AG6A 2JLZA 5AIJA 1XFDA 3LDHA 1EHCA 4FZJA 3SR0A 4BQFA 3HYRA 2JJ8A 4B43A 1I2CA 3TW0A 5FKJA 3ASGA 5JNWA 2YY7A 1N7HA 1Z8FA 4R2JA 1YK1A 4II2A 1XKTA 4A16A 4J6FA 4JT4A 5HOEA 1LNSA 2P9LG 2XRZA 3HDYA 6NULA 3R7AA 1Q0TA 4FEAA 2MSNA 3GLHE 3YASA 1AKYA 2OZPA 1PNRA 4ENWA 3ABRB 2DECA 3VR5A 1I2ZA 4P53A 4FONA 2GJ4A 2BD0A 1X13A 3SYKA 3K9IA 1OXTA 4BCCA 1REQA 3ZYCA 1LA2A 4GXNA 3F6SA 2E5LB 3SF0A 5B7GA 1WAO1 1LH0A 1JPJA 4DNPA 2AD1A 2UYCA 1Z4QA 4CKWB 1N92A 3Q8XB 1A5TA 3GMIA 2N1BA 1S63A 1PWHA 4OUDA 5HS0A 3ONVA 3SK0A 4IRUB 3W9YA 1TF2A 2R60A 3CUTA 3W2IA 2G5GX 1FLNA 4JLVA 2C61A 2GM9A 3V79K 2BGRA 5L7TA 2JHGA 1BMFD 3RKVA 5EZ5A 5A2QA 1MZCA 4HEJA 3HDGA 1XGWA 3HB7A 3E03A 1HDEA 3ZOKA 2QG9A 3WRYC 4X54A 5B6PA 2JFHA 3A1TA 4IFTA 4H27A 3N2NA 3P0FA 1OFIA 2D62A 1N36B 4EUKA 1YA8A 4J3NA 3CB4A 3WK8A 1G8GA 2M6SA 4Y9SA 1LQ2A 1MG0A 3UI2A 4OXRA 4DB2A 3GNQA 1TR4A 4L1BA 1R37A 2ZRGA 2ZTSA 3MRTA 5IM4A 1NWHA 1G9SA 3E81A 4LVOA 5GJVC 3U44A 3S81A 3FX2A 1XD9A 2EFEB 3F9CA 4JFAA 4OHOA 2BGWA 5JJIA 3NHUA 3IIKA 3DXKG 3KQOA 4EHJA 3ZX4A 3Q7AA 4YT4A 3KJGA 1ECFA 4JEIA 3KKEA 2WKRA 4M0FA 1I0LA 4CM7A 2GXQA 5AVQA 2D13A 1ZLXA 5JCJA 1TPZA 3H87A 4KOAA 4OAPA 3DMNA 4CGVA 3ZXUB 4RPIA 4PNZA 1H85A 4FJYA 4XD2A 4W8GA 1KDOA 2EYQA 2EDCA 2P9GA 4CM3A 3DLPX 3HYCA 5ENZA 2ZBVA 1ECGA 4EQFA 1PG5A 3B52X 3WGVA 1YJXA 1N4AA 1JWFA 1LX7A 3IDFA 2ZYUX 1WZNA 4GXQA 3JSAA 2H0RA 5HKPA 1I7SB 1EFTA 1KARA 3R7QA 1G20B 4AY5A 4EFLA 4GL4A 4YROA 2X41A 4MAAA 1KGSA 5F4ZA 3KTAB 1EGHA 2Q9AA 4JOCA 4AP5A 1FY2A 5AYVA 3BWEA 3FCAA 3N8GA 5HW0A 4MS3B 2QMHA 4CE6A 2D1FA 2AN9A 1KS2A 2XT0A 3LXMA 3TTTA 4IPTA 2XMBA 4ZDJA 3PS6A 4KQWA 3VISA 2QXYA 2BHRA 2ES4A 4E4YA 4YRDA 3AVQA 2QP3A 3L02A 1EUDA 1C1DB 3ZYLA 3KUDA 4F6RA 2AFIE 3R7SA 2ZJ5A 3HTXA 4MW5A 2G1PA 5AKXA 5J63A 1OD6A 1TW2A 4GA2A 4IHJA 3ZHSA 1ZD3A 4CFYA 5KSPA 4G5QA 1X94A 4EG6A 1KYZA 4KNVA 1J5PA 1ZNYA 4EA8A 2ZRAA 2MINA 2I33A 4E5MA 3ZXPA 3COJA 4RETA 1XAJA 4L9PA 4OHZA 4OLFA 4V2UA 1GGVA 4AX8A 5IWCA 2H00A 2ZROA 2QENA 1QVWA 3T1QA 3OZ7A 2H2DA 3FWYA 3TZQA 3PUHA 3F97A 3V31A 3BFKA 3SXJA 5CVUA 3F6RA 1YE5A 4TLEA 2W2NA 3FIJA 1CR0A 5DYNA 3TQHA 3OZCA 1XXHE 3L82B 4AJLA 3IKJA 4D41A 3RS2A 1ELKA 1HDRA 3JWJA 4XSVA 3ZY5A 3EHQA 4MKTA 1F2TA 5A3RA 3CG0A 5HK8A 5CX4A 2P67A 3A0RB 3FROA 3OLZA 1SC3A 3QUQA 4D7AA 2Y05A 1ADJA 2ILTA 4ENUA 1AHHA 3GRFA 4YJ3A 3BGVA 1RT9A 1UUFA 4IHAA 2XMDA 2EKBA 1D2HA 4N7BA 5LD2C 1Z0AA 3NI2A 3QPCA 2EL7A 3OM8A 3PGJA 3JYOA 1Z37A 4X66B 4ISBA 4JJAA 4ENRA 2W48A 3GHHA 3FOBA 3ZCVA 4Y0NA 1Y5NA 3M9XA 2IYOA 2ZIZA 5DNYB 5LA6F 4TXMA 1ODFA 3M5CA 4KQGA 3ZHUA 2FLKA 3A2MA 4PHFA 1KZ4A 2CLKB 4PG7A 2O0HA 3AAAC 1AQYA 1SHZA 1EK0A 5CG2A 3UT5A 3T5BA 5HP4A 4TV9A 2NO9A 1E3WB 1V7QA 3AY6A 2ZE7A 1ZH6A 3H7IA 4U1RA 1RCFA 4X65B 3WKEA 3HGMA 1BWRA 3EWSA 3TJZA 1TTPB 4B3RB 1HDCA 3CLUC 4BEPA 2KBEA 4RESA 3CKKA 3AUTA 1VIVA 1EM6A 1CPYA 3KSLA 3H17A 4NCIA 1T36A 4RPCA 1A04A 3MS2A 3QW4B 4RF2A 5TQ2B 3HU2A 5EQTA 1WQ1R 3H65A 4HFGA 1I9GA 4PG5A 1PJBA 2BFAA 1N2GA 3E5NA 3RS5A 1TAHA 3HVEA 2RKBA 3CCCA 2RJOA 3O3NB 5E6RB 1INLA 3TNLA 4INOA 4EHKA 1SCKA 1JKJA 4RAOA 1YS9A 3OUTA 2WVAA 2CJWB 5FQ8A 2QY6A 2HMVA 4GI7A 1VG8A 2G17A 2O1XA 4NMXB 3DHVA 4CLHA 4AI6A 4M7OA 1JG7A 2C1EA 5F3DA 3EIOA 5C8DA 2Y67A 3BIOA 4NH0A 3UWOA 1P1IA 3PDNA 4R9RA 4PZPA 4Y2PA 2EKZA 1RQGA 4ERNA 3H8SA 4KK3A 3RU0A 1SBZA 1OROA 2IOFK 3K0HA 4FHKA 3N2ZB 4JJZA 1AZWA 1YRWA 5HE8A 4DMLA 3UMBA 4PYIA 1K2WA 1ESZA 4Q0MA 4H1VA 1FNNA 4HXYA 4WZAA 5AXCA 3RS4A 4PANA 4YRIA 1EK6A 3GW4A 4MIYA 4KYVA 1KJWA 3HCCA 2J4BA 2YWGA 1A9OA 3T7TA 1DJQA 3IEIA 3D6AA 4ZYUA 2QSJA 2AOWA 2J33A 2PD4A 3OQ6A 2R00A 3WBBA 4DCCA 3RWBA 4HS9A 4V24A 4YYEA 5DH9A 2HK6A 3LCCA 3NPMA 2AGVA 3E4BA 3AR3A 4Z54A 2H5LA 1R3DA 3TKYA 2IYQA 3TQTA 4D6XA 4DUZB 1BX3A 1NJ1A 3EGDB 1I3OA 1GTL1 1H8HA 2F4NA 1QKIA 4MHSA 3B1JA 2GF0A 4RZIA 2XMZA 1FB5A 2XTNA 3GLFE 4OPMA 4HTFA 2JI8A 5AOCA 5AJDA 3PNYA 4L50A 5CFMA 4MYRA 2HIHA 1A2QA 1ZNWA 4JKOA 2WHXA 1XRSB 5KYWA 2G09A 1FEZA 2E6KA 1BU8A 3JV7A 5ITSA 5BOSA 1JCSA 1UXKA 5EXEA 3CUWA 4MWZA 1DKRA 1K8YB 4ZU6X 4YRQA 1SHLA 2O5EA 1NVDA 5C53B 3WKDA 4YV0A 4PLPA 3SJ7A 1RC1A 3B9RA 3OZFA 3NBZC 3WLPA 4TSRA 1R9GA 3KT8A 4BO2A 3MINB 4DCTA 4D8VA 4WKPA 3ER9A 1XALA 2PRKA 5LN1A 3DDCA 4F91B 3N2GA 4UMVA 3NP9A 1AY0A 2GCIA 1CVLA 4C4YA 4BOYA 2YV5A 4DV6B 4WZZA 1GN8A 5KWJA 5HMLA 3FOCA 2PZBA 4EPZA 3THXB 2CKMA 4BS9A 2Z9BA 4E5KA 5A4MS 3NB2A 3UHFA 1MRSA 1IIRA 4E5SA 1DKOA 2Y6VA 3EVNA 5T8IA 2I54A 2J3LA 1P1JA 4S1TA 2FG7C 3HP7A 1JXMA 4YDWA 3ITEA 2W7TA 4B6SA 4C2AA 4TXPA 4NF2A 4S1PA 2FR1A 1NQTA 3FTWA 5L7WA 3NHPA 2RH8A 1QQAA 2ILVA 1Q1NA 