4BX8A

Human vps33a
Total Genus 214
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
214
sequence length
596
structure length
568
Chain Sequence
AAHLSYGRVNLNVLREAVRRELREFLDKCAGSKAIVWDEYLTGPFGLIAQYSLLKEHEVEKMFTLKGNRLPAADVKNIIFFVRPRLELMDIIAENVLSEDRRGPTRDFHILFVPRRSLLCEQRLKDLGVLGSFIHREEYSLDLIPFDGDLLSMESEGAFKECYLEGDQTSLYHAAKGLMTLQALYGTIPQIFGKGECARQVANMMIRMKREFTGSQNSIFPVFDNLLLLDRNVDLLTPLATQLTYEGLIDEIYGIQNSYVKLPPEKFALPTEAKKLQLNSAEELYAEIRDKNFNAVGSVLSKKAKIISAAFEERHNKQFVSQLPHMQAARGSLANHTSIAELIKDVTTSEDFFDKLTVEQEFMSGIDTDKVNNYIEDCIAQKHSLIKVLRLVCLQSVCNSGLKQKVLDYYKREILQTYGYEHILTLHNLEKAGLLKPQTGGRNNYPTIRKTLRLWMDDVNEQNPTDISYVYSGYAPLSVRLAQLLSRPGWRSIEEVLRILPGPHFEERQPLPNRVTLIFFLGGVTFAEIAALRFLSQLEDGGTEYVIATTKLMNGTSWIEALMEKPFH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Protein transport
molecule keywords VACUOLAR PROTEIN SORTING-ASSOCIATED PROTEIN 33A
publication title Structural Basis of Vps33A Recruitment to the Human Hops Complex by Vps16.
pubmed doi rcsb
source organism Homo sapiens
total genus 214
structure length 568
sequence length 596
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00995 Sec1 Sec1 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.850 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4bx8A04
3.40.50.1910 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4bx8A02
3.40.50.2060 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4bx8A01
3.90.830.10 Alpha Beta Alpha-Beta Complex Syntaxin Binding Protein 1; Chain A, domain 2 Syntaxin Binding Protein 1; Chain A, domain 2 4bx8A03
5BV0A 1FVHA 4JEUA 4JC8A 3PUJA 4JEHA 2XHEA 3PUKA 4BX9A 5BUZA 3C98A 1Y9JA 4CCAA 5BV1A 4BX8A 1FVFA 1MQSA 1EPUA 4KMOA
chains in the Genus database with same CATH superfamily
