4BX8A

Human vps33a
Total Genus 214
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
214
sequence length
596
structure length
568
Chain Sequence
AAHLSYGRVNLNVLREAVRRELREFLDKCAGSKAIVWDEYLTGPFGLIAQYSLLKEHEVEKMFTLKGNRLPAADVKNIIFFVRPRLELMDIIAENVLSEDRRGPTRDFHILFVPRRSLLCEQRLKDLGVLGSFIHREEYSLDLIPFDGDLLSMESEGAFKECYLEGDQTSLYHAAKGLMTLQALYGTIPQIFGKGECARQVANMMIRMKREFTGSQNSIFPVFDNLLLLDRNVDLLTPLATQLTYEGLIDEIYGIQNSYVKLPPEKFALPTEAKKLQLNSAEELYAEIRDKNFNAVGSVLSKKAKIISAAFEERHNKQFVSQLPHMQAARGSLANHTSIAELIKDVTTSEDFFDKLTVEQEFMSGIDTDKVNNYIEDCIAQKHSLIKVLRLVCLQSVCNSGLKQKVLDYYKREILQTYGYEHILTLHNLEKAGLLKPQTGGRNNYPTIRKTLRLWMDDVNEQNPTDISYVYSGYAPLSVRLAQLLSRPGWRSIEEVLRILPGPHFEERQPLPNRVTLIFFLGGVTFAEIAALRFLSQLEDGGTEYVIATTKLMNGTSWIEALMEKPFH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural Basis of Vps33A Recruitment to the Human Hops Complex by Vps16.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
molecule keywords VACUOLAR PROTEIN SORTING-ASSOCIATED PROTEIN 33A
total genus 214
structure length 568
sequence length 596
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00995 Sec1 Sec1 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.850 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4bx8A04
3.40.50.1910 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4bx8A02
3.40.50.2060 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4bx8A01
3.90.830.10 Alpha Beta Alpha-Beta Complex Syntaxin Binding Protein 1; Chain A, domain 2 Syntaxin Binding Protein 1; Chain A, domain 2 4bx8A03
4BX8A 5BV1A 1Y9JA 4JC8A 5BV0A 3PUJA 4KMOA 1MQSA 3C98A 5BUZA 2XHEA 1FVHA 1EPUA 1FVFA 3PUKA 4JEHA 4CCAA 4JEUA 4BX9A
chains in the Genus database with same CATH superfamily
2Q5JA 4GXNA 4BQRA 3QX9A 3IVCA 2JLUA 1XRMA 5D2CA 1IY2A 3LFTA 1PN3A 2B0JA 2Y0DA 2ZUTA 3ELWA 5DP2A 3MOSA 3RS2A 4YCJA 1U9ZA 4I50B 3TNDA 1KT0A 1ODLA 2H06A 3KSLA 4EHIA 2QRGA 4CLXA 1RI5A 4WH0A 4OMCA 4FLHA 1S1CA 4OMUA 1Z75A 4WESB 1NKTA 2AUTA 3WNCA 1RM5A 1ZONA 4FGJA 1T24A 2I9KA 4YVQC 3CCCA 3MCXA 5BV1A 4I1VA 4JYMA 5A7HA 4RQIA 1N34B 1HFJA 1RHRA 3IHWA 1YDEA 2Z3VA 3LW8A 4HYYA 4II7A 4HUJA 2ZT7A 3FOBA 3CPHA 4K6HA 5JAMA 1YTLA 5K3OA 1A5TA 4CMAA 1B4DA 1L9XA 5F12A 1B74A 4Q9DA 1RM4A 5B53A 3K5PA 2RHJA 1SHKA 4QO8A 1IEWA 1Z4KA 4P82A 4RESA 4WZ6A 4DSZA 1NBHA 1W4ZA 4XIFA 2BCEA 2YY6A 4OU5A 4ZO6A 4F3YA 5KTOA 2ZRNA 3GNQA 2OCAA 2NPFA 2I1QA 1N5KA 1Q0RA 1M54A 1ZKMA 5HEKA 2V6MA 1I36A 1S8FA 1W49A 1ENZA 2KX7A 2E4ZA 3IS3A 4LCJA 4B3JA 3ECCA 3I32A 4PLYA 1P2SA 4R1UA 5CPBA 2HLHA 4JELA 1LEHA 2AOTB 2X8LA 4JSTA 3DNMA 2IY8A 2J9YB 1U2ZA 2J49A 3HPQA 2OCYC 2P78A 1MW9X 1IWOA 2BEWB 4E30A 3ASOE 4I2VA 1N78A 1UODA 1M33A 5HTKA 5JU6A 1OT8A 1O57A 3H99A 1TQHA 1CHDA 2ZWPA 3JS5A 4D9EA 4JVSB 4R7TA 3RK4A 4N0QA 4FLMA 5T6MA 1WM1A 1QKKA 3EGDB 1VKHA 3RKRA 3HCRA 4J6FA 2PJRA 2VAMA 1XK6A 3QXHA 3EWNA 3L2OB 3DFFA 5B1YA 3GLFB 3KVVA 3VLEA 1ADBA 4ZK2A 4WEQA 3I23A 1QHSA 3HRIA 4KQIA 4N5NA 1NDHA 1OXXK 2NU7B 4KN6A 1WO8A 2GD2A 1WUTA 1ZH0A 2JCXA 2AJCA 3IAHA 4LRSB 3ZXPA 2VP4A 2EF1A 3FUJA 2E55A 2XTAA 2AN5A 3AKYA 3NDIA 1LLCA 4INAA 2H0QA 5KJCA 3SK0A 5AHWA 4BJHB 2AJBA 3FMOB 4HS9A 3HXQA 2V7VA 1U6IA 5DX0A 3VMMA 3ZK9A 4BFWA 4DPRA 2R17C 1AOXA 1RQGA 2R00C 4Y2YA 3HR7A 3C7KA 4L4XA 4F86A 1G8FA 3OE7A 3H5NA 2E4WA 4B31A 1PZNA 4OL0A 1FVFA 2ORED 5F23A 1WA5A 3NNSA 1AQNA 3S2UA 3EWAA 4EG4A 3WZ2A 2PYZA 1BS2A 3OT4A 1JAYA 3GLSA 3WRYA 4F2WA 1P9WA 1M1YB 4H7IA 3JARA 5CFMA 2EX4A 4MCHA 3KS2A 5EZSA 1I4OA 4YK7A 4ZD6A 1X1QA 4ARVA 4WUYA 2C1XA 3K4HA 5EYLA 4OATA 3EZ6A 2D5CA 5FPHA 3V8PA 1CDZA 3T6KA 3NZUA 4JUCA 3ZQJA 3I1JA 4C2UA 1E3WA 3FUCA 2HDNB 1OLXB 2IH5A 1ISIA 3PFKA 1CWUA 2VBFA 5FNZA 2IP2A 4XIIA 2ZSDA 3CX4A 3FVTA 2OCIA 3S2GA 3LT5A 1OT3A 5DDIP 5JNTA 4YCLA 1YNOA 3EJ6A 3HL4A 3DEOA 3V6MA 1NOIA 4NMWA 3THRA 2YNMC 1EUZA 4DDVA 5EFOA 2PUDA 1Z7BA 2WABA 1P4AA 5DGXA 4BLTA 1ZIYA 5EIBE 4WFJA 3WLIA 5KJNA 1M2VA 3UG7A 4NENB 2BGRA 4ZCIA 5KWEA 2IY0C 4UASA 3G88A 4RVUA 3UG6A 1XDBA 3COWA 3IJRA 3P2JA 2Q3HA 2WKSA 2WJHA 4IINA 4IW3B 2WU3A 2BC9A 4OHCA 4PFQA 3RPEA 2QBYA 2OXEA 5EIWA 4OXRA 2VNJA 3L8HA 4MVJE 1Z5WA 1O77A 3LTNC 3U66A 4UM8B 2R9VA 4BV8A 3PC8C 1ZVKA 1JG4A 1PWXA 1DAGA 4LDJA 2OCBA 4JEIA 1BKDR 4WKOA 5EUCA 3RAPR 4CMKA 3AIIA 1IBCA 1XGWA 5JEEA 3P7MA 1UBSB 2AHRA 5T3YA 1NVMB 4B7CA 3ZZNA 1AQUA 4DX7D 2NZ2A 3CK8A 2VRNA 3OTGA 2GJ8A 1CR0A 1QRSA 3FEXA 2UUPA 1C81A 1UDWA 3GP3A 1TXGA 3I6MA 3LCVB 4M89A 5DIZA 2IZ5A 1THZA 1Q74A 3SZ3A 1YXMA 5HIJA 1BU5A 1JXQA 2VZEA 2W5UA 3CHYA 3EXHA 4HWSA 4JU8A 3ABSB 3UENA 5C35A 2QPTA 2XZOA 4TZ6A 3NH9A 4ATNA 4A55A 3L6OO 1ZHOA 5F3RA 3JAKA 3RU2A 2M63A 4LPSA 3CW9A 4DT1A 2OLEA 5IRCD 3SMVA 3T5BA 5EYPA 5AK5A 2X1MA 4BHTA 3U4GA 5AIBA 4OU4A 4C9BB 2PX4A 2QA5A 1WW8A 2I4MA 3GNTA 3ONEA 3HEAA 4H60A 2ZPTX 5EJ9A 1LSJA 1SBNE 2HUPA 3BE8A 4TM8A 1E0AA 4PVCA 3L82A 5DGTA 3PNTB 3PLAE 4RDIA 2FPKA 2ALJA 3GARA 3OCXA 2YIVX 4MW2A 2F62A 3PX3A 4JC0A 5CLHA 3LCRA 3RFTA 1WBBA 1YZHA 1ECPA 2PS9A 2Q0SA 3BGSA 4TRNA 1JG6A 3IDSA 2EGGA 2XTMA 4LDPA 3DOJA 4H3SA 3X1DA 2J59A 3JYLA 4BUZA 3EMBA 3M1YA 1UQTA 4IV0A 4GM0A 2O8DA 1IBSA 1QF9A 1U0BB 4QQFA 1RW4A 3GFRA 1Z7YA 3LDHA 4L0QA 5TT0A 2ZGDA 2QGFA 5GP1A 2WLTA 5HA5A 5SYNA 3VM6A 3AESA 2ZZKA 2QQFA 5T3RA 4KUHA 1X5BA 2VT7A 1HQKA 3KEQA 