2Y0CA 3HUTA 4W5OA 4JZKA 5F1YA 4AJ2A 5PGMA 1DO8A 1Z2PX 4ISCA 4M8KA 4C03A 2HPZA 1R0SA 2Q6VA 4Q01A 3HHPA 1K5DA 3HXTA 4MRUA 3EGOA 1XK6A 3QGMA 1NXSA 2G25A 5L3QB 1YZQA 4KZCA 4P7JA 1CRZA 1NUHA 3QVJA 2XXJA 5BQFA 3AOEC 1RJGA 3TIIA 3VH4A 4FE7A 2PMEA 3W34A 4OJTA 4WNAA 3EMBA 1GRRA 4FZ3A 1KI6B 1M6WA 3C7KA 4TROA 5BNZA 3V5NA 3F4LA 5IF9A 3BDVA 1XZJA 2HSWA 1U8FO 4RYDA 1DUVG 2A94A 2GPAA 4W7IA 1JEJA 1BKDR 1WV0A 1PWEA 4J1TA 2QZAA 2H1SA 3M8KA 5CYPA 4JASB 3N2IA 1EUCA 4MPTA 4OVVA 1JI0A 4EZEA 1X42A 3EDRA 3CHRA 1HNNA 1GLNA 4RTLA 3DZFA 2FZKA 4F4HA 4I14A 3TI7A 2WPDA 5G2NA 4EA6A 3OZUA 5HM8A 2OKCA 4QGHA 4WFIA 3ZU4A 3T9EA 1YO6A 5DWDA 1YZKA 2Y76A 3UZUA 4BU0A 5DBFA 2GZRA 4RY0A 1KBQA 3QSYA 5DNUA 3DTTA 3UY4A 4H7YA 2XXAA 2YZMA 3AMVA 4BDSA 4FS8A 1HDYA 5DOVA 3V1KA 3G5AA 4C6HA 2XWPA 1ZD5A 1OY1A 4ILIA 3E70C 2P2LA 1GQFA 4R1OA 5K9ZA 1N6OA 3W5AA 4N3CA 5NLLA 2H17A 2J6HA 5AVXA 2QGNA 1QC5B 1NVMB 4MITA 1N2CA 3EIUA 3QKIA 5CDFA 1R16A 2XVMA 4GZDA 4KGVA 1H9AA 4TOIA 3PDIA 1DDOA 1ZNQO 521PA 1H2FA 3ZE6A 1IBCA 4GYJA 3MNFA 2RONA 4X0EA 2PD6A 4A8PA 1UWVA 2A1UA 1YYHA 2YW2A 2VXCA 3SHTA 2VDWB 1V54E 1PTKA 4WDRA 2HLDA 4I1SA 2XDAA 1TRKA 3BWDD 4H4DA 1N8KA 3AF0A 1JAXA 2X8BA 3V7UA 3MCVA 5E9QA 3H0KA 4BO8A 2NZ2A 3BBPA 4C6RA 3I92A 3JZMA 3OFND 3ZXYA 3QK0A 1U0EA 3P9NA 2ETVA 4HB5A 3BS4A 1F7UA 2CC2A 1DX6A 3QJ5A 3KZNA 3DXZA 3EDMA 3HXOA 2EZ8A 1SK8A 3D6MA 2V9CA 3W8DA 5LVAA 4FILA 3CW9A 2CNOA 1P2BA 1BS1A 5IDYA 3OF3A 2HN9A 4DY4A 4E32A 2OHOA 3MUNA 3S5JA 3EFHA 4YRGA 3ZNOA 3ONNA 4BNVA 1FRVA 5B1BE 4DJTA 4RTJA 3ULQA 2FF7A 4DVJA 4NS1A 4U0ZA 1W0KD 1PEDA 2V58A 2C4KA 1RMTA 1FX1A 4D9NA 5KX5F 2WD8A 3LFTA 3SF4A 5D2CA 1HZ4A 3NYRA 3G85A 3WJ2A 3MC1A 3S2EA 4X1KA 3A2LA 3UM0A 5JYCA 2YV1A 2P90A 1T3SA 3G2OA 4L5IA 2WUFA 4UAUA 1AZSC 4YLGA 3RS0A 4GKAA 4Z9XA 5BORA 4DQUA 3THRA 1VLVA 2ECKA 4RHYA 1RC8A 5LDHA 1TOAA 7ADHA 2EGUA 4WJZA 4RJKA 5AKZA 4ZVTA 2FSSA 1E5TA 4FN5A 1ATZA 3D02A 4XKJA 1H0KA 4GMGA 5DHSA 5DGIA 4DCSA 2Q5OA 3M0EA 3LAWA 2WINI 4AY4A 1YDWA 1J4AA 4JJ6A 3FLBA 2XGJA 1E9DA 4EVQA 2JI9A 4MS1B 2D5BA 4QHTA 4WJKB 3JD3A 5DNDA 1I2MA 3WGQA 2GHQA 1VPEA 4NESA 3DE6X 1L4LA 2AJ8A 1N9GA 2EVWX 3E8MA 4F97A 4YUXA 4J7XA 4BUCA 3HI6A 4FHGA 1NU8A 5A4FS 3QVUA 4EPWA 4U8YD 4BAUA 1UMKA 1QORA 1O0BA 5JWOA 2A6PA 3ESCA 4HYEA 1COWA 2ZANA 2F62A 2DY0A 1VKOA 2AI1A 1DCTA 5FAXA 4DIMA 4FDAA 1Z3XA 5FUYA 2VYCA 4DCMA 5BWNA 4K9RA 1O6GA 3ZGQA 4H1WA 3OX3A 3R2JA 1M6VA 2YIMA 2W2MA 1ORTA 3KKPA 4MYSA 1AXRA 5MGNA 2Y1XA 4C1NA 2FR0A 4ANVA 1HRDA 2GARA 3EODA 4ZOQI 4HXEB 1M8FA 1YU6A 1PY1A 5KVQA 4UCFA 2ACEA 2J5XA 4O2LA 1KL7A 1I7DA 2YDYA 3AIMA 2OC4A 3TLBA 1SJ9A 2NSHA 2AJTA 5B58T 4GLJA 3V7YA 3UWMA 3IXLA 2IU4A 4QQFA 1JU3A 2PGOA 1P1KA 3V42A 3FTPA 2HA4A 5EKSA 4GXTA 3IDSA 3JQAB 1UDXA 2VGYA 3LTNC 2HCFA 1JFFA 3ZE7A 1I1HA 1QHFA 4AJEA 3UHAA 1Q6YA 3SIPA 5HGJA 1UBLS 1U11A 2YFYA 4U6QA 5ALGA 4ARSA 4CQNA 2B61A 1UBNA 2FCAA 1VIDA 1YB5A 3VFDA 4AQDA 4DR4B 5ADHA 1YJ8A 2HZ7A 1KC1A 1L5VA 3NBNB 2C57A 3AXTA 3FDHA 4EPXA 4IGKA 2HJRA 5EXXA 1FFBA 3OA0A 4KR7A 1M1NB 2HJWA 5C5CA 1ZKDA 1ABBA 3CVYA 3TQOA 2J3HA 3BICA 2DIWA 2MOWA 1T8SA 4HNRA 4LPSA 4DEYA 4AQYB 2YXNA 1UDWA 3ZHEB 4Y6SA 4GR4A 4JU9A 4QPDA 1IN8A 1R0RE 3MZLB 2OY0A 2QRGA 2X9VA 3NFRA 1PSDA 2R7MA 3BGSA 3E23A 1BYIA 5CTAA 1F48A 2C9OA 1GY8A 3UW1A 2W2VA 3FNRA 5DM4A 5JV5A 2ASEA 1E9RA 3NBAA 4KBQA 1Y80A 3FCUB 1NW3A 2JCYA 4DXHA 3FTNA 4IF6A 2ORVA 3WIOA 3ZNGA 1DO2A 3I1IA 1RBQA 2LWIA 3ZI4A 4GRIA 3FTXA 4ZPXA 4GRDA 3QV2A 4OHRA 5G1OA 1SAYA 1HX7A 2H63A 4KRGA 4GPKA 2GN0A 3E9ZA 4E08A 2A8YA 4AMBA 4ERXA 4C0KA 3CXUA 1MGPA 1PHPA 4D44A 4DAEA 2HLNA 4IDBA 1O95C 5LMUB 2I65A 2XTZA 3SZOA 3UXEA 3EPLA 2QSUA 2HU7A 1RQNA 1VRWA 4ZI5A 2HF2A 2JANA 3MWEB 4TLBA 1QZXA 3KRTA 5AQEA 2AOTB 3G6WA 2QF7A 3C1UA 1TZMA 3AG2E 1WMDA 1E64A 4XVUA 4MIKA 3W3AD 2VVTA 3H8WA 5GMOA 3OPYB 4DMKA 4B8AA 1Z4KA 3OLXA 1ULSA 1TM3E 1RTKA 2OLKA 4YP7A 1NW9B 2CW5A 4JKIA 3HUEA 4J2OA 4IXWA 2FGJA 3S8MA 1D2CA 2O0JA 1FQOA 3CLSC 2Y1CA 1SOWA 4A5SA 3ONFA 1JG4A 1QZ2A 5JATA 1TU0A 3S29A 2Z1DA 5EGSA 2XVZA 4KUGA 2BKEA 1Y7PA 2EJTA 4GD3Q 2P5SA 5J23A 3P4YA 4NZPA 1EIWA 3LBAA 3NBYC 2A30A 3FSRA 1QRDA 1P29A 1RYBA 3S40A 1LQTA 2OXRA 1Y8QB 1YK0A 5FR2A 2KLBA 2I76A 1PHRA 1TMYA 5CUQA 2DLNA 4NZNA 2CMDA 2D3WA 4RV9A 4U7JA 3JS5A 1VZ3A 5E8JA 1CERA 2PD3A 3PFKA 2LDBA 4EJSC 4DYDA 5CFNA 2IODA 3QXXA 1OT5A 4TRQA 5EFZA 1C9MA 1ZAKA 5JY6A 1SKYB 1IBLB 4EX7A 1YOBA 1PR2A 3QKRA 1A50B 5EMLA 3VGJA 1TM4E 1R5JA 2G7MC 3IE0A 3WO0A 3UX4A 1N1EA 3OMLA 4ESOA 3RIMA 1FLAA 3AP2A 2CXHA 1IPEA 4HS2A 2WKPA 2M63A 2I2OA 5IBPA 1Z6XA 2V7EA 1BCSA 4ASUA 1M34E 