4N5CA 5LQSA 4MCJA 3ORHA 4TLCA 4OQXA 3PFFA 4LV8B 1GCUA 4F91B 1NBOA 4HI9A 2E37A 2WJIA 1FF9A 4XOIA 1UKVY 4CLXA 3QW2A 1ZW1A 1N0QA 5H59A 3B6ZA 3IOCA 1U0GA 3U7EB 2D59A 3HXBA 2I7TA 4R3WA 2R85A 1RWNA 4I2NA 3QF7A 1L8AA 1ISHA 3RRFA 2G06A 3NEYA 2A1UA 3VOTA 5KQSA 5GAJA 3Q78A 3BMQA 4FYPA 1KQNA 1L5MA 3WLMA 3DSUA 4MGHA 3V4VB 3I23A 3TF5A 4RPCA 1GUBA 5FI1B 1Q0RA 2IOFK 4J0GA 2YMMA 4CM8A 5TPWB 4DTIA 4UDOA 3VYUB 1BI8B 3PJGA 3V7FA 2WHXA 3MTGA 4HATA 2F59A 4MQMA 2VCYA 3NIDB 3BK1A 4EZLA 1Q0UA 2WC1A 1LDNA 2VIIA 4K9RA 2YVKA 2QW8A 3T0IA 5FH9A 1DDIA 4QGSA 2P9NG 4LHWA 3T7DA 4HEHA 2I6FA 4UWLA 2B7LA 4NL4H 3B70A 2NO1A 3HKDA 1FVHA 1PYGA 3NHRA 1ACMA 2BR4A 4FWBA 3AV0B 3TTUA 4D0GA 3HY3A 1TJ5A 4DNPA 5BXQC 5GONA 4PSAA 5EN5D 1UXIA 1YWGO 1KZPA 2H9YA 4G81A 1RBZA 4HRXA 1E0KA 2D0PB 2EAUA 1JVNA 4EVSA 4Q19A 2Y1OA 5B2EA 4L5JA 1ZBPA 5KX5F 1HO8A 3MLAA 1NN1A 3TLGB 4QBTA 4JENA 2JF0A 1JHRA 4K03A 2NV0A 1UZNA 4QASA 3MB8A 1MX6A 4JBWA 5PNTA 3I62A 4UHJA 1QHNA 3BSYA 4BVGA 3RU0A 2BC9A 4LJKA 4C0EA 4CIYA 3KIPA 4KRGA 5AJWA 1I6WA 1P0MA 4GOLD 5CXXA 1AO0A 2X1MA 3AWDA 2RD0A 3PF9A 4JBYA 2YQZA 1PL6A 4MR9A 3VO8A 3DT6A 2GYYA 3D9IA 2WLTA 2UU9B 2FW7A 1R9GA 2C4HA 3OZFA 1ZI9A 5EE3A 4GP7A 3H5IA 3D9JA 2GSWA 1UC5B 2X1LA 1J8VA 5EHZA 3EEBA 3W7BA 4G8LA 3CF6R 2FO7A 2ORED 3UWKA 5CIWA 1HDIA 2XNKA 1A8PA 2BFFB 5J5AA 4CM9D 1IZZA 2YWRA 1ZNQO 3KLOA 1GGJA 3BJRA 4J75A 3HGTA 3N0TA 1EK6A 4R2MA 2VTVA 4WNFA 2DKFA 1TCUA 2HD4A 4OQNA 3C3AA 3GA7A 5KTOA 8OHMA 5J90A 1PR0A 2SICE 4ZGBA 1KAGA 2X4GA 3G7NA 1DELA 3DD1A 3NOOA 4MWSA 1RMYA 4BMXA 5MHTA 3CE6A 1M0TA 1I0LA 2R8YA 4HNQA 4GBMA 1P7YA 1S2MA 4YAWA 3FJYA 2OK7A 3MWEB 1Q21A 3IELA 1G8AA 5CA1A 1L7DA 4JLWA 2F1HA 2ZIFA 3RK1A 3THYA 3AKEA 3I9LA 1AZTA 1Z38A 2PS0A 2JFPA 4JB8P 2B2XA 1ZX1A 4LDRA 1LD3A 5REQB 4J8PA 5KQRA 3D3WB 3U44A 3LQQA 5LZ7A 3OKFA 3PSAA 1QJ4A 2X0NA 3TZKA 3LAWA 1VIVA 1FXSA 1VI6A 5EZYF 3ACDA 4D9FA 3UC9A 1T0IA 5CVTA 1ZIOA 4W8GA 3RVKA 2O7QA 1JR4A 3C0KA 1YJCA 8AT1A 4L74A 2B61A 1L5HA 1QO9A 1C80A 4IMIB 1G17A 3BDIA 4BAZA 1A5TA 5D66A 3A1WA 3TJMA 4UNIA 2Q9CA 5JMND 3RWMB 1XNGA 4CHGA 4KXXA 2I7CA 2WWHA 1Z4JA 2QN1A 4AIFA 1U0BB 1I13A 1DIGA 