4RVOA 2F3SA 1ZUNA 3ZN3A 2IL1A 2X58A 2W11A 2YWXA 1WR8A 3K73O 4AD8A 1KMHA 3M4XA 4KXUA 3JQAA 4CCAA 5GJVC 2EERA 1T5DX 3GGGA 3HCAA 3VDQA 4CCSA 4DR4B 1QE5A 3A6FA 1E20A 2FMHA 2C97A 3B8EA 1N2EA 3WL4A 4B73A 5I9TA 2BJHA 1EJ2A 1SQ6A 3IPLA 3O4IA 4U2KA 5E6SB 3F6YA 3UCFA 2BHSA 5M3BA 5HQ3B 4TTJA 4HRVA 5F1YA 3TLMA 1FQJA 5IYZF 4HGRA 1RU3A 3JQFC 4H0CA 2Q49A 3FR8A 4IJMA 2JLWA 2P8SA 2PN1A 5TPWA 1V7CA 2HK8A 3QLJA 1H2YA 4TS9A 2P2GA 3FN4A 4XSVA 3ZY5A 2ZSIA 1JQBA 3G3EA 2WQ6A 2ZYHA 4X8HA 4L5CA 4CR6A 1GAQA 1GKKA 4O4JA 2A5EA 1A9TA 1E96B 2H85A 3C72A 4DCPA 3DXXA 1YZVA 3AJEA 3GELA 1ZR2A 1A1SA 4AOFA 2QRMA 1KS2A 3G2KA 4N82A 2QX7A 2HH9A 3KLMX 4FFPA 3VTFA 3R6WA 3V48A 3DSWA 3V7WA 3P9XA 4R6WA 2NZWA 1WPXA 1N8TA 1NV9A 1ZO8A 5EPEA 3T34A 4CKBB 5IXSA 1J0DA 2JVJA 4BFYA 5JO9A 1ULZA 2X2FA 2X6TA 2RK6A 4NQ0A 1XE3A 1A0OA 3LUFA 1CNEA 4Y2XA 3DZKA 3PITA 4KXQA 4ILKA 2QNBA 3RIXA 1T2AA 2ZQYA 4F3NA 4DJDC 3D7MA 4XB6B 3PFFA 3UM0A 2DM6A 2PMKA 4GI3A 4I2NA 3ABME 1YUMA 3DMRA 4GMHA 4RK6A 1GTG1 4FN5A 1E69A 3U3MA 1KEKA 2FPPA 4ENSA 2CCJA 2Z4SA 3ZNQA 4B83A 4RFVA 3S70A 1NTRA 3ULQA 1H5QA 3IP3A 1N94A 3C8ZA 4EHBA 4P35A 5DSZA 3U3OA 4CGZA 3JW8A 5ITZA 2FZLA 1JNXX 1NFFA 2A9PA 3K0FB 1ORIA 3NDRA 2W2KA 3TPFA 4XD7A 1QYWA 5AVSA 1ENYA 1K7FB 5EY5B 3U13A 1L6RA 5ELMA 3PD1A 2PANA 1Y3IA 2YOFA 3DDOA 4A10A 1QGDA 5JC1A 1GDDA 1Z56C 4DDKA 4EY3A 1VCHA 1VI2A 3L05A 4OM8A 4BJ1A 3PTZA 5T57A 2HTEA 3KJGA 3IAM1 3OPNA 4Q03A 3WGKA 3TUZC 3KYIB 3KOMA 3SBEA 4U7GA 1I13A 1I33A 2VGYA 1VIAA 3OEEA 2PUJA 5JI2E 3QU9A 3WNZA 3ENQA 5HXAA 4B8AA 2Q1SA 4H7KA 4RK1A 4J4TA 1SC4A 2QR3A 1UINA 3L8CA 5FUXA 5THXA 4RULA 2FPLA 4D2IA 2GF9A 2YJ5A 2PNJA 2Z3ZA 5AVZA 2QNIA 4RVGA 4DB2A 1HYHA 2YJNA 4E22A 5JC8A 2ZRMA 3R7AA 4BV9A 2C7PA 4XASA 1IM2A 2YJTD 1NR5A 4RH3A 5I7UA 2Q6OA 3DLPX 2ZS7A 5JS2A 1T8WA 1U9JA 1CUYA 4E2FA 1W4CA 1P2GA 1Y6GA 4PS0A 1TAQA 2O5VA 4JFAA 1ODKA 3L0BA 3RO3A 4RYLA 2O0MA 3JQCA 3KL4A 3D0QA 1PW5A 2O8VA 2ZIXB 4RQAA 3TLKA 4U0UA 1W9HA 4B7AA 1O8BA 2OHJA 2O2CA 4MRVA 3FZEA 3R7QA 1GUBA 1PK8A 1YZKA 4JK3A 4LQCA 4MMZB 2FPSA 2R6FA 4KVGA 4BNDA 2Q28A 1HRDA 2C5EA 4RGBA 5HK8A 1F3LA 3TQFA 3UYKA 2VWGA 3ZLVA 3P2BA 1FP6A 2FI1A 2XITA 2B0CA 4L51A 5DWQA 4Q3NA 3SQLA 3OPYB 1I3KA 4Q96A 1SQGA 1KJJA 3EXAA 3MKRA 3ASFA 3UOGA 2B6NA 4YT2A 1NJSA 3UB2A 4U00A 3I45A 1ENPA 3ZU4A 1DJLA 1Q14A 2LVBA 5DV9A 3RJTA 2VHEA 4A9AA 2H1OA 3DBRB 2Q2QA 5A3JA 1Z06A 1XROA 2LPMA 3GT4A 3HFJA 4ND6A 4X1KA 1OV6A 2GAIA 2OXTA 2ZI9A 3KKOA 5D1HA 4R84A 1QWOA 4QJ5A 3QUSA 4E4YA 3DZGA 2Q8QA 5BV7A 4N5IX 5BNTA 1VCMA 1UM8A 2Q41A 2BR4A 3KVOA 3UKJA 1H0RA 1DLJA 4MH0R 5BMOA 3HXKA 1W29A 5A1TA 4J2OA 3CZ5A 2IYNA 4GLBA 2XJ4A 1JYEA 2D1YA 3MEKA 3ER6A 2O7NA 1I6KA 1GY8A 3QSGA 4DQDA 4YPOA 5CAEA 2CYAA 1Y8ZA 1LNZA 4D74A 2XVAA 2ZISA 1USGA 4H6WA 5B2FA 3DNPA 5CFQA 5JAOA 2IYUA 2WIFA 1SXJD 2WSLA 1UXIA 5JFOA 2YN4A 2WB4A 4BERA 2FP4B 4KT6B 3D8SA 3PQ2A 4MWSA 2OGWA 4XCQA 2RD0A 4RY8A 4ZI5A 3PK0A 3RLIA 1L4YA 4GXRA 4GQBA 4FB4A 1FX0A 2QRHA 3IUJA 5B4UA 3OPXA 1YZUA 1HKUA 3FGPA 2WTUA 4W9NA 3G2UA 2RCYA 4QLAA 3DSVA 1TM7E 2CJWB 5FL3A 3IT2A 3TW4A 1ZRMA 5JQGA 3QE4A 4J0GA 4PYOA 1HU3A 3HMKA 3V33A 4Z4GA 1CX9B 2XEVA 1K4MA 3O03A 1RWXA 2MR5A 1C29B 1U7HA 3IBFA 3I0NA 2WV9A 1P5FA 2NU9A 3NBUA 4FSDA 3EBLA 4BNFA 1Z7EA 3E0QA 1PR4A 3BRCA 3UTDA 1J9GA 2ZUSA 3ZYCA 2X5XA 1L5QA 4KYIB 4EPRA 5BVGB 4FFNA 1XRRA 5DIFA 1VSTA 3LPCA 5FIOA 2OBFA 3NASA 1XEXA 3L7AA 1CIPA 1NFQA 4BCDA 1YRAA 1W1WA 1BA2A 1DKPA 4G4GA 5IAAA 2A5LA 4MJLA 5G41A 2WSMA 4RDCA 3SKYA 1M67A 4LWZA 1TYAE 1QTRA 3LC7O 4HVTA 4P80A 4WE3A 2A5FA 3WK9A 4B82A 2C3UA 5FWXA 4URKA 1M1UA 2XH8A 4KYVA 5EE1A 2W6IA 4CEMA 2FRVA 2HRCA 4IIJB 4WPGA 1TF7A 2C42A 3EH1A 1RWKA 3I2IA 3L0PA 2P9QA 4EATA 2EFCB 4NMXB 5AENA 2VUUA 1MA3A 2WUDA 5EN5D 1E58A 2X2OA 4AWXA 4QT4A 2BFBA 2IUSA 1C7ZA 4OHUA 2C2YA 4N7JA 1FLAA 4O2AB 1XWIA 4S1WA 2JVKA 4XGQA 4X7PA 3U26A 2XMPA 3SOPA 1VSQA 1QK5A 4DYDA 1IXVA 1LI7A 1TUBA 3M6VA 4MHTA 1ZAYA 2NQTA 2VBIA 2Y6VA 1SCJA 4UWHA 3H8SA 3N39C 1RCTE 4N1AA 4EVIA 2R1UA 3GD7A 3V2GA 5DM70 2XQKA 1JP7A 3CGWA 3EOAI 5KPJA 5ENDA 1UKAA 3VC3A 5EVCA 1ZM3A 4EW2A 5JPCA 1DADA 4A23A 3C1OA 4PXSA 2N1BA 3GVXA 1JAZA 5EMJA 2NZYA 4F56A 3LJNA 2E82A 3JQRA 5I9BA 3ZHBA 1EZ4A 3AV3A 4YRGA 1NE7A 4R81A 3QE3A 3CKLA 2DR0A 4N3AA 4D10C 1E77A 3VZQA 5DJ5A 1F0NA 1NP3A 1CIVA 1Z0IA 3K96A 2GFQA 3MV3B 2W2PA 4D44A 3FH5A 3GGSA 3INNA 3M9XA 4G0MA 4MDYA 1VE3A 1BO6A 1EHYA 1N2JA 2Q62A 2Z1DA 2IYXA 2QRVB 4G5OA 1GNRA 4FE7A 4X8MA 4ALNA 4CL3A 3HDQA 3TXAA 1SXHA 1FMJA 3H5RA 3KV3O 1YA8A 3BA1A 2UWJG 4AMUA 1EGAA 1JR3E 2OCGA 2TECE 3PNYA 5D3MA 3Q85A 3G0CA 2Y0CA 2JZOA 2NYVA 1L3IA 3F2IA 4MS1B 2XT0A 4RIEA 4WKPA 5AHXA 1R4MB 1R0YA 4LRTB 4ZYXA 3K0CA 3S1AB 4CIDA 1RLMA 4YAFA 4ZV7A 4HVAA 1T9CA 2FPMA 2HF8A 2QRPA 5EQJB 3L4BA 2W9XA 3OUTA 1SC9A 4BQIA 221PA 3EXEB 2ET6A 4QICA 3SS8A 4HUTA 1S9DA 2FZVA 2QX9A 2H16A 4F3TA 3WBJA 1K89A 2GK4A 4G2NA 1FNSA 2PSDA 2XT9A 4WRRA 3U4MA 2L6JA 2WHPA 4MYHA 2CBZA 4Q05A 1WDLA 1NLUA 4F4UA 5J2TB 2NWQA 1NVXQ 3T3PB 1R7RA 5K45A 1D0SA 1U2TA 3HSSA 4RXTA 4E09A 3TIGA 3C6MA 1E1QD 5LL6P 4NU0A 1M83A 3S81A 4AJJA 4LYGA 4WFKA 1QIKA 4CR8A 4O4LB 1PQPA 1MJGA 3JUEA 2WRZA 5A7DB 5EFZA 5SZHB 4MS6A 5ANLA 2ZIGA 3DFUA 3AI2A 3NW9A 4QOGA 5KYVA 2GESA 2ZYWX 3V55A 1L5MA 4BX0A 1FYWA 3TE6A 3GYBA 3GT7A 2BGMA 4L23A 4F1KA 