1TDJA 4J4BA 1R27A 2B6CA 3BJRA 2BKKB 3RSEG 4A8JA 3TXMA 3TAXA 4CU5A 4M8NE 4Z7JA 1G21B 2FN7A 4ZFNA 1AKQA 1KI4A 3IPYA 3DEZA 4EMUA 5K0BA 4EHLA 3PHLA 1XTJA 1ZK1A 2AN3A 5DV9A 1F3OA 6REQB 3JQEA 4WWNA 1VCIA 3Q8LA 3COZA 2VXYA 4FUTA 2DTDA 1OIWA 3MCAA 4EHFA 4DGSA 4UTRA 1EVJA 2VPWA 2H08A 4ECEA 3FFLA 3CZRA 4LE0A 3IVXA 1DELA 3RAEC 3EAFA 4BESA 1ISMA 4PLHA 2F4VB 4ZVMA 1M0SA 4J7AA 1FNCA 1QANA 3GRAA 3KXIA 3KDPA 3KG2A 3O21A 2R1TA 2JGEA 1CUYA 5IAOA 1Z3IX 3A28A 4DZZA 3OHPA 4KNYA 2EARA 5BQ5A 2EBUA 5K1ZA 6ABPA 1M7HA 2ZT8A 2Z95A 4RZ3A 4X3PA 1NXPA 3ILYA 3AVOA 3LT0A 1RI4A 3WB1A 2HU8A 5IAJA 2EX4A 2F3UA 1OFVA 3NC4A 1B2LA 4UBKA 2W0MA 3M3DA 3KUUA 4MRNA 4XM1A 1RE1A 2CHEA 1T6BY 2REBA 1Z13A 1SZCA 5B2FA 5TQJA 1JEOA 2Y2UA 4K88A 4PSCA 3D9HA 2JLRA 1QCDA 3NG1A 3AETA 1TC1A 1TQHA 1QO7A 1WPQA 1CK4A 3U5TA 2GX6A 2N46A 5CYGA 2HWUA 2GFQA 2B7LA 1UKAA 3E8SA 3C45A 4YQYA 4MW1A 2DUNA 1VECA 2LSUA 1A8IA 1Z4LA 2W2TA 4DLQA 4TLMB 5C8VA 4UASA 2BRUA 3OCCA 3LEWA 2UUPA 4RE5A 1G63A 1FMLA 3SSOA 5CT9A 2Z2IA 4S12A 1OMOA 2PL2A 1JLSA 3R3WA 3QJYA 3TGOA 1CRQA 4B74A 2JCGA 5C4IA 3CO5A 3M9WA 1JX6A 2ZUFA 5JS8A 1T5OA 1CUHA 5L4LA 3NDIA 4P81A 4PLGA 3SGHA 4DA0A 3OX1A 4HUTA 4PNEA 1Y9EA 2DBVO 4AG5A 3PEEA 1RM3A 4NY1A 1NJFA 4LECA 2QL5A 1E32A 2H2IA 1FRQA 5CB4A 5JJLA 1VFNA 1Y1TA 5THXA 2O2IA 3O4GA 3QBEA 5SY4A 4EPRA 3AFNA 4GBJA 1DQZA 5LP1A 2X8LA 1OZAA 3GQBB 4MUJA 1L5YA 4DBZA 2HRRA 4A0SA 2JG3A 4HSGA 3T38A 2E87A 2V55B 3J5PA 5CHYA 5EIBD 4JGBA 1FP2A 4MUAA 4HDKA 1V11B 4LDQA 4PTZA 4ITRC 4B79A 3S7FA 2AG8A 2SKEA 2G6TA 2XW6A 4QLBA 3SZ3A 4RKQA 2H1FA 2FP4B 5C8YA 5B1DA 3FSJX 3FLEA 1EDUA 4TKZA 4CGYA 2FFAA 2JAOA 3QOUA 5JAUA 3SSMA 1ND5A 1ZKMA 4WUVA 4AAYA 1WZCA 2IY0C 1WKCA 4LKRA 3OXLA 2H4XA 3DAGA 3HLKA 2QX6A 2PYDA 3GT0A 2KCVA 3MLEA 3DE2X 4OXKA 3OJCA 1EE2A 1FUIA 1L1EA 4G5RA 1XT6A 3F2IA 1O5MA 1PT8A 2CVHA 1PJSA 3WK7A 2NV6A 2D0OB 4A82A 1T2UA 4KNWA 1IB0A 3NV9A 2IV3A 1LI7A 3PVZA 2JH3A 3NDRA 2POCA 2WTEA 1V5WA 2PH5A 3CCFA 4KPFC 4BDTA 3KTFA 3GD5A 4DM4A 2WXRA 4BFYA 4GSYA 1G98A 1KIFA 1I24A 2PAFA 5BP7A 2NYUA 2JGAA 1TFUA 2PUHA 3UGKA 5AW6A 3M4NA 3CR3A 5EIWA 1U8YA 3GLGB 1SFRA 1VE1A 4OXXA 5LOVA 2YQZA 2WPNA 2IOYA 5GM2A 3SYTA 4H17A 4G0PA 4BKMA 1DRWA 1NPTO 3FB4A 3H13A 3G2TA 2QVCA 3T8KA 1VMAA 4HVBA 4ND2A 3DZCA 4BV9A 3CF4G 1O1TA 3SBSA 3NGLA 4MBGA 1J9EA 1AKVA 3FNEA 3NVAA 1ST2A 4L78A 3HRIA 5D5HA 3SC4A 4EUFA 4G5XA 4OHWA 4Z7QB 3PZDA 1ODSA 1W5TA 3FIUA 3WQHA 4BATA 3P71T 1WCWA 2WJYA 3NEYA 4G5OA 4JBIA 3K1AA 3R6LA 3RRZA 3IUNA 2XT6A 4N5LA 2GJ9A 3RG8A 1AU9A 1ZOSA 5HR5A 4LJLA 1Y3FE 3PNQA 4REOA 2CHWA 3O4VA 2DKFA 4TVSA 5ALWA 3W8FA 4OP1A 1H1DA 1WXQA 4E0BA 2ZPUA 1HEIA 4RWZA 3LE8A 3HVIA 3QIAA 2P1RA 1HLFA 2H4FA 1P2TA 1U63A 4WNEA 5BR1A 3CVVA 5T8KA 3FUKA 2VSOA 1BI7B 5L3SB 4UDNA 3LUBA 1DXYA 1DKPA 3V7NA 4JVMA 1GFWA 2AG1A 1JHRA 5DK4A 2PKEA 4JJ7A 3V8RA 1NI5A 4G4IA 1PL6A 5BN4A 4KIWA 1ADFA 1E6WA 3SNXA 1PR3A 3MQFA 5A6SA 5DI9A 3WK5A 3W3AH 1KH3A 2V98A 1ZOPA 3GZNA 2VPIA 3PUIA 3ZWMA 3H4IA 3I45A 1U4OA 1ZGZA 3U4MA 4K81B 2VJDA 4GA1A 5CDGA 4R54A 1ZDMA 4B32A 1JE0A 3CEQA 4KR9A 4ZO7A 2YOFA 3L0IB 5BSRA 4QGAA 1WKBA 4OLAA 3V2UA 1D4ZA 5J2UB 2IHBA 9LDBA 4X20B 3DUWA 5AKJA 1ES9A 4RHFA 5H9WA 3EVFA 2HR1A 4BLUA 3RSLA 3BWXA 4EBAA 2HMTA 1NX9A 1Y1PA 2IZOA 1T9ZA 5CGZA 4P4NA 3LUPA 3KVVA 4C0JA 4KG7A 1J0BA 2IHKA 1BVHA 2VBGA 2ZDGA 2Z9DA 2G1AA 2OQ2A 3MOSA 4HAUA 4TV8F 2PMBA 1IAQA 2CDBA 5ALLA 1V2HE 1NT2A 4FC8A 2WNSA 1AMOA 2C3PA 4TMWA 2C03A 1RLMA 5J5VA 2ZUBA 4RULA 2ZUTA 3QMWA 5KTSA 1FYEA 5CIQA 1T0UA 4JLWA 4GP6A 1F38A 1XZIA 5BQPA 3DKRA 4ZI7B 4D5EA 3OEHD 3TZHA 1L8QA 1TA0A 2YC2C 2BSAA 5ENTD 3CPHA 4CLXA 1AUPA 3JYNA 1UMCB 4RJJA 4L2IB 3W9UA 2X0DA 4R9NA 3K05A 3F3KA 5BSKA 3JAWA 2YQ8A 5WRFA 4N6NA 4U7DA 4G1CA 4LHWA 1DAMA 1AO0A 3BGIA 2ZUVA 5ALHA 3KYIB 2HTFA 3QWFA 1ELRA 2J49A 3G0GA 2L0XA 1CRWG 1XDUA 2J3MA 1XHEA 3D9IA 1K3ZD 2KHZA 3I58A 5DNWA 3RI3A 1AIPA 4WZ6A 4WBNA 3R76A 3C4QA 2C2MA 2AVDA 3RRMB 4R1SA 1U04A 4F3VA 4J8EA 4HNHA 4KXUA 1Q7GA 4QUIA 1PEAA 4WY2A 4DXDA 3OPNA 2YRWA 3L17A 3T0GA 1DJMA 4M21A 1V16A 1VJRA 1RAFA 1DAIA 1EGMB 1YB4A 4W7HA 4OQXA 2Q0QA 3RT9A 3D0QA 3DQQA 3RLIA 3AEKB 4FS3A 1FTSA 2IPNA 2Y68A 3VHXA 4MCJA 2G0NA 1GILA 5I9BA 1Y81A 2AE2A 1E4EA 1R6XA 1BDJA 1KZHA 4OEHA 5CCEA 2FUNB 4I1PA 5FBZA 2J32A 2BHNA 1RWWA 2C1XA 5G0WA 3KJQA 4QARA 4G8CA 1SIWA 3A6GA 3K6RA 5A5VA 2PM8A 3UBTA 2OCAA 2C7GA 2JD0A 1FRFS 2VDOB 3VLDA 3NEJA 3BQ9A 3D0RA 4JLBA 1JQ3A 1E6UA 2P9SG 1BQ3A 2W9XA 2KATA 4UFNA 1PFYA 3I1FA 3N8HA 2ADOA 2G7ZA 2VT3A 1MMFB 3LI2A 2GETA 3GN1A 5HKKA 3I8XA 2QTLA 1LK0A 2G40A 1FVXA 1KYVA 4XEHA 3RS9A 