4BX8A

Human vps33a
Total Genus 214
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
214
sequence length
596
structure length
568
Chain Sequence
AAHLSYGRVNLNVLREAVRRELREFLDKCAGSKAIVWDEYLTGPFGLIAQYSLLKEHEVEKMFTLKGNRLPAADVKNIIFFVRPRLELMDIIAENVLSEDRRGPTRDFHILFVPRRSLLCEQRLKDLGVLGSFIHREEYSLDLIPFDGDLLSMESEGAFKECYLEGDQTSLYHAAKGLMTLQALYGTIPQIFGKGECARQVANMMIRMKREFTGSQNSIFPVFDNLLLLDRNVDLLTPLATQLTYEGLIDEIYGIQNSYVKLPPEKFALPTEAKKLQLNSAEELYAEIRDKNFNAVGSVLSKKAKIISAAFEERHNKQFVSQLPHMQAARGSLANHTSIAELIKDVTTSEDFFDKLTVEQEFMSGIDTDKVNNYIEDCIAQKHSLIKVLRLVCLQSVCNSGLKQKVLDYYKREILQTYGYEHILTLHNLEKAGLLKPQTGGRNNYPTIRKTLRLWMDDVNEQNPTDISYVYSGYAPLSVRLAQLLSRPGWRSIEEVLRILPGPHFEERQPLPNRVTLIFFLGGVTFAEIAALRFLSQLEDGGTEYVIATTKLMNGTSWIEALMEKPFH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords VACUOLAR PROTEIN SORTING-ASSOCIATED PROTEIN 33A
publication title Structural Basis of Vps33A Recruitment to the Human Hops Complex by Vps16.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
total genus 214
structure length 568
sequence length 596
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00995 Sec1 Sec1 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.850 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4bx8A04
3.40.50.1910 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4bx8A02
3.40.50.2060 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4bx8A01
3.90.830.10 Alpha Beta Alpha-Beta Complex Syntaxin Binding Protein 1; Chain A, domain 2 Syntaxin Binding Protein 1; Chain A, domain 2 4bx8A03
1EPUA 3PUJA 1Y9JA 4BX8A 2XHEA 4JEHA 1FVHA 4JEUA 5BV1A 4CCAA 1FVFA 3PUKA 4JC8A 3C98A 4KMOA 5BV0A 5BUZA 1MQSA 4BX9A
chains in the Genus database with same CATH superfamily
4RVCA 3I05A 3LCCA 2HQ1A 2BP7A 1X7WA 3KCQA 2Z1MA 4KBQA 1CZLA 1L5HB 1KI8A 2HCFA 3IT3A 4P4NA 1HDRA 2E1RA 2ADOA 1ZFNA 2A86A 4GLLA 2P8JA 3L04A 3ADDA 3ZNOA 3JV7A 4L08A 2V6FA 3AS5A 1E4OA 2WXOA 2LDBA 4F3KA 4I2ZA 4GMRA 2J67A 3OMWA 2ZBUA 2CFZA 4LCEA 3V1YA 5CLFA 2QRNA 3ZHRA 2NPIA 4ZXFA 5T3RA 5I4CA 1S2LA 5AQEA 3MAGA 3NHSA 1SVIA 3G1TA 2ZXEA 2P9EA 3B2QA 1U8TA 1HKHA 5SYNA 4AY6A 2ENWA 3GR6A 1JVSA 1EFVB 3AFOA 5CHYA 3AM5A 1U0JA 3E03A 3W9SA 1TJ5A 2LTAA 4RMGA 5EE5B 3QTTA 4J8PA 4I99A 1CDDA 2VQ2A 3KTFA 2G17A 3IQIX 3BN3A 3W4JA 2BGNA 2YY5A 3I6BA 5KYXA 4HB0A 5BXQC 2R1VA 5BR1A 3WGMA 4HH4A 2MSWA 2ZIFA 4UUOA 1MHQA 1K06A 1TEZA 4C9BB 1P1JA 1HT2E 2RGXA 3CF2A 4KR6A 4MIOA 5K0FA 1AKMA 3WR5A 1PZXA 4IS2A 3TD9A 1ZM4A 1IHBA 1U5CA 4AYWA 3VPGA 2DGDA 1GLVA 4WOCA 3DCJA 3QKWA 1K5PA 2CDBA 3CHOA 3FSGD 1J25A 2R2GA 2WHEA 1G21A 4OIFA 3IUYA 5ISMA 4PWZA 3RSSA 2FP3A 5H7PA 4OK6A 2H6HA 3O95A 4E09A 1QU3A 4CR7A 2ZBQA 1S5PA 1D9ZA 4KXUA 4TZ0A 3P71T 1Z34A 2FSUA 1OR8A 4DV4B 1NM5C 3IODA 4RMJA 3D5EA 3P2KA 1M2VA 3E5MA 3RC7A 3WB0A 3PNSA 1O1YA 4OSEA 4B3CA 1FJHA 3VO2A 5DT2A 4QTYA 1EX6A 1PT8A 1R6AA 1ONOA 3HSSA 3DMNA 4Z2AA 4QPNA 4IJKA 2FFHA 1ZU2A 3A0RB 1Z6ZA 2R62A 5CMLA 3K1AB 1HKUA 2JLVA 3TG8A 3DBHB 5HXAA 3ZX4A 3V7UA 2ZSUA 3NT5A 4AJPA 3ONDA 1E5QA 4FZ5A 1JKXA 1NUTA 4Y98A 3ZNQA 4KMOA 1V47A 4E7OA 2C2KA 3A1FA 4YMIA 4ZMRA 3HSYA 2VPZA 3VTAA 2IFTA 3OJFA 3TLYA 3UAGA 1VKZA 2P0YA 2UUOA 2A1TS 4DYHA 1F60A 1I24A 1CY1A 1A2OA 3TLGB 4FC7A 1U63A 4KH1A 4GM1A 3R0ZA 5BVHA 3VC3A 3ZBTA 1L5GB 5MHTA 4MKXA 1SVMA 4CMCA 2QRHA 4ALJA 3CBGA 1U3CA 3DNPA 3GN2A 4BWGA 2FPKA 2VN8A 4HG2A 2WJVA 4UVIA 5T3YA 2DY1A 1U0SY 4B33A 2HPAA 3CVLA 3D0RA 4L27A 3HN7A 3GAZA 5HRAA 4U7DA 4IDPA 4JBGA 2COEA 4K28A 4EAQA 1E1NA 4HVTA 2AN3A 1QONA 2X0JA 1YV9A 2D5LA 2OFFA 1Q3HA 2FW0A 2HGSA 1EDEA 5IVDA 2NXCA 3AUTA 1BE0A 1KERA 1L7MA 1P0CA 4L6AA 1H22A 4BMSA 5ANRA 2PJRA 3AESA 2IYEA 2EIHA 1KMHB 3FPKA 2QRMA 1T2AA 5L51A 1UDWA 2OQ2A 1SR8A 3BDVA 4WXEA 1XHEA 3EYAA 1N92A 4PYOA 3MTGA 4LBWA 4ND3A 1DADA 4KNVA 1ODLA 1SVLA 4DLOA 3ZW7A 1NR5A 1MYOA 3EW9A 5F1YA 2BMWA 4JX8A 4ZCSA 1JPLA 1OYVA 2AXNA 3DYVA 4I1OA 4JJKA 5FX2A 3IUMA 4F6CA 4KC0A 1J39A 1QE3A 5EMJA 4QBGB 3P8ZA 2OC4A 3DL4A 1K8RA 1X7YB 1SA0A 1ECJA 3FY4A 4D92A 1RQXA 1BDIA 2WXMA 3X1MA 4P35A 5I6DA 1OKKD 2AFHA 5FBZA 4LSZE 3HPRA 2QU7A 2QZSA 3LT4A 3N7TA 4OBXA 3O2QB 3U56A 4FFSA 4G3XA 1H8EA 1JEQB 4BAUA 3W9YA 2VPIA 3T0FA 1I5EA 4WRRA 5TQ0A 3R7WB 4C4ZA 1XFAA 1BNCA 3T0IA 4G9GA 5A9SA 1VPDA 4RVUA 2J45A 3HM2A 2CNNA 2QD4A 3WE7A 1Z0FA 4XB2A 4YXFA 3FLEA 3JXIA 4F38A 5DH9A 1RPTA 1YZLA 4R2JA 5CX1A 4IDGA 1QHHA 1XZDA 2WKQA 1DB3A 1F0KA 1KP9A 2NQ2C 4DKJA 3OQPA 1FSSA 1EG7A 1HE5A 4RK4A 5IANA 1WUTA 5BR8B 5DHPA 2NUTB 1QRDA 3QWIA 2E1PA 1FTSA 3OKAA 3GGJA 1Q6ZA 5C1IA 2R6JA 4R5HA 1KAHA 2BE7A 2P1RA 4C3UA 2JASA 3URMA 2XUPA 5C8YA 5LMNB 1CV2A 4YRAA 1NT2A 4UQXA 1OPXA 4Q7EA 3PQCA 3BXZA 4A82A 3BK1A 1FYXA 2HLHA 1HG0A 1WG8A 3OOWA 4JLAA 4BNTA 2RKKA 2Y92A 3EZFA 5G3ZA 2VUHB 3IDFA 1N2ZA 3EGWA 1RHUA 1T9ZA 4IVRA 1PR0A 3C3DA 1W9MA 1NTOA 3UKUG 5BW8C 2AT1A 2DU8A 3HB9A 4XFKA 1Z33A 1NP6A 1IFXA 5KAPA 4Y9DA 4QVIA 3LCUA 1F14A 3RWMB 4ARBA 5FRDA 3OBBA 2YOFA 2HF2A 2RH4A 4C0BA 1ML4A 1NW8A 3ESCA 2Q4EA 4NWIA 1K6MA 2XI4A 5EJ6A 1ZWKA 1RHQA 5DTQA 1ECFA 5J2TF 4S1OA 3DBVO 2I55A 4CIDA 3SF8A 4FYWA 3JZIA 4OK5A 4DLPA 2O2XA 4K5QA 4R69A 1CE8B 5ALKA 4YT8A 2X9VA 1V0JA 4GAAA 2A1TR 1LLDA 3KQVA 4DRXE 1LRJA 3QUQA 2NAPA 3JQQA 2Q2WA 2GM4A 3TG4A 1EIWA 2WWTA 1SZJG 2XUFA 3W8RA 