4BX8A

Human vps33a
Total Genus 214
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
214
sequence length
596
structure length
568
Chain Sequence
AAHLSYGRVNLNVLREAVRRELREFLDKCAGSKAIVWDEYLTGPFGLIAQYSLLKEHEVEKMFTLKGNRLPAADVKNIIFFVRPRLELMDIIAENVLSEDRRGPTRDFHILFVPRRSLLCEQRLKDLGVLGSFIHREEYSLDLIPFDGDLLSMESEGAFKECYLEGDQTSLYHAAKGLMTLQALYGTIPQIFGKGECARQVANMMIRMKREFTGSQNSIFPVFDNLLLLDRNVDLLTPLATQLTYEGLIDEIYGIQNSYVKLPPEKFALPTEAKKLQLNSAEELYAEIRDKNFNAVGSVLSKKAKIISAAFEERHNKQFVSQLPHMQAARGSLANHTSIAELIKDVTTSEDFFDKLTVEQEFMSGIDTDKVNNYIEDCIAQKHSLIKVLRLVCLQSVCNSGLKQKVLDYYKREILQTYGYEHILTLHNLEKAGLLKPQTGGRNNYPTIRKTLRLWMDDVNEQNPTDISYVYSGYAPLSVRLAQLLSRPGWRSIEEVLRILPGPHFEERQPLPNRVTLIFFLGGVTFAEIAALRFLSQLEDGGTEYVIATTKLMNGTSWIEALMEKPFH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural Basis of Vps33A Recruitment to the Human Hops Complex by Vps16.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
molecule keywords VACUOLAR PROTEIN SORTING-ASSOCIATED PROTEIN 33A
total genus 214
structure length 568
sequence length 596
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00995 Sec1 Sec1 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.850 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4bx8A04
3.40.50.1910 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4bx8A02
3.40.50.2060 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4bx8A01
3.90.830.10 Alpha Beta Alpha-Beta Complex Syntaxin Binding Protein 1; Chain A, domain 2 Syntaxin Binding Protein 1; Chain A, domain 2 4bx8A03
4JC8A 5BUZA 4BX9A 4BX8A 1FVHA 1MQSA 2XHEA 3PUKA 5BV0A 3C98A 3PUJA 4JEHA 1Y9JA 4JEUA 4CCAA 1EPUA 1FVFA 5BV1A 4KMOA
chains in the Genus database with same CATH superfamily
3PZDA 1A5ZA 5LM3A 1SUFA 4GC9A 2PZ8A 2C9BA 1SXJC 1XC7A 4CG0A 4LJ6A 1XFDA 5DSTA 4HX5A 4G1BA 2YBDA 3GX1A 1KJYA 2OO5C 4NJMA 4O2BF 5KHAA 2FJUA 2IV3A 1ELOA 3AF4A 1L4YA 2LO6A 3DE1X 2EGGA 2W2MA 2P7HA 3H2GA 2QVXX 1SXJB 2O4UX 5EJ6A 1JG1A 1WU8A 1NONA 2NV0A 1PTKA 1MT3A 3R5XA 3RHTA 3T5MA 3TD2A 5A3RA 1CUUA 4QHTA 4DR6B 2XBMA 4JB8P 1E7VA 1COWD 1SCUB 3QTBA 1VPTA 4PYMA 4TGLA 5JECA 2O8DB 1NLZA 3K9CA 3E2PA 3M3PA 1GZ4A 2EILE 1QH9A 2Q4DA 3AJAA 3FB4A 3OPXA 1YE8A 4NCKA 3ODPA 4NYJR 4AFNA 3B95A 4E7OA 1N6IA 4R1LA 4KNWA 5EKTA 1TUIA 1HF3A 3W3ZB 2ZAIA 3OE5A 2B3DA 2F9FA 1G63A 4EH1A 2HH9A 1L8AA 5C4MA 1MZVA 3BHMA 3BOSA 5AARA 3EIUA 1AA6A 3UXMA 4QUAA 1Z0UA 1BQEA 2F17A 4ZVLA 1FLDA 2F9MA 4AJ2A 1VE5A 3H11B 3TTYA 5H7PA 2NGRA 4EQ6A 2B5WA 4XQ0A 1T5HX 2BDTA 2GZ1A 3QUQA 2XQ0A 1H0HA 3ZYCA 4PNEA 3RVNA 3DEHA 5FLKA 3TEMA 2OLEA 2XCTB 3UAGA 2SBTA 3H19A 1LLFA 3FGOA 4XGIA 3JX9A 2WRZA 5HJ7A 2A59A 1VKJA 3JUIA 3K9QO 2WSYB 2L6JA 2DPLA 2GBLA 4KG7A 4JB8A 4XTRA 2QIPA 5G4KA 4ZZIA 5CFLA 2DFTA 1ZH0A 7AT1A 4RH0A 2GXAA 4LJ9A 5F7JA 4UI9K 1Y89A 3N86A 3U5TA 1QCCA 2GMWA 1ZRMA 2EZUA 1LTXA 1T2CA 2AI1A 2CFTA 1NMXA 4FHFA 5ICEA 2W37A 4TT8A 3HXCA 1UC8A 3I6MA 3KBBA 4A26A 1OSNA 4CM9D 3IDQA 1WAO1 2FXVA 3BXGA 1RJWA 1XCBA 2O8DA 2AJTA 2EIKE 3FWNA 3P9YA 4NL4H 1YT5A 2IXBA 3ER6A 1KYTA 2Q5IA 4DDKA 1M2JA 1R18A 2VJMB 4Q4JB 5H3LA 3K9IA 1UP4A 1DC5A 3LWDA 2BSXA 1UBTS 5H9VA 1C9DB 2Z6VA 3TXAA 3I32A 1JQ3A 2G63A 4TUYA 5DP2A 4LMRA 4BN4A 3O75A 1NRXA 3SX2A 4BNXA 5EWLA 2ILVA 4AD8A 4C21A 3NYRA 2BGLA 4N5HX 2HNKA 2I33A 3B8EA 2WT9A 2LXLA 2O5EA 4MO2A 1KK0A 1CLEA 1ORIA 1B2RA 1S89A 3CH5A 4XYMA 4CV1A 4DOMA 2NSZA 3ACBA 3DB2A 4RTQA 2X6FA 1XU4A 3NRBA 1YA8A 2XGGA 3WGVA 4LDJA 4CV3A 2WM9B 4R98A 3RV4A 3TM4A 3K8ZA 1P73A 4ENQA 4XARA 4Y1RB 3IP7A 4FMDB 4O4HB 3NH6A 3KHTA 2VTBA 2QRGA 3WKCA 2HIGA 3QRWA 1I0ZA 2RH8A 4JDPA 4HZUA 3IVCA 2A30A 2OO3A 4EL5A 5KSOA 2FLVA 2N46A 3CRQA 3MWLA 4BGVA 4IEIA 3H05A 3PPIA 4O2AB 2G9VA 4L07A 1X19A 5LBIA 3RBZA 2YJ4A 2H63A 1GRCA 4ZO8A 5TQJA 3PDHA 3LXUX 4DI3A 2DTEA 4WXMA 5MN5A 2WXMA 4TXLA 3P97A 4L4RA 1G18A 4WJLA 3I9JA 1XZJA 3G59A 1EFUA 4F11A 1GV1A 3OEHA 4O8ZA 2R8PA 5LP0A 3A1UA 3AP2A 5EZSA 4AJLA 5EEHA 2IX3A 1ESCA 3D7RA 1R16A 2VT7A 3QI7A 1A9PA 3D3JA 2R2LA 4HATA 2OHHA 4DQXA 1J0XO 3TUIC 2ZRQA 3KELA 2IP4A 3OMWA 3AJ8A 2XS8A 1G6KA 4MYDA 4S05A 3VYTB 3DTVB 5FWAA 5KOHA 2GCNA 3JRXA 4AMBA 4PEVA 4D5EA 1DU4A 3HRHA 4KODA 1E63A 5F78A 2R7LA 3HHPA 5L4NA 2GETA 1B43A 2EXXA 3EXHC 5FFMA 5A4MS 1RDFA 2NVOA 4I0WB 4BQEA 1WUYA 3PQ2A 1E5QA 2QTMA 2WXLA 1G7CA 2FP3A 5E2AA 4BNZA 3KQUA 3AVXA 1H8HA 1RBMA 5TF0A 2NO5A 2FYTA 3U3KA 4PSUA 2H7VA 2M32A 5T4HA 2A6PA 3TM5A 1V6AA 4UQLA 3GP8A 4E14A 4OH1A 5JMTA 2H2FA 1P31A 3HB4X 3VC1A 3E2IA 2FF5A 2ZWPA 3EQZA 4MQ5A 1IM8A 3VX4A 2QX6A 5IWCA 4LJ7A 1DEOA 2MMGA 3KWJA 2YV3A 4ZCLA 3VKVA 4A3SA 3PS6A 4DT1B 3H0KA 4R5MA 1HDRA 1LU9A 1VL5A 1KXZA 3CUEF 4FTWA 4QHYA 3TQHA 1T2FA 4II7A 2AN5A 2ZRFA 4QOFA 4YCNA 2YHEA 1CIPA 4OHKA 4YCBA 2O8EB 3GLQA 3N2YA 3FWYA 5JS2A 3KUUA 2HDHA 4JCCA 4LYDA 2R65A 4ZMBA 4IOLA 1ZHHA 1HT2E 2H4HA 2V7TA 1TOAA 3KOXA 4AVXA 5K0NA 2H1HA 2VHZA 3N8HA 1YS6A 1QKKA 1NASA 2V3WA 5CM9C 3T7EA 3UPDA 1WVMA 2Q28A 2WP8J 1E99A 1M8FA 3AR3A 4RBNA 1OOEA 5ES4B 1U0RA 4HNAA 3A1DA 4IDCA 2F64A 4P4SA 5AK4A 2I9KA 1NYQA 2AN3A 5KNCD 4DR3B 1MJNA 3T9AA 2HIAA 1DRVA 5LJIA 1KKMA 4OQMA 3P9PA 3EPJA 2VXYA 3Q0IA 1R6DA 4IICA 1U4SA 5FB3A 1O58A 2OEPA 3EBPA 4D9NA 1U2SA 2F59A 2QE6A 4P3YA 1BH2A 4ZVVA 3VR6A 3KSDO 5K6AC 1KSJA 4N5NA 4WV3A 3I5PA 