3L04A 4UTNA 5GONA 3T3HA 3PC8A 3H5TA 3TTVA 3C72A 1U8EA 1YBAA 2ZYDA 4NAHA 4IIEA 4YIKA 3S7ZA 4D74A 2A5FA 2V6IA 5JMPA 1KPGA 3K2BA 3AEXA 3DKPA 1ONBA 2QIOA 4LY0A 4I2ZA 3ASDA 5K20A 3VU0A 4R3UC 2I6TA 4BNGA 4RFSB 4F3CA 3RKSA 1SU8A 2OZEA 1IPHA 4U39A 4K6HA 3DNPA 4MKIA 2Z3WA 4Q3CA 6CHYA 3QUBA 3B7GA 2XRYA 4R1LA 3ZH2A 1E6EA 1PC2A 2QLMA 2RKOA 3V8PA 1TPYA 1PVVA 3U3WA 1VJ0A 4QC2A 2C9YA 3Q5EA 2HBZA 2GMWA 3FU3A 3QBTA 1SN7A 3FYUB 4L51A 2QLTA 4O33A 2M2IA 4HMQA 3VUFA 3ES9A 2QB5A 1J09A 5CBKA 1A8QA 3EK2A 2CLCX 4P0PB 3C1TA 2WJPA 5T3RA 3B7BA 1OFHA 3TUZC 4YMGA 2ZVQX 3AB3A 1PX2A 2WQ7A 2EKPA 4FC6A 3NALA 1R5NA 3KHKA 3G2PA 3LQ4A 2HJVA 4NYJQ 3LQFA 4X64B 2O7NA 3GJ7A 1T4MA 3IHKA 5LZ7A 4C4XA 4KKXB 3DP9A 2R00C 1TVCA 4WW0A 2FAXA 3TGPA 3PBKA 4F3YA 3LX5A 2WMNB 2W5UA 4KE9A 1Q2XA 3C85A 2X2PA 1D1TA 3DD5A 3D8TA 2EKLA 5LDDC 2PUVA 5M29A 5EQDA 4RF3A 2ZBDA 2EP8A 4EHMA 5KTYA 4NENA 4QNMA 4QXQA 2E37A 5TMEA 4UBOA 1KO5A 1Z4OA 2EFDB 3C43A 3DB2A 1QV9A 2IEGA 3JYLA 1VG9B 1P2GA 4GMXA 5BVGB 2Q45A 1UOEA 2QSYA 4UNPA 1P1HA 4RMIA 1XVVA 1JG1A 2GJKA 3SDZA 3EZGA 2NADA 5EERA 1ENOA 4ZI3A 3W3AA 3V7FA 1OSNA 4HI8A 4IWNA 4LYEA 2ETCA 1G4AE 4BE9A 2JFYA 4RUKA 2KJQA 4L75A 3SJZA 4V0ME 1VKRA 2KBXA 2A57A 3TZLA 3M6UA 4Y1FA 2RD0A 4KDEA 2XUPA 2I2AA 4ZYVA 4LCJA 5JS1A 2YJTD 1JB9A 2QR3A 4U5QA 4U0SA 1N25A 1E1DA 5H82A 4ED9A 3WQSB 5LCXA 1NJ6A 4J3FA 5L9AA 2CMGA 3IUBA 1AX9A 4DSTA 4P32A 5E1BA 1II8B 3UOGA 5D6OA 1GGFA 2PZAA 2R4UA 1DDIA 4NHOA 4X63A 1NRXA 2UZIR 2UKDA 4RQUA 4BTEA 3F98A 2IEJA 3KEAA 5CX1A 1J33A 1ODTC 5AM1A 3NYIA 5C5IA 4KXKB 2N75A 4WKGA 5DM0A 2P6NA 5IMBA 4PPFA 2H65A 4DREA 4EFMA 1U3DA 4RYLA 3GEEA 1ESMA 1BGVA 4AP2A 1JWAB 1N2JA 4L7VA 4A1FA 4DUYB 4G6ZA 5EZYF 4K2AA 2PUGA 1EDDA 4B3IA 3K35A 2KXPC 1ZSYA 1ZH2A 4JHKA 4I2WA 4E6PA 3Q3CA 3FNFA 5H02A 4FKZA 3I73A 5JO9A 4F9GA 5ECWA 2QPOA 3VU1A 2VNAA 2WWIA 4M83A 2DSTA 1SH7A 3CVOA 3D4OA 4QJ4A 2IZZA 4ND8B 1Y1LA 4MGKR 2RJNA 3LVQE 1HTBA 3T3GA 5U4XA 1MOSA 1NN1A 2XNDD 3ML9A 5SZKB 4ZEMA 3OECA 4U0UA 4QQKA 4TYMA 3VLFA 4BJHB 3TJPA 3K2EA 2YN4A 1XP5A 4LBZA 1ECPA 2OEPA 4FFPA 4BO1A 4P92A 3TX2A 3NZEA 1T4DA 1RWOA 1P5QA 1YA0A 3OEYA 4RG6A 2NZYA 2WM9B 4J1TC 3R7WA 4E22A 1UKZA 5FUBA 4URYR 5HZGA 1NI4A 2WKQA 4JUCA 4CMIA 5FDFA 4BTAA 2XGSA 3WLQA 3A9VA 2VGXA 4J91A 3QVGB 5ESWA 5HYVA 2CF5A 4YVOA 1BH6A 2VR1A 4JI3B 1CY7A 1UINA 2PN1A 4GWKA 2NP7A 2V4HC 2Q3MA 2Q4BA 1ZJZA 3OZRA 4IGFA 4GECA 3HCNA 4LGCA 2B7CA 2PA0A 1N9AA 1ZN9A 4GKVA 4O1OA 3EXHA 4XGNA 4GGPA 4ZCTA 2JIBA 2AUTA 3GU3A 2PVSA 3G9XA 4KQ6A 1KU0A 1QFJA 1T1RA 2Y77A 1KEPA 3K9HA 4FGJA 1K8QA 3DLHA 2X6TA 2ZYVX 1XPRA 1JHXA 4BLRA 3CR8A 4UI9K 2HRBA 2JDID 5ESRA 4BTLA 1LB1B 3A4NA 1QFZA 3QKSB 1Z83A 1OCZE 4O2AB 5K8LA 3R9IA 1EVEA 1Z47A 1SIOA 3PFIA 4KHZA 5FCDA 3KHUA 3UAXA 4GTRA 1IB6A 4N0PA 3KWJA 3QFRA 4YXWD 1DKMA 3P0EA 3AEQB 3ZKWA 3W7BA 1LBIA 1WDLA 3WGZA 4GVLA 4O4IB 2V7VA 3G1WA 3U40A 1S2LA 1C3EA 4P5DA 1YL6A 4QRDA 1TJ3A 1V6SA 3ESYA 3L8ZA 1QU2A 3JTEA 4IV0A 3LHDA 1ZR2A 5NULA 3AESB 4QG7A 1ZMTA 3CGGA 4Z4HA 3W8NA 4YRSA 1B0PA 1FFEA 5C2YA 1SIBE 2ATEA 3Q7FA 4WWHA 3DC2A 1G5RA 1JFRA 2JJYA 5ESXA 4H16A 1U1EA 3RUHA 3K09A 5A9TA 1LPPA 3LW8A 4A73A 3KXKA 1SXHA 4QPNA 2WLSA 1C9KA 4KQIA 4QUJA 5F12A 4ZGGA 4AZVA 3OCXA 4H3VA 3FA2A 3ASYA 4PCLA 5KTPA 1L7BA 1A8PA 4V1CB 4QM6A 3ODPA 4HQ6A 4PVCA 4LYHA 2VAVA 4G84A 2UDPA 2Z4RA 5KAMA 3SC2A 1P6QA 4MPDA 1PKXA 1UK8A 4P36A 2BFOA 2Z5LA 5C1BA 4GZLA 4GPEA 3JQFA 5KPDA 3D6UA 1FMCA 3WA7A 1A2KC 1Y1SA 3FSGD 1YS7A 4U8VD 5DSZA 4O1PA 1THMA 4OI4A 1QK3A 2BZ1A 5AUPB 3HDVA 4XAQA 4HDSA 3D4NA 1MB9A 4Y6QA 2G70A 4XDZA 4A6EA 4GTVA 4CETA 3IP6A 4NECA 3UGJA 4B75A 3NORA 3WYNA 4I6JA 2NC9A 4GUDA 3U1VA 3Q87B 1OYYA 4TMKA 1CUGA 3ASUA 3SBDA 4GXRA 3H5IA 4GLBA 5K8IA 1VI2A 1J2JA 2HMUA 4TUYB 5CVVA 4GYWA 1CJVC 3PC4A 2QBYA 1PGNA 1W76A 3HUUA 1EVQA 4MGZR 5HX7A 1ORDA 3GI1A 4X8QA 3BQOA 4AY2A 1G5QA 3RRJA 5A6VA 2XD9A 4FFNA 1FL9A 2WJVA 4BUZA 3AHFA 2J41A 2FK7A 4HAVA 3CVQA 4KC0A 2BSQA 4G0NA 2QLLA 1O4WA 3IAXA 3I9LA 3UG6A 2CB9A 3P9YA 8GPBA 3QEMB 5CM8B 621PA 5FOVA 3GLIE 2XR1A 1QIIA 3QPAA 3RO7A 1TCCA 4YAFA 2P4EA 3PFHA 4P3PA 5BXUA 1DI0A 4DRXA 3HSYA 4OA5A 1XZAA 3OU6A 4XA8A 2IIVA 1BN6A 3BVPA 3FHOA 1U6JA 2YIDA 3N3AC 4D96A 2PX6A 1YZHA 4XYEA 3H19A 4QDZA 4DNFA 2YN2A 4ETIA 1NKSA 1PL8A 2YIJA 4N01A 3V6LA 4G36A 5EYPB 4MUEA 4C0WA 2ONCA 4HN2A 1HE8B 5KQRA 2WAAA 1FCHA 2FR8A 4G11A 1ZN7A 3K9CA 3HNOA 2OZKA 2XB4A 5DGTA 2AI2A 2GCGA 4QATA 3G13A 2BBWA 3A3NA 4KQ1A 1M0EA 1J0AA 3L9TA 1W0JD 2IBTA 1QS0A 4ZEXA 1X7ZA 2WXQA 1R4NA 1HKHA 1UN9A 3A1UA 3VYWA 4Q9LA 3KFVA 3JXJA 5LP6C 5LQCA 4I19A 5H9VA 2G07A 