2XZTG 3KXDA 5LC1A 4GA1A 3A9RA 5AKIA 1Z3IX 2V7EA 1C30A 1O4WA 4DDTA 3FTXA 1B2RA 3ZTTA 3MWDB 1LTXA 2CHXA 4BP3A 4MYRA 3GJ5A 2SICE 4YECA 1F0YA 3DOOA 3WLJA 1T0PA 3AR3A 1QIHA 1J1IA 1CDOA 4WNGA 3A2KA 4N7RA 4UAVA 1XEFA 3VX4A 3DVLA 4M7WA 3W6OA 1ZI8A 3RADC 1Y8QB 3RSOA 2OY0A 4WFJA 3R7AA 2BTOA 4UKDA 3B48A 1LDNA 4U7GA 3RUIA 1X7DA 3TOCA 4LX0A 3LKBA 5FH9A 1CULC 5ALGA 4TXHA 4GQBA 1QHYA 1E3IA 2GPJA 4FOTA 3DAFA 3DONA 3LT5A 1CUIA 2YRWA 4BT9A 5FTLA 1OZAA 3LDHA 4FUTA 4HEHA 1UMBB 4P0PB 2GFQA 2IVFA 2IUYA 7AT1A 2XTAA 1VYVA 1TYAE 3G9UA 4HB5A 1RJFA 1NFRA 2HK9A 3PDNA 1OAOA 1XNHA 2HF8A 3UUFA 4NEQA 5D1NA 3ESLA 3RRNA 1O1SA 5IC5A 1YA4A 3IV7A 3X2QE 2FRDC 1PZHA 1NJ8A 3VR6A 2GO7A 2EFDB 3NJ8A 1W36B 3LQQA 4HEA6 1RMQA 1ZEMA 3EBOA 1DKQA 3L7YA 5AI5A 3KUDA 3DDHA 5KYNA 4KXKB 1K2WA 2J4CA 4O59O 3ZU2A 1U0HC 2BOVA 3BGDA 1R1DA 4U7WA 1V25A 1NMQA 5DGIA 2AJLI 4IX9A 3HRHA 2EINE 2HHAA 2V4ZA 1YMQA 2GJAA 4RE5A 2H5JA 1SIUA 4OATA 3CVQA 3K2QA 1OLSA 2CJFA 2JFPA 3KZCA 3HEBA 4TLDA 3OTHA 3CRVA 5KX5A 3MJCA 5DBHX 1CQJA 4QASA 3HWRA 1SCUA 4EB6A 4OO3A 1PWYE 1OGIA 2ICAA 3DO8A 1TAHA 4JT4A 1IWOA 2UZ1A 3PTZA 2V98A 3UCEA 2VXBA 2DY0A 1ST3A 2WXGA 1N9AA 1LPAB 5L8VA 3IALA 2CBZA 2LKDA 5K3OA 4DLZA 2E4ZA 1JQ5A 1RM0A 1MX2A 2VJOA 1O89A 3CN9A 2I4LA 2ORED 1W9HA 4AO6A 2HLNA 1UDAA 2IBSA 3OFND 1JH8A 1WXXA 1SC6A 4ZEWA 2BEKA 4QWMA 4PS1A 5TLSA 1MOSA 2I2BA 4D1YA 2YJ3A 3ABQB 3D2CA 2FQWA 2BZSA 4LRTB 1KJ9A 4GOMD 1W29A 3QX3A 1TJPB 4ML3A 2R47A 1BQEA 1QHNA 2FG5A 2V5FA 3DE6X 1AQLA 1XQYA 1K3FA 5HTOA 1QZZA 4D9CA 1T24A 5F78A 5D87A 4N4AA 4JBWA 5FZRA 1YMUA 3H5NA 5IASA 1ZJWA 4C87A 4ZRMA 2UY1B 3IB6A 1V8PA 2P9YA 4YJDA 1MFPA 5JAUA 2JDIA 5G55A 1UF9A 3UH1A 4I50B 2VAWA 3UG6A 3V7NA 5MFPA 2E89A 5GV8A 3TTTA 4B75A 4U7HA 1NRWA 5AOBA 2CV1A 3ICPA 3DTYA 1V55E 5HW0A 1NW6A 2NUPB 1RSZA 1TN7A 5E6UA 3U4DA 4EYOA 4B3FX 3OQVA 2DZDA 3OUUA 3AY0A 3B1VA 3P0JA 4FI3F 4P4GA 2FW8A 3E61A 4KQ2A 1B74A 3D81A 3AUAA 2QTCA 3QYAA 3COPA 2GXSA 3QOYA 1SU4A 2AX3A 2IBMA 1WKVA 2N42A 3D9MA 4EMUA 4X44A 1CJTC 1C50A 3VDNB 3JQ8A 2ZYUX 1BFDA 1ECLA 3C15C 5DBKA 2QLLA 1U2VG 2WTMA 3L0DA 2RGGA 4UEQA 1PFQA 5HHTA 3U2QA 2KZTB 4Q9NA 2RB4A 3FNEA 5ENTD 5LLDA 5HKPA 3B3AA 3H4IA 2VSXA 1YFZA 3T5DA 4KO3S 4Y6PA 2Q41A 4R1SA 1MJNA 4TX1A 4CR6A 2HK8A 3E32A 4PBTA 2RFAA 3PKJA 4U6QA 3WHPA 5KQRA 3CHRA 4GOOD 3M6WA 2P4HX 4W5NA 1CC1S 3PZ2A 4QBIA 4DX2A 1Y81A 4J49A 1G60A 1MF7A 4WDRA 2J48A 3PGA1 4CUJA 2DEUA 3EEBA 1NPDA 2R5FA 4GGMX 4LBYA 4DM3A 2KCVA 3RTEA 4HXFB 4BO5A 4AZ0A 4YQYA 4KZ0A 3V34A 1X1DA 1KA9H 1WJGA 1X7GA 3KFXA 5IABA 2WJPA 3FKJA 3L84A 4TV8F 1M6HA 2QHXA 1EYHA 3BCUA 4GTVA 2DCUA 1JKJA 3VPDA 5K0EA 1SO8A 3U48A 2I91A 3GY0A 3OJXA 3N3AC 3FM9A 4RW0A 2J31A 3WI7A 3RVJA 2WIKA 4Q7MB 4ANVA 2VXCA 4M9QA 1CEEA 5A4FS 2B4TO 1AZWA 2PBRA 1LF0A 3R20A 5K1ZA 4AI6A 4X0EA 2VUSA 2H2IA 1RW4A 4R2WA 2VNAA 4M22A 1T4CB 3U7QA 1F2VA 1CNEA 2I62A 3CPHA 1A72A 3SFXA 1I01A 3TNLA 4HWRA 3LSTA 3OESA 2B94A 4N12A 5DWVA 3L01A 1J0CA 1WBJB 3TKYA 3FWHA 2JHAA 4QUEA 4V02A 3KR0A 3U9TA 1QE5A 5AXBA 2XWBF 3TNDA 1T6BY 3F7MA 4MV6A 1BWPA 2V1XA 3ESKA 2CFCA 1OHHD 4MR9A 2IS2A 4H0CA 3MPUA 1W7AA 3NTUA 3NG1A 3SC2B 4ZT2A 3UQYS 1MH9A 3INRA 4TLLB 3RUHA 2G5TA 2Y05A 1GXSB 4KBFA 2FQ1A 2VZ0A 3ABIA 1E3EA 1VB5A 4P7FA 2YTZA 2WT9A 3Q75A 2RBGA 5LQSA 4MQEB 1I4WA 5FWXB 2PZ8A 5JZ9A 4J6FA 4PLWA 1W4LA 2CD7A 4JSYA 4BNNA 4GPD1 2FZ4A 4DX7D 2CXQA 3CZQA 3EQZA 4H7XA 3HU5A 4FWBA 3QOWA 5F5LA 2PV0A 2QN7A 1SHJA 4OBEA 2C9MA 2I9PA 6PFKA 3DV0A 3MIIA 1QFYA 4ND7A 5JCOC 4YCDA 4RJJA 4B43A 3CLRD 4IKEA 2WXHA 1F06A 4UCFA 1MC1A 3T3GA 3OIVA 3LQRA 4AZSA 3U81A 4QPCA 1TL7C 3FSRA 2ZBEA 5FOQA 3WNVA 5FJYA 3THXB 4PPYA 4CMJA 4ZT6A 4AP9A 1USKA 4CMIB 2VBIA 4B82A 3LJNA 2LO6A 1M6YA 1PQ4A 5DW0A 5C8DA 4MPTA 3TB6A 3QXHA 4H4CA 3GJ6A 1JR3E 4KJZA 3L40A 4P7GA 4XH9B 4BLUA 1OGJA 2OEWA 1RE1A 2MSLA 1HU3A 3UX4A 3HMQA 1AE1A 3ZK9A 3SZ7A 4FGZA 5D2MC 1M8KA 4DIFA 3C87A 3MW8A 3SF4A 2DWUA 3GFSA 1K4MA 4UEWA 3ZGLA 3WWOA 3T1HB 2XQFA 3PNKA 5HKKD 4Z3OA 1Q44A 3CJTA 3ZNGA 3O8OB 3EHEA 5KOIA 4ZAFA 4G0ZA 4IO0A 3PPVA 1Q19A 3FSJX 5DI9A 1HX7A 1ZD8A 4G4SO 5JS1A 2OV2A 2NZJA 3DWFA 2B1QA 1G63A 1I6MA 2HFKA 4N5CA 1VECA 4PF1A 3PX3A 3PFFA 1U0BB 1QHFA 1XWWA 3A1VA 1YCFA 4GA0A 2I4RA 4OHZA 4PHFA 5B7NA 3ZIAD 3ZWQA 1H1DA 4DR3B 4JVNA 2HMVA 1EG2A 1ZOLA 2A2ZA 4E30A 1S64A 1DO8A 3O9MA 1SCIA 5IZCA 3IOBA 1UJMA 3U9LA 3E3MA 2NYJA 4EQZA 2H8KA 4TV9F 5CR9A 5EQJB 1AK9A 1QWSA 1LDEA 2JFFA 4RSGA 2VIIA 1C5KA 4MUEA 3S2FA 5DM70 3NANA 4OGKA 3N0TA 2R8OA 3A1SA 1VJ5A 2E5FA 3W5UA 1KBZA 3AGPA 2BJWA 3KZ1E 3OLVA 4L3VA 1QP4A 3C3QA 5D51S 4AMGA 3OZDA 1P8JA 1PJRA 4DL9A 2EARA 1OA0A 4A8JA 3AVWA 2C1XA 3H16A 3KT0A 5JYBA 1RAIA 1TTPB 4EZJA 3ESXA 3O8CA 3Q0EA 2AA3A 1YVEI 3QKRB 3TLBA 1FZQA 2BEDA 3BJZA 3CZMA 1T5BA 4M1MA 1E2QA 1PT9A 4N6OA 5L45A 2YVLA 1QJCA 3K70C 5DMXA 3QG5A 3QBEA 1X77A 5HR5A 1MA0A 1T29A 2FN3A 2RI1A 3DXKG 2FEPA 2BLLA 1ESMA 2DUUA 3GLSA 4O2AA 4NCBA 3ABZA 2Z6UA 4GRAA 4LDJA 3GK3A 3G23A 2WNSA 2N3ZA 2GLXA 3R40A 2YHCA 3VISA 4G4IA 4EI8A 1FUIA 4CGWA 4WAUA 4IP0A 1B73A 1XA4A 3AL2A 4QBHA 2D7CA 4UUCA 2CFIA 1ORRA 4TLAA 2H16A 4RVSA 1KF0A 4IUYA 2A1IA 5FQ6A 3R7QA 1TZCA 1U2ZA 3C3KA 4W5RA 5EYLA 4DRYA 1LZKA 5IAAA 2E3JA 4MV8A 2GZMA 1KZ4A 2ZU6A 1WBDA 5CB4B 1ZKMA 4RXMA 2G9ZA 5TGTA 1STOA 1BOOA 1RJGA 3IX7A 2PVSA 4H7HA 2ZXUA 