1NW3A 5C5CA 3IXQA 1Z88A 3LUAA 4BRZA 2WKSA 1NE2A 3PITA 4IJKA 2VPWA 4M21A 4OJNA 1SCKA 5TS2A 4MUHA 2J7PA 3H2IA 4EQFA 1YV9A 2DP4E 2X5OA 2WMNA 1H69A 1X7DA 5G0VA 4TWBA 4Y67A 4XFJA 4A1SA 2R7AA 1CUCA 4MYCA 5EG5A 3DUFB 1PJAA 3ETEA 4MUEA 5EZYB 5DLEA 2A0XA 1L5GB 3PEFA 1CUXA 3NI2A 3D7NA 3PVCA 3L16A 5JSZA 1WXGA 3ZCQA 1IG3A 3Q0TA 5C5EA 2WXQA 2ZJAA 4Q3NA 1U1CA 1TZCA 4J1TA 1VSVA 3TRIA 1KBQA 4H7YA 3F5SA 3JY6A 1ZEJA 4FGJA 2ERCA 4AUNA 4K03A 4U2EA 5KPJA 3VPDA 2Z1NA 3AU8A 2GBFA 4QO8A 4M8IA 1BS2A 5D85A 2Z5FA 4FGKA 4ESOA 3TI9A 2W5UA 4UUAA 1DEHA 1N78A 1CEXA 3GY0A 3PZ2A 1CETA 2NW6A 3MMXA 4PX3A 2A5FA 4FC6A 5IJ9A 4Z3DA 1MQ9A 3MGAA 3CPHA 2FSVA 2XUOA 3KFXA 4B2LA 1JHAA 2HJWA 1AX9A 2QTGA 2AKYA 2AC4A 2CW5A 3E58A 4RENA 1WQ4A 4B0OA 1EG7A 4E1VA 1P2DA 2KYRA 4Q3EA 2GOYA 4HH3C 1H2AS 4PG4A 5TVGA 3TVDA 4XRRA 4D9IA 2VHCA 2FMFA 2AN9A 3JS5A 3JWGA 1TMOA 4OAOA 1MV5A 3NZEA 1WCWA 1X0VA 1V39A 3B6ZA 5AQ9A 2EWMA 1GU7A 2W6ZA 4FW9A 4R3NA 5TR9A 3S8MA 1P60A 3RFUA 3UK2A 1BC5A 5ALDA 3COSA 1Z7BA 2LKCA 3WYBA 1SA0B 3C3MA 3EY9A 3RHFA 4BJ1A 1TUGA 1THGA 5LQKA 9ABPA 4H2DA 3EMBA 3OZWA 1W1UA 1KPGA 4IMRA 2PA0A 4M1TA 2EZ4A 4Q02A 5AM4A 1EFDN 1NUAA 3QTLA 3UK6A 3UT0A 4Z7JA 1TGVA 3DBRB 1NF2A 2CZQA 1T9HA 1ZRNA 3D8TA 4M88A 5T41A 1GTVA 4QQ8A 2FFBA 5A3QA 2XF8A 2C7RA 3ZZ0A 1K6XA 1DG1G 3PF8A 4XWYA 2H1LA 4D3FA 1BDJA 3F3KA 3OBBA 1HL3A 5HBRA 3NHFA 2QRZA 3AG3E 5D8DA 2X58A 2VYFA 2HQ1A 4RQBA 2HCBA 3DB1A 1YK1A 4DQUA 2H9IA 1WHSA 3E30A 2CZGA 2VUIB 5JYCA 1KPSB 4TQAA 4PG6A 2FSGA 4JGBA 2GAFA 2VXBA 4F97A 4AS3A 1P6UA 1TO2E 4IOKA 4LRXA 4TTTS 3MM4A 3WMEA 3IMCA 1RAAA 2BWJA 4HOYA 4RHXA 5AHRA 4MLPA 4X7MA 3Q5MA 2VDMB 3CKYA 4Q3OA 2FPLA 2C8LA 2GZMA 3G0BA 1AO3A 4F9EA 3R23A 5DCWA 5FLXA 5AM0A 4EP1A 1M83A 4M3OA 3LIIA 4HEJA 4CGYA 2YW9A 4YI3A 3B7SA 1PJTA 2HRDA 2IYSA 1VGRA 1O94C 3D2LA 1Z26A 4HAXA 5LC1A 4WBNA 3FHLA 3S2GA 4M0KA 5A1TA 2RE8A 5L9AA 3OZEA 3LKDA 1RLJA 4BT9A 4XX0A 1H19A 3A4TA 4GOJA 4X20B 5IM5A 2F3UA 3OKPA 1XXHA 4RZXA 1RWOA 4DX1A 2YINC 4L95C 4XX1A 3IEKA 3KALA 4FC7A 1EHYA 1PJ2A 2B2XA 3ASUA 4G65A 2OSBA 5DYIA 5EN4A 3ZE7A 3PIRA 2W0MA 4B4DA 3C39A 5LQRA 2J0EA 2IHTA 3EFEA 4LVCA 1E9SA 1P4RA 2BR5A 3BGWA 3H18A 5IEJA 3IEXA 1UODA 2XOKD 2C0PA 3FYUA 5DM0A 4V2UA 3CR3A 5ARCA 2NO6A 5FADA 3HXFA 3NTLA 3G2WA 1OTYA 2WJVA 4P81A 3FKSA 1HLFA 2XIJA 3FUMA 4CEMA 2BBOA 1LDMA 2IPXA 2XKBA 1L4UA 1D2NA 4RABA 5IJAA 1AJEA 3I53A 2VAVA 2YDXA 3H65A 5AJWA 1OGYA 4GNRA 5EIAA 1EWRA 1OF1A 5J59A 1C1DA 4K0RA 2OG2A 2XADA 2Y9MB 4OI4A 3HUFA 1D4OA 1XZLA 1KU6A 3ZJVA 3VPSA 4ZCQA 2GX6A 2HLHA 3H7AA 2O3SA 3Q5DA 1QDUA 4ZQHA 1Y8CA 1ADBA 2I4MA 1UXJA 4BX3A 2GPWA 5DW3A 4I2VA 4IHQA 2FE1A 1OKKA 3CKCA 1BKYA 4IF6A 3STHA 3ZHVA 1OPRA 4WK2B 3QF4A 2JLVA 1P9LA 3DMGA 4C7BA 1H9CA 4RHYA 5CW2A 2K7ZA 3PUZA 4GPTA 3GVIA 4MPRA 3ZKWB 4Y2RA 3H5NA 3RK4A 4UU0A 2ZIRA 2B8NA 2DPYA 2LPMA 2O2GA 5D5HA 1QUFA 4RVNA 2R84A 3EW9A 4R0NA 4URYR 1G21B 3W77A 3WE7A 4JI7B 2IQIA 3QU7A 4N8DA 3F1LA 2V6BA 1JFRA 3KOMA 3WWCA 1V41E 4JQYA 4DR7B 3FTCA 4X60A 1O0SA 2RHJA 4D8VA 2W2PA 2OXRA 2PZFA 2VJNA 4K28A 1E89A 3FCOA 1OA0A 2ECFA 3C3PA 3FFXA 3KETA 1E5TA 3D4OA 3UPUA 2FDCA 2VCEA 4LE2A 5IBQA 2Z08A 1IVYA 1ORDA 2B83A 2XYHA 3H6GA 3HN2A 4MRPA 2ARKA 5D7BA 3S68A 3T3GA 3WK4A 2JFFA 4J2TA 2V9PA 4BY6A 3TB4A 3H4IA 5IT9A 4KJZA 1O1TA 5JC1A 1Y37A 2WF5A 1A9XB 3OIFA 4BZWA 2JIRA 5CCEA 3A26A 3B5IA 4NAHA 5BOSA 4JJEA 3D3EA 4G1TA 3B13B 1TPYA 4Y6RA 5JQGA 2BONA 2DBZA 1GG9A 1KFCB 4U2FA 3FVQA 1ZVKA 2ONKA 4B32A 2ZR0A 1SIOA 1FZQA 4KDRA 5DISB 4JGGA 2PG3A 1B89A 1YVRA 1WVIA 1EGAA 3FH8A 5BNFA 5A0VA 1IONA 1BE1A 3GDFA 1NIJA 1U6IA 1XDWA 4HB0A 1A50B 4J7WA 1XTSA 4PS0A 1R88A 5DBIA 5GJCA 3ZCUA 4DM7A 3A1NA 2ZM6B 1GGJA 1R4NB 3HP4A 4YDHB 4MR8A 5E4FA 2C4MA 2BHLA 1E8NA 1E2KA 5DTMA 3IB6A 5B57C 2P5YA 4V3CA 4YJHA 1TVMA 1UMKA 2R5WA 3F2IA 3ZVVA 1K97A 4CCYA 1VA4A 5KVCA 2OV1A 3QOUA 1P5ZB 1XQ6A 1NM5A 3LZCA 3O8NA 2ONJA 3TRHA 4A3TA 2PWBA 5AHKA 4BKMA 4AYTA 4IIVA 3GPDG 1Z56C 2JCGA 2B8EA 4Z49A 1OWLA 4TYWA 2R4TA 1JYEA 1TM2A 1T6BY 1CUBA 3HY3A 2AB0A 2G09A 1N3YA 4NJMB 1N4SA 5AI9A 3K72B 1Z18A 4KIJA 4F1SA 1BFKA 2W2KB 4B76A 1IY8A 5KQMA 4P29A 4ZT4A 1BJRE 1EQUA 2ZRLA 2XGOA 2J4FA 1C1HA 2I2FA 1ZIPA 3AEXA 3CVOA 4U7PB 2J0VA 5H5JA 1GZUA 3F6PA 1B6SA 4AU1A 3IPLA 3KX2A 1U8YA 3UGJA 4M9RA 5KWDA 1SCJA 3EVCA 3GLHB 1HQDA 1NJGA 4M89A 2JLYA 4KIUA 1XMPA 5M29A 4RS3A 2Z58A 4O0MA 5HKBA 4J4BA 4RIFA 4IG9A 2B4KA 2C03A 1RMTA 5IMBA 3C48A 4NCXA 1VLZA 1VKOA 2HA0A 1FY2A 3CFYA 4W6ZA 2PXXA 3CRZA 2KBEA 1Z7WA 2XB8A 1E3DA 4BBAA 4FZVA 4YHHB 5EFZA 4Z68A 5HS6A 4MB2A 1G3UA 4G09A 4KN8A 2KC7A 4PDXA 2PKQO 3IULA 3WQRA 1QTQA 1ILEA 3CWQA 3QIAA 1HFKA 4DIMA 3AJDA 4J7XA 2ZE7A 1GAWA 1YBVA 2RKOA 4TVKA 1IQPA 3RFCA 1GZ5A 2PQRA 2XWJI 1E8WA 2NXNA 2PIAA 4W1RA 5FOSA 3ASGA 4FCCA 1EXDA 4I17A 1J2EA 2XUIA 1N0IA 2R3SA 1I4LD 5F9HA 5IBRA 3F7OA 1UZMA 1W0KA 2NO4A 3MMZA 2CE2X 2W2LA 2FZVA 3P96A 1YS2X 3TW4A 3QV1A 3ZVRA 5CM2Z 4J0FA 1VBKA 4IV0A 1LV8A 2DJIA 4NMHA 5EP3A 2ZKIA 1E7UA 2P3QA 4KRGA 1EZ1A 4DV0B 3ZDZB 4DQDA 1FNSA 1PAQA 4TLCA 3ZNQA 2K2QB 4AKIA 3GRRA 4FBGA 5EUBA 1N3BA 5CU7A 3GFSA 2GEFA 4G0ZA 4RJLA 4C43A 1SC9A 5JH7B 3GD5A 5EE1A 5BSGA 2UXBB 1U4OA 2B3TA 2AJBA 3VU1A 2D0OB 4DWJA 2CMGA 3EODA 1F9EA 2XNDD 4ED9A 2IS4A 2FPMA 4MGZR 3RVJA 2W6NA 1TVCA 1CYDA 1ZIXA 2C8KA 4RF2A 5FBKA 4LY9A 