2O1WA 4YREA 3A1VA 3KOZA 4JD5A 1PNOA 3HNOA 1QANA 3FJOA 4Q24A 2JZCA 2Q4EA 1C8LA 1JEAA 3Q2OA 1KA9H 4FHEA 1W93A 4F85A 1UBUS 2IYTA 5HJEA 2GBGA 2PZMA 2EJVA 1AQLA 1H6BA 1KC3A 3FDXA 4F2DA 3ZV3A 5MGBA 4OX9Y 2WWVD 5LM3A 5LDHA 3VSCA 2DB3A 2WP0A 4DIUA 1XU7A 3ULEG 4W5TA 3FTXA 4J3FA 4QYXA 2QLFA 3V46A 2QZ4A 4KQXA 1RLUA 3DP7A 2FG7C 1NZJA 1L5KA 3TMYA 4R54A 3JZMA 2A57A 4IH9A 5ECDA 3VO2A 4IQ8A 4LA4A 2NUPA 3ZIAA 2ZEJA 1PI3A 5LQAA 1NXWA 3ED5A 2DIWA 2C9OA 2O2XA 3HTXA 2J9ZB 5KJLA 1G18A 5HS6A 2QG4A 5K4HA 1YJAA 3K6RA 1QRTA 4PLCA 2C4KA 1UK8A 4RW0A 4W9MC 1FX0B 3T3NA 3E9DA 3LH5A 3QOFA 2DCMA 2QUHA 2QN1A 1VXRA 3G17A 1G9SA 1JYSA 3VXKA 5B7QA 1Q3KA 4IDHA 1M2EA 2J41A 4PG4A 4RD0A 4LK2A 4ZAZA 5EWMB 3VPAA 4C05A 1MH1A 3FYUA 2C1EA 2C3PA 2VDOB 3L5OA 4KFRA 5G1PA 3AI3A 4N4AA 2YQ5A 3NM5A 2OM6A 2ZYSA 3ULKA 3MX3A 3OE1A 2XGOA 1U3TA 4BGVA 4RJIA 2WB2A 4MGIR 5HQ3A 3N6VA 5EWLA 1ZS9A 1H6KA 4R2IA 3SSMA 3GIDA 4KTTE 1UJNA 1KXZA 3NOOA 3PHLA 4CU2A 4A0RA 1ZJJA 1UEJA 4Q00A 3AERB 4UBNA 2ZJ3A 4O4JF 4UUMA 3IDAA 5MN4A 1F4VA 3PQDA 1QRUA 3MINA 3BKWA 3COJA 5KDDA 4H7XA 2AQIA 2FUNB 4N0DA 2PUEA 1V1JA 1HG1A 1MJNA 1JE0A 1OYVA 3AESB 5FOXA 1V8DA 3VTXA 3AFOA 3DOUA 3R8XA 1KRXA 4PNZA 1G64A 2C20A 4XJSA 2DJIA 2RCNA 3LYAA 2O7RA 4TV8A 2ONDA 5GOTA 1EFCA 1PKXA 2ZCUA 4QDKA 3WAGA 3ER9A 4EHDA 2ZWAA 2Z6UA 1E9CA 3IHYA 1NBIA 1AZTA 4KO8A 1N6LA 4EVSA 1A50B 3RYIB 2K87A 3PC2A 1RXIA 1XMVA 3EMDA 2HFKA 4YCAA 2XAAA 5LSAA 2CVPA 1Y3HA 2WG2A 4KPEC 3V7NA 2ZYUX 3PUJA 1XNFA 5TQJA 4IVRA 4IV5A 1QCCA 1IN5A 2E4VA 4FZVA 1YQWA 2XUQA 5TQ2A 4J76A 2Q1TA 2P9JA 3ANNA 3NHZA 1E0SA 3NPAA 3S7TA 4ZQGA 2GHQA 3A2LA 2KCVA 1NUSA 2PT5A 5BSTA 5L45A 1T5SA 2IEDA 2O52A 1B8NA 2QV7A 3BXFA 3C8DA 4MW5A 5EHNA 4BLVA 3S6JA 1CY1A 1WQ1R 5B1AE 5IJ9B 2Z4TA 1OXBB 3U56A 2VGXA 1I0LA 4M0EA 4BE7B 2PGDA 3U3WA 3RS9A 2EFEB 3A2NA 3D6HA 2BT4A 3VR0A 1WZCA 2ODWA 4RK7A 4P53A 5BSWA 1JBQA 3TLZA 3GLQA 4RFLA 2Z83A 3TGLA 1PFKA 1QTIA 4KSBA 4OI4A 1YHZA 4BTBA 2QTTA 3WDMA 2JGRA 3UCXA 3LBNA 1BCRA 4L08A 3O1LA 4QO7A 3M6AA 5LBTA 1P7PA 1YCHA 3II6X 1I2ZA 1UFKA 3GJ8A 2C7OA 3ASVA 3MMXA 3RYFB 3QM1A 3JRWA 2H52A 4H3HB 4KQFA 2JLCA 4PU0A 2QQEA 4FMDF 1SVSA 3LWBA 4H6XA 1TTTA 3ZDBA 2WY2D 1BN6A 4W1SA 2XR1A 3A31A 3I8SA 3WWZA 4LIPD 2HCTA 1O94D 4NENA 4C0QC 2OWEA 5A2GA 3EVEA 4ESVA 1Z4OA 4KMMA 3ITEA 4U0KA 4XX5A 4XQGA 2WM8A 4HQRA 2HPZA 1DAMA 4IR7A 4BMYA 3U7QA 3FTSA 5DXFA 3WLHA 3ZW8A 1J1UA 4X41A 2WJ6A 1RZ3A 1LV8A 3Q7FA 1JQLB 2CDNA 2BSAA 2ZBVA 3FLAA 4PZ0A 2B1JA 3FROA 3ZYLA 1YE5A 1XLTC 1Y1QA 1Y5IA 3CH6A 3C1AA 2BE9A 4HX2A 6PFKA 3S1LA 1U8EA 4AVYA 3HYCA 4DR3B 3UMVA 3K5HA 3FKSA 2WJGA 1FFYA 4JBXA 1I2AA 1VIMA 4S1NA 4XB2A 1ONNA 1GZ6A 2DPGA 3OO1A 5FZQA 1T5OA 2AFIE 3ORYA 2AOVA 5EJ8A 4Q3BA 3KOUA 1KQOA 4J6EA 2CFCA 4G0YA 3WK8A 1OCZE 1T5BA 4LVNA 3E82A 1MQAA 3BULA 1JQEA 2C00A 4X8QA 4DCSA 2AWNA 4OEHA 3TOXA 1EF1C 2XCIA 3DHEA 5CTAA 2FF5A 3DV2A 3G5AA 2PV7A 1MD9A 4ALIA 1NYRA 3TLGB 1I6MA 2K4MA 2Q21A 4RA6B 3OOWA 2YHAA 3DPUA 4L4YA 4YDEA 3X1YA 3QOUA 1LX6A 3B48A 3T5AA 2RGNC 1ZVMA 5K20A 2XGMA 1QIMA 2P4SA 5EDSA 1WP4A 2A94A 2FOLA 1OREA 2QTWB 2QF7A 3K2QA 3IEXA 3OZCA 4E2ZA 4DRXA 2FSPA 3ABKE 4JYPA 1ZOSA 3MXOA 3G6WA 2HKIA 1JJAA 2RHOA 3NWBA 2YIJA 2NP7A 2B36A 4ANWA 3UXGA 1QO0A 1UXKA 10MHA 1NMSA 1XEFA 2OV6A 4RHUA 1P5RA 1RJ9B 5EJIA 5AVRA 3DL2A 4UQXA 1JQAA 3ROXA 2IF2A 4RA6A 2G6TA 4TL7A 1BWRA 3KJIA 5HF8A 4ZEMA 4DN6A 4PO3X 5JHAA 3EEQA 2I3GA 1ZK2A 1XZQA 1DC6A 4RTRA 3CGHA 5J4LA 2OBXA 4YROA 4BSXA 5I7RA 3EZ7A 1RI4A 2A9VA 2CLKB 3PFNA 3H04A 4J0UA 5HUJA 2AOTA 4OP2A 3CWCA 3K05A 3L4SO 5TQ0B 2IVFA 1UPTA 1ZUHA 3ABIA 4ZVUA 2VDKB 4R7ZA 2QQ5A 3FPSA 4RQUA 3IDFA 3H5AA 4FFBA 3GFOA 3DEKA 5A5FA 2KBXA 1OAOC 1RHMA 4CTMA 2ZJ8A 3C8HA 2R6HA 3CPJB 1NVBA 1UOOA 4HFJA 4LGCA 2QLJA 2ZUVA 2HCRA 4HJRA 3FOAA 1V1MA 3QX3A 1R50A 3BK1A 1OZHA 3D6UA 3WK4A 4HLLA 1WAMA 5DXJA 1SU4A 5K1ZA 5FORA 5KDOA 1ZI8A 3RBVA 5HKKA 3UMYA 1P33A 1E4YA 3O4FA 1TRKA 4M76B 4PYRA 3D3MA 1SCUA 2B1IA 3SQMA 4ALJA 1ZU2A 4L5IA 5E3IA 4LUCA 2YASA 2FSVA 4KXXA 4RVCA 2A9RA 1KY3A 1JUDA 3JWIA 3PXCX 4DSUA 4HZIA 1O54A 5L3SB 3FWZA 4FHZA 1TEZA 1V25A 3O4RA 3KQNA 2IYVA 3S7FA 4OLAA 4DPLA 1WMDA 1W9MA 4HHEA 4MPTA 1KDOA 1P18A 3VA7A 4BX8A 3MWDB 2AJTA 2FX5A 3GUYA 1OX4A 4KYOB 2NZXA 5L4LA 1ID1A 2DHQA 4ID9A 2E1PA 4UJ5A 5IDVA 1YS9A 4LSZA 1KFCB 4Y18A 4AURA 2YYAA 3AVQA 2FFAA 2PKYX 1AGNA 3KCQA 4M9SA 5JRJA 4UQZA 2FGKA 1SQ5A 1S89A 3INGA 4C0XA 1OH7A 3QU7A 3PUHA 4Q1CA 3DKIA 4AO8A 3DL4A 4GTRA 5J1SB 2XZTG 2QU8A 1Y5LA 4QECA 1H2VC 1J49A 2PSFA 1IQ0A 4JBWA 4NONA 4UHKA 4K3VA 2VJLA 5LOVF 2XA1A 4RTSA 2CZQA 2QGZA 4UM9B 4U6SA 1GQYA 3C4VA 5TQ2B 1N2HA 4YP6A 1KEUA 1PR9A 1TF5A 3EY9A 3QEMA 4BNIA 2IHYA 5KNCD 4LC0A 3PR1A 5LZ9A 5EL0A 4B80A 1O95D 4LK3A 3DR5A 2PJZA 3BRWA 2FV8A 3FOEC 5AK3A 1XZDA 2QN7A 2PUVA 2XGJA 5TQ0A 2JGMA 3HLTA 1NN1A 2QRUA 3RYTC 1RBYA 5H7PA 3HM2A 3P0EA 1F5SA 3BD7A 4GBMA 4LXQA 4MI1A 4M53A 2V0CA 4Y0AA 5JDIC 3NMUF 4EKDA 1B0AA 2WFZA 4TV3A 3V79K 2ODEA 3DOIA 1PTJC 4R3WA 3LNCA 4O2BB 2IW3A 4S3MA 4DMCA 4ZI3A 1QGUB 1GV0A 4B0ZA 3JQEA 3WKEA 3MF4A 2AOUA 2JGDA 4IQ4A 4P33A 2GZHA 4I4TF 5EKUA 4YP7A 1L7RA 1OX6A 2ESRA 2DBRA 5G3YA 1PEAA 3F74A 1AGPA 1E1KA 2WHRA 1BW9B 3IRVA 3K0BA 3LSYA 4YTEA 1XDGA 5J23A 2W70A 4H1UA 4OOFA 4U7PB 3H5LA 4EFDA 4RANA 1UT8A 3AF2A 4MOWA 4EJ0A 2CVHA 1YS7A 4OK3A 