5CHEE 4YJGA 1XJ0A 3F6PA 1K88A 4P3OA 2EHDA 4Y8VA 1J4AA 4GTSA 3T41A 5COBA 2Y0EA 3RK1A 4AMBA 5FTNA 2J6BA 1RPAA 4HYTA 1JHUA 4B6JA 4AZVA 3SJAA 5AKGA 4I66A 2W2NA 1XT6A 4MJLA 3CLVA 3WTBA 4KSBA 2GLUA 1O8BA 4WWPA 1T0JB 2IF2A 2F59A 1OYYA 3QXXA 3P1JA 2IUUA 2H17A 2VK1A 1HY3A 3I5AA 1KO1A 4FJ2A 4OHYA 4F84A 1TU4A 2Q1YA 2WYUA 5EMMA 1TTTA 1R0CA 3U6BA 3ZHTA 2FULA 1EJ0A 1E3QA 3C1AA 3Q6NA 3BK7A 3D7NA 3PHBE 2PWZA 1RXUA 2HNAA 3BZUA 2RH5A 4KVOA 4MYTA 4P82A 2JW5A 4ZYYA 3G89A 1GHTA 3AB7A 1KPSB 1UMKA 4NZNA 2A9FA 5KNCA 1GGEA 4FVTA 4S2EA 4RDCA 5DHAA 4J2HA 1H69A 1K89A 4NATA 3DHEA 4FZVA 3C39A 2DKNA 2WTUA 2JLRA 3URZA 4P29A 4YO7A 2CXOA 2JVIA 2X0IA 2C5GA 1ORTA 4HOYA 2AJBA 3FCAA 2VDRB 2WMNB 3ZQJA 1WNTA 2C9ZA 3JQGB 2CMHA 3H8JA 5LP6C 3ZG6A 3ZU3A 3IIEA 1T4GA 1FTYA 3I5UA 3H99A 1LGYA 3ACCA 5LKAA 2ZIAA 5FF9A 3ABSB 3DRAA 3OTNA 2C2LA 3O93A 4FGSA 3UZUA 2ZZMA 2WXPA 2ODWA 4E03A 4A8TA 3NC1C 2YS7A 3P96A 4H27A 5ALPA 4DR2B 2FCAA 1LV8A 5KSOA 1VL1A 3GRPA 1QORA 1PSZA 3DEJA 3ZI0A 4G11A 1VLMA 4B3IA 2WWHA 3VOBA 5LKRA 3NFRA 2AMFA 1GFSA 3BWEA 1FMCA 3EA4A 1ULBA 2QN9A 1NAIA 3HQ4O 4URZR 1OFTA 2CEKA 4JJGA 4HH0A 4D9BA 1JIKA 2EQAA 1NUSA 1I36A 2EDAA 2NU6A 1BMTA 2NO1A 5CCLA 4B80A 2WMOB 2VCHA 1N7HA 4P83A 2GHIA 1KJQA 2KMLA 5JRZA 3EVDA 2R85A 2R11A 2ZTVA 5CT6A 3WFZA 2W6QA 2FRDA 3BSSA 2F3SA 4XXHA 4K1LA 2I71A 1T2VA 3ONFA 4DADA 1Z0IA 4IDFA 2R79A 1HDZA 2C0QA 1ZCZA 2AW5A 1FPPA 3ETHA 3UJ6A 1Q16A 4GKJB 3M6VA 5D0QD 3CLUC 3TUJC 3PXDA 2W37A 3IP1A 4KGVA 2X42A 2GCOA 4QUBA 1T8PA 4F5EA 2UZAA 1L7DA 9LDTA 1MJFA 2VBCA 4Q34A 1YR3A 1RQPA 2VOJA 4UNRA 2Z58A 3DTTA 5ITWA 4QJBA 3FU5A 4KXVA 1JG4A 4GMFA 4PVDA 1AKTA 3D9IA 4S1PA 3EGCA 3PHGA 5JYDA 4J9VA 4CCYB 2XBMA 3DYBA 3NUQA 3ZQ4A 5KOYA 5EJFA 3P9XA 5J5VA 1EM6A 1YS7A 1T9AA 1MD9A 4X7MA 3T61A 1MABA 4OKIA 4RKQA 3A6ZA 3T7RA 4MDYA 4ZQHA 1NVBA 2LCIA 3ZDCA 1C1YA 3KS9A 2ZS7A 4Z68A 5CT5A 3DDWA 4XVRA 3QH4A 3FZGA 2WU3A 4QBFA 3H6KA 2FEXA 1C4OA 3RABA 3A2MA 2LNIA 1NASA 2IZ0A 1SC1A 2GZ2A 1R74A 4PX3A 2O7NA 1U3UA 1E98A 3ZWWA 2QW0X 3N1UA 3L93A 4WACA 3HDGA 2X6TA 2WKPA 4R51A 4M88A 4E2ZA 3VR4H 3OE7A 4JEMA 4PFJA 3DMTA 1WMEA 2C1EA 4AZ3A 4ROTA 2B8JA 3AEYA 3SXUB 4HATA 2DYKA 2WHPA 2XZDA 1KI6A 2CGEA 1NBMA 4IAOA 5AVVA 2QJFA 4MINA 1UPTA 5F7OA 1H4VB 4IYPA 5DHRA 4H60A 1CP3A 1FBTA 1CHDA 4H3VA 4ZO7A 4ZO8A 3AR2A 4ENUA 1U4SA 1XRMA 4EGQA 3RUEA 4EY7A 4MYCA 1NN1A 2QDKA 4MW4A 3W2FA 3PXUA 2WI8A 1SAYA 1C1DB 2O57A 2QBYA 1X39A 1DG3A 4C22A 2REOA 2X38A 1SIWA 1LSUA 4HGQA 3UKRG 1OSNA 4KDEA 1DXHA 3BHMA 3QU2A 4YY3B 4DTIA 2Z2XA 3IP9A 1DCKA 3WLRA 1SBCA 1R7RA 3Q11A 1OAOC 2P2CP 4CBVA 3HP7A 1Y7PA 4GTRA 1JI0A 1GFIA 1A5BB 5A7DB 3ZYLA 3B3QA 3AC0A 2ZFUA 3HGMA 3UXEA 4C29A 4DA8A 2W2LD 3NETA 2AUNA 3DC7A 3AG1E 1QHGA 2QZAA 4Y2YA 4EHIA 4KFSA 4MP6A 4YJHA 1M2OA 1LKZA 1WPXA 4QFBA 3JAWA 2G1UA 3TWQA 1VLZA 4KQ1A 2GBFA 3FULA 2V7UA 2RG8A 1QV6A 1UQTA 2YXNA 4XM0A 2XADA 2GBGA 4ZI7F 1AG9A 4QYTA 4R98A 4QT4A 1USGA 3HJFA 3A6HA 3QP9A 4NJEA 4KXFB 1SK8A 1ZIXA 3VR4A 3LUHA 3W6ZA 2HCTA 2YMMA 5A62A 2O1EA 2XQ0A 4Y2UA 1L9XA 3AUXA 221PA 1T5OA 2CBGA 4G5OA 3N2EA 3PXGA 2H1VA 2C5BA 2XZPA 4KLCA 2AOTB 4UATA 1ZR2A 4ARZB 1OASA 2ORIA 2UYCA 3L0CA 2HR1A 1PS8A 2OXFA 3QEMA 3OEHA 4J6IA 3V4PB 3B85A 2W22A 3ZC3A 3IGFA 1REQB 4TXJA 4GMDA 1V8DA 1P1CA 4M1TA 4HMPA 3AVVA 3C1TA 1SHUX 3MCTA 5ALFA 5B37A 1DG9A 4ABTA 4XJVA 2V6IA 3KTOA 5SICE 2PWAA 5FOUA 3NIBA 2X9LA 2QU8A 3O7MA 3I30X 4N01A 2GJ8A 2P9BA 3B5EA 2DH5A 2FP4B 1Z6YA 4ER5A 4IICA 2UZ0A 3U26A 2IZOA 5GJVC 5A4MS 3ILSA 1EZZA 1PKXA 4BUCA 3PZDA 4GIBA 2IE0A 5FULA 3ZHSA 3HLKA 4F8YA 1RPJA 3MJEA 3UK7A 2OD9A 4R1NA 4GPBA 4U7FA 3HC7A 1W0JA 4CNQA 3SQWA 5JNSA 3EXEB 2V7TA 4P86A 1M1YE 2KB0A 3BE6A 2OOKA 1V35A 4D9EA 4FQ7A 5K0JA 4YJ2B 2VH5R 2FXIA 1HLGA 5B5SA 3HJGA 1DWQA 4E94A 1N3BA 2X2EA 3TWUA 5CTJA 3G2VA 3UC9A 1RM3A 2XEDA 4KGXA 3TEMA 1MV5A 3OO1A 4DNOA 3LPZA 2YV1A 4FJZA 2HRCA 2YZ7A 1MXFA 2XVYA 4EFKA 2EIJE 1HDXA 1QIFA 1RWVA 3LMKA 4BS9A 2L19A 2OFOA 4CEMA 2X7HA 1V71A 1UKAA 4JOBA 4ENRA 1W30A 4EW2A 1FPQA 2TMYA 3KKPA 2JS7A 3DLPX 4ID3A 1D4FA 3ADKA 2XUJA 4B83A 4Q4JB 4K7JA 2ACVA 4WNYA 2JFUA 3ANSA 3EFBA 5E1OA 4ZAZA 1FNNA 1ZN8A 4PM4A 2EIME 1LA2A 3LF2A 1NBHA 5JCOA 1WABA 1E3JA 4ZDKA 3KEZA 3LP8A 4L85A 3QELA 3P9CA 4GHWA 4EF4A 3HCEA 3M81A 3C6XA 1Y1KE 2PU7A 3QHAA 5IAOA 2JJQA 1X1RA 2O14A 1O6CA 3L6OO 5K3FB 5CLQA 2AG6A 1W75A 3KJGA 4ZJPA 2X5XA 3QVTA 3PS6A 3STYA 4DILA 4WWOA 2AG0A 1IEWA 3V1MA 3RAPR 2GK3A 3RVLA 3RYHB 1GDHA 1YVRA 2ZSAA 4F4UA 4M9UA 4MR8B 2X3UA 1NJ2A 2JZOA 1YUMA 4F5WA 2OD2A 4EUFA 4M53A 3V9AA 4AN0A 1YS2X 2DBYA 3K53A 3MUOA 1I3NA 1ZOPA 5IBRA 2YZGA 2WWFA 3SGHA 5BSUA 2EVWX 3O0TA 4OVKA 5H68A 1WD5A 3IQFA 5JALA 3GMTA 5E1DA 4YR9A 1HEYA 3IEVA 2OZKA 3TCXB 4IY1A 3SBSA 5ALYA 1XMXA 4YASA 1M2WA 1T1SA 3L6DA 4TL7A 2YWJA 2QM0A 1EWYA 3THWB 4L74A 3WIDA 3H6HA 4I9GA 1GKIA 5LBUA 4LSWA 3UJ9A 1H3EA 1R6UA 5BXYA 2R8EA 4LYGA 2OBBA 3LY8A 4KH0A 1V4NA 4NU0A 3NV7A 2G9NA 4R0NA 2Z0MA 5JSKA 2HOQA 2ASVA 1Q15A 1U2DA 3RAJA 1WKCA 5BMOA 3LP5A 3KYDB 5JAQA 1IDN1 4PSAA 4O08A 1JFFA 4GMKA 3UGJA 4KITB 1YO6A 4E4YA 4AJNA 1G5RA 2APJA 2VYVD 5JS8A 2R1UA 4DY6A 4IQFA 5L7WA 4UM9D 3PC7A 1JDVA 4M99A 2FLVA 5AK0A 1WMFA 2W70A 3O9VA 1XVTA 1OJLA 4EFMA 3DNFA 1KFEB 2NGRA 2A0YA 4ZJUA 4R81A 1O8CA 2ACEA 2IV7A 3E6AA 1F2TA 4LA4A 1IK4A 2IDMA 4JB3A 1QK5A 