2WFLA 3PF9A 2X6KA 4U8HA 2ACEA 3L6DA 2NU8B 3IKJA 5H4HA 3UW1A 2W6IA 1U8EA 3I6QA 4DLOA 1PE0A 1RBQA 3LX8A 3NCHA 2LTAA 1YJQA 3PIDA 4X8OA 4TVOA 1QAOA 2CC2A 1IWPB 3PHBE 1A2BA 1FDVA 4S3MA 1KDZA 1NOIA 5LB4A 5K8LA 4BXOB 4L0MA 4LJLA 5J4VA 1WXHA 3RVQA 1II9A 3L8FA 1N94A 3DEPA 3FTXA 3EFHA 3FAZA 1GYPA 4QE3A 3Q72A 2HWWA 4BMDA 1OUVA 4OM7A 4R9UC 1IZZA 3B2NA 5I9TA 3OAAD 4APOA 2C9MA 4PONA 4N40A 5EHZA 2WA2A 4G4IA 1KJIA 1OXUA 5JMND 2NO1A 2VC2B 3I5UA 1FX1A 4AQYB 4ZEXA 3CF2A 4C5AA 2KLHA 2AOUB 4R0VA 3PP8A 2C5EA 2IUSA 4F53A 1GN8A 4I7EA 3OP4A 4EGQA 2Z56A 4RTMA 1CJCA 4IHJB 4CL8A 4WKBA 3DGEC 4F12A 1AVTA 1X1QA 2MYUA 4ARZB 3HKDA 4MVJH 5EYPF 1DUVG 4N5CA 2I7DA 1QBKC 4U2KA 5AXBA 2ODPA 4TTVA 4LSMA 4V1CB 3HTXA 1MC5A 1WXXA 1RJ9B 3HKBA 4JKOA 2VNSA 3P9NA 4K9PA 5CECB 2I0FA 3NVDA 4X41A 3IOEA 4UMEA 4BX9A 1RT9A 1PWHA 1EVYA 3DR3A 2SKCA 1GNQA 4J1NA 1W36C 4P5DA 4J29A 1EA5A 3R2JA 5K9ZA 3QKYA 3NTUA 4Y2GA 2I8LA 4OMCA 3P52A 1KS9A 3FIUA 4PZUA 4KAXA 1F2VA 2REBA 1M2HA 4RANA 1L4NA 1EJ6A 3DAGA 3T3EA 3WHIA 3ZGQA 1J7JA 1UDCA 1SXPA 2X14A 1GTSA 2H0QA 4S0ZA 3WKBA 3TWWA 1PL6A 1Z0DA 5K45A 4IDEA 2JARA 5NLLA 5AVWA 4D4MA 2BF0X 3JZAA 1M8PA 3W8DA 2HNAA 2C0CA 1NQ5A 3JCKC 1O95C 3QOFA 5ICFA 5A1JA 2C9CA 3PD1A 5P8WA 2J5QA 4JNCA 2XY4A 2JHGA 3HKBB 1KOLA 2MSCB 1YS1X 2QN6A 2HA2A 1NMQA 3IKOB 1QK3A 3HSSA 2VP0A 4N7RA 5A3VA 3VU3A 1XMXA 1E20A 1AF7A 1SBCA 2VHJA 4K9OA 4MIEA 4OQDA 1HMYA 3O9MA 1TNZA 3EISA 3HU2A 1P1JA 1XNHA 4PF1A 5AKJA 5LQAA 5AQ7A 4GRIA 2WU8A 1CZHA 1UZAA 4HMQA 5FV7A 3NZSA 2X5JO 1ZW1A 2A9QA 3CX3A 4ZO4A 2GCIA 3RS7A 1AG9A 1DBRA 2J5KA 1B6RA 1GO2A 2QPTA 2X76A 3DDHA 4GBJA 4IAOA 2ZG6A 4LFAB 4BTLA 1AHHA 2W8BA 2Z5LA 3B3QA 1WU7A 3EAFA 1P2TA 2OCKA 4QJIA 4C0WA 1S0UA 5A4FS 3FU5A 2P9NG 5GM1A 4BNKA 1IUKA 3BMOA 4GPAA 3FHOA 4IH4A 5ALWA 5L95A 1NVXQ 3DL4A 4Z5XA 5JRZA 5K4HA 3CGGA 3QXHA 1KAMA 2C99A 2G8NA 3VJKA 5AJDA 4L7QA 2OP0A 4F7WA 3DXMG 1SPBS 3INTA 2DM6A 4KQEA 3I76A 3DEKA 3DC7A 1TM1E 2XB9A 4NAUA 4IVNA 4AZ3A 1JEEA 1U2PA 4HNGA 5JZ9A 3TEJA 3USZA 1Q3KA 3EHEA 1YJBA 1Z4LA 4KIGA 2ZTVA 4N3NA 4YMHA 1HG1A 4KYIB 1KQPA 2AXUA 2V03A 3Q79A 3PV0A 4PPYA 1IHBA 2QAGC 2HADA 3R3ZA 2GFHA 5JVDF 5BSEA 2RMKA 3LBYA 4X90A 3SX4A 5AQAA 1JECA 3ZZTA 3MSXA 3OAAA 2NYAA 2GEKA 4P36A 4EB8A 1LPNA 3CLRC 3EPHA 5KQGA 3D9HA 4GBGA 3UAYA 5K2OA 4GP6A 1J2JA 1MXHA 3GNTA 1T9AA 3GAAA 3PNLA 4JVLA 3BZWA 1JWFA 4CIDA 3OTIA 2C5HA 3EH1A 4GAEA 4BNYA 1GILA 2D2IA 2ZXUA 1WMBA 2VVTA 1CJBA 4BMNA 1UFQA 1D6SA 4Y0NA 1UOPA 2NAFA 2GJSA 2JH3A 1YH3A 1LQ2A 2BCJQ 2BMJA 3IUYA 2ZJ0A 2J9FB 3R9AB 4HFMA 3CTMA 5TEWA 3E1SA 2GD0A 1SA0A 2IPMA 3OLXA 4V0NA 3SJBA 3V32A 3EA5A 4BO8A 2COEA 1QE5A 2B4QA 2H85A 3FNEA 1P45A 4JAVC 2FW6A 2I4OA 2JZNA 1DRUA 3MPUA 2GEDA 3ROQA 4BLVA 5BSFA 3IDZA 4DNXA 2V6JA 1IPFA 1LD8A 2FFRA 2QN8A 1EFRD 1ZD9A 2QAIA 4MW5A 4TKVB 1AIPA 3RYIB 3RUFA 4G4GA 1QQ5A 1EWTA 1B16A 4GTMA 3HDGA 4G01B 4O1HA 2E48A 2CLFB 2GASA 5CCDA 3RUAA 2JPDA 4DLNA 1EYHA 1F06A 2ZRNA 4LVOA 3W9GA 4V3BA 1N5JA 2F6RA 1M8KA 3CKMA 3KK0A 3FOFC 1EB8A 1UWLA 1KI7A 2BFOA 4M99A 2OSVA 1E2UA 3ET5A 5KYYA 4GL4A 3RIBA 4ILEA 1FDIA 3ORSA 4HFJA 4ZQGA 4UI9C 1BXGB 2VBGA 3JAKB 1EFHA 1VSBA 2UZ0A 2QQ5A 3X1DA 1CP3A 4BJ3A 3R5SA 3R3JA 4Q39A 5JPIA 1ZHFA 1F6DA 1EFCA 3T7RA 4ESHA 4OK3A 1KMNA 4H6VA 1JDBC 1BXKA 1NQXA 2OQRA 3AG4E 4PC6A 5ILQA 4B6RA 1QRRA 2ZSKA 1K4KA 3KSZO 3ESXA 4EENA 2XGMA 1BROA 3KE8A 3ENQA 1W9MA 2XYGA 3EULA 3W5VA 1RM5A 5EL0A 5H3HA 1E1KA 5ALTA 4R2WA 4TMKA 4YK7A 3WKDA 4HNVA 7MDHA 3FFBA 3STWA 2XEEA 4V1CI 4WADA 4BTVA 1BI8B 1Z3YA 2J67A 2JATA 5E3JA 3EQ7A 3GEMA 2AXPA 5CLQA 3L46A 3FWKA 3U4QA 3PPWA 3GG2A 1OY1A 4PX9A 4YMIA 4B8AA 4M1WA 4M9SA 4CEJB 3TLCA 3ZIAD 4B6FA 4H7HA 2Q62A 2XVAA 3LHFA 4URUR 3UMRA 1GAEO 3NDIA 2CBXA 4DBLE 4F93B 3DWFA 1H2BA 1C1DB 4HGOA 3KHSA 2OUKA 2WTEA 3LHSA 3LUGA 4LBVA 3NB0A 3GAMA 3TL3A 5KSYA 1KTIA 5D86A 3WIEA 2MR5A 5KX5B 3OQVA 3N6VA 1BKSB 2ZTMA 3I9MA 2BH2A 4C0SA 3ICPA 5E7IA 4IIEA 1NI5A 4BO1A 1I4EB 2RI6A 4AKHA 5KQPA 3KAEA 2GM3A 1M1NB 1VCOA 5AJYA 4ISCA 1ZOPA 4K5CA 5A3SA 3EJWA 5JQGB 5A7HA 1KJ9A 2JJQA 3IEUA 4Y2XA 4HOQA 1W96A 1EVQA 1W5TA 3NUZA 1Y4ZA 4GNKA 4PHTA 4UWKA 4TV8B 3ZDBA 3PREA 1TW2A 1YHZA 3GEHA 2E5FA 3GNLA 3H87A 3C7CB 4MR7B 3KM0A 4K9NA 2H4FA 2W6JA 2JLAA 2GPAA 3QE0A 4L4YA 2DEUA 4LUNU 1Q19A 2Y1FA 4EPRA 1IPEA 4BYMA 3D0RA 2WIJA 1LB1B 1P5HA 4E5DA 2A4KA 3NDPA 4P3XA 4AF8A 3I4GA 4I5GA 4Q4CA 3FTZA 4EHIA 1PCXA 1PD1A 3AAAC 1KAGA 4IYJA 4YUVA 2BISA 1E2DA 4FIZA 3W1WA 4QYXA 2WSIA 2P41A 5BR7A 4Z1MD 1P7PA 1SIBE 4CEJA 4Q4AA 2CB0A 4Z9AA 1AV6A 2HA4A 2YN4A 1J20A 3Q7EA 4XTCS 1YE5A 1FPQA 3GA5A 1SHUX 1L5FA 4ZODA 2GWHA 3HVJA 3TIXB 2O6LA 3EGXA 3U4MA 1XTIA 5ICSA 3PE4A 3G13A 4X84A 2E6KA 3DMNA 4ZEMA 1ZXLA 1HXHA 2AUTA 3DFKA 4HUQB 4WW0A 4B35A 4ERXA 4DDUA 5C5DA 2H5EA 5JYBA 2NNWB 3X2QE 3PDUA 4EJSB 2WQHA 4Q34A 4XRGA 4PC3A 3AEQA 3MAGA 1W0JD 1OI7A 1K7YA 1Z8HA 4OK5A 5K3CA 4B75A 4D4JA 4FZ5A 3M5CA 4DILA 5KHOC 1SWWA 2E4XA 3AUUA 3V4SA 1IHOA 1N25A 2ETXA 3B3FA 3CE6A 1LQUA 3I28A 4X93A 1SUEA 3C3QA 3ROEA 4TRMA 5F2EA 3WLFA 2XGSA 2B4RO 4LJ4A 2YWDA 3PXXA 5EZ5A 4RK6A 3FPAA 2ZITA 2QUHA 3HYLA 4X8LA 4PN3A 5AFSA 1PD0A 5EX0A 3G88A 2BFFB 4QUKA 2O8FB 5EJFA 5EJ2A 1BFDA 1FEZA 2W98A 1U7DA 4GM1A 5BN3A 3IP5A 3M6IA 3ZXXA 3OIWA 1UXGA 1A1SA 2PQ6A 1VLMA 4QUJA 4M1ZA 2W2KA 4DHWA 4YUYA 3H1AA 1VMAA 