3TECE 2VSYA 3O83A 3AOEA 2JGFA 3KJFA 4MW0A 3S7ZA 4Q3LA 3U1VA 4LHVA 1T35A 3PYMA 3VISA 2H17A 3HXBA 2DVMA 1MORA 3GLKA 3A27A 5EI5A 1Z07A 1ISHA 1IHGA 3TGPA 4DI4A 1U0LA 3CRRA 3ZLTA 3ZWYA 5KWDA 3LYUA 2YWEA 3C97A 2IBTA 1JDUA 3W04A 4JVSA 3BOSA 3IJPA 1FTYA 4LAFA 5JATA 5ALGA 4JL6A 4DCTA 4NBUA 4B3SB 2DFDA 4RSHA 1YJ5A 1UM9A 5JASA 2ZS9A 3RRBA 1A2KC 3IEVA 3I83A 3ZHCA 3QYJA 2VVTA 2VEDA 1JU3A 4XGRA 3TD6A 2IJGX 1LDYA 1IHPA 1V3VA 2HF7A 4EG3A 1HLPA 4O4LF 2B1RA 4XDZA 2HXSA 1ADJA 2XUKA 3NT5A 4JZYA 1RLOA 2ODPA 2ZW9A 2VRBA 4I17A 4MUNA 4AYWA 3RVKA 3P4XA 4YBZA 1LDMA 4V3CA 5A5GA 4DARA 1KBQA 4DX5D 1ZGZA 5CLGA 4TV8F 5AFSA 4XQ9A 2XZDG 3FP3A 4CDNA 3OWOA 4QU0A 3ESYA 4TMFA 4BC1A 2IYYA 4WV3A 1RYMA 4EHJA 5AN8A 5HRAA 4TVBA 2H5EA 2UZ0A 3NYWA 5LQCA 1TADA 1GGHA 1WV1A 4LNUD 3C70A 3V1MA 4P3XA 4Q1FA 1PR3A 2QEQA 3HCDA 1F0PA 3O91A 3KQUA 2HIGA 4ISCA 4B3GA 1F3OA 3K9LA 5LP1A 5D00A 1OFIA 2GJSA 1TQ8A 3APCA 3QBJA 3W4IA 5HFNA 5JWRA 4L6AA 1CJSA 1ACMA 1NRJB 1ZXLA 2VP2A 4PLHA 3TTSA 1U8TA 1V9LA 2H1FA 2FSVC 2X15A 3EUEA 4M9ZA 4OHKA 4XJTA 4AKEA 4HXFB 4EF4A 4OJNA 4ZJYA 1XZGA 4WA7A 4HAOA 3K6SB 2ZM5A 1QRDA 1C30A 4NYIR 4P29A 1RWWA 1B15A 1G7CA 3LP5A 4GP7A 4ML3A 3IPRA 3R9WA 5KWSA 1FNNA 3FPHA 5FA5A 2QM0A 3MT8A 2HBYA 4TYWA 1S0PA 2AEMA 2WSBA 4IO1A 2J4BA 3O9VA 4KB5A 1T1RA 4NHOA 1N75A 2ISQA 3U3XA 1SMKA 3H84A 4YUYA 1J23A 4UE2A 4YAGA 2OT3B 3C3MA 5DHSA 4P38A 5JNVA 3I0ZA 1WB6A 3VZBA 1DQSA 1NJ1A 3GJYA 3Q3HA 3DOHA 3UGQA 4C4ZA 3RVRA 1QQAA 2I6QA 2XDQB 3OZVA 3WA7A 3X1JA 4QOSA 1NVAA 1NU6A 2NVOA 1L4BA 4ECEA 3RSZA 3QX8A 1LH0A 3IIEA 2HMAA 5COBA 1U0OC 1UJ6A 1FK8A 2G0TA 3CWZA 3FCEA 3U17A 5BSGA 3WG7E 3AHJA 3P20A 5K0TA 3ZQ4A 1ENOA 4ZU6X 1DAIA 1D8EA 2HGSA 2EV9A 1GAJA 4NWIA 1R27A 2R4TA 3BN3A 3L01A 3SN6A 1FSZA 1KOJA 1T5HX 3W3AD 2J3MA 5JXJA 4CXMA 3PIRA 3H97A 3HB9A 4HS4A 1M76A 1J0CA 2GRLA 2X6HA 1PZEA 2PYDA 2BHLA 3UJAA 1ZR4A 1HXHA 1VYVA 3KKZA 1KK0A 1E2EA 2C2ZA 5CFNA 1SBYA 3DSUA 2FR0A 3C43A 4Y6PA 4Y0VA 2VF8A 3HBAA 5M34A 1ZCZA 1KZOA 2ZATA 3B1KA 4YYEA 4YAJA 3I4FA 3OAAD 2PRSA 2F1IA 4JW1A 2EINE 2ONZA 4ER5A 4GKVA 4BVAA 3EZFA 2JJ2D 3SFZA 2ZRIA 4R98A 3EPRA 3KXPA 4QXMA 2VPXA 2FLVA 2PSHA 2YVAA 4XX0B 5L3QB 3VH1A 5AJZA 3IAS6 4F06A 2A1UA 3A2KA 1FE8A 1HZZC 3EXG2 5EXPA 1YVRA 3BORA 3H4IA 3V97A 3VVLA 3GJ0A 3DVSX 3GEGA 4KAJA 2JJ1A 4IICA 4Z1OA 1J0EA 1KERA 2CK3A 3QEKA 5H3CA 4CGWA 1ZCBA 2QK4A 5JDCC 3VU8A 4KRYA 5I3ZA 4C21A 5JQGF 1KARA 4D4LA 4ZVSA 1HT0A 3FTPA 4FN4A 1R4NB 5PGMA 4Y6OA 4GTTA 2R6AA 5HZKA 3HN2A 1P4SA 5FBVB 1CVRA 2AFHE 1W88A 3GFQA 3E34A 1GGMA 5G2OA 3ZHVA 5KYWB 3K5IA 3R9XB 3I9LA 1VECA 3KJQA 4Y6GB 1E3IA 4KHZA 3UJ7A 2EKBA 3TTXA 2GH1A 4Y2RA 1JJBA 4DCUA 1RTTA 4QVIA 3BGOS 4OAPA 3W9BA 4REQA 4KK3A 3WQHA 2H59A 4F21A 3RS8A 3GD5A 5C51B 2P79A 2AFIA 1F9EA 2GNPA 2FE4A 2WJ4A 2X4GA 4YT5A 5TMBA 1O6FA 4D9MA 5AJDA 1F2TB 1RAFA 2QVBA 4J29A 3LCJA 3EMVA 2V59A 5KX5A 3OZGA 2FZ5A 1ESNA 3ASNE 2ADMA 4U2FA 3LVBA 2GHRA 3MC1A 3OPQA 2H1RA 2O23A 2K7FA 1PX2A 3DAPA 4FC7A 4OHYA 5AKIA 1SG6A 2BKLA 3OT1B 3DE7X 1CQJA 3C24A 3SGLA 3LW7A 4H77A 4R8LA 1ATZA 3T7TA 2GRQB 4DA9A 1GUDA 4LC1A 4TMXA 4HXYA 3DEFA 4OLHA 2I22A 2WHYA 3BFXA 4D4GA 3C48A 3GJ6A 5LYYA 4ZOEA 2AT1A 2D1TA 5J08A 3LPAA 4U0SA 3DYVA 4R5HA 3SC2A 1JBKA 3QUTA 3EE6A 5LX8A 2WMOA 4MV0A 5KYGA 3CVQA 1FRFS 2WWRA 3FZQA 4QGSA 1T9HA 5E8JA 2BKGA 4FJ1A 4WJZA 1HR0B 5LFAA 1RFGE 1MT0A 2FP4A 2RH8A 3BMXA 3QLUC 4HLCA 4JKYA 1H8HD 4NH0A 4RHFA 1OILA 2NPOA 4D9FA 5IJ0A 3ISJA 3V4RA 2YIDA 5AJVB 2C0CA 2QYHA 4I5GA 4IDCA 1UQUA 3C5RA 1LA2A 3MM4A 3PZ2A 1K7SN 3D6FA 3WKBA 4A5SA 2TS1A 1KI4A 3LY8A 3MTAA 2Q4DA 4TMVA 1ZVVA 1RHKA 3L0DA 1G6KA 4O4HF 1NN0A 2QZAA 2P3LA 3F97A 3L7JA 4MW7A 3BMOB 4QYIA 1HNNA 3TL6A 2C7GA 4IJQA 4IUCS 3BL5A 2O8EB 4FCTA 4KZPA 3O82A 3OJWA 3HKEB 4KN8A 4OYYA 3GLIE 5J90A 1Y7LA 3OCWA 4GVPA 4MK4A 5FA8A 3IOCA 1FZTA 2BTEA 3GK3A 1T6NA 3GRKA 3HGQA 4G8KA 1LRKA 3IMCA 4Y9TA 1TZCA 5E6UB 5LWHA 3CWQA 2G1AA 3AF1A 4J4BA 1Y6FA 4PZLA 4O0MA 1S3IA 5EHQA 4AKHA 1R6BX 1YGPA 4GSKA 1O6ZA 2V7UA 5AHRA 4F8JA 1GA6A 4M98A 5LQUA 1K88A 3FOWA 4BC0A 1T0UA 5FR2A 2EATA 2CHUA 2O7SA 4P5PA 5CA1B 5FUBA 2BLNA 3BXGA 4B84A 5DZSA 2IHNA 2O9JA 5K8IA 1PFVA 1NMZA 1EGMB 1U90A 2C9BA 4HNRA 3BXXA 3C0KA 5JHGB 4AULA 2WWYA 4DV1B 1XQYA 3AEUB 4IKOA 1GTRA 2VQFB 3B7UX 2PGJA 3FGOA 3ZX4A 4ZYLA 5BWLA 5B57C 3DPYA 5ES3A 1JECA 2B7CA 4QGHA 1H8EA 4KRFA 2VJKA 4KQ1A 5A3VA 4XH9B 1SIUA 1XFAA 2Y71A 2VPWA 1G63A 5LOZA 1C0EA 4OQLA 4F7AA 2PMBA 2PX3A 1IZ7A 4GKBA 4PV7A 1NMYA 1GPJA 2G63A 1RSZA 1EM6A 1I8TA 3OJFA 4L6IA 5TEVA 4B3MB 4DXDA 2VATA 3WB2A 2I7DA 4JOBA 1MOSA 1O6BA 1IBRA 2G0NA 2QE6A 1UC5B 3G2OA 5CJPA 4BMCA 821PA 2XUDA 4CDGA 3G13A 2ZYVX 1AK1A 4BB0A 2XCCA 4PPYA 4BX3A 2YV4A 2IHKA 2NPIA 4CYMA 4CM6A 1E1LA 2FJUA 3KL2A 4BMDA 4NCIA 1ZH4A 4QDXA 3D5EA 1VG0B 4IAOA 3VVBA 2J7PA 3R23A 4GNKA 1U3WA 3ZCPA 3HGMA 3MWGA 3E35A 1WZEA 1ZICA 4YJKA 2AXNA 3Q88A 1VHWA 3LOUA 2FZEA 1C7FA 2OFFA 3VDXA 1HGXA 2F8XK 3ILSA 5CRIA 2HL6A 2VXOA 1RXSA 2ETAA 3GEPA 4E4TA 3STUA 3ZLBA 1UQRA 3BL8A 2WIKA 2FLWA 2AXUA 4A8TA 1U3UA 1YVDA 4QDJA 3MWFA 4DQUA 5I7VA 1K86A 5ARDA 2GASA 4FUQA 4OYSA 1M75A 1OZAA 1MDBA 4R9SA 2AJLI 3SE7A 1NJGA 1OLUB 2P1RA 4HEA6 4TQ9A 1WSWA 5JZMA 2GZDA 3R5SA 2VYFA 2SKEA 2BEDA 1TL7C 1X0XA 3PWSA 4JLKA 4JT8A 4PSUA 3NO4A 4IHQA 4UE6A 4W5OA 1H3EA 1GL9B 1P0CA 