4RD2A 3ZHCA 3DE4X 4AUMA 1Z6PA 3MMZA 3EVZA 4PAQA 4Q48A 3KSQA 2MYPA 2ZR0A 4RSMA 4C1BA 3EWIA 2XPYA 5ENSD 2QM0A 4FB4A 2OEWA 4BU1A 4KITB 4HGQA 3KZ1E 3KK0A 3DZDA 4AEZC 1L5MA 3LUCA 3ZN3A 1VIYA 5G3ZA 1K1AA 4N2SA 2TYSB 3TOVA 1LXCA 3U4TA 2JLVA 1QYXA 1WF3A 4D8UA 5KQSA 4RKWA 2BW0A 3R6WA 3S2SA 3TL6A 1G3UA 5A7GA 1N32B 3IAAA 3I5PA 3LDGA 2V5FA 3HC7A 5B5SA 4FX2A 2BFBB 2FQXA 3T3EA 3DSSA 4M1SA 3UQYS 4QLOA 3FY4A 1JAYA 2PDAA 2R6FA 3EFOA 4IKEA 2FEZA 3C3YA 4ZYTA 2WFMA 2ZB8A 4HJXA 1FSFA 3V46A 4IF4A 2F3PA 2VYVA 2W6JD 5CM2Z 4A5OA 1RMYA 1P1FA 3C16C 4G1MB 3QKTA 4DV4B 1PDVA 3MKQA 3EZXA 2JFUA 4CXMA 4RMNA 5FPHA 4LCEA 4IGIA 4NOJA 4CDNA 1FSSA 1QGZA 4XWOA 5F3WB 1YNSA 2OQVA 3MYYA 1LCIA 4ZC1A 5CA1B 3ETLA 1C1YA 4NATA 4LZLA 3MTAA 2VK1A 5FINA 4FR5A 2JK0A 3HXFA 1ZCFA 2CL0X 4DLUA 4E09A 2WXLA 2XS8A 4MGHA 1DQSA 3K70D 4ZOBA 1DBSA 4DLPA 4KZ0A 4RVCA 4AROA 1WY6A 5FAKA 2IYEA 1KAGA 1V35A 2CVFA 2HOQA 3HKDB 5K7SA 2FW0A 4UOQA 4R2IA 5BUZA 1J2TA 2GLUA 3QYFA 3GGGA 9ABPA 1IL0A 2C3MA 4M88A 3TQRA 2WHQA 4PBTA 4E5DA 2BMFA 1VLQA 3JQ8B 5KDDA 1E6CA 1KDVA 4BMXA 4CT4A 3A9RA 1LDNA 2WMDA 4M9SA 4P86A 4CF7A 1Z5UA 3OO1A 1UZUA 3IGFA 4Q6WA 2EP5A 3OLCX 2WSIA 3ZYZA 4DM7A 4EQ6A 3MTQA 3FVTA 1PJZA 4UJ5A 4L4XA 3QXJA 3AGPA 4QHSA 4BB9A 4HDNA 4D97A 1A5AB 3H1TA 2NSJA 4K2HA 4E46A 2ZIXB 4M9QA 1R2QA 4G63A 1IY0A 2PZKA 1UJ6A 2JKZA 3CO0S 1GKIA 1Z12A 4O4JA 3HADA 2P2SA 4C0MA 4E3ZA 3WLHA 4RDIA 4RTPA 3MKRA 4H6PA 3VR0A 1K6MA 1LSOA 1YZTA 2O2ZA 1SQ6A 4F92B 1HT1E 3CNLA 3QVOA 5AQBA 3VNQA 3K15A 1MW8X 4IOKA 3ZVRA 1RM5A 3DGEC 1IZ7A 2YMLA 2XOXA 1YRBA 3E53A 4DLLA 3DA8A 2JJQA 1M8JA 4L27A 1C3OB 4XIFA 4RFVA 5E3JA 1M8GA 1SA4A 2V7WA 3ETHA 4E7PA 2F9FA 4REMA 5CLFA 3N59A 2EFJA 4PGAA 1HNZB 1BE6A 1POXA 2FNAA 1Y0BA 5D3ZA 3LZ6A 1HFEL 3RK0A 5A02A 4WI1A 1BVYF 4DX2A 3QNWA 5K0EA 2DHQA 2P62A 1IHUA 1GUBA 3SR3A 3SKVA 5LBIA 1JCQA 4LDJA 3O8DA 1PWXA 4MVJP 2E89A 4DLNA 4YS6A 4ARBA 4JI5B 3CK8A 1T91A 1WCYA 2GAIA 4FOOA 4TYPA 1UWCA 5EPOA 4AUNA 3N0RA 3MILA 3HRKA 1EWTA 1OTXA 4HEHA 3PLRA 2CHXA 4S05A 4NPHA 1NF8A 2DLCX 2C2LA 1BX0A 1E2JA 5BYKA 1V4BA 2V0CA 5BV0A 4PS0A 1NA0A 1C50A 1XLUA 4HZUB 4O4HA 3FAKA 3FOAA 3SJCA 2WFZA 4KDCA 2OQRA 4G5HA 5B53A 5L3RA 1IJKA 3O8QB 4V02A 3TVTA 2VCYA 3C48A 3EXG1 1OCRE 1XMJA 1J22A 2AMLA 4CTKA 1BMFA 2QX9A 4TMVA 4TSFD 1QKJA 3A9SA 3CUUA 5FEUA 3R3VA 5KVVA 1L7PA 2YV3A 4GCNA 2AWOA 4GGOA 4OYLA 1E59A 4M9CA 2O14A 1J9GA 4PQFA 1PE0A 4S1WA 4DSAA 4HNSA 3ZJ4A 1IN7A 1GAJA 1GG2A 2H6FA 3JD1A 4DLOA 3FUHA 3S2YA 3R8FA 4AIIA 3I53A 1S96A 4Y2QA 1J8QA 1PJTA 4OAOA 1I6KA 2GN4A 3WLFA 4K6MA 2GASA 2BGUA 2VIIA 4PS7A 3G0BA 4FCWA 4EX6A 3WVNA 1NV8A 1W5BA 2DM6A 2BUBA 4ENTA 3BG0B 4B0PA 4AJOA 4CM4A 3M33A 4EG4A 3TTXA 3R5JA 5INTA 2HYZA 2QZ4A 3L1HA 2IW1A 3M5PA 4P83A 3UEOA 4LVUA 3ESZA 5KJKA 3WBFA 4DEVA 1SUFA 2FWAA 4L7TA 4CGWA 1X7YB 4KACA 2JI4A 5EAIA 3ASHA 3P26A 4Q19A 1ZUIA 4QU5A 3ZU6A 4CCAA 3STTA 3P4UA 5K51A 1GO2A 4WBXC 4L7QA 1GPJA 5GZ1A 4X1YA 3SBTB 4JJEA 4JUFA 1NZFA 4HADA 3I2GA 1ZN8A 3C7DB 1R0KA 3DDHA 5D2MC 3AEUA 5BRAA 1CDOA 1JWLA 2H51A 5FPQA 4PYQA 3O7MA 3O0DA 3BZWA 2V74B 1QBQA 1XQXA 1NBEA 2IV7A 3GGDA 2W2LD 2GJSA 1YQDA 3FPHA 1PJCA 3P9RA 5BW5A 5DVZA 4DARA 2HA0A 3L1KA 1A7AA 3ZPJA 1SQ0A 3QVXA 1J99A 3L6EA 4M7RA 4PYOA 2LKCA 3JQGA 1S1MA 1ZBQA 3Q9LA 3BMOB 4JL5A 3P9ZA 1GJRA 2C3YA 3HWX1 2O2SA 2KZTB 4GI2A 1Z9BA 2GSDA 2PUEA 2XB8A 2VBIA 4HQOA 4I9FA 5E6UA 4CUKA 1DE0A 2WTAA 3ZGYA 2YJNA 2GI4A 4UTOA 1QE5A 2ZSHA 2DKNA 3KSUA 3CEJA 1P3JA 1KY5A 4D10C 4TYWA 1I2BA 1U6KA 3HE3A 3G9UA 3PE6A 4ZV9A 5SV2A 2Q3EA 4RQBA 4ES6A 4G9BA 4G1BA 1DNPA 2V9PA 1JDBC 3ASZA 3ROEA 1VC2A 4U2GA 4PYNA 2ID9A 1HGXA 1XVIA 5EXPA 3O3MB 4EBBA 2QYSA 3I30X 5EOVA 3ZZ0A 3TLZA 1SOVA 2WJHA 3GBVA 7MDHA 3D7SA 5FTLA 1PU2A 2CWDA 3VMFA 3O75A 1PFKA 1WUTA 1P7WA 4BV3A 2G88A 1VLZA 2MU1A 2CXSA 3ZCQA 2HW8A 3B5EA 1QBGA 5TEWA 2WSLA 1QH1B 1MYOA 4JC8A 4J0EA 2FHSA 2WIKA 3H84A 4LRSB 3THWB 1R6VA 4F4CA 5J2TA 5IUJC 1V7CA 2SHKA 1DAHA 3SQWA 3U17A 4QOJA 2EFHB 4B09A 2GCOA 4D4MA 3EEIA 3C6KA 2JIQA 1Q7EA 2UVDA 3B12A 4X8HA 2I7CA 4R2WA 1XTUA 3TOSA 4F12A 1GU7A 3AY0A 1WD7A 4Q18A 3L0DA 3NGXA 5ERGB 2F3QA 4LIPD 4IULA 4U4AA 1XTRA 2P9UG 2GBFA 3U9LA 2GK7A 4MV4A 4BC0A 4ZOLB 1J70A 4YQZA 1C7EA 3PQ5A 3AI1A 1PS0A 1N2IA 2WY2D 4OI1A 1L2TA 2JVKA 4PPNA 2SECE 2P6OA 3ZV7A 2XCSB 2ZRJA 3CR3C 4E5NA 4KL8S 2MHKA 5FT9A 1CIJA 1JH9A 4P08A 3MLBA 2XKJE 2C78A 3DF7A 3ITKA 1R6BX 1PYOA 3RV3A 1K8KG 3CU5A 3LSTA 3GPCA 3AM1A 3KKKA 5BUCA 4PQYA 5I4IA 1GRCA 1JBQA 1OC4A 2NWQA 3U16A 2PZMA 3C5HA 1DV2A 2DTXA 3PU6A 4BFXA 1T3TA 2ZQZA 2AW6A 3RAPR 3G0HA 5FTKA 4YHBA 1KPSB 1Q83A 1SOUA 