1W5BA 1UJ4A 5FOVA 2O0HA 5PGMA 5IHXA 1KEVA 2C03A 3WQQA 1DTEA 4QOSA 1OC4A 2PG3A 5LCWJ 4GX2A 4EO9A 2C04A 8ABPA 1Y4SA 2EKDA 4WNIA 5JH7A 2Y1FA 2V0PA 5BUQA 5MGBA 2R8RA 3H18A 1E9DA 1RHJA 3TW8B 3ZXXA 2J9YB 5EC8A 2J3DA 3HZHA 2VHZA 2LBPA 3D8NA 4YDWA 4ZK6A 3TUIC 4A1FA 4ZJYA 2FQYA 1SXJA 3UXGA 2JPDA 3GI1A 3NTRA 4URFA 1VFNA 3ZR4B 1SC4A 3ZUVB 4NAHA 4N5NA 1WLYA 2CMDA 3IAXA 3OKFA 4IHKA 2P30A 4BDSA 4MV5A 2J0QA 1KXJA 2FFBA 2QLBA 4Y2HA 3X1XA 3H4TA 1BDMA 2PRSA 3ZCSA 2UVPB 4I4LA 2B2NA 1CUXA 3HDTA 2QSUA 2C84A 2X13A 3DXYA 3R3HA 3DSVA 4QDJA 2HCRA 3ZD6A 2WHYA 3Q40A 1OIVA 2V8OA 3TVDA 3C45A 2Y6UA 5JD5A 1HE8A 3BK2A 1NZJA 1G2IA 1IXZA 5CRVA 4FHKA 4FOOA 1J8MF 1LQTA 2ABWA 1CY0A 3IEKA 2Z2ZA 4X7RA 2CV0A 3WG9A 4G07A 4R4JA 4QYIA 2DHEA 1N4DA 2BHRA 4NFHA 2GM9A 5IH7A 4PS0A 4OSPA 2JGLA 4FFLA 1TO1E 1B8VA 1XWFA 4UHBA 2ZR7A 2VPPA 3RIEA 3MS2A 3VR3A 5A0TA 2O50A 3J7AC 3R3JA 1ZK0A 3U4QA 4NBLA 3LAWA 4CLRB 3GAFA 1X38A 3MGCA 5ALNA 2HCJB 3TGOA 3RIBA 3DKVA 3LW8A 2EKLA 3RT7A 5F7JA 2ONYA 2C97A 5ERYA 4RJ2A 1NE2A 3LYAA 5EN4A 2WM3A 4ECAA 4LHZA 1HS6A 1MKYA 1QKIA 4ETWA 4ZYWA 2Q9UA 3AW8A 4QFVA 4BNVA 5J2TA 4EB3A 5I7RA 1AKWA 1GAXA 2JGRA 2NNLD 4HQOA 5IZCC 1L5LA 1WTCA 1AXEA 2BN4A 3LRXA 1QSGA 3KEOA 4LW8A 3Q5DA 1OH6A 3LUKA 1F20A 5T67A 3GFOA 3T7JA 4QA9A 1XDUA 4LI3X 2VF7A 3JQ7B 4DV3B 3PSHA 3AHFA 5LQMA 1G6KA 2HHLA 4WKPA 1UBEA 2WDZA 3OT4A 2GMWA 3RH0A 1W85B 4JPSA 2DT5A 5LP6A 4LGMA 4PRYA 1Z2PX 3M2PA 2CC2A 4IS3A 4B5LA 2I6XA 2B83A 5FYDA 3RVSA 3PUJA 2EATA 4MQ4A 1A7KA 3TTYA 4A8JC 1E5XA 2OEVA 3TQCA 1RPNA 3HHPA 3DQZA 4J8DA 2DETA 5TQ2B 5WRFA 2D1FA 4C76A 3FZNA 3PGKA 2VSNA 4FDLA 4CDGA 1QRRA 2X6RA 2YWFA 2EEZA 1QCZA 3ZWDA 4E1AA 2XAUA 3QHQA 3TZQA 2Q3MA 4HOSA 3V2GA 3PD7A 2O5RA 3H97A 2PMFA 3RWBA 3CKBA 3HYCA 2E87A 2QR2A 4UASA 3RUDA 2BFBB 3FOBA 2VSYA 3U4AA 4D42A 2YWBA 1PFUA 4HDKA 4Z49A 2L6BA 3H2BA 3M83A 5KKAA 2FBNA 1YZYA 5G4KA 1N5LA 3INTA 4Y2VA 3T3DA 5HZKA 4O4IF 2ZE8A 3ZJUA 1UT5A 1M1UA 3BBPA 1JAZA 1CF2O 2BLNA 1YD7A 3O4GA 5JSZA 4ZTUB 1ZR4A 4KE6A 4RIHA 5TRTA 4K9PA 3KAQA 1GLNA 3FMGA 5EP4A 4M0EA 2GN4A 4B74A 3SS9X 5ARBA 3VLDA 5ADVA 1WR8A 1WB4A 4NZPA 1UM9A 3N2GA 2WF9A 1Q2XA 1TNYA 1WXQA 1X74A 2C78A 3KXPA 2C4NA 2ZIRA 4WNAA 4DXHA 3L02A 5AK4A 1QG6A 2AVPA 3R0QA 5H3LA 4JLUA 1TO6A 2A5DA 4IXNA 2A59A 5CMYA 4ZEVA 1YS1X 3EXAA 4NBTA 3QWAA 1U2QA 4LJAA 4E07A 1LF8A 4JC5A 4KBYA 1MZPA 1W0KA 2PANA 2R7AA 4KOAA 4WXMA 3NLLA 7REQB 3GJ8A 4C48B 1ODFA 4HMOA 1PUXA 4WADA 3TQOA 2XNDA 5DTMA 2CUTA 4DSUA 3KOUA 4HGRA 3ENWA 3AJDA 2JFWA 5K8TA 4IDEA 2DT8A 5CBPB 2PX0A 3FMFA 3FOEC 1MRZA 5M34A 1RI3A 5KQMA 1ZICA 3LHIA 4HRYA 3E2MA 4KU4A 5BRJA 1COWA 1X8KA 3VR6H 1L4NA 4CKWA 3HO6A 2WY2D 3AUFA 1BXZA 1RM4A 5AJUA 1JHYA 5EKUA 5F9HA 1JEYB 3OG9A 1EHCA 1R0ZA 1P81A 4C0QC 4FMBB 1G3QA 3IEMA 1F2UB 5GGXA 3JD4A 4LOKA 1EGVB 2RH8A 2BUBA 3BSWA 1E2DA 2QRUA 4MTCA 1CQZA 1G20E 1S0UA 2VDLB 3MCUA 1T8WA 3EAQA 4M0CA 4EX7A 1MC5A 3WMEA 1C8VB 3G0GA 4QLAA 2FW7A 4RMNA 2R86A 4DKXA 3WL3A 2WIBA 1PJLA 1E20A 4KL8S 3TDMA 3OZFA 3V4RA 4IJ5A 1WV1A 5IJ9B 3I04M 3Q7RA 4ZTZB 2WTBA 2IIPA 1RFLA 4HAOA 4W5JA 4B9AA 4NOJA 1VOTA 1WX1A 1O5TA 3OICA 3U9WA 1CUGA 3LCJA 4HTFB 2WAOA 4AX8A 2V7QD 1LDMA 5FV7A 4OP2A 2VDWB 1PO7A 1NW4A 1YRBA 1PZNA 1VSVA 1AP7A 1KTVA 1ISJA 4R8KA 3BQ9A 1OAAA 4DR7B 1HURA 5C5EA 4NBNA 4AO7A 1ZA2A 2IY7A 1H0KA 3NZEA 2FPIB 4JBLA 2PUHA 2ATXA 4G8JA 5FO0A 1LFDB 1WPRA 2W11A 5TPZD 4TRRA 1V9LA 1UBMS 4B81A 4X9XA 4OFWA 2A57A 5EHIA 3IJ5A 1I8TA 5FP0A 4J0KA 3JALB 5ITZF 1NF8A 2ZVPX 4D4JA 3ZIDA 3SFZA 3TWRA 2UU9B 3UCFA 2V7PA 5LZ4A 1FS5A 1E90A 1KYXA 4WDQA 1L5YA 4L7QA 2Q6KA 2AHOA 1YT5A 4MS3B 2RHRA 1E18A 4QXQA 1DAHA 4X95A 3WLNA 4L3OA 1G8KA 4RWEA 5AUQA 3RKVA 3VYSB 2IHUA 2QJWA 3U0VA 5FAKA 2Q9CA 4N5QA 2ODAA 1OZGA 2VL7A 2IPXA 2R9VA 4Z0PA 2R5SA 1PF7E 3TPFA 3B7WA 1T6NA 4DQXA 2AI3A 1JTVA 4K8RB 2PT6A 1Z13A 3PIDA 3ROQA 3NNDA 4G4SP 3SPXA 2LGJA 3QPBA 3V4VB 1TTQB 1NMEA 2Z98A 2PEZA 2PZFA 4LSGA 3VPXA 2EYQA 4WKOA 4MR7B 2VFAA 2JFQA 2ZS9A 1U1IA 1XQXA 4EHLA 4HSGA 1B1CA 1KS9A 1R12A 4X1IB 1KQFA 3EGDB 3MKRA 3ZZNA 3N07A 2DR2A 3W6NA 5LB2A 3F8WA 1O97C 3DAOA 2JHPA 4CFSA 2VP2A 3K96A 2VPTA 4X7BA 4ZVRA 1LW6E 4ZCRA 4DTCA 3PEYA 3L1KA 2FOIA 3AERB 3OZ7A 4GEGA 1GNPA 1RWBA 1WIWA 4RU1A 3PRHA 5AKJA 2L6JA 2V9ZA 4PXAA 3EOZA 1BN6A 1ZGJA 1AO3A 1B0AA 1TYDE 4NC9A 3QVLA 4TUYB 3KWLA 3RKRA 5CFRA 5I9SA 3WGJA 3F7TA 1GAJA 1MOQA 3EG5A 4ND8A 1LQ2A 2QVZX 1ZM9A 4LWZA 1FCJA 4PZAA 4AZTA 4XYBA 1VFPA 3OY2A 2LCQA 2G5GX 1ZNYA 5G40A 4OLJA 4F8JA 3USCS 3UO8B 3K72B 1PJAA 1MT3A 2ZWOA 1PBTA 5ULLA 4I55B 1FLNA 4UQPA 3KYBA 1NPTO 4N40A 3L8FA 4GKAA 4DLXA 2ZR9A 2H29A 3DMTC 3P0RA 3N8KA 4MOWA 2H18A 4HOUA 1WY6A 3L7DA 3ZCQA 2X8BA 1KOJA 4PTLA 2QW8A 4JYCA 1OYOA 2K2QB 4TL8A 5F33A 3TXXA 4QGHA 2NUAB 2IDZA 2VT6A 1O4VA 4OM7A 2FR8A 2BFPA 3E05A 4GZMA 4LFCB 5LXTF 5JLJA 4Q94A 4J3JA 4BQRA 2L17A 3EIFA 3ZY6A 1UPUA 3PT5A 5FI1B 3K0SA 1FDTA 3DMDA 3RC9A 3G8AA 5AKHA 4AUEA 2R96A 1DIAA 2B8TA 2ZCUA 2FSVA 3ZWPA 2YJ6A 3TMAA 1BFKA 1W5EA 1PC2A 3CEMA 4M86A 2PZLA 5JHAA 3ULEG 2DB3A 3CQCB 1R6XA 2SKDA 1H0HA 4JQCA 5CDHA 2HPHA 6ABPA 1O0SA 2BPOA 1J5PA 1C7EA 2IU1A 1ZD1A 3K92A 1K7FB 1FL9A 1JDSA 3ZWXA 3N6VA 2OHHA 4QOJA 4TLMB 2IXDA 1BXGB 2HGZA 4WXHA 3QA3E 2FWAA 4KWIA 3DE2X 4HBDA 4JT9A 4ATNA 5KJ1A 4LJ9A 3BFKA 1W8DA 2A78A 4BETA 3ODGA 2W6IA 5HJ7A 