2H2HA 1XAJA 4QNRA 3OBIA 5BVGA 2AQHA 3K1JA 3TLJA 3L13A 1V8BA 3WRXC 3EUWA 2NACA 1TI7A 1A8QA 2DY1A 4CM5A 4MWEA 1NR1A 3TR5A 2C4HA 2Q2VA 4WADA 3SZLA 3B6IA 2LCIA 2BFFA 3MJEA 3BIJA 1SGWA 2NNLD 1UPBA 4X6YA 1RWVA 5T8KA 4R9UC 2O2EA 5B12A 4N3GA 1BFKA 1R3DA 3IHLA 3ZKWA 1DCQA 4BWFB 5CLJA 2XENA 4JL8A 4PQYA 1WDMA 1N5LA 2YNMA 2FZCA 3CVWA 2BGJA 3MWKA 3FU0A 1U7OA 3W6PA 1S63A 4HDMA 4QRDA 3HVHA 4AMGA 3GXBA 3VYRB 3V1NA 2QYSA 3LQRA 4C5CA 1A4RA 1F06A 3MILA 3H6KA 4EA9A 3VJKA 4FR2A 2I9PA 4OFXA 4OYLA 2LCFA 2P67A 4R1LA 4FFBB 5KPDA 2P4EA 5DASA 1DCTA 3ABOB 1MHPA 2XNCA 4M38A 3H2BA 3E58A 4YNDA 3ZE7A 2HSZA 3V1YA 5AW1A 3BCUA 1MTZA 4M7CA 2FKAA 2ZBQA 4DMRA 1PY1A 3ZYMA 1HM5A 4JI4B 4KV9A 3BQ9A 5CIYA 5C3MA 4C0MA 1L5LA 4J0IA 4NV0A 2PVCA 1NSFA 4P93A 4S0ZA 4DBZA 4C7VA 4M22A 2ZWOA 1GT91 4E33A 1SIWA 1R4AA 2LDBA 4LJSA 3PNBA 3ZNGA 2CE7A 2NQ2C 5GMOA 1P1KA 2EKQA 1S8NA 1DU4A 3N0XA 4ZYYA 4COKA 1QFXA 3ASHA 1NYTA 3NEPX 3PZ1A 1GZ5A 4QXAA 4YJ3B 5BWOA 4BJ5A 2G08A 2L0IA 4C30A 2EWMA 1RXVA 5IK2D 3GLGA 2YXNA 4HTFA 3HFRA 4YXWA 2CHFA 1ZX1A 5BSFA 1PJ2A 1RXEA 2C3MA 1K6EA 2GSWA 1HOXA 3HHPA 4K05A 4P36A 1RR6A 4J1TC 4QEKA 4U5QA 5ESDA 4UTPA 1IH8A 1DINA 2CLEB 1WXIA 3L43A 3UHAA 3BRSA 4ZCMA 3H4MA 1AS2A 2F17A 3QEMB 4PC3A 1VMEA 1SURA 5J4KA 2OFWA 1GTSA 4Y9UA 2HX1A 4YI3A 2I2CA 4IJUA 4JROA 2GARA 3DDWA 3NBMA 4ZCSA 3CVNA 4WVFA 1W46A 2CL6X 1RYNA 3NBYC 3DO5A 4KSCA 1J99A 5ESXA 4N9WA 1PJRA 4EFNA 3T9CA 4RVSA 3ITKA 2XDWA 4PQFA 4QQKA 1FT2A 1CERA 3N8GA 4R9RA 5EAIA 1JI0A 4GGPA 2JCVA 2OZPA 4KXYA 4U1RA 2ZR7A 1TX4B 1YIDA 1EU1A 1WXDA 2GZRA 2NSYA 3M89A 4P7GA 2B3TA 3NAQA 4OJKA 3DGEC 4LHWA 4CDMA 3K2BA 3ICPA 4MQMA 4RY2A 3IP5A 2O2IA 5MFZA 1IDOA 5EX3A 2GXSA 1Y5RA 4US0R 4ZAYA 4LXIA 3U62A 5IASA 2ETVA 3SIPA 3Q7AA 3ZGLA 4BNUA 1N54A 3J7TA 1W581 2X86A 1TN7A 2ZXEA 1ARZA 2QVYX 5KJ1A 4XRRA 4A2PA 4F0JA 2VSFA 3A32A 1C30B 1DIOB 1IY0A 4GM4A 3G2WA 4TUYA 1XQXA 4EB3A 3HYNA 2HR1A 2NZVG 3LC1O 1DVPA 4Z9YA 3KXLA 3IQDB 1RC0A 1LJ8A 5GPBA 3KT3A 3O73A 1FQKA 4PVDA 4AZWA 4CUJA 5DNWA 3AFMA 3OLYA 4LTNA 5FOTA 3SDBA 3SM3A 3W90A 1XIVA 4NESA 4M46A 1PNVA 3GDGA 4MVJF 4F4DA 3I4RB 4KPUB 3ZBTA 2LGJA 3AJ9A 4IHKA 4C3ZA 1SZ9A 5DLEA 2WJWA 2ZJ6A 4TRQA 2PCJA 3O8QB 1MQ8B 1EHCA 3GEDA 1ZK1A 3L1IA 3NBQA 5ALNA 3WIEA 4FP7A 1L6IA 2O3UA 2NO0A 4L5BA 4RD6A 2C58A 4EGQA 3ZU7B 1A96A 1JS1X 5CVEA 3QP9A 3ZV6A 1WPGA 2B8JA 3G2PA 3LHDA 3W9FA 3LLMA 3P45A 4GS5A 3V9PA 1TO2E 2GILA 2AZ4A 2VUSA 1P2TA 1YT5A 3L6RA 2IYPA 3OX2A 4MUYA 3T54A 1ZMBA 4DY6A 3R5HA 3ZDFA 3ZPXA 4CF3A 3GFPA 2DG2A 5HRCA 4U7WA 2Q6VA 4R2XA 2O8BA 1GUFA 4IX9A 3LL7A 3KKPA 4UQOA 4W1RA 3GJ7A 8LDHA 1IN8A 5C8ZA 4X92A 1CULC 4HDRB 5AMXA 1RKBA 1X8KA 2Z0MA 4V0KA 3ZTTA 1BSVA 5DFAA 3E32A 4E6EA 1LV7A 2JIZD 2ZYAA 4J90A 3VNBA 2V3CC 1P1FA 4D8WA 5JNSA 3ISMC 5CD1A 3NVMB 2DX7A 2BDUA 3NX4A 4PQRA 2FQQA 1XLVA 4OA8A 3RCBA 1J6UA 1UDAA 1QP4A 2YHSA 2O4UX 2ZSJA 2ZJ0A 1QPGA 5B3SE 1Z16A 1PRYA 4KE6A 1WG0A 5ALWA 2VDNB 1KRWA 2XSZD 3W5DA 1ST2A 1AKRA 2Q07A 2WWWA 3M2TA 2P4HX 4EI8A 1U2QA 3S5UA 3KYDA 3T7IA 4YDWA 4EKEA 2BMVA 1Z4LA 3U4DA 2J3JA 4B3CA 1F8FA 3A9TA 5DYIA 4JKOA 3NH6A 4BJ6A 1N6NA 4RX1A 3M6UA 4MYDA 1G9XA 2FPGA 2HT6A 4ZT4A 1FFHA 2RK4A 3PGXA 4D8YA 2IYLD 1UDXA 2ZAGA 5DOZA 4E3ZA 1THTA 5J5CA 2IS6A 2XQGA 2F67A 3UJ9A 2QDKA 5KWJA 3L8ZA 1XCGB 2XB6A 4YIKA 5F7OA 5EP4A 3FUDA 1MGOA 3P1JA 2V3VA 1DDOA 3LDAA 5K3FB 3Q1LA 4AT1A 5AKZA 3GCZA 4F71A 3A28A 3WXBA 3U3JA 3ROMA 1PFWA 2IGBA 5CBNA 3T0FA 2MDTA 5K7SA 2CFIA 1W87A 3AF3A 3H18A 1Z28A 4CMCA 2V0NA 4O3FA 3GGJA 1L4FA 2PX6A 4INJA 1R0ZA 4D0SA 2Z30A 1WUJS 5I7AA 5JCOC 2OESA 1Z6QA 2V6FA 3SF8B 4DLZA 4MLCA 5FJYA 5EUQB 3WGOA 2R6R1 3CW8X 3IQFA 2ZIWB 4DDWA 4BGEA 3H42B 3HB7A 2CNLA 2D5AA 4X1IA 3EISA 1Y63A 2BMAA 2VF5X 3ETNA 1VDZA 3L7KA 4N2QA 1NYQA 4FNMA 4KSYA 4V2IA 2AD1A 5LDDC 3E22A 2AC2A 3CHPA 3NOGD 1XA4A 5TARA 1WW3A 4QHYA 4H35A 1ELWA 3SXPA 5LA6B 2I2XB 5EJ7A 2QTVA 3ZKWB 3GLHB 1T8TA 5K8UA 3JQPA 1CYEA 3PPWA 5E6RB 3LYLA 1WHTB 4Q69A 5D5PA 3E37A 1N2SA 1Z5ZA 3I53A 3SX4A 5BN4A 2C78A 3OJ0A 5I48A 1EAYA 4BKQA 2FUG6 3OUUA 4H1VA 5K8LA 4IO0A 4Q19A 4Q4JB 4X93A 1TA0A 3DWEX 3F8TA 1R2QA 2L82A 3VX3A 4B6OA 4Z54A 1KY5A 4F38A 3I04M 5CFRA 2O2ZA 2DOKA 1IJKA 2AYYA 2NQ8A 2ZU6A 3O8DA 1PD1A 5JISA 2B3DA 4WBNA 1Q2XA 4HFMA 1G2IA 4BQEA 3GA5A 121PA 3LAWA 2ERCA 4F4FA 4GVLA 5CVVA 1SBTA 4OOEA 5F3DA 2NUTA 4WXYB 3D9QX 1LPOA 2CMHA 5HGJA 4I66A 3WZMA 4PEVA 4CHGA 5D87A 1XCLA 3WK7A 1W4LA 2VXBA 2MSKA 3DTTA 3UEOA 3K1AB 2AG0A 3RJZA 4M1QA 1WP9A 2C94A 5KSPA 3VI3B 4HLNA 1JKJB 9LDBA 4M9RA 1DRJA 2Q6TA 3STHA 2IV7A 4OQQA 5COQA 3VV3A 1Z5PA 3OBBA 2R1VA 2QN2A 2HZBA 3MELA 3J81k 2AVPA 5ALFA 2X2PA 4N8SA 1WDWB 3U7JA 1IMOA 2B7LA 2A0UA 1BXRB 3U4TA 4WBSA 4HB4A 4QHSA 2DGDA 5MN5A 2TMKA 4M88A 3ROQA 2V6JA 4I4TA 3TTTA 3CR7A 1VP3A 3TTUA 1KYTA 1YBHA 1LDBA 2CZCA 3O4JA 3SYTA 1KF0A 3HK2A 3JQ9A 2PXCA 3R6TA 3SHTA 3ROFA 3OJXA 1KP2A 3Q8MA 1IJEA 2P5TB 1EG7A 2MSDB 4RLYA 1G0OA 3QWWA 1DXYA 1EVQA 1RRKA 2CLSA 2VP5A 3L9XA 2P9HA 3R0XA 3LL4A 4WXHA 3SQOA 2J0UB 2G5PA 3HBNA 1YK0A 3HKBA 1CP2A 1EP2B 2EILE 5UKDA 3CUWA 1DEOA 3DLCA 4UCWA 4OJYA 3NVDA 1BG6A 1SXGA 1Z2PX 2O2DA 3OZBA 1YYHA 1BC5A 3HCBA 2DKFA 5TIIA 1XJ5A 4KFUA 2XCBA 3D8HA 3IUEA 3USCS 3RJVA 4W1PA 4XYBA 3KSZO 1OCCE 1UZAA 3ZDZB 5AI4A 3EXFB 3BILA 1P44A 4R8SA 2MU1A 4UUAA 5F7JA 3DAGA 2CVQA 