1IHGA 3C8ZA 2VCHA 1EAMA 2W4MA 4CEMA 4BX3A 1SC9A 5DNVA 1WDMA 1J0DA 1O3YA 2VJBA 3Q9UA 4MLDA 4YRAA 4F2WA 1T8TA 4HDCA 1L5QA 4K9LA 5LZ4A 1ST3A 1DKLA 4C3ZA 4IH1A 4KWTA 3NYWA 4P1ZA 3GLVA 1N34B 3HZZA 2IFTA 3ZI0A 2Q49A 3FUVA 3E3NA 3B1ZA 2OECA 4F72A 1OLSA 2FZ5A 2PT5A 4QBFA 3I5UA 3T1TA 2ZJ2A 4AT1A 4M8IA 1VCMA 3EXFB 1YB2A 3REOA 4MCHA 1JFVA 3KP1A 3GVXA 4XUDA 4HQRA 1MOZA 5REQA 1U0LA 2FWJA 4MUHA 4QICA 4YXWA 3D6NB 2RC5A 3H2GA 3OWHA 3WFIA 1EFLA 2G4LA 3U3RA 2UYGA 3NBKA 2PV0A 3HFGA 4DLAA 1E7WA 1N2ZA 3K0BA 4IXTA 2FXVA 5KVAA 4NJEA 3UN1A 2L17A 2CGEA 3QYPA 4K9OA 4LRYA 3DTVB 4E6HA 3PYXA 4EFNA 1I1QB 3ZVVA 2B20A 3WKBA 1CUZA 3ABSB 4HAXA 3O38A 3A9WA 4GPMA 3K6SA 1M2VA 4A10A 1NXXA 3AJDA 4N5IX 4ZJPA 3CPEA 3BH7A 2VXBA 1L5OA 5TGDA 2OORA 2J3JA 1G0NA 1U7WA 1GYPA 4H4EA 5A4DA 2VCEA 2IYZA 2H2GA 5PNTA 2O3TA 5JQWA 3L18A 1SU4A 1UXHA 1HFAA 1KOLA 5DHFA 3OF5A 1YAJA 5BV8A 4CRWA 3T0FA 2AR7A 1E79D 4BKOA 1S3FA 2I78A 4DADA 5JU6A 3RC9A 5L51A 3DLBA 4RLHA 2D4AA 1P5JA 3HCDA 4LHVA 2QGZA 4Z6KA 2B37A 5B6IA 1KH1A 4YP9A 2QTMA 1YJQA 1YDMA 3DZGA 3TFWA 1JZTA 3R0XA 5C51B 1KMHB 1E8DA 3DEIA 1HH4A 4A27A 4TTJA 2BWJA 1RLJA 5T4EA 3GUVA 4BB5A 4I17A 4Q4HB 3N9IA 2H9IA 3FGPA 1BI8B 1IWBB 4UEJA 4KE7A 4YR9A 4NTZA 1EESA 1HE4A 3MWLA 2Z43A 3WWYA 3M1IA 4Q1DA 5ILQA 1KBOA 1APBA 3GFQA 2GPBA 3I6BA 3B6EA 3KAEA 3T3MB 1BCRB 1LF8A 3PXEA 1NA3A 4J7CA 4E07A 2UVPA 1HO8A 3CCBA 3WS7A 1EDBA 5C1DA 2JIPA 4RTNA 3ROTA 1K8RA 3W6ZA 3ZDDA 3QVVA 3AFHA 4LJKA 4AZ0B 4W5RA 1SXJB 3GMDA 1AV6A 1KQ3A 3JZDA 4BX2A 3BRCA 3IEKA 4TKUB 2YY5A 2FI7A 1C0EA 4Y7DA 1O57A 1JE1A 3ETNA 4NIMA 1KDZA 3UMGA 3ZGNA 3R7DA 4QYMA 2PV7A 4OH7A 1S6YA 4QFCA 1D04A 1UZNA 1TE2A 1VDMA 4RZHA 2O52A 3E2MA 1O5OA 5CHEA 4PC6A 4UTXA 3UIPC 2DPGA 4NFSA 3KZMA 3B38A 4CL2A 4YCCA 1D4OA 2OM2A 2E49A 3I5MA 1Z0DA 2PBLA 3FZGA 2ZU6B 2IOSA 3QPBA 2C3OA 1U2ZA 4L3VA 3HA5A 4BLPA 5D01A 2XD4A 1F2DA 3TIXB 3T1NA 2X6JA 1GZVA 2C7VA 3D43A 1SZDA 3ED5A 5ULLA 1GZHB 1QHXA 4I1OA 3REQA 4MDFA 2IS1A 5I7RA 3UWDA 3AXSA 2V03A 5M72A 3GCXA 2OBXA 4ZCMA 1HX8A 4Q93A 1YR9A 1DIRA 3PC8C 2BL4A 1NT4A 3JUEA 2PM6A 3GL9A 3Q73A 3K5IA 3EWAA 1RRKA 1HC7A 3WGNA 1XC7A 2CZQA 3LP5A 1S02A 1XZGA 3ZU7B 4UU1A 2ZBFA 5BMVA 1DIOB 2WJWA 1YIAA 4EBAG 1W73A 4IDEA 1UT6A 1PQYA 3TTWA 5F76A 3HN6A 4O2BB 5CFOA 3VMMA 1Z6GA 4YFYA 3NHBA 1R8SA 2W22A 3BHMA 3M2TA 2C0LA 2H48A 3ZTYA 2X6IA 2XMGA 5LQRA 3A4TA 2A86A 3DMPA 2X4GA 1E2IA 3RC2A 1GU0A 4R9UC 5ALOA 3OP4A 2EP7A 3MHPA 4P22A 3X1YA 4PBSA 1OCCE 4ZYYA 3D2BA 1WMBA 1SA5A 2DPYA 3ITDA 5FWXA 3JASB 2W6JA 4KQJA 2DVMA 1FFXB 4ZT7A 3T9BA 1P4RA 3R5HA 1N6RA 3RU2A 1YL7A 3OIGA 4MV5A 1FF9A 2P5TB 2X0FA 1IXKA 3VVLA 2P9PG 4P33A 5CECB 1M33A 4JLUA 3THSA 1R74A 1OOEA 1FFHA 3OAAD 5ISMA 3GOHA 5KHAA 4EL0A 4MS6A 1K1EA 3FTCA 4KO4S 5TMPA 3ICCA 4WGFA 1IWOA 1P9NA 3UAOA 2R8XA 4YT5A 2A33A 4QL3A 1EUQA 5DFAA 4BECA 4BJ1A 2X6QA 1F1BA 2BMJA 2PPVA 2HBQA 3KBOA 3NIGB 2HV8A 3F96A 1S01A 4IV5A 3I76A 2Y4TA 1TA9A 4HAIA 3CLHA 2QVGA 3H2BA 2IW3A 1W75A 3GK3A 2LE0A 4WFKA 3DVAB 2V8BA 3N7TA 4B6PA 3IQIX 3CRMA 4V3BA 4YDSA 2XZTA 4M4SA 3GHYA 3F3YA 1LI4A 4UAGA 3ULYA 4KTVE 2Q5LA 3R5XA 5AM3A 3IC5A 3SQDA 4OYHA 1LZLA 3OCYA 2ZJBA 1C30B 3C2QA 2GBCA 4JGGA 5E8RA 4UVGA 3N0WA 3DPDA 1XNGA 2DPHA 4JDUA 4NP6A 4OQDA 2WVJA 1E5DA 5DTEA 4CKEA 4KN9S 4Q1VA 3CNBA 4H7DA 2R8ZA 4JHXA 4BZPA 4Y9RA 5D8DA 2BFMA 2VF2A 4RKEA 3W0LB 3OFNA 1ONPA 4PNHA 3ZJVA 4JHRA 3ZE8A 5TS2A 2WT8A 3Q6NA 4I7EA 3EZ7A 4LTNA 1OXBB 3NBFA 5FUVA 2EEPA 4ZXFA 2L0IA 1C3JA 1VBFA 4DRZA 1G5TA 2QLNA 3H4VA 3TSOA 1PN3A 4AYTA 4JLSA 3ZWPA 4BMDA 3NWOA 1YQXA 4OP3A 2IUEA 1G20E 4ND6A 3LNCA 3N0VA 1ZCAA 3ENVA 1FJXA 3C41J 5LXTF 1W0KA 3IUSA 1ISSA 3U9TA 4NE9A 2QN8A 3QELB 1VTKA 5DHRA 1O6BA 1XV5A 3T6KA 3WMWA 4HWTA 3GJ8A 3ZUGA 4EDHA 3LNTA 4V0OA 1ODIA 1EFDN 3GH1A 3B2QA 4YAIA 4M0EA 5KYYA 4PLYA 1OWOA 4TS3A 5CXUA 4ABYA 3RYHA 5ALQA 1PZGA 1KU6A 2VQ3A 2WG2A 4QGFA 3WISA 3CMMA 3WDLA 2R44A 3H9JA 2P77A 3JYSA 1D1PA 4MI6A 2MSEB 2ZQ5A 2R6AA 3EBPA 2PRSA 1K88A 1DQRA 1MLDA 2IY7A 3B89A 5B58C 3AVXA 4ZVRA 5BN5A 3DHNA 5EUBA 4X97A 5TS3A 2SCUA 3UYKA 4I1UA 4O4LB 1N2HA 5ALUA 2H5IA 2XBUA 3Q75A 1PZMA 3FYDA 2Z2KA 3RYFA 3CPSA 2FX3A 4OHPA 2C4VA 3F67A 4G2TA 1S0PA 3EXHC 1MQ8B 1TX4B 4R83A 3FUMA 2A9JA 3O83A 3SFVA 4LXHA 3WLAA 4WVFA 1XZNA 3DSWA 2QAGB 2R4QA 4KIUA 1P2SA 3PRZA 4HRVA 3FFAA 1NZJA 5T64A 1BNCA 3IAS6 4CDMA 1LGYA 2VTBB 4RPGA 2QYTA 2KPOA 1BOFA 4RA6B 4LEIA 3CNQS 2WMOB 5IM4F 2GHTA 4MO9A 1TL7C 2EKDA 1PZXA 2HWYA 5GQSA 1T4CB 4BSZB 2FRDA 2HF9A 3KQUA 3L7BA 2GEUA 4H1HA 3T7DA 1FJ2A 5DCYA 4BZWA 4O08A 1PZFA 1G17A 3VZSA 4QO8A 4Q94A 3HRAA 1UT8A 1V71A 