3MQ4A 2OCAA 4W63A 3P2OA 1SBIA 3K35A 1RACA 1O57A 5KREA 4U8VD 2ZSJA 4IFIA 4ZMSA 4KIGA 4PO1A 4Z54A 3COWA 1Q7CA 3NZSA 3IKLA 3IKOB 2XIJA 3PWZA 3MUFA 3EQ9A 4F85A 3E81A 1NOIA 1H65A 1G4AE 3ITDA 1XYYA 3R77A 2RGWA 5DN6A 3AI2A 2ZUEA 3KPWA 1ZU5A 1WY7A 1V8OA 2W98A 1K8ZB 4KI7A 5THQA 1G3IA 3PC2A 3VJRA 1U1EA 3E3NA 2I1WA 2J6HA 2NV2B 2ORVA 1YASA 3RSZA 4LTMA 3CH6A 5COQA 2JGKA 4Z8XA 4C0EA 2H2DA 4LNGA 3EIJA 3FU3A 1RRGA 2VHJA 1ZVQA 1VBNA 1WMDA 4MKZA 3A2LA 2QX6A 3UV6A 4GVXA 3S81A 1YCSB 1C0IA 3CKKA 1YB4A 1IEQA 3LVRE 1Z15A 1SVWA 1OH7A 3QEAZ 4EW1A 1I2DA 2KLBA 1Z38A 4DR1B 4CTMA 1DBPA 5CVVA 1IUKA 1M34E 3GA0A 2BBTA 4LPKA 3MTQA 4TN5A 4JLOA 4TQAA 3WGYA 3FRIA 2QZ4A 4LAFA 5BNTA 1MVOA 3KB1A 1LBQA 3FSEA 1WQ3A 4EHJA 4O4HF 1U6IA 1IEXA 4HX5A 3NHKA 3FNGA 3GT7A 1HSOA 3KZKA 1OXSC 1D5CA 3E9CA 4D5EA 5J08A 3GLGA 3ETLA 1DKRA 1X1BA 3FCYA 1Z4KA 1HE4A 3E5RA 1DZIA 5KPJA 3K0FB 2NXJA 4WL0A 1J8QA 3WDMA 2P9LG 4TV9A 3DSTA 5EIFA 4UWLA 4DG8A 2AFIA 4DCJA 2YFYA 1RWNA 1PVVA 2ZBDA 1M8FA 5CDSA 5M72A 3FVWA 3FLBA 2VA8A 1AC5A 2BFDA 3P9YA 2EZ4A 3HCNA 1XNQB 4JH0A 1TGVA 3W3AA 3L2OB 4ERNA 1MX3A 2WB4A 5J1SB 5TX7A 4FYKA 1TC2A 3ZEIA 4CZ2D 4TWRA 3AG2E 3BF8A 1PWEA 2VTBB 3PDHA 3FNHA 4AJHA 1TT7A 5CNIA 2QMHA 3E37A 2WW8A 4CM8B 1Z75A 2DXIA 3PEWA 5EHQA 3B7RL 1Z5UA 4RTSA 4LJ4A 4CGYA 1V2GA 3SC4A 1RXVA 1HWYA 3CS3A 4M46A 1IDOA 1AGPA 4YXWA 4EEZA 4FMDB 2MJLA 3KAJA 5JRDS 1Z6QA 3RSLA 5BN3A 3QEOA 3H84A 4E33A 1T5HX 4RZSA 4N7BA 4ANUA 3LO5A 3L79A 4AKEA 3WGNA 3BHIA 2O8CA 3D7RA 3E1KA 1QO0D 3P5BA 5JMPA 1PY1A 3PRYA 4GECA 2XMPA 5E3JA 4IZHA 4H3HB 1PTJA 3KD7A 1YC5A 5DNWA 2JK1A 4CKXA 5KIAA 3IAUA 3L07A 3BE8A 2YXLA 4NEGA 3R5JA 5AI8A 3RRBA 1XZCA 4L5IA 4MROA 3DD5A 5A2GA 2UVDA 3DZFA 1RAFA 4WZAE 4KZPA 2BI7A 5JBNA 3NCTA 1M2GA 2OCBA 1L7BA 2GTPA 1UXIA 1IOWA 3C4QA 5GV7A 4X85A 1GV0A 2H5EA 1YJ8A 4BTBA 1NR7A 1KKUA 1SVXA 3KYCB 3V4OA 1KJWA 1YZUA 1BWSA 3ONWA 3FKSA 4YRIA 1MR3F 1OJ7A 1FW6A 2E6UX 4FFVA 2A8YA 3BRSA 3TI9A 3WHIA 1A8QA 2V8BA 3PZ1A 3NPAA 1E1CA 1J2UA 1JI3A 2AG8A 2Y1GA 3BEOA 4NBRA 4JP1A 1Q7TA 1DRVA 2FWJA 4NE9A 3KV3O 2Q7XA 3ES9A 2QSYA 3WSTA 4HC4A 4P5EA 3TW4A 1E1QA 4K2HA 1AA9A 3UIOC 2EBFX 4LRSB 2GX6A 1P4RA 1U2DC 3L0BA 2YIMA 2AR0A 4TQGA 4Y2RA 1ZW1A 2RHWA 1VBMA 1UMCA 3A3YA 5CM2Z 2HMYB 4PZYA 4YBRA 5AUOB 3IMKA 4WWNA 1QTRA 1XZFA 3R9MA 1RJ9B 2PKEA 2FMKA 3GJ0A 4L72A 2HREA 3GRAA 1PDWA 3MZ0A 2YX1A 4DCUA 5CBKA 5HNKA 1SMKA 4YP6A 4G41A 5CCMA 4IINA 1EVZA 3BYZA 4JT2A 1BS9A 1PZGA 3LUBA 4P36A 4JGIA 2C2WA 4DMCA 2PAAA 2HE0A 4GXTA 1KAQA 2PZMA 4LDZA 3EVAA 1PJQA 2BGLA 4PGFA 3H1FA 1M2JA 4GPEA 4NV0A 3CRNA 5HUJA 1BCRA 1EVEA 4YNBA 4OFXA 1W44A 2IW1A 2HK6A 1EJBA 3OQBA 4XAQA 2IEIA 2Z5FA 1RRFA 3MAJA 3CE9A 1KBQA 1L7OA 3F3KA 1E7VA 4UBLA 5C2YA 3VSEA 3D2LA 1NZNA 1KKMA 4EJSA 4C21A 2TECE 1SXPA 3SYTA 2MHCA 1SQ0A 2CHEA 3JQBC 3EUEA 3ASHA 5BV1A 1OLUA 5KNCH 1SXJC 4RA9A 3OU6A 5IT4A 2DWOA 3A37A 2PXXA 1H2YA 1P3DA 3C1OA 2OLKA 4B3GA 5DIZA 4RG9A 4P58A 3FWKA 4J90A 3RFTA 1X1CA 2D2XA 3KQMA 2IEZA 1HC7A 4O1HA 5GONF 2J3EA 4YUAA 4GC5A 3D9OA 4LNBA 3OFVA 2KHZA 4NK5A 3OCYA 5J4LA 1K98A 1GTSA 3OIDA 2VJMA 1NUUA 4RVHA 1PL0A 3TJMA 2B21A 1XVVA 1E3TA 1LWOA 2OCIA 1XJCA 2P75A 2ZWMA 5AKYA 1YR7A 1NFFA 2POQX 2NVWA 3PL5A 4Z9YA 3MOGA 3RRMA 4WUVA 1L4GA 8ADHA 1DAOA 2FEZA 4GEKA 3CVUA 4YRBA 3GPIA 4TMVA 2P7IA 3ND7A 2XXAA 1NFQA 5D84A 3KOWA 2AF4C 4V24A 1J9GA 4PCLA 4P7JA 3PHHA 2ZOSA 2QAJA 3FZYA 1UFOA 4G65A 2GERA 2CE7A 3R2JA 3I2FA 1PL6A 4R9RA 4V0QA 1OW3B 3MMNA 2X1LA 5C51B 3EHNA 3L4SO 1P5JA 5ARGA 5GWXA 3B89A 4Z1MA 3H2GA 1Z0UA 1AGYA 4MJ7A 1I1HA 4ILKA 2A1UB 2BEVA 4CEHB 3CB4A 1L4HA 1UKCA 4CM5A 3DVAA 2QLFA 2CCJA 2J9FB 3W8NA 2X6KA 3GZNB 4FSXA 2M63A 4QPZA 2X40A 4G9BA 4O3FA 4GF5A 5JYCA 2RE8A 3PX2A 3SHTA 3VHLB 3V55A 4RCVA 1KR2A 5EX0A 1JA0A 3MJDA 1XAHA 4FPXA 1N2CB 1UJJA 1IJFA 4XGQA 5C37A 5D2CA 1H8HA 4L76A 4IN3B 3FCEA 1V37A 4B3BA 4OI4A 1ILEA 4XE5A 3KQQA 5A71A 2R3SA 3FI0A 2WQHA 1JQAA 1DKUA 2HXSA 4KPFC 1RXYA 3F49S 5HJ2A 1I13A 2PMDA 2AXVA 3VC1A 1YQQA 4H6PA 5FD8A 1E92A 5FQ4A 4NOLA 5E1BA 4M0DA 4EF6A 1EGQA 4UE6A 4RC9A 4D8TA 1B41A 3EMBA 5ALIA 4BRUA 1GGNA 1IH8A 4BASA 4IXTA 4WY2A 1THZA 1FMTA 1RAAA 3M6UA 5H5JA 1H6BA 1XCBA 2Y1EA 2GF0A 3A7DA 2V5QC 1R8SA 3ULQA 1YDHA 1NNUA 3N6RA 1T8RA 5CK4A 3AKEA 2WD9A 3EGXB 3LLMA 1JQJC 4A2PA 4KXYA 3A6LA 3F5QA 3VSDA 1ULZA 3G2IA 3D6FA 3FGPA 2HA4A 1AUVA 4MARA 4YEDA 4TKVA 2R68A 3QKSA 1T36B 1VKNA 1PBNA 3V32A 5K9ZA 3QK0A 1UKBA 2ZBPA 3O4RA 4HI8A 2Y69E 3ZEAA 3NWJA 1JHDA 1PJ3A 3CZPA 1BVUA 4HWKA 5JAHA 3ZLBA 1IE3A 4MVJF 1T1EA 2ZBVA 3AJ9A 4C7VA 3GVIA 2Y99A 1T43A 4DQDA 3UM3A 4PRKA 1XXLA 3GJRA 3MQ2A 4RLSA 4G2TA 1JIJA 3KSMA 4UQZA 1AMOA 2EKPA 1OUMA 1AQIA 3VI3B 4KQEA 3JQFC 1N1DA 1L7RA 3ZY4A 3D4LA 1FVFA 1WXGA 4U2KA 4YAOA 5BMVF 5A3RA 4UPDA 1C4KA 4HYYA 1AZTA 2WWWA 3LBFA 2QNIA 1SUEA 5HOQA 3R0IA 2IEBA 1XRSB 3ITKA 5FI0B 3TDNA 1TZ2A 5GZ1A 2Q5HA 4IF6A 3K2BA 4GCOA 3IDAA 5CFPA 1OQAA 3D2BA 2I3DA 4ZT7A 3JQ6A 4C88A 2OGZA 4X90A 3BJIC 4GQAA 1YH3A 4CF3A 2Y2UA 3IQDB 1P2SA 4DLVA 3JYPA 1AGNA 3WO1A 1NNSA 3O90A 1GU7A 1LBEA 2CHQA 2YMPA 4LQCA 1W5TA 4L73A 4DRXB 5CA1F 5LYJB 1Q1GA 1HE1C 3DPIA 4PXSA 5A3QA 3S5UA 2FK7A 2GJ4A 3BREA 3SM9A 3LXMA 1GGKA 4ZVOA 1K3UB 3T7IA 4Y9SA 4G4JA 2PX5A 3TIGA 1FVOA 1MPTA 5I8PA 3VBCA 2GAJA 1XAIA 3NJRA 3KVRA 1Y37A 3WWYA 3ISVA 1CY4A 2W2VA 