4J7WA 2A5UA 3OIDA 2PLRA 3EHQA 3QFCA 4X5OA 3KQTA 1XN1A 4JITA 3FMIA 2RHTA 1JDJA 1HEIA 1V5EA 3O3NB 5ILGA 1IZ0A 1G7RA 1KDTA 2HWXA 3BJRA 2I54A 4LXHA 5C32A 1FEZA 4CGVA 1JEDA 1EH5A 2MOKA 2PPLA 3DG9A 3V42A 1II9A 5KTSA 3OUZA 5AI6A 1CETA 1MRZA 3VGPA 1UMDB 3KSRA 4WFQA 5J4HA 5BW8C 3IDQA 4YWHA 4RTLA 4Y6QA 3ZLUA 4YDHB 2I4RA 3H3JA 3MJDA 3DQQA 2JGEA 3TLGA 4BO4A 2XMSA 4MP3A 2BL4A 2ZULA 2UYGA 4RS4A 1RRPA 3HYLA 3DMHA 1EZ1A 3ABLE 4GE0A 3TTWA 1B0UA 3ICEA 4JLJA 2OBLA 4BZXA 2VP6A 1UZUA 4IV8A 4TVSA 4CIYA 2O8EA 3QXCA 4A91A 4ZOBA 5LYJB 3FWNA 1B0PA 5F7ZA 4ZOQI 4N48A 1HE5A 4QX6A 2UVQA 5F2NA 5CDFA 3C98A 2FP3A 4U9HS 1HETA 4X62B 1ZC4A 2DBQA 1YRQA 3WLJA 4FLBA 3W5HA 1RZRD 3IP7A 2PSSA 1H2BA 1MA0A 2VAPA 3CF4A 3URKA 1YA6A 3KHUA 4B8ZA 5KU7A 1CJCA 1JLRA 3QVXA 4DM4A 4GXTA 1FTQA 3FSGD 4M1MA 1UEIA 1TEVA 1UOHA 1FCJA 1CBUA 1GW6A 1KZ9A 2WZBA 3M0EA 4JDUA 2I1LA 3AFIA 3OWHA 4B6FA 3ADDA 2ZJFA 4FZJA 4Z0PA 1ZJYA 2CL0X 1KJIA 3SC6A 1E8WA 3UMMA 2VNHA 5JD6A 5E9AA 2B4YA 2XDAA 1PL7A 4KBGA 4R8VA 4WUVA 4YRKA 5FP0A 3DFZA 1ATIA 4ABYA 4YP5A 2B25A 1MKYA 5JMND 1RAEA 3DH0A 5FO1A 4G1VA 5G40A 1QU3A 1DPFA 1E0JA 3DZCA 1G6HA 3K32A 4K6GA 5A5EA 3TQTA 1DJNA 5HQTA 3SC4A 1MB4A 3UFBA 2FXVA 1KI1A 4QIHA 2XW6A 1Z45A 4QATA 4JP1A 1RD4A 3MTJA 5DLDA 1YL6A 3IUPA 2W2QA 1LGYA 5EHGA 3QC1A 1JFSA 3D02A 3FCCA 3GBSA 2Q5LA 3KAEA 1Y7HA 2JI4A 4IOJA 5JCPA 1H93A 4H7FA 1P6QA 1Q5PA 3KALA 4FPXA 3OXLA 1GN9A 2XBMA 3IUQA 3KQLA 2HN9A 1Q0TA 2IOFA 4IWNA 2PLFA 1T1SA 4G2VA 4RMNA 2EWVA 4Z9FA 4KUEA 1U7DA 4ZCRA 1XSEA 3R5TA 1W88B 4UBMA 3HWSA 3R9XA 3BE4A 3EU5A 5CEFA 1Q15A 1R6VA 4HEA1 4KQ2A 1BMFA 1J8DA 2RGUA 3O4VA 1E7SA 3JYHA 4CM7A 5IM5A 4U8YD 4NCBA 5AUOB 2XCUA 2JLBA 4S2EA 2ZITA 3PEVA 3TMKA 5KTYA 3HV2A 3A37A 4JUIA 2CLMB 4A3SA 1O9BA 3W5IA 3HZHA 4O5AA 4KLCA 4EA7A 4DUGD 1TYCA 2WHPB 3NV9A 3RE1A 1LSSA 3TRDA 4JP3A 1PFQA 2ZB7A 5HOQA 4QAQA 5TR9A 4Z5XA 3AVYA 3NOXA 3RUDA 3SOZA 5A71A 1Q1EA 4G07A 3EGCA 3R6LA 5TGTA 4N54A 3LVRE 4BU1A 4C0AC 1YBAA 3C2QA 4BBZA 3GWGA 2OZLA 1NUUA 3CQ9A 4IMJB 4QFDA 4O2BF 3GQVA 5CNJA 5EA2A 2RONA 4E12A 4C0WA 5DCYA 3PD0A 4YRZA 5JXGA 4HB2A 3HDJA 1M0EA 1LRJA 1XCBA 3KPJA 4D99A 3U3RA 1N36B 2YJGA 3DF9A 3PHGA 1QQEA 4PNEA 1IJFA 2NYUA 2VPYA 2HNKA 3CV3A 4KAFA 3TYXA 4YUWA 1J2YA 4QYWA 3EPHA 4P22A 2VCYA 3FPFA 1JT9A 2J4DA 3D6NB 2G17A 5HF5A 1TUBB 2VJAA 5KQPA 3G0GA 2ZIXA 4ZC8A 2BTDA 4KO3S 3OZAA 1USVA 5C7LO 1C0KA 2FFRA 1NMEA 2HC9A 5LCWC 4FHKA 1NBME 2ASEA 1CTQA 2HB6A 5KX5F 5KMGB 3DEIA 3ONVA 1FB5A 7ABPA 3D4PA 3NOCD 1I4EB 5IKPA 1V8OA 4FULA 1UADA 1ZMOA 1HOTA 2ILTA 2NSDA 2BFOA 1CNFA 3BRQA 4C5BA 3I9KA 1NVVQ 2IO3C 3RRJA 5CX1B 4B75A 2YFQA 5F2EA 1YMUA 3F6EX 2IU3A 1EX1A 1JXMA 2PFGA 1HX8A 4EGCB 4P1ZA 3RFVA 1JLMA 4BX9A 1XV5A 2PS3A 2OFXA 4BGUA 2X9NA 2W71A 1Y80A 3C87A 3LT1A 1HG5A 2FWIA 4OK6A 1OXUA 1SEVA 5TC4A 3UPVA 3N28A 4WX2B 2BKXA 2H5JA 4ZODA 2DQSA 3GX1A 5KOJB 1QVRA 1CDOA 2IEZA 2OMEA 3ECAA 3K9NA 3O1IC 3ORFA 2Z9BA 5A6CA 4B3RB 3LS8A 2OXFA 5IAGA 4DB4A 1EBBA 1V8PA 4QXOA 3M49A 2FJPA 3PKJA 2PG3A 3B1WA 3ILHA 1XJQA 2I7CA 3PTLA 2QTZA 2JFBA 1QHYA 2D0PB 1OFGA 4ICIA 1PV4A 1CJMA 1GLVA 2R02A 3T5XA 2X9QA 3QW4B 1G3NB 1D1TA 4W8HA 4YONB 5AOVA 5SYAA 3W05A 4ZQEA 4U02A 4BKPA 4CCYB 1IQPA 1C3EA 4HNQA 3VAAA 4QVGA 1JGTA 5JRZA 3LBHA 5HF6A 5KINB 4EARA 1RP7A 4MRSA 2PL2A 2VYND 3M4ZA 5DHAA 4AJ1A 5EESA 2W83A 2WIBA 3TZEA 2FUG1 4PLWA 4R1NA 1XVIA 2FCAA 3GOQA 3JQBA 3PVCA 4IDPA 1P60A 2X6KA 2VPTA 4RXUA 5CURA 3GRVA 2BF7A 3EA5A 1CR1A 4EX7A 3RJ5A 3AVOA 4RCVA 4P81A 4ILGA 3SF0A 4OAUC 1K8KG 1GD1O 1SCAA 1JH8A 2I6HA 2D74A 3GUZA 4OA5A 3IXEA 3T4XA 1HTBA 4MIEA 3U19A 2G06A 4CNQA 2XRYA 1SVKA 1PYOA 5I8PA 2M1ZA 3M5CA 1C7JA 3DHVA 4OQZA 4DJJA 1NQWA 2AXPA 4TWAA 1IN7A 1GPBA 4G1TA 1SK8A 1TK2A 3LF2A 1QPBA 3FNFA 3OH8A 4FCVA 3VYSB 2UYHA 5T4YA 1ISMA 4OG2A 4TKUB 4YACA 5CCDA 4FSHA 1IU9A 4J0HA 1SOUA 1UUFA 2ZAOA 4RH1A 3PJDA 4JFRA 4QYSA 2PZ8A 3FU5A 1Z8HA 4F6RB 5I9IA 1CCWA 5B6IA 1WUHS 2HCBA 4WK6A 3WSTA 4R0MA 1EJ0A 3CLSC 4MIYA 1H9CA 2BKAA 2GBCA 3RG8A 2MYTA 3H8VA 2IZ1A 4C7XA 1LPPA 2MR6A 4BNDB 4L28A 4DV7B 3SBDA 3QEJA 4B87A 4NC9A 3LXUX 1Z29A 5CEAA 2I87A 3ETJA 5CYPA 4AUMA 1AV7A 2HA4A 1JHAA 4OHVA 2QL7A 1VPEA 2Z98A 3QH4A 2UXBB 3STVA 4K40A 4WN3A 2E5FA 4PG5A 1ACLA 2GPWA 3ZY2A 1V11B 4BBJA 1IBLB 4XIGS 2BBOA 3ZGZA 2VJQA 2BUCA 4N5HX 4OSPA 3OZRA 3ETGA 2QTLA 5BUCA 3PH0C 3AY3A 2KCKA 3DC2A 4RPJA 3I5AA 2QHXA 2HA7A 4Z9BA 4A1SA 5HR5A 2QD5A 3RVJA 3EIQC 1A2OA 3FULA 1M7HA 3F5MA 3HCWA 3K9GA 2NO9A 1Z0UA 3KO8A 4FYVA 1WJGA 4LNUA 3ZGQA 1ELKA 2XMBA 3I2KA 3OPYA 3QELA 4O33A 4KVZA 4B5KA 3DBOB 4YMIA 1WWKA 2XEXA 1E6KA 1G8SA 3FVRA 1Z22A 3B7SA 1XKQA 3PU6A 3DOEA 3L3BA 4HYTA 1CUDA 4YRMA 2RFLA 4R2KA 2P9CA 2BTQA 3KTFA 1IATA 3UJ8A 3RFFA 4PNPA 2VHUA 5JVDF 3EAFA 1HDZA 1T4DA 5KYKA 5H8WA 2IWHA 3AMVA 1KOGA 1ZM2A 2O05A 1G8KA 1TR4A 1F7VA 1YC2A 4FGLA 2WICA 3B6EA 4GDMA 3ICWA 1YAHA 5IVKA 2OR3A 4AF7A 4U6QA 3Q3CA 2PSJA 4Z4QA 2J33A 4B4KA 1VL6A 3DSTA 1Q7GA 1NL4A 1CG6A 1FJGB 3T7KA 3JYNA 1HRKA 2AJAA 4JGIA 3ESAA 3SBOA 2H1HA 5JE8A 1VPWA 4HGOA 4IJWA 1EFPB 3K3PA 4E08A 1FUYB 1U1FA 3LQYA 5SY9A 3PBKA 1W4RA 2GJAA 1PDWA 3OU2A 1F0KA 3A4LA 3EPLA 2CFZA 2XIQA 2IXFA 2IS2A 4TRMA 1NQVA 2BFCA 3VKWA 4G0VA 4AAYA 3UT5B 3KEOA 1C2TA 2G9VA 2XBUA 3C7AA 4KQWA 1AWCB 4U0ZA 4S12A 3VTKA 4DC1A 1K0FA 4NBWA 1JPNA 5KBAA 4I8XA 