2PT6A 5T57A 1E1LA 5BRJA 1J5EB 4ACBA 2BFEB 3QEBZ 3Q9NC 5AYVA 1RZ4A 3N2KA 1JNYA 3BIJA 3FBTA 3TOCA 5BMVB 3KEOA 4AP6A 2QYSA 2PPVA 4NG5A 5AW9A 2OTCA 3GRZA 3H5TA 4HB3A 2PBZA 1WDYA 1SU7A 4DCMA 5BUSA 5IYZA 5CD1A 2C94A 3PEWA 3NOVA 4V39A 1HLGA 2VTDA 4KVAA 4UCXA 1G8YA 3SZUA 2ZI3A 1TJYA 1TNBA 3A9RA 3GXOA 4HGYA 4NARA 2QMEA 3IE0A 1XTKA 2J0UB 4AYWA 3CRRA 2X0JA 3EXAA 2QVBA 3GFQA 2Z2XA 3WHKA 4B31A 4CG3A 4EJSA 1KY2A 2RGRA 3ABKE 4OHPA 1I4OA 4D81A 4L9WA 1Z4MA 3MZLB 1H3FA 1R4NA 2JJMA 3AESA 2DCUA 1W73A 1XA3A 1SC4A 1T24A 1WCIA 2BMAA 2WV7A 3N0VA 3QVSA 2AMFA 4MRNA 1DWUA 1FJHA 1UINA 2G80A 2GPSA 2VLBA 3U64A 1QH8B 2HK7A 2ZCUA 3L7MA 4JWKA 3W05A 4Y2HA 3TQOA 2MOWA 3C1AA 3QBJA 4C0BA 4BO7A 4BEBA 4W9RA 4H1VA 3UMGA 3NM4A 4RMNA 2AFHE 2X9VA 4CEHA 1JSZA 4KBGA 5JD3A 2A14A 1M1ZA 2Q5OA 3DVRX 1RWNA 2GUWA 2L2QA 1JDNA 1X14A 4Q18A 4IUBS 4ZT5A 4EVRA 4CXMA 1JHRA 1TVKB 2XZPA 5BN3B 2PRZA 5E6SB 5C0OE 3REGA 1F0PA 3HB5X 5IK2D 2ACKA 4MWOA 3E22B 3OUZA 1Y1SA 3IVAA 1E2IA 4EY3A 2HFJA 3AYZB 3DGFC 4OBEA 4MQMA 1KTVA 2XUAA 4ER0A 4L76A 5GP1A 4A8HA 5LVAA 1GFIA 1YD7A 1BYIA 3I1JA 5IN5A 3ZXUB 3QKRB 5K8VA 4B6SA 1YRAA 3WTCA 5JFGA 2UV8A 3U3JA 4UHEA 1ZGBA 4TUUA 2D0PB 4ID9A 5B37A 3SZLA 4BRSA 1H22A 2YZMA 5B1HA 3G1UA 5CPBA 2HPAA 3V00A 4QRHA 4A0HA 1LBSA 1CFJA 2BLNA 3ZY3A 4IEEA 3ZU2A 4X62B 3OE7A 3E37A 1PSDA 1L5MA 3L43A 1T3HA 1U80A 2BC9A 2DKOA 3KYIB 1X1TA 2OCIA 2BZGA 1T0PA 4KR9A 4HRNA 1WZ2A 3W5SA 3SS8A 5I9NA 4DEXA 1CR1A 2E37A 2BEWB 4QBFA 2W0SA 4QZVA 2Y66A 3APCA 1ENPA 1UP6A 2CUNA 3CLTD 4YLGA 5FQNA 4AJIA 4DCPA 3JZIA 1GT6A 3LPCA 1CQWA 1FLNA 2IY7A 3ETCA 2PS3A 4E2ZA 3V97A 3RAEC 3H2KA 4OPMA 2Z3VA 2I4NA 1V4NA 4ZXFA 1VKHA 1KKLA 3K6KA 1T15A 1ZGJA 2RJNA 1JHPA 4L75A 3TINA 5FTWA 2QZ9A 3V42A 2E4WA 1RS0A 3G82C 1T2NA 4GICA 1EG2A 4DIFA 2D5BA 3ELYA 3V2XA 1IN1A 4HDRA 1Q0PA 3Q9LA 4R1QA 1VHJA 2UZIR 3HO8A 4PNHA 5KWEA 1RJ9A 1A82A 1E58A 3PDCA 3I2JA 1B93A 4XJSA 4UJ5A 5JAOA 1ESEA 1DARA 5CDUA 3O1IC 4D3ZA 4I1MA 1WXDA 3QKSA 4QYMA 3FSGD 1MB4A 2DY1A 5GVRA 1P5FA 4HLDA 1GCAA 1J22A 1PK7A 3PC3A 3AR7A 3K5IA 5GONB 1QWSA 2NU8A 1NZNA 2QT9A 4IDBA 3KZOA 5SV2A 2PX2A 3ZYQA 2HB6A 4HYTA 3LUJA 2JGNA 3QFRA 3UJ8A 2YH2A 4C2AA 4CUJA 5CNIA 3DYVA 4JEMA 1FNCA 3VTAA 4P7GA 3L7LA 1LS6A 3RRJA 1PF7E 1QV6A 1RW2A 2W7TA 4L7VA 2R86A 1VL0A 4NMWA 5CT9A 2XTAA 5E6SA 1ECCA 5CB4B 3DF9A 5TPWB 1YMUA 4C7JA 1XNQB 2D5AA 1SHTX 4Q7KA 4EB6B 4NVRA 4IMPA 1AGNA 4MUGA 4BVJA 1J0EA 1DQYA 2FSPA 5AJZA 5SZJA 3W34A 5M5BA 1O5TA 1K1AA 2HSGA 3ZWCA 1ZR4A 3DR5A 1CUSA 4LE1A 1O6CA 2WT8A 2P3LA 5CERB 3EVTA 3JVEA 4OK6A 5JEEA 5FINA 3AKEA 2CG3A 2MRIA 7REQB 4L3WA 2F67A 3QM1A 1JV2B 3TG5A 4U02A 1U0TA 1UBLS 2R6CA 4R05A 3VKWA 5BNWA 2YQ4A 3FY4A 4KBQA 3T94A 4C4YA 1BOFA 3G5TA 1ORHA 3KSMA 4C03A 2Q50A 4ZRNA 5KVSA 3KB2A 1NBOA 2B0OE 1C81A 3PNLB 3AVQA 3CW8X 1VP3A 3CC8A 2J59A 3FDZA 4QEDA 4AG5A 1PJBA 3HO6A 3WIDA 1F8UA 5I51A 2HYIC 2X6JA 4NH4A 3C70A 1OKKD 3L6RA 2JFBA 2HTFA 2Y67A 3HWWA 4Q69A 1JKXA 1W3BA 4RV5A 1YONA 5KQRA 1QPZA 1MP0A 2IPLA 2IKSA 5TQ0B 4WY2A 1K7FB 1HL7A 2VSYA 1M1YB 2BPOA 4PRLA 5DBEX 1CERA 3GZJA 3U17A 1JDUA 2BD0A 3EFOB 4ATGA 3S7DA 4MPJA 5ECYA 1FYVA 3TNDA 4PU0A 5AXDA 1QZUA 5FZSA 2WB2A 4CM5A 4L51A 1CTQA 3CPSA 3CSSA 4RVCA 4BKQA 5IXYA 3U09A 4QLOA 2BLLA 4IRUA 4XH9B 2BKXA 5HJEA 1B15A 2DBQA 2V55B 2I6XA 3H4VA 3QKTA 4IYRA 4YECA 2OK8A 4MQ4A 5KNBA 3HK2A 4US0R 3IAEA 2PMWB 4PO8A 3TFQA 2RGGA 5EKQD 1BXGA 4KMOA 1SD2A 2VNIA 4BNMA 6ADHA 2B9VA 1MZCA 3HXEA 2ET6A 3ZY2A 3CT6A 1UKAA 4JVSB 2EIJE 2FPPA 2ZAMA 3OFNA 4RKRA 1AZTA 3IAFA 3ROGA 1JYFA 2ZIZA 4HMPA 3V4PB 4IO0A 3WV5A 1BCSA 2B1GA 3JVVA 4QARA 2MSDB 4I9GA 1YFKA 1QANA 5J3JA 1ZSYA 2UU9B 2O19A 4TRQA 2WJZB 4L8YA 4QTZA 1RWBA 3SNKA 1SUIA 3FPJA 5TMDA 2P2CA 5C1PA 5IVKA 3ULKA 4QBHA 4KREA 2RBKA 1E2QA 4UU8A 2JBAA 1C7EA 3OECA 4AP5A 2DUWA 5CDSA 3HJFA 2GBLC 5IVHA 2EL9A 2C2YA 1A5SB 4U0SA 2DZNA 1K3FA 4UPDA 3H5WA 3HWX1 2L0IA 3RCBA 3ND6A 3CR8A 4P82A 2Q4EA 4RO0A 5BXOA 2ATEA 2QXTA 2G83A 1F3OA 3C16C 2O1XA 4JUIA 3RARA 5GZ3A 1CQIA 3I04M 4U5XA 4Q9AA 4C20A 4GIBA 1X3LA 4QEKA 3QX7A 2L19A 1D9ZA 4MRUA 4BPRA 4H7KA 5FCDA 3G9UA 1PJ4A 1ZGCA 2HEGA 5EJEA 4I6JA 1GQOA 2EKPA 3LNCA 1WL8A 4O3MA 4IMJB 5CX4A 4URHA 5TVKA 1Z2NX 1L0BA 5LSAA 1SU6A 1PT7A 1J7KA 3CZ4A 3QK7A 5ECDA 1DIGA 4QHSA 4ALJA 4BJ6A 3IA7A 1N6NA 4MWGA 1PUJA 4TMVA 2HAEA 3THWA 2A1IA 1N34B 4FHGA 1N8SA 1BEZA 1XVLA 1P0PA 1HQCA 2HYDA 3D6NB 3K31A 3LP5A 4KEAA 4URZR 3UHPA 1C8BA 3L79A 3W3AH 4E88A 4DDTA 3ORQA 1ODTC 2LE0A 3M5PA 4CFYA 4DLWA 3R7QA 3PD7A 4N6GA 4NOJA 2QK4A 4CUKA 2M9MA 3EDRA 5B2ZA 3DBHA 1CS0A 4JASB 3WXBA 1C1XB 1S2IA 1QS0A 5FQ6A 2D1FA 2D2FA 4LC0A 1XTUA 2G40A 2GEJA 1EZ4A 2I2BA 4ZZ3A 4E5SA 1YNOA 1HFAA 1X7YA 3N8DA 4CIVA 3QFSA 2JGJA 3EOZA 4ES6A 1UKBA 3DG9A 4L08A 5IVDA 4GTRA 3BGOS 1ZJYA 1E66A 4RMHA 1ELKA 1FCJA 3T5DA 1XZFA 3PHCA 2A33A 2JEKA 1Y80A 3FMOB 3Q7PA 1Q74A 1MIHA 2JDID 1VYVA 2X7XA 4KXQA 3R76A 4AOFA 3HUTA 1UQTA 2OZLB 4HDOB 4N6OA 3DPYA 1QZXA 1W5SA 2FY8A 2GN6A 3LPNA 3VMMA 3GUZA 3ZNNA 4DUYB 3ULYA 3QUCA 3S8EA 3EQ2A 2AFRA 4C6TA 4M60A 3EB9A 4CKEB 3DKVA 4B8YA 1E32A 2X9QA 1P9RA 4EVIA 1RFLA 2R4UA 4RVDA 4GLLA 1FCHA 2Y1OA 3G79A 2HU7A 5A4AA 1PGQA 2OHFA 5C7OO 3NHMA 1T8SA 1Y42X 3HG0D 2VAPA 2IF2A 2IZ1A 1Z3IX 2QTTA 2Z4SA 1Z0SA 1YJ5A 3MQ4A 1QIJA 4W7IA 3ZWKA 5CK4A 3G68A 1VPVA 3WG7E 3E35A 