3R5KA 3COYA 1R9GA 5K51A 3JAMA 3M7IA 3R6TA 4O4LB 3SN6A 4X24A 1OGYA 4BFWA 1TADA 3EA0A 1GSHA 5AIAA 2Z3ZA 2ZB4A 4ANXA 4PHTA 4JA7A 3C6MA 3D9QX 5EKXA 3OF3A 5BPHA 3T9BA 2O7QA 4K9OA 1THGA 3VU3A 3FR7A 3I2KA 3C3XA 1GUBA 1M7GA 1QC5A 5GM2A 1Q1AA 4E5UA 1YJXA 3CCBA 4NRHB 2VDNB 2VNJA 1MO4A 1P0IA 5B4TA 1RWOA 4JSTA 1LK5A 1YR8A 3GP8A 4QQFA 5DFAA 3OP1A 4YRMA 3PXCX 1GPAA 3JATB 1F8GA 5K4GA 2VJNA 2BFFA 4FZRA 3LLUA 1R0LA 2YFKA 3NRCA 5JSHA 4X92A 2ZSHA 3QIAA 3HVUA 3B6EA 3QTBA 1PJBA 3FTZA 5EJ8A 4LTDA 5U9CA 4WBSA 3DHNA 4FD3A 3ZY5A 4J0EA 1ZD5A 4HN2A 1BMFA 3G2WA 1U1FA 3UM9A 4OGWA 4DNFA 2I6QA 3EUWA 1W87A 2J5XA 3AF0A 4KYOB 3QEBZ 4EL0A 3BUSA 4X66B 1MX9A 3KKKA 4QKQA 1QF9A 3HI6A 3T54A 1Y1TA 5A04A 2WM9A 2PGXA 3QLEA 4OQYA 3JTMA 10MHA 4NAVA 2CXTA 1EWKA 2H4JA 3ZBPA 3MBOA 1PZMA 2XVMA 4S04A 3EA5A 3QXCA 1YZHA 1PR6A 3F5DA 5HQ3A 2WM2A 4DQUA 4OVUA 1LF5A 4FI3C 2C2GA 1H3FA 1A3CA 2QUBA 3AM1A 2ID8A 3KU4A 3QPAA 5E9AA 3L46A 5T8KC 5ALDA 4DMUB 3MNFA 1JDPA 1CD5A 5TPWA 1EX7A 1F9EA 2OENG 4G37A 2FPGB 1U2RA 3F46A 2ZISA 1E0JA 4YB8A 1E7QA 3LRTA 3STHA 3G2LA 3THSA 2P5TB 4N3GA 2I2AA 3AYZB 3MWGA 1KK3A 5BP7A 4Z8YA 3INYA 4K6MA 2W58A 1JBKA 3B8HA 2O05A 1NY6A 3WKBA 4JASB 5DM2A 4YP5A 4D9FA 3O8QA 3AF1A 1ZCBA 4LF8B 1SRQA 4BX8A 4P84A 2XTMA 1M9NA 5HRYA 4CMHA 1E4VA 2OXEA 3KR1A 4L9SA 2JFZA 2FG6C 2YV2A 1LVUA 3P9NA 1E32A 3S40A 4UPVA 5IARA 1U5AA 2RFMA 1W4RA 1DIOB 2O8EA 3CUSA 1T5IA 1WMAA 1J8VA 1VJ1A 4DLWA 3VZSA 4EKIA 2EZ8A 3FBGA 3CEPB 2WABA 3H1AA 3I39X 4HLUC 2BTQB 3HVEA 5DYTA 1Y63A 3T1VA 5I8ZA 4OJTA 3PJDA 2DPXA 4IRUB 4EECA 5KJFA 2X0FA 1GQSA 4H9GA 4RD0A 2D00A 5H83A 3JAKB 3LKVA 2VT7A 5IYZF 5FEUA 5K0ZA 5E75A 5ADUS 2Q4OA 1RKXA 1OYWA 2CJPA 1U5BA 3EDMA 1PUIA 2EEPA 2BIFA 4DLUA 1V11A 1IVSA 4EATA 4IGEA 4Q1AA 3PQ3A 4O63O 3VDMA 4XD7A 2XAAA 4UM5A 1O87A 3MEKA 5CA0F 2ZI9A 1KMCA 1EMDA 1ZU4A 4YDSA 1PP4A 9LDBA 4F4JA 3PUIA 5LSAA 3DF9A 1JJIA 5CEDB 3OPVA 2GR9A 4UULA 4IWXA 2YZ2A 4U3JA 3PV0A 2DWQA 2FR8C 5HIIA 3OT1A 3VYTB 5J4KA 3LO8A 5BRNA 1DELA 2HRRA 2Y2VA 3MILA 3OZXA 3N74A 2H07A 1EVQA 4MW1A 2GVDC 1N57A 1PK9A 2AFVA 3H5LA 4N5DA 3C8DA 1RPZA 1O96A 1ZJ5A 4IIJF 2FSVC 2HXYA 5HDQA 1BXRB 3QU9A 5TJHA 1XMVA 1PT6A 1WMSA 2Z57A 3DKRA 4L3WA 4BQOA 4AY5A 3BQOA 3LFHA 2NT4A 4BTAA 4BMVA 1ZK1A 1CKEA 5A4DA 1UOOA 2VHQA 3F2IA 5JNUA 1EEHA 5LCWC 3TM5A 2ZXFA 3EWAA 2X0RA 3L8EA 5JSFA 1B3BA 4LWOA 5IP5A 1V45E 4PYQA 3LX8A 1YFLA 1HK7A 1AU9A 4DQKA 1MHPA 4M9ZA 3UMRA 3EQ2A 1GRNA 3BMQA 3N8HA 4FMPA 3G17A 3KJZA 2XUZA 5CCXA 5TGZA 1U0RA 3LLCA 2B78A 2XRYA 4KYVA 4GB9A 2WIJA 1TU0A 3O8RA 1DKNA 5KAMA 3VTKA 1AKQA 3H0KA 4Y1FA 4GLFA 1G21E 2PD4A 1Z8DA 3ZJYA 3MGGA 3JD0A 2A0KA 1ACLA 3EAGA 2WUWE 1KSJA 4FS8A 3LH5A 3FFTA 2GD2A 1MJGA 5EJGA 4GRIA 3CIAA 4G36A 3PG5A 3T52A 1XMOB 4X1YA 4LV8B 1EBFA 2C29D 1WDTA 1SCBA 4CKEA 1FQWA 1H2ZA 4G67A 2XS8A 5CDGA 1BKSB 5REQB 3OZVA 1QB7A 1D2GA 4TWZA 5AW4A 4A55A 4IIDA 2C0LA 3ZE2B 4IOJA 4V1CA 2WHRA 4HUJA 4LF5B 3ZBUA 1J22A 2XDYA 3IHTA 4N0DA 1PVDA 2PRIA 3LZCA 4B8AA 2OUIA 4Q4AB 4DV6B 1UBLS 1J06A 1DJMA 3CLSC 1WVIA 2SECE 4MS6A 1EA7A 4WWHA 2ZPUA 5HCUA 4CHGA 2WVGA 3GFFA 4HK4A 4LJKA 5CECB 5EFZA 5K4HA 2EHJA 1ORWA 1U11A 3TOXA 1PLKA 3CW9A 3SICE 4I9UA 3OAAD 1SH7A 2JGMA 3LI2A 3P9SA 2QL6A 4F6RB 1D2CA 4MW5A 3EY9A 1WW8A 4ZOLB 2ID9A 4XSGA 5KKNB 3B9BA 3K6KA 1N94A 4MUFA 1NURA 3DUWA 2WWGA 2D7JA 3DFUA 3WX0A 2DERA 1M6WA 4NHOA 4F9EA 3AS4A 3FU0A 5P21A 2P90A 4CQMA 1UPXA 4XVHA 4JUBA 1R4NA 1D8DA 2ZRMA 1VQ1A 1E1YA 3AQIA 1DFHA 3Q3JB 3BTSA 2YYZA 3ED5A 3IXEA 1N5OX 1M3SA 2ZRQA 4W8GA 1IAVA 4JUAA 2AH5A 1QIEA 3TXAA 3GG9A 3EUVA 2I3AA 4B2LA 3HG0D 3LY9A 4EZIA 3ZOZA 1KOGA 4QXAA 2ZSFA 1BDJA 5HMMA 1L2TA 1GCOA 2XGSA 5ENVA 3WBBA 1U4OA 4CIYA 3JQBA 3LS8A 2QVYX 3AM3A 1ZD9A 1RS0A 3U3RA 3VPHA 3V3TA 4RTRA 3I6YA 4KQGA 2ZIZA 3CZ9A 2CMKA 1DINA 5G04J 2XENA 3MKQA 4I0WB 1GTJ1 3ASVA 2FV8A 2ZJYA 5C7IO 3QC1A 3MBKA 1NAHA 2ZSEA 2WF6A 3O0DA 3A4TA 1E3MA 2I76A 2RI6A 3VTXA 3FUNA 1OB2A 3HSKA 1QGED 1HZZA 2BVNA 3WXXA 2VNIA 4EELA 4MH0R 2OG1A 3IAEA 1E79A 1PTJC 4BZPA 2YICA 5FUWA 3SVZA 2QS9A 1XJ5A 2B0JA 1AKRA 4GYYA 3ML8A 1UKYA 2P6UA 4B9EA 5IEBA 1FDIA 4Z1OA 2AFHE 5F3WB 5GQSA 3LPNA 5ALTA 2FKNA 5DZSA 2V03A 1MJ5A 4Z3DA 2BHSA 4P08A 4A4DA 1M6VB 1HOXA 2JJMA 2QY7A 2HDWA 5TC4A 4AQ7A 2PX3A 4JP3A 3UT7A 3QLVA 3LK7A 1T0HB 1XTVA 4HWTA 4H1TA 1U7ZA 5LQUA 4E2XA 3CHSA 4UBJA 4FX2A 3Q73A 2GKGA 3BFVA 3EHQA 1V16A 1TECE 2CMFA 1ZXXA 1XD9A 1G291 2IXBA 4OD0A 3T3NA 3N2KB 4KXMA 1GCIA 2AWOA 1KOLA 3G8YA 1I3CA 2C2MA 4HAYA 1PVOA 3IAS1 4DMGA 2A94A 4ND6A 3WDKA 3G1UA 3GOQA 4ZOBA 1C3OB 5LUAA 2E7ZA 5KOJB 4NCJA 1HEIA 3PRZA 1A50B 1NSYA 5B58C 4PR0A 1ZNWA 4QARA 3GL9A 4OY3A 4AXXA 5EFOA 5JS2A 1T8SA 1RI4A 5T4EA 3PDCA 3W6UA 3HL4A 4ZYZA 1FBNA 3A9SA 2JIMA 1GG2A 1XN4A 2AG1A 4RQTA 5ENQD 4LERA 2I9KA 4WAFA 3WYAA 2Y3AA 4PX5A 2H8GA 3IPCA 2BMDA 1YSCA 4U9HS 1NC1A 2GZAA 4MCJA 5HFJA 3CTPA 4MV3A 5LVAA 1B8OA 1BWQA 1MAVA 3R09A 1E1LA 4J4BA 1SA5A 4GX1A 2XEHA 1QYIA 2OECA 4LWPA 4CODB 4MQFB 3E8XA 2A7XA 3T7SA 5AYVA 4Z4HA 4LC0A 3RC2A 4BWFB 1D6JA 2H63A 4AJOA 3IILA 3OECA 2HLPA 3SYMA 4CF5A 4ER0A 1BJTA 1Y5RA 2RMKA 2HMTA 1UJKA 4EJSC 1QG4A 2PMKA 1OFUX 2J4BA 4GS5A 2PZGA 1ADGA 1E5VA 4FNGA 1KQNA 5FLKA 1T3HA 2VGXA 4MVJP 5FUQA 1Z2DA 4KN5A 5CNKA 2CVHA 5FWNA 2EJCA 2AK2A 5BURA 4M98A 1IB0A 1KO5A 5JPCA 4FT4A 4YK7A 4AXHA 