1TF2A 5CB4F 1EYHA 4UMDA 1E9DA 1K8QA 3CT6A 3Q7EA 3GJSA 4DOMA 1ZZGA 3BPSA 3GJZA 4N0MA 2WQ7A 1OV4A 2NV6A 3I30X 3FPEA 4IZHA 2Y0BG 1GGVA 4FEYA 4M2LA 1ZLYA 2AVNA 2PQ2A 3OHSX 1ZGAA 2C5HA 1IVYA 1NXVA 3NALA 3D64A 4G0XA 4R1SA 2H92A 5ALHA 1M2VB 1IDN1 2XT6A 4ZWNA 3E7PA 1TJCA 5JQGB 2WXFA 1KR5A 2BR5A 2CJXA 2IYOA 2XB9A 3PA6A 2XGGA 4HN9A 3OJLA 2V9CA 4M8LA 5AVJA 1T10A 5I7EA 4KWHA 5EINA 2VT3A 3I9JA 1BOFA 4QSMA 5JAPA 4RVFA 4NIKA 1R3UA 2DRIA 1F4PA 2GJKA 3FBTA 3H65A 3K9WA 4NZOA 5I3CA 2VA8A 4M9CA 4M83A 4ND7A 5AKEA 3VDRA 3A1CA 1VGVA 3EFOA 2ZG6A 2HLDA 3SJCA 3DS8A 3OF2A 1MB2A 3HR4A 3U44A 1V71A 5JNWA 3AG4E 3ISVA 1G98A 3TG8A 3V3KA 3BMNB 1FW8A 4KCGA 1UJCA 1DCMA 2DH5A 3MK31 5G3ZA 4PZCA 1J2RA 1NMQA 1JPLA 1UBTS 3H9GA 4LG6A 1J00A 1J24A 1M3SA 3DWIA 2ZB4A 3H16A 4YMUA 2JEZA 1P8JA 1E0DA 1NBEA 2BHTA 4Q7EA 2JFVA 3GLFE 2UY1B 2DULA 3TOSA 4DQ0A 3KDSE 4RGQA 2RJ3A 4UAUA 3C3EA 5HZMA 3Q2IA 5G4KA 4IIUA 4Y1EA 4AZ0A 4AY6A 2A3RA 4K26A 3JALA 5IU6A 4C4PA 4H7EA 2GBLC 1PJAA 2FDRA 1R9GA 4D96A 3CJQA 1HG2A 3F3KA 3SU8A 4BZZA 3UT8A 2CFSA 4ZZ3A 2WR8A 2I3DA 4DA6A 5A05A 3KD2A 1K7XB 5AIJA 3OSUA 2WFAA 5CXQA 3KSQA 3FW1A 2IFTA 5IF3A 5ERGB 4MB2A 2GETA 1CY7A 1JDZA 2E4YA 3I61A 2GBFA 3HRAA 4HMPA 2I0FA 5E6SA 3EOZA 1V9CA 2WD8A 4HFGA 7GPBA 2EKPA 3MA0A 3WHKA 4ER6A 4GKKB 4ZO7A 2R1TA 2QD3A 1EQAA 2HDHA 3KJHA 3L07A 1QIHA 3FDJA 1N4RA 4DIMA 5IJWA 2W2VA 1WNTA 2J3KA 3E9CA 1QLWA 1ZITA 1FFWA 4FGUA 1HY3A 2XHEA 3UAYA 4WWOA 1GKIA 1KMCA 2QAIA 2C4TA 2V9ZA 1YA4A 2VLBA 2X8WA 3AUSA 4TUYF 4WKGA 5B36A 4OGWA 5BNWA 3BSWA 4H4CA 3KPWA 3MCZA 3ETEA 2FEOA 3OJCA 2JVIA 3KBOA 2B6CA 2P9IG 2VKTA 3A7EA 3FUUA 3WLPA 3S55A 5AVQA 1WZNA 1W2HA 2P62A 2YRFA 1HYEA 5JSHA 2KBEA 2QMHA 2GXQA 3ZV5A 3S2EA 3ASZA 3ZQKA 4TKMA 1GNPA 5ALOA 3WL8A 2QM8A 1QP7A 2WTNA 3N2LA 2PH1A 5AK6A 5ISMA 4M8KA 4DKJA 3LC0A 4LF8B 1B8OA 3CH4B 2PGXA 3DT9A 1DFIA 4OHOA 5E1BA 4NR0A 3OQHA 4ARBA 5I6DA 3SR3A 2ZQZA 2B98A 3TW0A 2GNAA 2AI1A 2BIFA 3E61A 4J03A 2QXUA 1Y9EA 2CMFA 1MOPA 5HWSA 3IE0A 1DIAA 2RB4A 1L5YA 3T06B 5T4EA 1RMYA 5ITZB 4M3NA 4DC9A 3COZA 1EFHA 1R0XA 3IO3A 3T95A 3E2PA 4N9QA 1UBMS 4HAIA 5C2YA 3L22A 1E7WA 3R9KA 2Z5VA 1QF6A 2JFXA 1CVLA 3JQGA 3L5KA 3W5JA 3JR3A 4A6DA 2QV0A 4IOKA 1HF3A 3KWJA 4D8TA 1S2DA 1XZBA 1Z2NX 3OQJA 2RGDA 3HZRA 1I4WA 1RZRA 1KI9A 5FWYB 2PWPA 4DX6D 1JTVA 3UX4A 1WZUA 2ZU6B 3I2HA 3IGFA 4O60A 2O7VA 2MSLA 1BCRB 2VXYA 3IV9A 2HYDA 1JWAB 4WZBE 5F76A 3ZWPA 3V80A 1C9MA 2V4HC 1U7ZA 4TWBA 4LKOA 3WLEA 1EVIA 3R9AB 1LW6E 2Z1MA 3DSSA 3IUBA 4BT9A 4CKZA 3T5PA 5C34B 2PIDA 1E79A 3I42A 4ZEXA 3OQNA 2Q6IA 1TQ2A 2A5DA 2IIBA 2OKCA 2VOJA 2Q9UA 3EZYA 2PMWB 3MT9A 4FK8A 3GU3A 2YINA 4G5HA 5JHBA 4MHSA 5CGQB 1L5GB 4DCCA 1HA3A 1YKSA 3REQA 3APFA 3GLHA 4LI3X 5KOHB 1OXSC 3MJSA 4N5DA 1QG4A 1I10A 2EQ5A 2QUIA 3W5VA 2HREA 1Y7TA 3ZWWA 3A1FA 5G0UA 2DUJA 4I7EA 2BDEA 3O1HB 4CMIA 5TGDA 2X0RA 3ZKAA 3BMQA 4ILEA 2AK2A 4RV5A 2RAPA 5ESRA 5I01A 4RZXA 1KR2A 1L5ZA 3QKWA 2VSXA 5C5CA 8MHTA 3HFGA 2UDPA 3KPYA 4HPJB 4QLOA 3ZYZA 4Z99A 1CUAA 3D43A 1FP4B 1S01A 1XYYA 2W2TA 5AKJA 3RS0A 1KU6A 4DIOA 1IN1A 4EFLA 1FYVA 5LQSA 1O96B 4L3VA 2QD2A 4X20A 5AKGA 3KU1A 1E9RA 4MTLA 2IONA 1MO5A 1WG8A 1SCBA 2GN2A 2I55A 2L2QA 2WQZA 3OE4A 1RJDA 3KT8A 1R10A 4IRXA 4Y6SA 3T8KA 5HE8A 1TLFA 5EP1A 3NQPA 3A58B 1TTHA 2IEYA 3FR7A 3E1SA 1DO8A 4I1SA 4MB6A 5J1TB 4NPAA 3MINB 2DUNA 5KJ6A 2ZZMA 1EGHA 2YWBA 4XLLA 4IHJF 2BFNA 4H4DA 2Y67A 4OHMA 3FTEA 4Z4CA 3CLKA 3JZIA 2WYVA 1NF9A 4WY2A 1T91A 3BB3A 3TW8B 5DULA 1F0YA 5EWLB 4OSEA 3T12A 2JANA 5GVSA 3E3MA 1REQB 3E9EA 3ZJUA 2AQKA 1GNVA 3CGGA 3L8MA 4ASUD 1YRHA 2CL5A 4MKHA 4WVLA 1N2CE 1RADA 2E4XA 5G2NA 2GEFA 2MHCA 3E9QA 3C7TA 3MAGA 1VA5A 4NYIQ 4PSCA 5ALRA 4F8YA 1H5UA 1PG2A 2BISA 1L5RA 3KHTA 4UI9J 1QRRA 1ZWKA 3PFHA 1AUOA 4IJVA 3OFNA 5ENVA 3TZ6A 5LN1A 4MRRA 4PFKA 2LKDA 2XTNA 3AK4A 2COKA 3GVIA 4FWBA 2O0KA 3KJNA 3GCGA 4ZPJA 5EIOA 3VSEA 4PIVA 2IUFA 4GPIB 2ZVDA 3FCSB 3H7AA 3IYLW 1F8YA 4URWR 2Q4TA 1NV8A 1F2DA 4DRXE 4B2IA 4ZA2A 1RPJA 3SHVA 4E5YA 2C0PA 2IT1A 2XNKA 1E1CB 3CF4G 2C29D 1JLKA 3QVGB 4HDRA 3U9SA 3ELUA 3GFVA 2OGUA 3QLEA 4BN4A 4I8DA 2JGAA 2Y92A 4KW7A 1NLMA 1GRQA 3ZY3A 2Z2YA 3U31A 3I5YA 2QPLA 3LUKA 2GCGA 2X2EA 2BEUB 2V8OA 3JVUA 4MVJH 3RNLA 1E2GA 4NQRA 3SJBA 4BAUA 2GM4A 5EIHA 4J2TA 1GOTA 2HM8A 3O4GA 1BQ3A 1TUGA 3W9SA 3B6KA 5JBIA 4NATA 3CLUD 4OL9A 3IAS1 1XCPA 1BKSB 2Y66A 2IU0A 3SHFA 3EAGA 1NQUA 3ETLA 3PEWA 3ND6A 3JXJA 4QGAA 1PG0A 2A5JA 2VPIA 2R25B 3IBSA 1TW3A 2R66A 5SZKB 4C1BA 4UWGA 5HUHA 5L53A 3BT7A 4H18A 3IIJA 1N4AA 5LPNA 1GL7A 1OU0A 1T13A 1NVEA 2OCDA 4P4SA 4JJEA 3U7QB 3OZ7A 1E66A 3CZQA 4CTJA 4DF3A 1BD4A 4ZVRA 3AM5A 5GIPE 2ODBA 4O4HB 3IIIA 3UAOA 3KWLA 2GZSA 3M9LA 2J3IA 3GXOA 3O0DA 5FTKA 5IARA 2NTEA 3MKQA 1KIMA 1QS0B 2ZYDA 3HYRA 2VP3A 3M5PA 3FUFA 3MT7A 3AG3E 4ZQHA 5K0CA 4A5OA 2W00A 3PEEA 2II6A 1KPIA 4HWPA 4WESA 2C88A 5DI9A 1HLDA 1WLSA 4MUEA 5FADA 3USZA 3G9QA 3W2FA 4QFMA 5A2QA 4OO3A 5JANA 1UFQA 2OORC 4HQKA 1OLXA 2PK3A 5CG2A 1DUVG 1SZJG 3H8WA 4ON9A 3ZK7A 1E2QA 2ZJ4A 3KSDO 1UJ2A 4EUFA 1ONOA 5DM4A 2ZFUA 5KVQA 1BXGA 1RZ4A 1P39A 3KB2A 4O08A 2PWAA 4C2AA 3FHTA 5BSEA 1Q6YA 4RABA 1GVNB 3G49A 5J63A 1D4FA 4JBHA 3UATA 3ZUVB 1Y1TA 1NQTA 2CVZA 1EEHA 2V7EA 2HMSA 2JFOA 2NO7A 2YBDA 4IMIB 4LHEA 5D6NA 5B58T 3V8BA 2VGXB 3B3GA 4YAUA 5H9WA 1K06A 1Y7IA 