3GCZA 2ZIUB 4BVAA 4MP6A 2WXHA 5ES3A 4CPDA 2JHAA 2O2CA 3UUEA 1SUSA 1U99A 3L7KA 3AVTA 5CCXA 3PWZA 3MJWA 1J0CA 2Q3BA 4HYQA 3ZY5A 3PUXA 4E94A 4F38A 2QBYA 3QUBA 3HYNA 1ZMTA 4JXJA 4NJOA 2W6CX 5J9FA 5BVHA 1GUZA 3A1WA 2WVGA 5DT9A 5C8DA 3OHPA 4N9WA 4F4CA 1G2OA 4KP7A 1BHSA 2GN9A 1X7YB 4CKBB 2QUKA 5F7XA 1QYCA 1GZHB 2TMKA 2VHVA 2QEQA 2Z8YM 1HTWA 5FZQA 5BV0A 1D6MA 4KO2S 4RVUA 4BNUA 3ZWXA 2J07A 4FD3A 5K0TA 2CMHA 3DPIA 3EAGA 3JVIA 2ZUCA 2ZATA 3N0XA 4MUNA 4MKRA 3ZLUA 1N2GA 4EYEA 1N6HA 2PE5A 5L6LB 4QDXA 3E22A 4DFDA 1XZNA 4FEEA 3V55A 4HVLA 4PPFA 2CWWA 3O4RA 4C4ZA 3HKCB 4FCWA 3RPEA 4BDSA 4DBZA 4RA9A 1ZJWA 1Y1LA 1ORVA 3UA3A 3DWIA 1Z07A 4MVWA 3TKLA 1YZKA 4M6WB 2CWDA 4YV1A 2HA3A 1P4JA 1M73E 4FKBA 4MROA 4N7BA 2R44A 4JYCA 1EFRA 1GPNA 2PV0A 3OU2A 5L7YA 2NX2A 1VHTA 2IUFA 1EH5A 3QGMA 3EZNA 4L23A 3TWSA 4HZUB 4QPZA 3TLBA 2OXFA 4D74A 1IPHA 2O7SA 5B6JA 2X38A 4ISBA 1NJ5A 2IZ6A 3IHKA 4R8MA 1XVAA 1Y7PA 2GZAA 4KQWA 4XKCA 1OZHA 3EBOA 3L1JA 3HYCA 1NMYA 1DZ3A 1N1MA 3D3QA 3QUSA 1EDDA 2R5FA 5KC8A 1NV8A 4LQLA 4I4TB 4XUDA 2P9BA 1MH9A 4B73A 1FTGA 2W8ZA 3PJDA 1O96A 5AWFC 5IZCA 2QYUA 4N82A 2P9PG 1YZHA 4DW8A 5SYAA 1MX3A 1ZGHA 1NVDA 3D3NA 4G1FA 4POAA 1DAOA 4Q01A 3SFZA 1V5FA 2YZ7A 3C5VA 5DVZA 3T1QA 1ZU5A 4MW2A 2RI1A 2XXAA 3WK6A 1POXA 2RI0A 3EDCA 1KWGA 4XCXA 1RHQA 2HM7A 5L4SA 2Q6KA 4XJTA 2Y1XA 2VZLA 1Y8RB 3GMDA 1DAEA 5HYVA 5B1YA 1GDHA 2WXNA 2AOVA 4N76A 3WLPA 3DO5A 4KGXA 4X92A 5FTNA 3RUEA 3UAVA 3RUCA 1ADFA 2DLDA 3MQ2A 4KXFB 4UBIA 5HHTA 2IEAA 1RYEA 4S2UA 3L2OB 3IQDB 3ZHZA 1EGMB 3W5JA 4EHJA 2P9YA 3ULQA 3HWSA 3HCOA 3SQOA 4ZICA 5FH9A 2AYZA 3QI2A 4JL0A 4M8NE 2IPAB 3EXFB 3N2ZB 1Q1GA 2BFFA 2JAQA 2IE0A 1YCHA 2A3NA 4JB2A 4OGGA 4C7VA 1R37A 1FRNA 2G08A 4DCOA 5A6SB 2XPCA 2CNWD 4HO1X 3CHOA 2PYZA 1DT5A 3B60A 3RAPR 2VJDA 4KPFC 2EBUA 3O38A 4J0CA 1SR8A 2R6GA 3VKUA 4JLUA 5H80A 4CMIB 3AL2A 3H1TA 2YY5A 5FYQA 3SEFA 3AM5A 1M2NA 2XMRA 4D4LA 1V8DA 3DVAB 2XB2A 1O5MA 1G5QA 5CBPB 2VPPA 2B7BA 3RSZA 1T8PA 3IEMA 3LF2A 4PXSA 3AVYA 1DCQA 2ADFA 2CLCX 3A6KA 3FA2A 4GYKA 4M0UA 4MRRA 4OYLA 5LMCA 4DIKA 3W1VA 1DXYA 3FPGA 2RGAA 1XAHA 1U7PA 1Z2OX 4C7OA 1FDUA 5L3QA 3OEWA 3EEFA 4FOOA 2B1RA 3AG1E 5UKDA 2GYWA 4M4SA 4WINA 2XQKA 2Y68A 4JOBA 2FPIA 3LK6A 1K7XB 2ODNA 2YCBA 3K9GA 3FMFA 4N6NA 3R7NA 3N8IA 3U56A 2PQMA 3SZ3A 1R15A 2K2WA 3RG8A 1KO5A 4CF3A 3SZ7A 3DL0A 1KVQA 4Q48A 3U2QA 3LO8A 1O03A 4QPCA 3HA7A 3V6MA 5K0JA 4H1TA 4KDCA 1BW9B 4UPVA 4BO3A 3KPYA 3ZHYA 1PJQA 3T0IA 1ONPA 4DB4A 1HQKA 2BBTA 5JCPA 1VG0B 3G2OA 4WGFA 4WL0A 2GW1A 1LPSA 4BQOA 1E2PA 1PDWA 2P40A 3H3JA 3GFTA 3L1HA 4A6DA 5EI5A 1IM2A 1XP8A 1WD5A 2VR1A 2GHQA 4GM0A 4YJGA 5JMPA 3X3HA 3CONA 2CFCA 4CDMA 4JI1B 1J0AA 4NBNA 4AT1A 1IJKA 3W5DA 4KBYA 3BWCA 1U7TA 1SG9A 3VDRA 4OLBA 4EMUA 1M2KA 4M0EA 5D2MC 3H86A 4UHFA 1I4TD 2I7VA 1A8HA 1BWQA 3T99A 3W2GA 3AV3A 1A17A 3QW2A 4TKMA 1KQFA 4WFKA 3QHAA 3NTXA 5LBTA 1EVIA 2YZ2A 5J5VA 1GQ2A 1PNRA 2D1TA 2YN0A 3L22A 3E5MA 3G1TA 4JI0B 3J7AC 3JQPA 3WNDA 3X1MA 2PX4A 2OK7A 2VK4A 2DQZA 4ZC8A 3AIKA 5IAKA 1ZINA 2JKZA 3UTDA 4MYHA 1SU4A 2PXCA 1Z0FA 1VKNA 2QD1A 3MT9A 3FHEA 2KB0A 4OJTA 2VKTA 1XKLA 3ZDXB 4C88A 2W6MA 2CSXA 4O4IB 1FMCA 4NF2A 4RXUA 3ZHBA 3ZW9A 2Z95A 1EIWA 3W5IA 3NIDB 2P1DA 1H4QA 4WPGA 5L3ZA 4PINA 4EZEA 2WUDA 1C1YA 2KHZA 1PQUA 1U0GA 1VTKA 3RSOA 4WA8A 3GJSA 5KYUB 3EGOA 2X4LA 2I2WA 3QK0A 1L9XA 4FX2A 4QYTA 3SKVA 5FEMA 5KYVA 4QU8A 1M67A 3MLEA 4NRHB 1RXVA 4MDHA 2WIGA 3DXFA 4EEKA 3AR2A 3T5VA 3GRYA 2JVKA 3AHJA 4GXTA 5KJCA 1JJFA 4BKOA 4RMIA 4ZA2A 1XN4A 1HEIA 4Q7EA 3UWMA 1QRSA 4KQJA 1EK0A 1W19A 2QZ4A 3E05A 3H8JA 1G0NA 3OC6A 1QU3A 3HRKA 3ESYA 1WETA 3W6UA 1LRLA 1WXQA 4N5MA 1Q1BA 3EF0A 3MS4A 5EEGA 3VO8A 1DEXA 3L6EA 3RHSA 3OTQA 1N3LA 1JFVA 2FWNA 3VISA 3ICWA 2PUEA 1AZLA 1Y48E 3RFFA 2YXEA 4OHCA 3TPFA 2ZRJA 1IHPA 3L92A 3OQIA 5REQB 1W2GA 4DQVA 1M1YE 2C29D 2Q4RA 4Y0VA 5KBAA 2WSSA 2ZBUA 5CJ2A 1RWVA 5CNMA 1YJAA 1T5DX 2RGUA 3R20A 5IDYA 3S8YA 1UPBA 1AUVA 4ZKEA 1H8EA 2BY4A 3A9VA 2FW9A 1T9BA 3JR7A 4R31A 4WVLA 1EHIA 2P62A 3STTA 3VHXB 4MWSA 3GD7A 3ACCA 2ZETA 3B5JA 1J06A 3PFIA 3K0EA 3EHNA 4JUFA 3BMQA 2R6JA 1G5PA 3K0FA 1DBQA 1YASA 3NVMB 3TAHA 2OM6A 2RFAA 1NLYA 4JL6A 4CTMA 1X7XB 5AT1A 1EUCB 1A04A 3NJRA 4X8QA 2Y99A 1RHUA 1TMGE 3G2MA 3MIZA 4YA6A 3KQYA 4UE3S 5INTA 3VUFA 1OH7A 3GW8A 4KWTA 4RETA 3VU8A 1W0KD 3BTOA 5J63A 4OP3A 3IPRA 3AETA 1M0TA 1KNQA 4RJIA 5HS4A 3SVTA 1LSJA 2FB9A 4FP9A 4XWGA 3UV7A 1FTSA 2Q3MA 1WXWA 1QP0A 4H7IA 1CDZA 2GRNB 2CNOA 3AONB 2Q7OE 3RWBA 4TRJA 1GLNA 1ZN2A 1QYMA 3LAWA 5KYXA 1L9KA 3GUCA 4FU3A 4M8SA 2IUTA 5E4TA 1F4LA 4JLSA 5T64A 4EW1A 1G41A 5KI6A 4DIBA 4AROA 1A5BB 1WDLA 2RH9B 3B1YA 3Q4GA 4PZCA 5EXTA 4AWBA 2D1QA 3V5NA 3ZDRA 3AB3A 1SXGA 3RC3A 1KZPA 4UNSA 4TXNA 3WGQA 4FEGA 3LY9A 2PKRA 3PGJA 3DBIA 5LP1A 1ES9A 1I32A 1YAJA 2C1ZA 3F46A 1ZZEA 3LMKA 4FYWA 4J1TC 4Z2YA 3VA7A 3GJ0A 5ANRB 2MYNA 2RHGB 2OFWA 2R1TB 3M4XA 3MV2B 1ZC4A 3TIFA 3JYNA 4LRZA 2RIPA 1B0ZA 1S9DA 1V1RB 4MTLA 2QT0A 4ZYWA 2Y4UA 1O54A 2ZYHA 1OZGA 2J9RA 3EXHB 4NJEB 2M1XA 2Q9BA 4IILA 4WZZA 3U9SA 3KXDA 1UT5A 3ANYB 3LPAA 2WWWA 1F7UA 3LWZA 3CH6A 3Q47B 2XZTA 2AK2A 3ENZA 2OV8A 3D0KA 3IA2A 4LBYA 4KQ1A 4P0QB 1ZN9A 1XA4A 4JJIA 3T3MB 1RIFA 4K9MA 1EM8B 4KQFA 3V8EA 4D44A 5IDWA 5HOEA 1QO7A 4ATZD 2WKPA 4DM3A 5KNLA 1QQ6A 2W6OA 2X7HA 4LRYA 