3MWJA 4UOEA 5THKA 3FCSB 2H31A 5JEEA 1QZ3A 2OBBA 4E12A 2ZJ3A 1VHLA 3VZPA 1XRRA 2G9VA 5TX7A 5KYUB 3FZNA 4N0EA 1ZL0A 1SG6A 3KYCB 1AQJA 4R98A 3N6XA 1EWQA 2DWPA 3F5QA 3L7OA 2FX2A 4CPDA 4B89A 3D7LA 1B2RA 1AN0A 1HT0A 2DZNA 2V7BA 1WBJB 4Z8YA 3RARA 1WNTA 3E3AA 2DUJA 5FPPA 2PGLA 1VYHA 4MCAA 5H7XA 4BFCA 1GZ4A 3RRXA 2JLXA 3K32A 8ATCA 2Q2OA 1FS6A 4F2GA 2CXRA 1OJLA 3K09C 1X80B 1O03A 3BSYA 2W11A 4LSZE 4FADA 4QFBA 1H3FA 1YB6A 2QROA 4QYWA 1E6MA 5EKQD 4W1PA 5LNK1 1JHVA 3TDKA 1DEXA 4XIGS 2RB5A 1PGJA 3PQ3A 5JJCA 3B5JA 3OPMA 4BCDA 5LSAA 2WP8J 5K3DA 4YCJA 3QIVA 4MJLA 5FO0A 3UUFA 3WGOA 1QPBA 1OWLA 3SY2A 3WXXA 3JQFC 5GOZA 2PY6A 3HL4A 4QLAA 3L0PA 1Z3CA 4DR3B 3PXDA 4ATGA 4MUXA 1WXFA 4KLCA 4M1YA 3MMSA 5K0GA 3OO0A 1XD8A 1K66A 3A4IA 2C8VA 4B8YA 1UL1X 4Q4AA 3GZJA 1J8DA 4IHJF 4V2IA 2I1QA 2EJBA 4GZ3A 2I0FA 2B6NA 4IX1A 4UFOA 4PSUA 4LGMA 3SO8A 3W7VA 1R5OA 5DBHX 2ODNA 3AS5A 1XE3A 3IS3A 2Q9UA 2QA5A 5GGXA 1U3GA 4M1OA 1NSTA 1N3IA 3PJDA 3FNQA 4N7JA 1VE9A 1CZUA 2HO1A 3HWRA 3LPNA 4TRRA 3WWCA 2MR5A 3DHYA 4IIYA 4RTSA 4M3OA 4Y2GA 2C3UA 4FGLA 5EKTA 3RC7A 3SKYA 1BWPA 1TZ2A 2AQIA 3L4BA 1G8KA 3WGUA 1SQFA 4XB6B 1FTGA 2ZS8A 3VU3A 3VNAA 3WLJA 4F5YA 1BDIA 3UT4A 1KIMA 1SD1A 4Z4CA 1C0PA 3J7AC 1R4AA 4DV3B 3ADCA 3I8SA 2ZT7A 3OICA 4HVTA 2RHOA 4JB0A 3CUEF 5KI6A 3EASA 3NM6B 3FVQA 3IQGX 5AQ1A 1XHLA 1M73E 3WLTA 2BEUB 4UHHA 2AXPA 3F71A 1G64A 3M6IA 4DNQA 1DTWA 5DEOA 3K5HA 4QDOA 2Q6IA 1U2DA 1RLTA 3A9UA 1AS3A 1CTQA 2MMCA 2W2KB 3WWOA 2ZYIA 4YJ3F 1PRYA 5EIXA 4HGRA 5COAA 2HSZA 3NJ8A 1YVEI 4LJ7A 5CLIA 1UBEA 5DT9A 2AG0A 4C4ZA 1FU4A 3ROMA 1ZISA 4XI9A 2Z1MA 1T6XA 5JS2A 2AJDA 5IWAB 1H2ZA 3OXFA 2FR8C 3ZHBA 2OCGA 3WADA 2FE4A 1A7JA 2IGBA 4NICA 4LHYA 2FZGA 1QIMA 3PDJA 3E9QA 4TTSA 3PX2A 3H9BA 1XDWA 3OZVA 1N94A 3I5YA 4MRSA 1RE0A 1NZNA 3BPSA 1V9CA 1P45A 1N0QA 2AYYA 4MR9B 4AQ7A 4TN5A 3GW8A 2R97A 1N95A 4JLAA 2UUAB 1O6CA 4BZQA 4R2HA 4C0QC 1D0VA 1XMXA 2Q3JA 1TNBA 4MHTA 1P5RA 2IYUA 4MMXB 1S7GA 5EHGA 3DMHA 4OKSA 3MMXA 4TV9F 3RHTA 2OGWA 2XT9A 3G2VA 3KU1A 1LPOA 3A3YA 4BVEA 1X7XA 1SVSA 3EZNA 1YHYA 4FFBB 5CERB 2AMVA 4H08A 2WIDA 2EWWA 1CR1A 1W25A 3RSQA 1VMEA 5BPPA 5IBRA 1S3IA 1X86B 2CHUA 4EY5A 3TTYA 3PLAE 5C37A 3FBWA 2P9IG 3F78A 4BGIA 2HXSA 3GUHA 1TGVA 5EP2A 5JMWA 3GQVA 3E61A 2AZMA 5H0IA 3HBMA 3G2WA 3A8TA 4J75A 1SCIA 4ZZ3A 1AZTA 1NVFA 2GVZC 4FFWA 3JQDA 1F60A 3QEOA 1S9HA 1XSEA 1Z25A 2I3AA 5EXTA 1B8OA 4C07A 3H11B 1PW7A 3HBAA 2CEKA 4D6PA 2UYYA 2B0JA 4NZZA 4AL4A 2A9KA 2E85A 3IQHX 4BNJA 1KJZA 5EIAA 4U7GA 2QYOA 2PL9A 5AHRA 1WG0A 4DTCA 4JVSB 4C7XA 1ZZEA 2FSGA 1AGXA 3ESBA 1L9KA 3N05A 1IWPB 3CNNA 4I9HA 3B1FA 2PSJA 3KPUA 5TNXA 1E79A 4X6YA 4E1AA 2P2CP 4LDNA 2L19A 1DFIA 4ZDKA 1T8PA 4JS0A 5G05J 5CB6A 1U9ZA 1NPDA 1Q14A 3ENWA 1JR3E 4P84A 5M2QA 1CJCA 4KXYA 3R74A 1WZUA 4DG8A 4H9GA 3LBFA 3H7AA 1ZITA 1YWGO 2B1GA 2VC2B 3ZC3A 4BERA 4HOUA 2R5WA 2REXB 1W87A 3NGMA 3P0RA 3S1LA 5FI5A 1QVRA 2IXDA 3P5SA 1SCUA 3WP0A 1ZBPA 5IASA 4LMRA 5F2OA 2ZWVA 5T4HA 1E8NA 5J4KA 2Z08A 4F2HA 4EYOA 3D4IA 2CDCA 1K3UB 1P80A 4JL6A 3DVSX 1QTIA 5AKLA 2P9NG 3D3NA 3HB0A 1T6ZA 2FPGB 6PFKA 4KZKA 3U09A 3VTYA 1YH3A 2R02A 3VPDA 2QRQA 2ZREA 3O4IA 1KO1A 1T5TA 4Y1EA 2A9PA 2VS1A 3ST7A 3V4PB 5E9WA 4C7OB 2I4RA 2PGIA 5A5GA 1Y63A 2TRSB 1XL1A 2FO7A 4B34A 4BC1A 2DC1A 4JODA 3ZIDA 2CLOB 2F1IA 1UQTA 3RWMB 4BVHA 1Y1RA 4UHJA 4C3OB 4RADA 1FS4A 3FTYA 4C48B 4GTOA 2Q8PA 4LA4A 3PEYA 4W7SA 2PUCA 2PGNA 2KLHA 2PL5A 4EB6B 3BTSA 2PFGA 2I4OA 5IYZF 2WWWA 4ZGWA 3ZX5A 2K6GA 1XMOB 3WYDA 1N6IA 3UICA 2AN4A 3EEFA 5ECDA 3IVGA 5FTJA 4DDWA 5F7JA 2ZCUA 3UWSA 2AB0A 4M9RA 4MVYA 4UREA 3MFYA 3WBJA 4AP6A 1IG0A 2R6DA 1PDOA 3RS3A 3SC3A 2Z6VA 1ZI9A 5E6SA 5F5XA 2O2GA 2J59A 3S27A 2C8JA 1M6YA 1HPLA 1J9ZA 2IU3A 4HT3B 3GOQA 2N3ZA 2X1VA 4R84A 2DYSE 1SB9A 1ZM2A 3QA9A 3ODGA 2FSIA 4IKOA 1KQPA 2GSWA 2FLWA 4OK6A 3UCEA 1EXWA 1U9JA 5TSDA 4F5ZA 1QWOA 3BREA 2ZI3A 5ITZB 4YJGA 5IKXA 2O8DB 3A3KA 1OH6A 4F1SA 1MX6A 4P7KA 1A88A 1NBWB 5M04A 1B89A 3DNFA 5JG7A 3I4FA 3B36A 3G9QA 1YFZA 3JQ7B 3O1LA 4Q9AA 4RH3A 5BYJA 2G04A 2J6IA 1L5HB 2E48A 1P8JA 2M32A 3IO3A 2CD9A 4IZOA 3S7DA 2V3VA 3AJRA 2B34A 2Z9CA 1I8TA 1IG3A 4XQ9A 1XZQA 3LX4A 3KQNA 2FH5B 3CQCB 4R7TA 1XR3A 3WFJA 3FZQA 3R23A 1Y4UA 5DDIP 5EIDA 2QUKA 3OTHA 5EQFA 2GWHA 2RGEA 2OHXA 1PFQA 1Q0SA 2HIAA 1MDBA 1CBUA 5KOHA 5IDVA 5IC6A 1ZIXA 4DMFA 5EJ5A 2DF8A 1SCQA 1TAGA 4NDZA 4QQRA 1KMIY 4EYGA 1R8QA 3NONA 1P0FA 2WD7B 1TN8A 1RRPA 2P3OA 4C20A 1TMOA 4XIYA 1D4AA 4DM3A 3WRWA 5BW6B 4OM8A 1KGDA 1MABA 3O9VA 2B1QA 3KLNA 4KUEA 1Y34E 3WGIA 3QNKA 2PS9A 3NF1A 5CURA 3K30A 2JFZA 1MGOA 1IBSA 