1E2MA 2RG7A 5T64A 4BVGA 4Q01A 3RADC 3RSEG 1NE2A 1KFEB 2C4VA 2GBPA 2VWHA 1QHHA 5DNDA 5FNVB 5GAJA 4BO8A 2ODQA 3QFFA 4XQ0A 3T1VA 5C80A 1EFRA 1W36D 1LPMA 1P3DA 2ID8A 2P77A 4JWKA 1EUQA 4ND8B 2WBLC 2AH5A 1II0A 4PG8A 2DHCA 2VHQA 3Q9SA 3FVWA 1C3JA 3L7LA 4PQEA 5A04A 4D8VA 1GYRA 4OP3A 1QDUA 4V0LA 4ZO8A 3TGOA 3N74A 3QWAA 5GZ6A 4GOKA 3KZKA 1DBQA 4WWHA 4AZTA 4B79A 3TIVA 5BXQC 2CC2A 2WW8A 2XQ0A 4KBQA 2NU7A 1PT9A 2JBWA 1SA0B 3SD7A 1AN0A 2DWOA 4P3YA 3AJ8A 4GPZA 1A7UA 1CR4A 3D6VA 1TIBA 4HRLA 2Q1UA 3EGEA 3Q41A 4F6RA 4G0UA 3OP1A 2PGLA 4NPHA 3PRZA 3WP1B 1VI5A 3LPNA 1UG3A 2G0AA 1N6IA 1E3LA 4QBGB 1QG6A 4AP9A 3I09A 4AZ0B 3EX7C 1XNHA 4RZSA 1PYDA 4LHSA 1Z62A 2ZS8A 3AY0A 4WL0A 2FR8C 2CKDA 1KC1A 3N2NA 4JVMA 3WLSA 4X1OA 1W6UA 4JCCA 5GQSA 2BV3A 2YC2C 1HEUA 1BRMA 1H2UA 3TG4A 5AQEA 5CB4A 1MU0A 2AHOA 1JLSA 4KQHA 2YFKA 3D9KA 1TKRA 4IH1A 5DMHA 2J0VA 4A8JB 3V4SA 1A4IA 3FCAA 3M3HA 3RC3A 2V74B 3IT3A 3KQOA 2FYTA 1SC6A 3P9SA 4D0LB 5D7NA 1K6IA 5A4MS 5I51A 1E2PA 4YIHA 4AG6A 2QTNA 5KTTA 3OZWA 5GIOE 1AN9A 1AF7A 2YV3A 4FW8A 1GQRA 4K9SA 2R7MA 4WKNA 2XE7A 1M0SA 4ZC1A 3OMWA 3G0OA 4JLVA 1OD6A 3AR8A 2A7QA 4BIIA 1M8FA 3HBJA 3OM1A 1CR6A 4B3TB 1M5TA 1KL7A 3BD9A 1KMIY 1R9JA 1USKA 3H13A 3R7DA 3GRFA 4Z7OB 1Q77A 4R8RA 1Z8DA 5CTJA 4BNKA 1WXWA 5ITVA 1V1RB 3WGTA 3UT7A 1E8DA 3Q7RA 3UGJA 4A4DA 2XYRA 4RY9A 3L1JA 4AKTA 1JHZA 3PXBA 4JXKA 4MR8A 3H7IA 2O14A 3BIFA 4GOMD 4NECA 4OBEA 1U7WA 2Z4RA 4YS6A 4EW3A 1SBCA 1HK7A 2FDXA 4EZEA 4L16A 5B2EA 3DV9A 2XX3A 2FHPA 1QC5A 3CTPA 4K9PA 4EUEA 3CLJA 3BEDA 5LCWJ 1ZNXA 1MNAA 2CNWD 3LJ3A 1NPYA 3MCVA 2L69A 1UP4A 3KG2A 2JGJA 3PA8A 2HUNA 4NDAA 4EJSC 1QOZA 3BX1A 1HE2A 1P8AA 2B4TO 2JI7A 3WFJA 4PZEA 3ACDA 3WLTA 2I4NA 2Q99A 3U7EB 3B6MA 3BXOA 4WCDA 2FFQA 4JKIA 2HE0A 3TUJC 5HKKD 1DAFA 5DLQC 1J06A 1DG9A 1W34A 4QKQA 2ZRCA 1M8JA 4CHTA 4DWOA 1VPTA 3TEJA 4QRIA 1SR8A 4EHHA 2PS1A 4LI0A 4YXFA 1GM5A 2WF6A 3OEHD 4I46A 1DX4A 3LRTA 5CT6A 5B55A 5F98A 2EU8A 3VKGA 1TJYA 2V7QD 2EJBA 4KOAA 1QRAA 2QL6A 1ONBA 5E3HA 3OTOB 4IX1A 5JYCA 5F4ZA 4HEJA 3AKEA 4ZGGA 3RIMA 4CQMD 5KTKA 1A88A 2GTPA 1KY2A 3OEWA 3SKVA 2V4ZA 3RVLA 4MYUA 4L27A 4O3MA 3LSTA 3TCXB 2PGOA 1IULA 3AG2E 2OGSA 4NKRA 1XRNA 1RRVA 2A1UB 1WCYA 3MFQA 3QLVA 3IRUA 3L54A 5G4LA 1ORDA 5SZIA 3S40A 2QRKA 2R62A 2WHXA 3AGQA 3OIWA 1OWNA 3PF9A 2GGFA 1NDQA 1VBKA 1XYGA 4LEUA 3RF6A 2AX4A 4YGYA 5TMDA 4IG4A 2BY4A 5E76A 1DCFA 1Y48E 1PE0A 2B0OE 3HJHA 4KLZA 2OY0A 3F96A 3KLPX 4DABA 1AQYA 4CT4B 1UPAA 4B4UA 2JJ8A 4JI5B 1CIJA 3ZVRA 3ND9A 1PWZA 1AHHA 2D8MA 2H48A 4KXVA 4NFHA 3T3DA 3WL3A 4EYSA 4DDUA 2J3QA 4HNVA 4BEPA 4XIYA 3AVPA 5P8WA 1NW7A 3DUFA 1L3CA 4ZDWA 5CDSA 1MQSA 2BI8A 2EHJA 2FX2A 4MHOA 3UBMA 2EBHX 4UREA 4JJ6A 1F4LA 5LVAA 1T1IA 1OCEA 1QG0A 1MAHA 2I6FA 2O2HA 1Y82A 3PEVB 3E3OA 5HDQA 3RWMB 1MX2A 3ZIDA 5IPFA 2X38A 3OKPA 4YB8A 4AICA 4JR0A 1W0JD 4TWIA 1ECGA 1FYXA 3ETCA 2WAMA 3FGZA 4AP6A 4GA2A 3RASA 1E9EA 1Z8NA 2JJMA 4ANVA 1U6KA 1YB5A 1YE3A 4IRMA 5JPIA 3TNJA 3TVDA 1FFBA 2C84A 2VGEA 1Z6TA 3A05A 1JKIA 5EJ4A 3BTOA 4OKNA 1HZZA 3D9OA 4DVJA 1N5MA 4EPZA 1EVEA 2RGWA 3VH2A 4BWYA 2QUAA 3CG4A 3ISTA 5D3QA 1SHJA 5E6UA 1E2IA 1YOBA 4I1RA 5DLYA 1TVEA 1ORRA 4MRNA 9MHTA 3ZGOA 3L93A 4L5AA 4L8LA 2A9OA 3UHFA 3TK1A 1YDMA 2PQNA 2Y1OA 1NWCA 2P7HA 1ZH8A 4P98A 2P7IA 5LQDA 4MUHA 1L7PA 2XF8A 1O7JA 4BOYA 2AMVA 2P6RA 4DLPA 2PBLA 1J4AA 1TZ2A 1XZ8A 3QNKA 2HQSA 4BYGA 1DO2A 4FOPA 2HOQA 1EX9A 3EDYA 4NQZA 4LGYA 5B30A 4JT9A 1VYHA 3DAYA 3K0FA 1XXLA 2AXZA 2ZIVB 1UT5A 3UN1A 5J40A 9LDTA 3M3PA 4G8BA 5IMBA 1N6HA 2DF8A 4TTIA 3HL0A 3BUAA 2VPZA 5E3JA 2JFZA 3K4QA 4J91A 4DS3A 4L4ZA 3N8KA 3J5QB 3F90A 4B74A 2Y05A 2GR9A 2DXIA 3QKSB 2YZ7A 4AF6A 4FU0A 4RTMA 4R1MA 1AK2A 3IVRA 1Z2AA 4BYMA 4Q3CA 3IE1A 1MXFA 1TVKB 2YH2A 4M9XA 2YMMA 3QGMA 1RACA 4G09A 4DAEA 2GX6A 3FG9A 4RLHA 4PRYA 3WTCA 1OWMA 3KEAA 3MLAA 5GY7A 4GAEA 4JJ8A 4BLQA 1IXRC 3CHMA 4ENUA 4DR2B 5JSYA 3GC6A 4ROTA 3QQPA 4CF7A 5A9SB 1YJXA 3T9KA 5BSVA 1N2OA 4NNOA 2H7VA 1Q6ZA 2X5OA 4GX5A 2OXRA 4UNPA 1ZEJA 2A1TR 3JXIA 2UAGA 4XEHA 1Q22A 4UOEA 1BFDA 1NVWQ 2D1QA 2GLUA 2VPPA 4MVJD 4IHJA 4GD3Q 3W6NA 3WMEA 1TUIA 2ODAA 1LBSA 3HO1A 1P73A 4ZVKA 3ZQ6A 2QRNA 3EIOA 2NYAA 4OB7A 1IPEA 5L6LB 4BV2A 1DRVA 2EJTA 5L6MB 4C4YA 2OAGA 4MVJI 4RJKA 1HDIA 2VQDA 1PZMA 2XGSA 2HBQA 4K9KA 1JIXA 1E9VA 5KHOC 2WIJA 3PDUA 5JJTA 3LCAA 2DR2A 1FTGA 2CDBA 1OBOA 2YRXA 3Q9NA 4BNNA 1YNSA 2NVUA 3A2MA 2PD3A 5AJWA 1MB3A 4C4XA 5BN1A 2BSQA 4OF4A 2A8YA 2VZ0A 1WQ4A 1DIGA 5E8RA 1KAGA 1KZ7B 2NXCA 1IY1A 4UI9C 2WE7A 2XMGA 4G0OA 5ALZA 2ZSEA 5AW5A 1ICEA 2H2DA 4HG2A 2YWJA 1VLMA 5TQVA 4F3RA 4D3SA 1H1DA 3REOA 3ZJVA 1I1HA 4XA8A 2NSZA 4UNIA 1KNXA 3UAZA 2EDCA 2MYOA 3IDOA 2QXYA 2WE8A 4MWOA 3SS7X 2BBSA 2X4IA 2F4VB 4LJ7A 4JNCA 3U64A 2WAYA 3N2KB 4RLFA 4R16A 3TOVA 3TTYA 1SKYE 2B9EA 3ZWDA 4D41A 4HNHA 3PJFA 3FPLA 4H6PA 1Y8RB 4MBGA 2Y9MB 3AKDA 3LY7A 4FUTA 1BGXT 1LCIA 3EIFA 1OHHD 3NQ41 4B35A 4BO2A 4NMLA 4LPKA 4EEKA 4JPSA 4OHFA 2I7TA 5CUQA 3TUIC 3JQ7B 2WD7B 2RD2A 2XJ9A 3BD8A 3W2IA 3IOBA 5TJHA 3QYFA 4MINA 3UXYA 4M0PA 3C3XA 3UJDA 1QCYA 2R1VB 5ARGA 1YK1A 4QYTA 5IT0A 3IEMA 1HV8A 2A59A 2ABWA 2H6IA 1KE2A 1QS0A 1HH8A 1CVIA 1DQPA 4DLKA 3K0SA 2WVHA 3VX4A 3QVSA 1SB9A 4HB5A 2WAAA 3WLMA 1MX6A 2JRLA 5CHEA 2ZE8A 4U7EB 2BZGA 4WINA 1FRQA 1KK2A 3H5IA 3N1UA 4LTMA 4W1QA