4CMAA 4QDZA 1RYYA 5T7BA 4ANXA 1RYDA 3CU5A 4HQ6A 4DTIA 2XAUA 3FDHA 5HP4A 3CZ5A 4BZQA 5FFFA 2EHJA 4IQ4A 1MJGA 5DHPA 1WNTA 1USUA 1V7ZA 2P27A 2I87A 5EX3A 3NTQA 4Q4DA 1BRMA 4O2LA 1XRSB 1U0OC 1U04A 3L4BA 1QZ3A 3CXRA 2VP2A 4TKVA 1YA4A 2HZ7A 3PRJA 3TSAA 1UWVA 4MTCA 2Y0CA 4WZBE 5E2IA 3CNEA 2EYQA 1LC3A 521PA 4MRVA 1VB3A 1TO6A 2SHKA 5L7TA 2RG1A 2XS1A 4PS8A 4HTFA 4O2BB 4TTPA 4EYGA 2ZYAA 3FE2A 2GNPA 4GUAA 2Q3JA 2YQ5A 4ASUD 3IBEA 2GBCA 3KT8A 3LSYA 4IQ8A 1Q57A 1IJBA 1JEJA 2YWGA 1WCXA 3C8MA 4IIXA 1P7CA 4IIUA 1Q0TA 1C8KA 5ERXA 4AG6A 1E9BA 1PEKE 2XNSA 4L5BA 2WG0A 4I4TF 2P4EA 3RUIA 1CG6A 2J3KA 2P9KG 1X9GA 2CUZA 2VF5X 4ZJPA 1PZXA 3ZE1B 5BN4A 1RRVA 2JI7A 3BFJA 3FJYA 3MT7A 2VHTA 2XCQA 2Z43A 3TLXA 1DG9A 4F2WA 2YIVX 1SEVA 1E8XA 2B5OA 4BV9A 4EABA 2XDYA 3KC2A 4O02B 5A4JA 4MV6A 1H4SA 3AY6A 3E9YA 4URVR 3NETA 4ZTBA 2JAHA 3UMFA 4KO3S 5G0WA 1EI9A 3BIOA 2HEIA 4YRGA 1ZNWA 3Q98A 1MV8A 5CA0B 2BUBA 3F9RA 4U7TB 2CJWA 1BX0A 2ZRDA 3S7BA 1O2DA 3O90A 3FLMA 1OI2A 1E5VA 3PVSA 1T4CA 4KV7A 4QGBA 2PZLA 2OXCA 3B7WA 3TGOA 3GT4A 3LW7A 2F8YA 3ONNA 4L8VA 2GAJA 1G6OA 1WABA 4X94A 5FYDA 4B45A 3JASB 1UPTA 3CZQA 1KIMA 1RWWA 1E3EA 4FYVA 4KAJA 4XDYA 3QH4A 5F52A 3HNOA 1W5BA 3AFMA 5D66A 3LJKA 1NFQA 4G63A 4I5IA 2BAGA 3CZCA 1RRKA 4Q1DA 4GPBA 4KX3A 4GKJB 1ST3A 1YQEA 1DRWA 2R1VB 4RZ2A 4AC9A 4FMCF 5KX5A 2ZBRA 3LNTA 4F91B 4L0QA 2Y4NA 4A0FA 2W4IA 2Y6UA 1G16A 4LYHA 4CRWB 2ANBA 1U3GA 4XYGA 2B2CA 4W1SA 1BS1A 1F8FA 3IT0A 2F62A 2WTXA 2PSFA 4R2KA 3D1LA 4EVSA 4D6YA 2P9JA 3ZH9B 3OZUA 2PVSA 3FNBA 4EHFA 4JT8A 3DDNA 5E38A 1H93A 3SC6A 4MLCA 3MYRA 1G21A 1D04A 2QV7A 4GSLA 4OJMX 2I3ZA 1IWBB 3H6KA 4L50A 5H81A 1T4GA 1XXHB 1YBMA 1AZSC 3GW4A 1SD5A 2DPHA 1KI3A 1DQNA 1NUQA 1XDGA 4CNQA 5KEIA 1JPJA 4FYPA 2CJXA 4GZ6A 4P38A 2PX0A 5ALHA 1I5OA 4GOOD 4BGEA 4J8FA 2AE2A 4HEA6 4EGAA 3TQRA 1RWPA 4MVCA 1KZ7B 4E0BA 3QE2A 1OFGA 2O0MA 3VTXA 1PAUA 2B6CA 2WNSA 3E3MA 5EJIA 5KJLA 2AI2A 5JJ6A 3E7PA 3HXTA 1OLSB 1KHTA 4TTQA 3V7UA 2FMKA 5LU8A 1QZ2A 1VGVA 2NSHA 1LTQA 1OLUB 1E1CA 3DH0A 4FLHA 4MKZA 5J2UF 1CUDA 2Q1XA 1KAEA 4YAIA 2QF7A 2ZE6A 3P9XA 4HDKA 1I10A 3U0BA 1VPWA 3BG5A 3R7AA 1QTIA 2WC1A 4RG6A 3THRA 2ZBVA 4X1IB 1BDBA 2XE4A 4TS1A 5CVUA 5FF9A 3RRXA 1QLHA 5FZRA 2CVHA 4BO9A 1GQFA 1BFUA 2DUMA 4HSGA 4PZYA 5FIUA 3TSZA 4MVJG 3ZCVA 4DWOA 4E4YA 1KOGA 2NVUB 2V5AA 4ZT3A 4X1OA 5J90A 4MVXA 2H54A 2WUEA 2JGRA 4KXWA 2W83A 4M9UA 3ACDA 1W5AA 5C80A 2HT1A 4HAWA 4HDSA 1OIWA 1KNXA 2XAAA 2PU5A 3SMVA 4CIXA 2AMVA 3Q9NA 4ZYUA 1A9TA 3GWZA 1NBAA 4BYGA 4R1TA 3HB9A 4F4IA 2WM9A 2PKQP 3BGDA 4WGGA 3DO8A 4DCSA 1EESA 3VNUA 4ALKA 2G1UA 2BTEA 3GB9A 4B3TB 4XVRA 2BDEA 5M34A 4EFNA 1TYEB 2OHVA 2HU8A 1G8KA 3OU6A 1U8CB 4NE7A 3RB8A 2KXPC 1R6XA 4AJ9A 4RJJA 3E48A 2VJKA 3GJ7A 2AVNA 1PFKA 3EQ8A 1AP7A 3DHNA 3DRAA 4IRMA 4P33A 4BCBA 4JEHA 1MO4A 1J0DA 1EVZA 2BFEA 4RHCA 3WGHA 4LPKA 5THKA 1KFEB 3VTYA 1GRQA 2AEEA 3AV0B 1T4DA 5DCYA 1QGED 4NMXB 2HFKA 2IZ5A 2BT4A 3FIJA 1XTBA 4UM5A 5U4QA 1M34B 1MX6A 3MCUA 1EJ0A 1HORA 3ONFA 1S3SA 1OLXA 1EP1B 3TLAA 1X77A 4IDOA 2GVDC 3T5AA 1JBEA 4ZEWA 5G41A 4AUKA 3TGPA 5H59A 1P0CA 5IAEA 4DLQA 2AH5A 1KPHA 2HPVA 3JWHA 3R24A 4HQLA 3T9CA 1W88A 3F0TA 5FJJA 3WYEA 3U9WA 2WD8A 3BWVA 4E30A 6REQA 2BJVA 3C3KA 3HJBA 5HRUA 2R8RA 3VPXA 2Q5FA 3HR4A 4OHOA 4YRCA 3WG9A 1XMOB 3Q3EA 2QLLA 3BL5A 1HZ4A 1DV2A 2YXBA 5JSZB 5L45A 4URXR 1QCDA 1CIVA 2GESA 2IOFA 3DTNA 1CNFA 1XZGA 5AVVA 3P71T 4ZP1A 5T3YA 2WMOA 3I5YA 4HDKB 3B7GA 4IG4A 4KQ2A 5HF9A 3RVOA 1XO1A 3GCXA 2H6EA 3HA3A 1L5RA 2JJ2D 3O2QB 1V5GA 3QMPA 5FR1A 1T9GR 4LNGA 3QENA 2F4NA 5TXGA 1NI3A 5JC8A 4HLLA 1RRPA 1HR0B 1P19A 1FS6A 5DOZA 5FBZA 2QL5A 1GKIA 3FTQA 1OBVA 4B79A 5CEDB 3HS3A 3GFRA 3DL2A 5LWQA 2CNNA 3B2QA 5DEIA 2DZOA 5JCJD 3ID6C 3PDIB 5ENZA 2B1IA 4LYFA 1QH0A 3CUVA 2HRRA 3FDFA 3IBCA 1FFXB 1E94E 3ROTA 4CLDA 3BFKA 5JVDA 2ODAA 1RJEA 3GQBB 3AFIA 1NNLA 2K6GA 2OC9A 4I1IA 1DFGA 1N7JA 3VR3A 4ILGA 5FBWB 4Z4IA 2AG1A 1JPVA 3RUPA 1GNVA 4CQLB 1X7WB 4TXJA 4Q9IA 4GKKB 4R8VA 2PKEA 3PNOA 3T9BA 1NPTO 1B3BA 1OT8A 3HJHA 2QZPA 1GG2A 4PZ0A 1W4LA 4CODB 1CY4A 1QOPB 2OLKA 3L0OA 2FV8A 3LHKA 4PCUA 4D3XA 1E2BA 2J6CA 4O6VA 2ZRAA 3SC2B 5FI5A 3O8LA 4NFHA 2J46A 3S40A 5ULLA 1XKXA 5ALRA 2B30A 2ZR8A 5FI3A 3O26A 2EX0A 4UM9D 4FHZA 5HK8A 4IFTA 1ZK1A 1NI4B 1B0AA 3IOBA 4BPBA 4OAVB 1HT0A 1L6RA 3M6XA 1J25A 1DT3A 1YVUA 1X1BA 1TCVA 2EG9A 4OU5A 1H94A 4R5HA 1SBNE 3QLUA 4EF5A 4LEIA 1Z5NA 2X8BA 4IVPA 4TMTA 4YP0A 4FBLA 1EBFA 3WOVA 1NI1A 4H31A 4Q6BA 5TX7A 4PLGA 2G9QA 3OOJA 4EFDA 1OH8A 3DCJA 2R6ZA 3FUJA 3ANTA 1EGHA 3KJXA 1X0XA 3NBQA 3QZUA 4I1YA 3U48A 2X6QA 4F45A 1FE8A 1CZLA 2COUA 3TL2A 3U44B 3CQCB 3FJOA 3GAFA 5FUXA 1KARA 3T3IA 4ERNA 4OAUC 4L74A 6Q21A 3C3YA 1T2EA 4OYSA 2RDMA 1BE0A 1JPNA 3IMEA 1TL7C 2C58A 3QSYA 1W44A 2EZTA 2J3DA 1GY8A 5AVSA 1SC6A 1NT2A 3V7NA 1BHQ1 1U0JA 3GNSA 4RKEA 1WSBA 5CVVA 3MA5A 1AQUA 4YB8A 1R8QA 1SURA 1IHDA 3K8YA 3PPXA 3IRVA 2EJVA 3NIFB 1SHJA 1V3QE 3EVZA 1YUNA 1A4UA 4NURA 1PFVA 4CBVA 1XLVA 2XCUA 1QGUB 1T0HB 2J9QA 3EHRA 4F7AA 2MU1A 2P5SA 2QSJA 1MOPA 2UZ3A 3ISJA 2X3FA 3EG5A 3QG5A 4UBMA 3ZDCA 4Z8YA 3T1HB 4H17A 3BXEA 3UFXA 1WXIA 1YI1A 4KTTE 4YPOA 2XPIA 3ORYA 3VO2A 2OVBA 4J43A 1TEZA 1CF2O 1YHNA 3C4QA 2A94A 3Q7SA 4HGPA 4I8XA 4BNDA 1KI8A 1FYDA 2L42A 4G89A 3TTUA 4C0MA 1T8WA 3DSXA 2WVHA 1YMVA 