1DHRA 3RS5A 1K3TA 1RKVA 2O8DB 3TOVA 3LOPA 4Q3OA 4B4UA 3GH3A 1JQDA 3RJMA 1ISHA 2O54A 2QUKA 4MAMA 3PPIA 1G38A 5A4KA 4OJMX 1HFJA 4D9KA 2IRWA 4FKZA 4QD3A 4CW7A 1E6KA 3JQFA 3OEYA 1FFEA 5DTRA 3QWFA 3D6AA 4PYJA 3WB1A 5AW5A 3FMIA 2EGUA 5EEGA 3GLRA 2JH8A 2YHIB 2VQ3A 2CUZA 4HLQB 5DX0A 3ZGOA 1Z47A 1SG9A 4Y6CA 1ZMOA 3AO0B 4BDTA 3GAAA 3AVYA 4YRSA 2NSHA 2BBWA 4PO9A 2GPNA 1LD8A 2YVQA 5EYPB 3AVXA 2XUAA 4RUKA 5L40A 2G1JA 2IJGX 3U49A 3G3EA 1IL0A 3LCMA 3ACBA 4FW8A 3T4EA 4JA2A 1P17A 1J00A 3SQMA 4TXQA 3M0EA 1WQ1R 3LWNA 4X41A 1BGXT 3FLAA 1GL9B 1U9ZA 4HNAD 1C7QA 1E2BA 1NA3A 4HGNA 4UHFA 3CF4A 5D8DA 3AFMA 1NMXA 1NDQA 3ZIUA 4ZALA 4XTRA 5DEIA 4OPMA 4CKBB 1ZIPA 4I3HA 2A5FA 5T4HA 2IUTA 2QMOA 1QF7A 4BNXA 2OCLA 1GN8A 2PDAA 3KXKA 2GN6A 1JH9A 3D4PA 3P4XA 1WDMA 1JXOA 2VTVA 4MQUA 1H6KA 5IBPA 2IUFA 2Q3EA 1KVTA 4I6EA 1QYXA 1I6WA 4L8GA 4EITA 3FH0A 2D7DA 3UATA 1CJSA 5B3AA 4YJFB 4LZPA 1VL0A 1HE2A 4B7CA 2HLDD 3GCDA 1NQXA 3DUFA 1VL2A 4LJYA 1MX5A 4M8KA 2Y68A 4GOLD 1KXZA 1H2AS 3B6MA 1SNYA 4CM4A 2GZSA 2H52A 1TUBA 3B6IA 3PYLA 2CNKA 1DJNA 1SU7A 2H6FA 4O4JB 3HV0A 4Y7DA 3T9DA 4V39A 3AVQA 1YIOA 1R4ZA 1ZVVA 4EG3A 2F8YA 3ON5A 5AI9A 1CT9A 2VBGA 3ZHBA 1RQ7A 1BI8B 1DKMA 1EZ1A 1U80A 3MEQA 3IMCA 1HG2A 1V5IA 2XE7A 1D2EA 4YFVA 3RIXA 5KWDA 3HKBA 5TDHA 4MI3A 1US8A 1K2VN 3ANMA 3ULKA 2GROB 4NPCA 1ZI9A 3TG2A 4HDOB 3NQPA 3PWTA 5JFGA 4YV2A 2PQRA 4AIFA 3U31A 4EABA 3QOUA 4A3VA 4MRMB 4QGSA 2Z4TA 3RYCA 3RYIA 3THYA 3WGUA 3EQ7A 4GNRA 5I7EA 3A58B 1HOTA 1N7JA 3F98A 2YKGA 2CNWA 2GRMA 4N49A 4G26A 2J09A 3TOZA 4ENVA 2I2WA 1YJBA 3H7AA 3U0BA 2ERXA 3O8BA 4HB4A 5T64A 2ZW9A 1SVOA 2XMZA 2ZJBA 2PCLA 4LF4B 5T8KA 5E2AA 5K5EA 4W1SA 1YDGA 3H2JA 2RHTA 5CH5A 5KHLB 4RYLA 4LMBA 3F5MA 3RTBA 5CB0A 3SQNA 3JVVA 4N6NA 1K27A 5EHNA 1V9SA 2PA3A 3UK0A 1AWCB 4KEAA 3F0TA 2GEVA 2ZUFA 2J6IA 4PFQA 3WZ2A 1XTSA 4RXUA 2G8LA 4TT3A 5C3UA 2RAUA 3H05A 3VMFA 4DCSA 4TWBA 4DA0A 2P2CA 4LRYA 4MUKA 2UYQA 3EZ9A 1U8ZA 3TX2A 3T5MA 3DZJA 4EPTA 1UQRA 1K7EB 4EKGA 4YT2A 3EPJA 1YOVB 4ICIA 3FEYA 2ZCVA 4OJNA 3EC7A 1ZGHA 4CYMA 2NO9A 4HDNB 4BSZB 1DPFA 3QNWA 4PGMA 2CXXA 1SUSA 1UUFA 4PLHA 1QVAA 2QNRA 1FZTA 4TVSA 3A3KA 4HO1X 3K09A 4RTPA 1F8UA 1PFVA 3BERA 3VBEA 4KAXA 4ZHSA 3L4BA 5BT9A 3LP6A 4LN1A 3BWCA 1NQWA 1SU8A 4R9UC 3PDIA 1WDYA 4S1WA 3ZHUA 5DBGA 1ZK2A 5CD9A 4OEHA 4L95C 3OCCA 3IUEA 2J0SA 4MIKA 3IJEB 1XXHA 2VSXE 4HLUA 1XZQA 2KLHA 4LXQA 3LL4A 1TO2E 3PD0A 5DU2A 3GHYA 3GIWA 1EKXA 3M3PA 4TV8A 2CHFA 2RDMA 2PM7A 1Q11A 3LDZA 1JXAA 1GKYA 4L8WB 4BECA 4LDQA 1ZH0A 3WGZA 2AKYA 4TTIA 1XDBA 1GZ3A 4GTMA 4S35A 4RD6A 2JFGA 2AEMA 3TKLA 4LNUA 2W6PA 2CJWA 1NHGA 3BQNB 1SQMA 4ND4A 3NYQA 2JFYA 4LYFA 3GT4A 4JOCA 4FMCF 1QFZA 4AMZA 4GCNA 3KPYA 3RHTA 1WB5A 3HNOA 1JYFA 1K7CA 3W8DA 2ZETA 4B7ZA 1D6MA 1ZM3A 2KM4A 4MUBA 1NQVA 2GK4A 4QEDA 3QJYA 5H82A 2EFEB 3CT6A 1IM8A 3R6LA 1DTWA 2ZZNA 4X3PA 3I1JA 3FB4A 5AXDA 2PBZA 4HAUA 4O4HA 2P9NG 4A26A 4B76A 4B6PA 2P40A 4R05A 3QEKA 5JAIA 3CR3A 3VNSA 1EBUA 4CU2A 5A0VA 1HDYA 4C04A 2RD0A 3JPYA 3QJGA 4TL6A 4C89A 3KZVA 1T5SA 3BB3A 1T4DA 1F8FA 4IKOA 3EZNA 1JFRA 4WNFA 3HU2A 3K9HA 2RK6A 2LXMA 4CCWA 1N0RA 1CUJA 2PAFA 1XDZA 4AKHA 4UTVA 4A6DA 3FH8A 4X1OA 3IP5A 4JI7B 4YAWA 2OTCA 4IBOA 5ESXA 5J2UB 1DOZA 4RFSA 3UWKA 4TROA 3QJZA 1I6LA 3TGLA 2GOYA 2OAGA 4OQZA 3R8XA 4B1FA 4BTEA 2VA9A 4D4MA 2XHEA 4BEPA 1PJZA 3VO8A 4CMKA 4JU8A 2QT1A 2NSLA 4AP6A 3P9PA 4MUGA 4UMFA 3NHYA 4ID9A 1ISSA 4RFLA 2B35A 4RYDA 4KMMA 1V7ZA 5BSTA 3GBPA 4NTZA 5HF5A 3HTXA 4REQB 4XRGA 1R6VA 3MS7A 3AF2A 2VGYA 2XT6A 5HM6A 4UXHA 3LOUA 4ZVPA 2X6FA 4HI0E 5F5XA 4AS1A 1I2CA 5A02A 1ZUNA 2OHXA 4IG9A 2D06A 1CNFA 1CBUA 4ETIA 4E3ZA 4I1MA 5CXQA 3W3AH 4AF6A 1P31A 1PWXA 2Z9CA 4EG7A 4EEXA 3A3NA 3KNZA 2A5EA 4DLRA 2WE7A 1TB4A 4V0LA 4OU5A 4TTSA 1TX4B 4FWTA 5G02A 1W49A 4OHBA 1E9RA 3A9CA 2O0JA 4C7OB 3OJWA 5CP8A 2YXDA 1NOJA 2F64A 5AJXA 4O8CA 3NKVA 4E1VA 1WUHS 1IZ8A 4DR6B 1TEVA 3AKCA 4KODA 4TOIA 4DWOA 2VT2A 4DIEA 2AZTA 5TF4A 1PGQA 1O94A 1MX4A 4WJZA 1P33A 4DNQA 1KORA 5KS2A 2AC4A 4XWKA 1W6UA 4Q4CA 4Y6QA 1E0AA 4PG6A 4N7MA 1XRJA 3ADCA 4L1BA 5HZGA 3W06A 3GJXC 5E4JA 5F7XA 3G68A 1PYDA 2EGHA 3NDRA 5JLAA 3RRZA 3IEUA 5DPMA 4CWAA 4R2KA 4M21A 3FUVA 1NW5A 2BRUA 4ONEA 1M1YB 4DMFA 4EA8A 3FPBA 2OV1A 4H7JA 1BVYF 3IHLA 4Y2JA 3BD9A 4P3YA 1QTNA 3MF4A 5LBTA 2DKFA 1G6HA 3A10A 2B4AA 4MHTA 4C6TB 4U2CA 2NADA 3EPKA 3IUJA 5KMGB 1X70A 2VQDA 2JI9A 1CS0A 1JT9A 4LDRA 1UBGA 4QQNA 3R9XB 3SBXA 3DOFA 2C4TA 2EWMA 1JJ7A 1JALA 4MJ3A 3TQSA 4HRXA 5A03A 4JP8A 5T41A 2RC5A 5DM60 1IB6A 1XZPA 2YN0A 4D96A 4ZAXA 4UJ3A 4BMPB 2RCYA 2KXPC 4TXLA 2OMKA 4MEBA 3Q4GA 1FRNA 4J1SA 1RT9A 2P65A 3UHJA 4M1YA 1MX6A 3L0PA 3PQFA 4LVNA 3B2NA 4BB9A 1EK2A 3EGVA 1VDMA 1RKUA 1BS2A 1QX4A 1PX0A 3ESZA 5LD2C 1LPMA 4L8FA 3L6AA 3AEKA 3N7UA 1EFKA 1RYDA 1H4QA 1C9EA 2Y1LA 2P5SA 1L5KA 1I5OA 1YE5A 4RKEA 1KVSA 4CMAA 4AWXA 3ZE1B 5KHAA 2RHJA 3WKCA 3BD7A 1NJGA 3OFKA 4Y9UA 2BKAA 4MI9A 2DHQA 3NYWA 5F9MA 1B43A 3TL5A 4UQYA 2L18A 3Q8WA 4G5HA 1B8NA 5DI3B 3ZPJA 4PO8A 2QLMA 1KEZA 3VZCA 3YASA 3T5GA 3HM9A 4FEEA 4ESVA 4WZBA 4RY2A 2XOKA 5DRYA 1USIA 3VC2A 3RFVA 1W36D 4IW3B 2I67A 4A27A 2O8BA 1PQUA 2AR7A 1E96A 4IWNA 4DUGD 4NSNA 3CRZA 2Q3FA 2QP3A 3SEQA 4CQLA 2XZLA 4R7GA 3FPAA 4CM3A 2RIRA 3K7EA 2RG1A 1R6DA 4J7CA 4K6FA 1LLCA 4AJLA 2FWBA 621PA 5E6SB 1GAEO 