4RPKA 4YRMA 2KS6A 3OTQA 4IL5A 1Z2OX 1UFOA 2JGNA 2G06A 4B17A 3T52A 4FR0A 1A9ZA 3W05A 3Q79A 1L3CA 1KYTA 4KGDA 2ZYHA 4EGSA 1CJBA 4B2IA 1HG0A 1GOTA 3ZIMA 2JGDB 1DC2A 2DU8A 4OXYA 3WL6A 1I13A 3ELWA 3NCHA 1UN8A 1JQDA 1P0QA 3IRUA 5A9SB 3VOSA 4LOAA 1FP4A 4FFLA 3FUEA 4HK4A 4PX5A 3DVQX 2G9NA 3BE5A 2PZIA 3P19A 3RC3A 5T7BA 1Y5LA 4W5QA 3WHLA 4DBVO 1ICEA 3ZNNA 1RXWA 1YTUA 2FE1A 4CCYA 2RDMA 1T2DA 3OQHA 1V8OA 4G0ZA 3SI7A 1TLFA 1H93A 1J07A 4H4CA 2P79A 1ZM4A 3CSDA 4BFWA 4OF4A 3UT6A 4QRHA 1G18A 4ABTA 4JWTA 1JAZA 2IKQA 4GO1A 1PGOA 2O8EB 3UUEA 2JEZA 3T35A 5HDQA 1NI1A 1QO9A 3K72B 4LZWA 3J81k 1N2EA 2YZKA 4G8BA 4J2TA 2ZBPA 3T4EA 1H0AA 1P2VA 5DYGA 4ZANA 3ULKA 4WWPA 1NA5A 2CXQA 4LRXA 2FULA 2PSDA 1GSIA 3SIXA 3ORQA 1IBKB 1ZW6A 1P62B 1E1NA 3KT3A 1H2TC 5TQ0A 4IEIA 2Z04A 4BEWA 3FTZA 1KYYA 1HSOA 4ZVQA 1WABA 1DBPA 3C3QA 5L7YA 4WESA 2P2YA 4I50B 2BHLA 3LO5A 1EYHA 3GBPA 1YI8A 3GFFA 3AKDA 2PT9A 2XF8A 1SBTA 2BUCA 1GIAA 4WFQA 2VTDA 5EVJA 3SZUA 3CWQA 1GTRA 5JC8A 4WNCA 4HOQA 5E4JA 2Z57A 1USWA 3DBRA 2VDRB 4MQEB 4RPLA 4TKLA 1RXVA 4Q7QA 1RXSA 2OBLA 5AJHA 1CU1A 4NFLA 2PX0A 3KKOA 3ZE9A 4MJ7A 3OEHA 3PIRA 4FNGA 1YZ3A 4H60A 2I22A 1G4HA 4IDGA 4IDOA 1JLLB 4YP1A 3RD5A 4ZHSA 5LC1A 3RJ5A 4DJJA 3D2LA 4RCZA 3NRCA 1K5PA 2QTFA 2P0AA 4WLEA 1TQDA 3GFPA 3V48A 1H2BA 1C8VB 1GGHA 4MRMA 1H2HA 5EY5B 1VA5A 3CH7A 3P9XA 1X8KA 4LS3A 1SA0A 2YASA 2GZAA 4PQGA 3KALA 1U7DA 4IVPA 1HDOA 3HJFA 3R3HA 3AC0A 3CZ5A 1RLOA 4PEVA 4XWWA 3BMCB 2I9KA 3ZQ6A 1T5SA 1YOVB 3K5PA 3PQ8A 4RMJA 1M10A 1N0IA 5G3YA 3T1OA 3SGLA 1DWOA 5B37A 1FPMA 5I6DA 3MOIA 1IM8A 4BCBA 1E2QA 2XPZA 4G56A 1CDEA 1B76A 1EP1B 4ESHA 4XJTA 2ZVDA 3PR2B 3IAM6 3DE1X 3Q3IA 3KQPA 2G8LA 4YVQC 4EA9A 3CH5A 3A2KA 3PUZA 3QYAA 1MC1A 3Q9UC 3GR6A 1ILEA 5H1YA 2ZQYA 3UFXB 5ARGA 3VYRB 1OAOA 1ZMOA 2AF4C 3KAPA 1ZU5A 5IJAA 2YZNA 4PHTA 4J7WA 1G1MA 1FPQA 2FZLA 1F8XA 4KVAA 4ME6A 2AVPA 3OTNA 1LEHA 3KDAA 4OSPA 1ZOOA 1Z26A 1UM8A 2OV6A 2ZM5A 1W5EA 3DCJA 3IUJA 3N0XA 2CJPA 3MAGA 5CA0A 1DJLA 3ECAA 3H83A 2ID8A 5CGQB 4EO4A 5BSVA 3FWHA 3D9NA 3JX9A 1ONSA 4RX1A 1W93A 4D9HA 3JWGA 5ELLA 4CHTA 5KJ6A 4MKZA 5HF5A 2GFHA 2DUWA 2YUIA 4A8JC 1JSZA 1N1GA 1OAKA 5BUSA 2NYJA 3RABA 3Q6MA 2G5PA 2ID4A 5CMYA 3WFZA 4H6XA 3ZWYA 4AS3A 2OB2A 3LUDA 1ND6A 3WNDA 5JAIA 4QFMA 3IDZA 4TL9A 2HHHB 3B1XA 5LP6F 4NARA 3R5SA 3PC7A 4HV4A 4WKNA 4K9SA 2IEZA 1K4YA 3KEQA 2OORC 4BKPA 1RZ3A 4CQMB 1N4QA 1SKYE 1X2BA 3PHJA 4EKIA 1P7VA 4RANA 5TPWA 3C6BA 3B60A 4MV1A 4M0LA 3H3JA 3KYBA 4AY3A 2XRFA 3ZJYA 3T5CA 3FFTA 2C5SA 1Q2UA 2WYHA 2QUBA 1B1CA 1EFPB 1YGYA 1IATA 1U7XA 4YDEA 2GN9A 1W85A 2BM8A 2FI1A 3FB1A 2HU2A 3PD0A 1BH2A 4Y7CA 4BE4A 4CEJA 3GJTA 1G21E 2Z5GA 4FT4A 2GGFA 2HREA 1YMUA 1VBNA 3K8YA 1QE0A 2AYXA 4I55A 1P8AA 2MWMA 1OJ7A 3FZYA 3T95A 4RNCA 3KVNA 2IYPA 1TLLA 7REQB 4U02A 1TEHA 3JQAD 5KSZA 1W9HA 5KMGA 1E96B 4KI7A 2EWVA 3G68A 1RR6A 3U9WA 1ZPDA 4UUPA 4NU5A 4PIMA 2A0KA 2HHAA 4CMEA 1G9TA 4F04A 1NR7A 3OJFA 4QJBA 2IWHA 4PS8A 2RCYA 2JJMA 3A6JA 2R7LA 2AOVA 3KB6A 2GM3A 4Y18A 3RS8A 5AVTA 2BRUC 1KY3A 1SULA 1MXFA 2WHEA 2A5UA 2ATVA 4KOEC 2QXUA 1JVSA 2X9GA 3QU9A 1FUUA 4DSUA 1S2DA 3TOXA 2NTJA 8OHMA 5LBTA 1E2GA 3QJZA 4DJFC 4UVDA 2BGNA 2XKKA 5K2MA 4LBWA 5AM2A 1E2FA 5EL0A 4MLZA 4OL9A 1A9XB 3DJYA 2AQ8A 4KE6A 2XADA 3HWWA 3WK4A 3TLKA 3D6VA 4ZAZA 4WAFA 4P4GA 4L5JA 2I7TA 1T4GA 2XE7A 3ZK7A 5KOJA 3I8OA 3N71A 2OGSA 1NF3A 1KK1A 1QE3A 3QWVA 3TWVA 1EX9A 4MR8B 4BWYA 1G59A 5EX0A 5JVDB 1A95A 1ZM9A 2H6EA 3COPA 2H1OA 1CFJA 3LBYA 4AN4A 3FMIA 4EY7A 3FNBA 4HGOA 2A0FA 5JE8A 1KIAA 5K3AA 1JPNA 4HVLA 1W49A 3KVYA 3UV3A 1FX0B 4KO3S 1NG1A 3CRQA 4KX5A 5EC8A 4YXFA 1F6DA 1W2HA 4JVOA 3GJZA 1ZQ1A 2GD2A 5DP2A 3O9ZA 4YCLA 1CD5A 1L5WA 3L0ZA 3WTCA 2E55A 2F43A 1ICIA 3SQNA 3KT6A 4JT9A 4RZUA 3ZYQA 2VSXE 3D2CA 3KKMA 3QI2A 4L9RA 1BWQA 3N74A 5FORA 2CXNA 3VZCA 3CX6A 4WUYA 3WKCA 2O7RA 1RJ9A 5T57A 4H59A 1VPDA 3OI7A 1JCRA 1ODJA 4JSYA 1GSHA 2QORA 1QYVA 1F8UA 1KFEB 5CMLA 2RBKA 3L6CA 4V0KA 2WWGA 2XUQA 4TL8A 4FN4A 2PCLA 1BMTA 1VPWA 1NZDA 2ON6A 1IRIA 1KI3A 1G8FA 1OIXA 1Q74A 4F0JA 1QIEA 5IAAA 1ZGJA 1Y1QA 5D86A 4HFJA 2XNDA 1NLFA 2NT3A 4U3JB 2DWOA 1G3QA 1KZ7B 4ALKA 1IOWA 1NFRA 1P19A 2V59A 2JLQA 1QH8A 1NW6A 2FYTA 2PKRA 2RJ3A 4EITA 2I2XB 4GEGA 4PAOA 4I4NA 3DUFA 3GLHA 2EC5A 1CUVA 1E1CA 4MH0R 2FHPA 1BXGB 2ZAGA 1MFZA 3TNFA 1RCUA 2A9RA 1RHKA 3LA6A 1T9AA 3U4CA 5CB8A 4BX9A 5J4LA 4NCHA 1GAWA 5JSZB 1WPGA 2BEWB 4LZZA 3PWKA 3QF4B 4RW0A 3A6EA 4Z0TA 3QPVA 1Z8DA 3B85A 5KAPA 4YDQA 1TF5A 4HH4A 4CIAA 2OXIA 2OBNA 5JIBA 1EM8A 2XCUA 2A2ZA 1YCFA 4AXHA 1Z22A 5AW0A 3GYZA 1Q5PA 1RM0A 1Q3KA 3NKVA