3ENKA 4L15A 2NYUA 4WLUA 3SDZA 2QLFA 2R5NA 4JJ4A 1PLKA 4N7MA 2AG8A 2A9JA 3MOGA 3KT0A 1CQIB 3ZUPA 4CDGA 4RF4A 5FTLA 3AU4A 1WE2A 2FEOA 2ZT6A 4AIIA 2X6IA 1F0YA 1F14A 4XJVA 3V8BA 1Z15A 1QHNA 4L57A 3MX3A 5FWQA 3U80A 2Z1DA 4AV7A 3HDQA 4TXMA 3WYNA 4B1FA 2IPNA 3FNFA 1KI6B 4JLJA 5FA6A 1ZZGA 3LLMA 5K8JB 2PXAA 3R0JA 4BO0A 4FULA 1JMYA 3LA6A 5I9IA 5BSTA 2WWIA 3WGIA 2AUMA 5IANA 1I33A 4FXOA 1AS2A 3UC5A 3D7SA 1L5ZA 3MJVA 3WTBA 3CIAA 2ID9A 2ZI6A 3WMXA 1I1QB 3IEIA 3K9WA 1JCSA 3FWZA 1C3LA 3PGMA 3ZDQA 5JR3A 2C4TA 3B1ZA 3QWFA 1AKNA 4UWGA 1IZ7A 5U1PA 4IXMA 3GU3A 3MMSA 4YRAA 3AR8A 5JWHA 4ZZ0A 3RRYA 3SLKA 4C0LA 2PZKA 3AINA 1I2CA 5FA5A 2RHBA 5IBCA 2UUBB 1KRHA 4HQOA 2ZRHA 1R0ZA 3OE7D 4PSCA 3NOXA 1JHUA 3TK1A 4EUHA 1E9DA 1DWPA 3QIVA 5BYBA 5CRVA 4UAUA 1EA7A 4TV3A 4MJLA 1UKCA 4RTNA 1JG4A 3Q7QA 2Y6VA 3B8HA 4U3JB 3SE7A 3DHWC 4G0YA 2KJQA 1C7JA 1E4VA 3B3GA 5NULA 3WRYC 4BUZA 4NCNA 1L4LA 1AD2A 3G49A 2IHBA 3BWXA 4Y6GB 1WXFA 2FR8A 2ZJ1A 4ZVTA 3ZI4A 5A4DA 5MF6A 5KTPA 3MWDA 3MKQA 1L8XA 2ZCVA 1A96A 3BQNB 3A6JA 3NBAA 3AO0B 2GCPA 2AQ8A 2MIIA 1GNTA 1QP8A 2BMEA 4YRJA 2VJYA 1LPOA 3IESA 5TEVA 5K3DA 4YVFA 1Z73A 1MABB 2IHUA 2ZSUA 1Y6QA 2C31A 4LCEA 4CF7A 1DX6A 4W5RA 4J8SA 3H4MA 4JUAA 4TXQA 3ASHA 2IBTA 4WESA 1BXRA 4PQEA 3WDSA 3WZ2A 2JCBA 3ICVA 4DJDC 1CVLA 2FXIA 2IHZA 2NT4A 4OMUA 2FUKA 2WHPB 2XPYA 1KJQA 3FUUA 2RH4A 4BUJA 1WUJS 2CEAA 5JANA 3WLAA 3OQOA 1GPMA 2GCEA 2G67A 1Z47A 4TLLB 4Z0PA 5IG2A 3ZWPA 2A4ZA 1DVPA 3QMVA 4DRXA 3GLGE 4RA6B 1JW9B 4NLLA 3UI2A 3DSUA 2IYLD 2NU6B 4KL8S 5BMVF 2CK3A 2ZYRA 2NV6A 1QO9A 2X9GA 5BMVA 3WJAA 3U6BA 4KN9S 3BFPA 3LRTA 5C8YB 3ABSB 3NQPA 3DE4X 3K9LA 3ORRA 2H52A 2DBRA 2L0XA 5G3ZA 5J2TF 1OMOA 1UBOS 1OAOC 3F5QA 4G11A 4YAUA 1ZM3A 1B23P 4PZ9A 1GZ7A 1RWKA 2QVCA 1UPAA 2PZGA 3VR5A 2CUTA 2QN2A 3K92A 2NOAA 3R5TA 2G17A 2AEJA 2CDNA 2I7CA 3AEQB 5J5CA 4BNWA 1U63A 1FW6A 4PBRA 2JJ1D 2ZWVA 3O8QA 5ALPA 1X1SA 4DV6B 5JYDA 4U04A 1OWMA 1KETA 3HPQA 1FNMA 4KTVE 3CPJB 3DZKA 3ESBA 3V79K 3INGA 4MWBA 1P5RA 3ABOB 1L5SA 2PZJA 1ZRSA 2XE8A 3W3AA 1PKEA 3AIOA 1E3JA 2OAQ1 3PQ5A 3R7WA 4BLSA 3BULA 3CLJA 1HT1E 2QRUA 2CNWA 3E5RA 3EGWA 1C0PA 1HA3A 4GMRA 1P4GA 1I5EA 3M3DA 5AVOA 1TNYA 2F43B 5K3FB 2A5JA 1ZM9A 4ZVUA 1ZNYA 5EJ7A 2BKUA 3A32A 3E7XA 2BMDA 3HNRA 4J3FA 1L7BA 5B4TA 3BDIA 2ZRGA 3KAQA 3PXCX 2AW6A 1JHZA 4HEA1 1GUYA 3CKLA 3F74A 4YJKA 3D3WA 1ZM7A 1AK2A 2R00C 4J2HA 5LDHA 5EA2A 3SQNA 4A1OA 3K8QA 4V3IA 2FP4A 2ID4A 5LOVA 2ENUA 3MTAA 3SC3A 2XMZA 1RAEA 1L7XA 2GEUA 4KX5A 4XPIA 1G2IA 4OHUA 1P1FA 1SK9A 2ANCA 4NIMA 3ELUA 5JO9A 4BFLA 2O54A 5DT2A 1YB6A 4TV8A 5JDCA 2VP3A 3IPAA 3V8QA 4QDTA 4OB7A 1KQGA 4U63A 1FF9A 5LMUB 2XHZA 1YGYA 1CE8B 2G25A 4X7BA 4DLUA 3O95A 3R0ZA 1TJ5A 4M6WA 3V80A 3THOA 4RHFA 4JOQA 1DSSG 3HC7A 5CLHA 5IF9A 3D9NA 4PRKA 3HIZA 1MJFA 1ATZA 1C1XA 3B6MA 2C9DA 1KO1A 5ALVA 3TQCA 4FR2A 3U0VA 1KDPA 2Y05A 2O3QA 5ELMA 1MOQA 1T5IA 2PGAA 1K8XB 2DR2A 3AEKB 2B0CA 1JLMA 1JQ5A 5F98A 1NJSA 1W1WA 2Z3ZA 4KACA 1JT2A 4RD0A 3N05A 1WDKA 5AJHA 3VV2A 1YRHA 2FDXA 1PP4A 4FOTA 3TSOA 1V1MA 3EIFA 5G55A 4JITA 4UZSA 1T4CB 1TD1A 5HM8A 3MRSA 3I45A 3Q10A 4OCZA 1R0YA 4NYIQ 4WD3A 1KI2A 4C05A 4JU9A 2H65A 1XELA 3L9WA 1JZQA 3P2JA 1QRAA 1V7PC 1BXZA 3TLZA 3PDJA 3UWDA 1VCMA 3G2TA 2PBFA 1TYDE 4JT4A 1AT1A 4LZZA 4QNMA 3BJIC 5ERGB 4WXYB 1Y5NA 1GGKA 4GR5A 3UJAA 2RG8A 2QD5A 3ZGYA 4BU0A 1KZ1A 2WNIA 5IPFA 1IIRA 4XWWA 4DSAA 1I7LA 2OXTA 1OREA 3JARA 4HN4B 4MS1A 3BWEA 1NL3A 1A8IA 5BYAA 2EX1A 1L8QA 1F1JA 3OZXA 4R68A 4H27A 5A05A 2ADOA 3BXHA 5FT9A 1JLSA 3C7KA 3IP6A 3L4SO 421PA 1HKUA 1LEHA 5AKGA 5G3YA 5DB4A 3LPZA 2QVGA 2E7ZA 2VJMA 4Q4JA 1EFVB 1W59A 2CEKA 2PSDA 4K6CA 3T3DA 2H31A 2WIFA 2I4IA 2NU9A 3LGXA 2FSVC 3JQ7A 5F73A 4FADA 2IK8A 2Q2OA 4BFZA 2BKKB 4YAWA 3IP8A 1LK7A 3Q7IA 5DH9A 5CPFA 3WWDA 1PR4A 3THXB 1N8NA 2CXRA 3EVNA 3GT0A 1M2WA 1SZDA 5DNAA 3N7UA 2ZEJA 4DNFA 4ME2A 2KM4A 3M2PA 5ESRA 3OCZA 1N5KA 1PJRA 1G8AA 4L0DA 4HQFA 5LB2A 1L6IA 1DRKA 3DOFA 4QREA 2NQ2C 4N01A 1CD5A 5F4BA 1MLDA 1XNFA 1XVIA 3BTSA 3JYHA 1O97D 3W1EA 2WJJA 2PUBA 3F5FA 3SFTA 3K0CA 1MEEA 1RXUA 1XQYA 2VGYA 1MG5A 3DDCA 4DUGD 1AQNA 3D4LA 3E1KA 3LPMA 4O1IA 3WBJA 2QUZA 2NUTB 2V98A 3EGCA 2FZLA 3L82B 4RDCA 3EDOA 4ZVQA 3OWXA 5JI3E 1TJCA 1YGPA 4FGSA 5DI9A 1D2AA 2OQIA 3VR3D 3RIHA 1DIHA 4TWJA 4JMLA 3N58A 4RQIA 4RIGA 5DMXA 5IN4A 3VLEA 3SI5A 2OBYA 3JQAA 5KOJA 1KDYA 3FWPA 1KOFA 4LJAA 3WLNA 1YF3A 1RYBA 4F2HA 1X9IA 3RF6A 3FHCB 1IAQA 3HQ4O 3ZNOA 1T5BA 3CB4A 4I8IA 3REQB 1ARZA 4LRSB 2Y0BA 1T36A 4ENVA 2D6FA 4GTPA 4CTNA 1HGXA 2DERA 1J07A 4GCOA 2CY0A 1J24A 5F1OA 3T4PA 1Y3HA 2GM9A 3R1IA 4TZ6A 4HH0A 1R00A 1PIWA 2W8BB 3EWNA 3FRJA 4NDAA 4O2RA 3O31A 3GEIA 1TCUA 4N12A 4F60A 5MGBA 3ICEA 5ENRD 2HJVA 1UFOA 2RKBA 2XVMA 3M4YA 4QL3A 3KKQA 3QOWA 2VHXA 3NDRA 3GJTA 3UINC 4GRAA 4YFYA 4BO2A 4EKEA 3NJ8A 5K8IA 3LF1A 1UN9A 1YK0A 2XX3A 1EZZA 2ZTHA 1QG0A 1SA5A 3OPYI 4FFPA 5EZYA 3UMJA 1KEKA 3D6HA 1DTEA 3QY9A 4M0LA 1DCTA 4AZ3B 3SG0A 2OFFA 2DR0A 5ENPD 3QVUA 2GF2A 1IJFA 1MD9A 4X3OA 4WZAB 2H29A 1NUPA 1XVVA 4LHVA 3UKUG 2RHLA 4WEQA 3VV3A 5I45A 1QGAA 1Q12A 3PPVA 2F55A 4TSFD 3RHZA 1GUAA 1VIVA 1G1AA 4Y2TA 3IAM6 2WXIA 2ON6A 2QLNA 4ZHQB 4PFQA 1AHPA 5GINE 4RPCA 1AKEA 3MLBA 3VR6D 1YJCA 2Y92A 3DEFA 5AM5A 4WZBB 4QFDA 3RGWS 4WNIA 2Z6UA 1RMQA 1GUDA 4WE3A 1QR2A 5GOZA 