1Q0LA 4ZAGA 7MDHA 3JARB 4TPKA 2FW1A 2AVNA 4GPZA 2IODA 2HMWA 3KJHA 5ENNA 4WESB 1KK1A 3RREA 1GZSA 4OHCA 1U7WA 2V5VA 3FWVA 2Q6IA 1A9XB 5EMLA 3L54A 2ATIA 3E3AA 4CIVA 2QKYA 1OMOA 2PPLA 3K6JA 4W9NC 4EB0A 2ATEA 3CSDA 3O1JC 5AI0A 2JKYA 3T38A 3SZUA 3PXEA 5LX8A 3ZK7A 3WK8A 3SK0A 3U3DA 2X6HA 1GGVA 2P35A 2F2TA 5ALRA 5FNVF 4QJ5A 3UBMA 3R5TA 4U00A 5KWEA 3V33A 4FGJA 2Y0BA 3GGGA 4QPPA 2JGDA 1BHJA 5J40A 1CJKC 4MLPA 3NC0C 4D3DA 1ZEJA 2QOEA 1VJDA 2AN5A 3RUAA 3NBUA 3GJZA 3Q7SA 1VE5A 2J32A 4YMVA 2D0IA 3FIJA 3IXLA 3OWHA 4BCBA 5JU6A 2H51A 5J90A 1GAWA 4PPQA 4Q1DA 2OP1A 2D0OB 3TPCA 2YUTA 2W93A 3K9WA 4ZRNA 3EYWA 2BGMA 3UC5A 3VV3A 2XMGA 1QRTA 1CB7A 3I8SA 1QNLA 3NATA 5H3HA 4GMLA 5FT9A 1DQZA 1QBQA 4MPDA 3IBCA 4IYJA 3ETNA 1O95D 5KDLA 5KCZA 3LDAA 2WILA 1RZ3A 3BB4A 4OI0A 3AHJA 1G16A 1KH2A 3A2NA 4YAEA 1P4HA 5EOVA 4IFBA 3RANA 2DFLA 4J3NA 4QJ4A 5DULA 3A4YA 3CG4A 3S1SA 4V38A 2ZIXB 1E7UA 1VCNA 5LA6F 2BF0X 2YNQA 4YQFA 1PS9A 3F1LA 5TGDA 3VRHA 1DAMA 1ITZA 3ZJ4A 3TLEA 2R84A 5AUNB 3HDVA 3RSHA 1QV7A 4NENB 2MHKA 2GSDA 1LI4A 2DQKA 3SM3A 3BMCB 3WJ7A 3ZKJA 1V1MA 4DE5A 4O29A 1HZZC 3LLSA 1SY7A 2FI7A 2FQQA 2C58A 1XZKA 4M8NE 4Q00A 3AZQA 3GZTB 1W4AA 2IHTA 3NVAA 5ALJA 2C57A 3MUEA 1M2KA 2G1PA 1ARZA 2JGNA 2QQGA 1SHLA 4LK3A 4MVJA 3KFVA 1UBJS 4C2BA 5AKXA 3FPSA 4D79A 2F8MA 5K3CA 2ZQZA 1O0BA 4Z4IA 1QQTA 3L41A 2IPAB 2H92A 3QLVC 3W8EA 2PRZA 5JCXA 4WXPA 4O8ZA 5MDHA 6REQB 1VSBA 1GYQA 1II8B 1JZTA 5LR6A 1TUIA 1N6IA 3U40A 2OZLA 1GEEA 2ZSIA 3S29A 1RRMA 1PTKA 1KSHA 4UFNA 1V6AA 4GPIB 1QVZA 2QVBA 4WE3A 3SR0A 3WXMA 5BWMA 2PQ2A 1YU9A 4Q9AA 4J2TA 4IPTA 1Z0ZA 2WPNA 3L8HA 5KQPA 2GK7A 2JGEA 2QSZA 3W5BA 3IVXA 4UZSA 3QFTA 3NTOA 3C24A 1K1AA 1W5SA 3DM5A 3QXSA 4XWGA 4MI1A 2CLMB 1ZN7A 1G8AA 5EL0A 1CXZA 1G5QA 3L7MA 4JI6B 4PLTA 4CDRA 5IKOA 1NI4B 1FSFA 2QQ5A 1IOLA 2XDQA 3R3XA 3ZDDA 2J6CA 4KRYA 2ODBA 4IRXA 4OQ4A 3B13A 4UWGA 3N9IA 3OD1A 4WBNF 2PWPA 3D7LA 3KOOA 1MP0A 3F6EX 1GEGA 1JCRA 3S1AB 1I2AA 3JYOA 3GUZA 2RGUA 4CI9A 3KDAA 4ZO9A 1LH0A 2FW9A 1YQEA 1J20A 3FHTA 2C88A 4WKGA 3CIOA 4GTPA 2WUVA 5AD1A 4GYKA 3TR0A 3GX1A 3USES 3ESBA 3ND5A 3SR4A 4TT8A 4EQ6B 5EG5A 1BC5A 4TRMA 4JY7A 4Y0VA 3Q41A 2PKRA 3QBTA 3WO0A 1ICIA 4FN4A 3K0KA 4NCNA 4R3WA 2PU5A 1S63A 2F0YA 2ZQ5A 3TQTA 2HMSA 2WYOA 2BKLA 3RFUA 1M5TA 1Z08A 1K5DA 4TXNA 2J5KA 1IWPB 2Q1WA 5CJPA 2GQ0A 3DZCA 2WKRA 2JGAA 4D99A 1X80B 1PS0A 2O2IA 1QF6A 1TM4E 3HYTA 5LQJA 2VHYA 2H1IA 2HDHA 2WUDA 3B1JA 4Q7LA 1EFUA 1M0TA 1U7XA 2ETAA 4HDRA 2C95A 3FWNA 1ZNQO 4J07A 3WY9A 3WA6A 3GLTA 5IXYA 2GETA 1RC8A 2ZVJA 4YH1A 5IT0A 3GGOA 5H3CA 3NTLA 2FDRA 3L6BA 2FUNB 1TRKA 2PJZA 2FETA 2NVUB 3OJ0A 2OGWA 1I3LA 5JAOA 3UJCA 1JECA 2XB6A 2EAUA 2E4UA 1NBME 4ZK2A 5C31A 4PZ9A 3P52A 4H7FA 1ISGA 4ZYLA 2IO2C 4YLGA 2GT1A 1VZ3A 2NTJA 2VCEA 2W0SA 4BNDA 4B6OA 3AZPA 2I65A 4JKYA 2DJIA 4C7MA 3E9QA 1N4QA 1E3SA 2O7SA 3ML1A 1I2ZA 2C4KA 4UW9A 4RMHA 2G3YA 1OX6A 1XZ8A 2FEKA 4JYMA 2ZYVX 1XCLA 3TQFA 4LE0A 2F48A 4BZWA 3GNSA 4H7YA 5CH3A 3DTVB 5ELMA 1KEWA 1H1TA 4COKA 2WFMA 1DHTA 2G25A 1NDHA 2XYGA 4CF7A 3QXJA 2H06A 5EERA 1QP8A 1XJQA 3JQAA 4KQWA 1B4DA 3VHQA 4HLLA 5BUCA 4ZI7A 3VU9A 4G8DA 4MV7A 1XVLA 3BXXA 4UZEA 1ISFA 1ONNA 2BEWA 3IYLW 4URXR 4FDVA 5EKSA 5GJWC 1M0SA 3LY5A 4O60A 4Y7CA 4GPTA 4O2LA 1IAQA 4XW2A 1JQLB 3V8EA 4R40A 3D1LA 5IAKA 4OXNA 1D07A 5A3VA 4YP1A 4OL0A 2PUWA 2AYXA 2HFJA 3GPDG 2HQOA 1QHXA 3E27A 2ZYRA 4R54A 1Z7YA 1EXMA 3VO1A 2ZVDA 3RU3A 2NXPA 4OJQA 1RMTA 1KDRA 3IPYA 3HZZA 3WLQA 2ZYGA 4KFRA 4HVCA 3JD1A 1QLWA 1ATZA 1SKUA 3S8EA 4TQUS 3LC2O 1RWQA 2ZUTA 2WTNA 1A1SA 2VJKA 2WUFA 1XD2A 5IYZA 5FTMA 1P8AA 1QQAA 4QM7A 3TEFA 2HL6A 4HGZA 3RS3A 4ZICA 4HCJA 5AVOA 4YWJA 2D1QA 1LC0A 1B00A 5KQGA 3F73A 5CA0A 2A9KA 5CPBA 4RZ2A 4NG4A 5BWCA 2GI4A 3DOHA 2ZWVA 4ZZ3A 4JW1A 2VVTA 4HUTA 3TVYA 2GCIA 4OJKA 4CG2A 1K6JA 3MBIA 5F76A 5CFQA 4R2MA 1QO9A 1SD2A 1GPYA 1JR6A 3VTYA 1CZNA 4CHTA 4NBKA 1K66A 1BDHA 4ZT5A 4BLRA 4FFMA 1T1GA 1XVAA 2ZKIA 3CKMA 3QVVA 3TLZA 1MAUA 4LFAB 2QTZA 2X8JB 1AKVA 4W82A 1XE3A 4JEIA 4JB0A 1R4MA 2HNKA 4BSXA 1DBSA 2ZG6A 4XX5A 3THOA 3G7SA 3IIJA 3NBNB 4NY1A 5JR3A 3JVIA 4IXDA 2PT5A 4A7PA 1Y6ZA 3X3HA 2R03A 3EJWA 2Y6VA 1K75A 1MDBA 2O8NA 4OBWA 1DUIA 2P1ZA 1BU8A 4HDSB 3PKIA 5MN6A 4ESEA 2HCBA 5IT9A 4G0OA 5FHRA 3DCIA 4LV6A 4QIHA 1T2CA 2BDUA 1OLOA 3L1UA 2Z3WA 1S3GA 5IY5E 4NE2A 1EINA 3NZUA 2AOUB 1ZC4A 1JYSA 4DM4A 4BMCA 1JDUA 2QMZA 5FWYB 2V97A 4RHTA 3BCRA 4B09A 2YXEA 3DE3X 3TJRA 5BQ3A 2CL6X 2C4UA 1O5MA 2QT0A 2IQCA 2DOKA 5AW8A 2YV5A 4JJFA 1Q1QA 4RTLA 3SX2A 3WK5A 4JUFA 1L5NA 2ECQA 3RRYA 3K09C 1GGFA 2H2GA 4KZKA 4R8VA 2VYIA 3KQNA 3L4BC 3NMUF 5KTSA 3IT1A 2BFMA 3SKVA 1XEWX 2VYNA 2DSNA 1WOMA 2FGJA 1QIKA 4RIFA 1H19A 3RQIA 3GCXA 4H2DA 4PNZA 3TJPA 3D8RA 2J46A 3IE0A 4Q3NA 3REQB 2PX8A 1QGDA 4BMXA 1Y8CA 4LKRA 2V55B 4HNGA 3FYUB 4AMYA 2F1RA 3L16A 4X45A 1XA0A 3VTZA 4X93A 1A8IA 2YBEA 2WU4A 1YU6A 1ZGGA 2C42A 1J21A 2Y27A 5AO9A 2JLCA 4M60A 3B60A 1NJ6A 1MXHA 5BWNA 2E4AA 1QCYA 2OCCE 5B58T 3OOSA 4JDPA 3TWWA 2IHKA 2ZI7A 5DYWA 4JXZA 2Q1SA 1E1MA 4W5QA 4PUCA 3RV4A 1NXTA 2BFCB 2ZCJA 2GZ3A 3FSGA 1BJKA 2CUKA 3Q2KA 3WVNA 2C3OA 1CRWG 5DGHA 1OZHA 3UMMA 3LYHA 3DPSA 5HILA 1NIJA 1PEYA 3BCSA 3UA3A 2R7KA 1T0IA 3OX4A 3WLIA 4QUKA 2OCGA 3K0AB 4IJVA 4WXRA 1DV1A 3ER6A 3HCCA 3DV9A 2W6NA 3QMPA 3EQ6A 1ETHA 4MW2A