2AXVA 5TJHA 3QPVA 3D4PA 3GDHA 3PQ3A 2HW8A 1GQRA 3K1YA 3KZ1E 3I4CA 3FU6A 4AW9A 1K9SA 1KQOA 3G0CA 4YRRA 1WR8A 3IELA 3SR3A 2IC5A 3VDNB 2HO4A 1CEYA 4FDUA 4JHRA 2OP1A 4HCJA 3SS7X 4H4CA 3AX6A 4BNVA 1OASA 3WL4A 1EK1A 3F9IA 4S0XA 1IMOA 2HSDA 4DVJA 4YRIA 1PHPA 3V1TC 3DYBA 2LXNA 1QQAA 3ZU6A 2UKDA 2BTDA 1SQ5A 1T5TA 3E2MA 3ZU4A 1E1QD 4K9SA 3TGWA 1N2CE 4JBIA 4MDYA 4I43A 2F90A 5AK5A 1B41A 5HPYB 1WD7A 2CVOA 4F96A 3EEQA 3BL8A 1U2ZA 3G5AA 1HE5A 4FDLA 4HWOA 4X97A 3UYLA 4EB0A 2LGJA 3ZH2A 2R03A 4N3GA 2ZIAA 3IQHX 2WPVA 3JAKA 5LCWC 4JYZA 5IH3A 3R6DA 3S2EA 2ALJA 2P4SA 4A0GA 1UM8A 1G6Q1 1Y6RA 2GO1A 3JRWA 2Q0QA 3A6EA 2VZ9A 4X3PA 5JG7A 3KQOA 2V5QC 5HKLA 3U7IA 2DBAA 3CHSA 3V30A 3CUSA 3NWPA 3AKCA 4A1GA 3ICOA 3QVVA 1W8IA 1WZCA 4I19A 3EARA 2OESA 3TNJA 3FVVA 2OEVA 1JVBA 1R0WA 3MELA 4JA9A 1L4BA 5K3OA 3CEHA 4KXYA 5B3KA 4YX9A 3QVGB 4Z86A 1MBZA 4WOCA 1O0BA 5I9LA 4GPD1 3BF8A 2NSLA 2HA5A 3UAWA 2JGLA 1LLCA 4L3OA 1YB2A 3CLSD 3PA6A 3RRMB 3MINB 2K5UA 3IBSA 4U0ZA 1Q84A 4GDMA 1UBRS 4V2IA 1RCTE 1ZSNA 3Q4AB 2VQDA 4ZN6A 3FKJA 3NAMA 4K8RB 2OCAA 1LDNA 1JAIA 4F3KA 2VT3A 3MTIA 3WWPA 3ISVA 2Y1LE 2NU6A 2BHRA 4MW6A 4B2IA 2PUCA 2DXIA 4ENWA 1J21A 1XRNA 4MQUA 1RLIA 3DJYA 3HWRA 2WV9A 3RBAA 3WSWA 3O6VA 5CURA 2A78A 3UMYA 3T52A 2HXYA 4PRYA 5HZGA 1H5NA 1Q7EA 2DZDA 2IZOA 3D8UA 1JQBA 3VM6A 2QORA 3FUTA 1K5DA 1P3JA 5JXJA 4KPYA 4UUCA 3UGTA 3O4GA 5B1SA 3GGGA 3V1MA 3CJTA 5FEUA 1U7XA 721PA 3G9ZA 3BG0B 2KCKA 3KEMA 4FE7A 5DBGA 1H4VB 2HHLA 4FFVA 2XRYA 2GRAA 3D6FA 4X1KA 5EJ9A 3PSHA 5JHAA 2YASA 1I2BA 4OGKA 2I76A 2J9FA 1R6TA 5FPSA 1I14A 2CFRA 4YS6A 2JJ8A 4I50B 2ZISA 4Y30A 1I6MA 4DLXA 4ZI2A 1Y33E 1ZYUA 1OHHA 2DWCA 3GJRA 3OJOA 4NYMQ 5COQA 4C3VA 2VXOA 1J56A 2V1XA 2OWEA 2WTMA 4FP7A 1NKTA 3F3SA 2PZIA 1XTQA 5CYOA 1WP9A 3ILHA 4LDQA 3RYHB 5JT1A 2P9LG 1X92A 1KYIA 2RK4A 2HSWA 1KIFA 4O1MA 2R96A 2Y9PB 3Q7FA 3NH9A 4ZDJA 1QHHA 2FFQA 2JA1A 3ADBA 2P91A 1HKHA 1NMSA 1UBGA 2ZBDA 4DKXA 3G2UA 3COWA 5A62A 4BVHA 3B7TA 5KTYA 2PO7A 3ABME 3IVMA 2HHJA 4CL0A 4A2WA 1RQRA 1P2VA 1UEJA 4CI9A 3NUQA 3L0IB 4G5YA 2QM7A 1FRZA 1KI6A 1KZGB 5L51A 3F3YA 3BSSA 2RAUA 1W9HA 2YV5A 5EMKA 3T3PB 4BGUA 1W36B 3ZIUA 3EUFA 1E9FA 1XLTA 1XD8A 2Z8YA 3BAFA 3MWEA 4LY0A 4NPCA 1YU6A 5F9FA 1NY6A 4I50A 3RODA 2OE2A 4I3GA 3Q8LA 4MR9B 1Z4IA 2E85A 2MJLA 2QKYA 5SYNA 1G3RA 4CM8B 1SVMA 3ESKA 1N1EA 5CVDA 2BR4A 3CY6A 1C9KA 4YN3A 2VJ8A 2H2AA 2HCRA 1FFDA 3C4VA 1SAYA 3RT7A 2IRWA 2PS0A 1K66A 5SY9A 3ZTWA 2KZTA 4G4SP 4JLPA 3ZU7B 1AKTA 3GLRA 2BEVB 3D6JA 3LX5A 5FWYA 1MKYA 3IUBA 5CXUA 5JS6A 3AF1A 3TCXB 1PJ8A 2RHDA 3UKJA 2AJ8A 2VNJA 4EPWA 3ST7A 4K2AA 3RT9A 4ZT7A 2XVYA 3BN3A 2G70A 3ZHSA 2FO1E 3S5UA 3X44A 1MVLA 5DE3A 3S7FA 4J9VA 3PJEA 4D8UA 2HCFA 1BGVA 1MA3A 1KE2A 5KNCA 3RAUA 4OGWA 4ZCRA 2RAPA 1ZJ6A 2Q3CA 1RLTA 3HUDA 3NT5A 1RWXA 2CVZA 2ZTUA 2CVFA 2Z9CA 3M2TA 4FDAA 1ANKA 4X63A 2ZJ4A 2XT0A 4TTAA 1E3WA 3ZLVA 4RDXA 4M0DA 3AR9A 5T3RA 4FHKA 1AMOA 1BQ3A 4OVUA 5THXA 5TF4A 3PLAE 1QVRA 1AH2A 4J75A 3ENEA 5B53A 3BA6A 1Z62A 3GGDA 2VHQA 4FFSA 4ZWNA 4KLRA 3VH1A 5JATA 2WT4A 4G67A 4MWDA 4OJYA 4LHWA 4WWNA 4B6OA 3HY4A 5CEEA 3BHNA 4ZQBA 1O1SA 1QMGA 4NV3A 4HXGA 3GLIA 5JYEA 3EUVA 1CDEA 1MAAA 1QHGA 1U0FA 3L6UA 4ZPXA 1YU9A 3V1KA 3SHQA 3VSAA 3S28A 4HDMB 4HGZA 3WLKX 2C9YA 3ZEFA 4N18A 2BELA 7MHTA 4PE5B 4KXNA 1GQQA 3PNMA 2FN9A 4ZU1X 1E6CA 2KATA 1GXSA 2E4ZA 1FUEA 4KXLA 5JAQA 5M2QA 4KQ9A 4OOFA 1CZOA 3BDAA 2IT1A 4PHFA 4YCDA 1ZAYA 4TSKA 5LWHA 4U2CA 1TU3A 4NPAA 4UMDA 4FT2A 1UJCA 4MH0R 1DCKA 1FYXA 1PT9A 3OLZA 4QC2A 4WNDA 1U9IC 1Z35A 3CMMA 3LT0A 3G7SA 4ZU3A 4OQZA 3V33A 4BGIA 3NAWA 3T95A 2ECOA 3ZVNA 1W47A 1ISPA 3A05A 2ZGGA 1NFFA 2M6LA 1A2OA 2CXOA 2NG1A 4RMGA 1QFMA 4G0XA 4RF3A 3CJQA 3F71A 3H2BA 3WGLA 4DREA 2Q0HA 3FGZA 5KJMA 3ZHUA 1Z82A 1HY3A 4MUAA 4F4DA 4CIWA 4HRVA 1CR2A 1OXSC 2DTDA 2XCLA 3NHZA 3O3NB 2AFHB 4HAUA 4Y2PA 5GWXA 4HXFB 1P29A 3W8NA 2PKCA 3P4YA 3BRWA 2IXAA 4GGPA 3L9TA 4C30A 3VPBA 3DLHA 3IPXA 3T3OA 4LFBB 2G06A 2DFDA 3LZDA 2QRKA 4A9AA 1P2BA 5T6BA 1XF1A 4R2MA 5EGSA 5A5GA 2XUPA 2BUAA 2GGFA 3AOEC 4HJXA 4UHBA 2CJWB 1OAOA 1QAQA 5AVUA 3LBIA 2WFLB 4Z51A 2ZROA 5CAEB 2C4HA 1CZUA 4LGMA 1OBCA 3JD1A 3IHLA 1YHYA 2IBMA 2UUOA 4CMKA 3A37A 4CKCA 1B4DA 3ZUVB 1V9SA 1ZH6A 4GA0A 1U0HC 2JIBA 5CVEA 4M9QA 1AHNA 3CUWA 1ECPA 2CNBA 2X77A 3CHPA 2WHXA 5DASA 2XZLA 1RPAA 2GD2A 2ZJYA 4XYLA 2PL5A 5DTEA 3BJZA 4BFUA 1P1BA 2FZ5A 2B8TA 2I8CA 3DONA 1RRGA 4DR2B 3E9MA 2A7QA 1Y8AA 1PZEA 3HLTA 4QU5A 4C9BB 3FNRA 3I3SR 4IULA 1WDMA 2X6TA 3FYDA 3HXLA 4CETA 2IV2X 5JJIA 1IBKB 1S8OA 3IP3A 4QFVA 4WH0A 1PO7A 5J4KA 1NVUQ 3U37A 1SVSA 2XPZA 3BWDD 5BO5A 1CRZA 3A4NA 2FEPA 2IONA 2RG7A 3MF4A 4Z4CA 4ZARA 4I9NA 2ONZA 4AYXA 1SBQA 3O0TA 4KGVA 3VJLA 2GK4A 3EGEA 5DYNA 3PQ6A 4MLDA 4NR0A 5TSDA 2NU9B 3T1YB 4G24A 3BZUA 4APFA 2R59A 1XROA 3M89A 4GOMD 3C3EA 4M0FA 3S55A 2PCLA 2EG5A 4DJJA 4RLYA 5HA5A 4PC1A 4YJGB 3QLVC 1S2NA 3P9CA 3V4ZA 3VBEA 3WHPA 1WCIB 2I6UA 4D56A 4DZRA 1RVV1 1O94D 4UI9J 5FPYA 5JEDA 4RX1A 1GCGA 4YJHB 5CG1A 1B6TA 5KJNA 4FIDA 2MSEB 1F60A 4A27A 1ZWKA 2QTWB 1WB4A 2PGDA 2XDQA 4XKJA 3VVBA 4HFNA 4XZ4A 3FN4A 3D31A 3RS8A 3WGJA 2I6HA 3E8SA 1Y34E 3CGHA 4YRQA 3L6AA 3W0LB 3CXUA 2G3YA 4B7XA 5B1EA 4KDFA 3OCVA 2G72A 4AX4A 4BQNA 1W6UA 2QM0A 4Y6QA 5C8XA 2I3AA 4K87A 1U7HA 2CD9A 2NYRA 1Y81A 3EVFA 3P1JA