1LBQA 1QYDA 4QECA 2WHPB 2DWPA 3FB1A 1X70A 5IC4A 1YQUA 4RCZA 3UM9A 1EFTA 4CYMA 1ZW6A 1CNMA 4PYJA 2NZVG 1FIUA 2DAPA 2J7PA 3N2EA 4LXQA 5JHGB 2YUTA 5L3QB 1P5JA 1JSXA 2FSUA 2ISCA 5EJFA 4JI5B 3F6QA 1YUMA 4HV4A 2JATA 3AZOA 4PC2A 3GYZA 2QVXX 3AIOA 4K6HA 1U8EA 1KSGA 2ZJYA 4O2LA 4J0HA 4YO8A 3CIAA 3JTEA 2JVJA 2QXYA 3EGXA 3P94A 1W2HA 4IP0A 1G8GA 1XF9A 3VPCA 3MS2A 4YMGA 3D9HA 3RADC 5F1PA 2B4AA 2ENUA 4LF9B 2YNQA 3M4NA 3SICE 3GZTB 2I6HA 4RM3A 4K5QA 3HRHA 2W2NA 1GQRA 1Q6ZA 3L7AA 5E9JA 4X41A 4HH1A 1Z74A 1KFBB 5BO5A 1E6WA 5G3ZA 4WLEA 2A33A 4KFTA 3LVQE 4RDIA 4CEJB 3L8EA 4BWFB 3GUCA 2ZZMA 1Y8RA 5TARA 2H59A 3RIYA 4MR7B 1P1BA 1AB6A 3I9V1 4NU5A 3EPJA 2BKEA 3W3ZB 2WWGA 4HGYA 4CF3A 2YXLA 2FY8A 4K40A 1X5BA 4Q7MB 3CK7A 2NNLD 4RTOA 4JLKA 4ZA2A 4PSCA 5DKFA 4YJGA 1CLEA 5K0JA 2R65A 4FMDB 3EY4A 3KZXA 2NU9B 1MIOA 3VO2A 1PJ2A 1M6NA 3BVPA 3L8CA 5HQJA 1LA2A 5HQ3B 3FGNA 1MVOA 4PXSA 5DV9A 1YULA 3T41A 2H4FA 2Q5FA 4ZAGA 2O3RA 1F8YA 1ZLXA 4JVLA 4CEMA 3PXEA 4FOLA 1TIPA 3X1XA 2GEFA 3R7WB 4PIVA 3LUJA 5FT9A 4G4SP 3BEEA 1BVUA 1PL0A 3S2GA 3R41A 4WLVA 3C3KA 4PIMA 3C1UA 3NWBA 1JECA 1ZN7A 1D4FA 2ZSHA 2ONJA 4Q3AA 3DCYA 4UBMA 1PLLA 4D9EA 1IB6A 3CVOA 4WWNA 4TMTA 3QLVC 2WNIA 3S1AB 1JHAA 4DMUB 1B8OA 2P2NA 1HLGA 2RBEA 3R0JA 3LUBA 3JQ1A 3ONDA 1D1PA 5H82A 3HBFA 4K1LA 5AJUA 5AKIA 3F4KA 2YWGA 4URWR 2Q07A 1BAPA 3L07A 3EH2A 5HJ5A 3O2JA 2XJ9A 4ZI7B 2C95A 4A8JC 1DJNA 3KNZA 2OXIA 3HQ4O 3TSOA 2OCCE 3E22A 4U39A 4HDRB 2X8BA 4C29A 1ZOIA 4GUDA 3SF8B 1YKGA 3SLKA 4BO7A 3MTEA 3NMUF 2PX0A 1EP2B 1NT2A 1PJSA 3H5WA 4QJIA 2DJIA 3BQNB 1QIFA 1UBKS 1WU7A 1XDWA 2PNNA 5HM8A 5E2IA 3H7AA 5EZQA 1C1HA 5JZ9A 3OBBA 3G2OA 1M1UA 2HJWA 5FOXA 4QXRA 3ICQB 1G4UR 2XTZA 1PR2A 1GRNA 5JSQA 2HF9A 2IEAA 4Z2AA 1YS4A 4LY6A 3WWCA 5CMWA 3RFVA 2NXPA 4R6WA 3U7IA 3PDUA 2A1TR 5G55A 1EGMB 3PP8A 3CJRA 2NV2B 2REBA 4FWTA 5C81A 4GNKA 3RSEG 3GH3A 4A10A 2M6RA 4TLEA 4D9JA 3F2IA 3M6AA 5FR2A 5ES3A 4IIBA 4EGSA 4ZFHA 5BNTA 4DABA 1XZFA 3OX1A 2PBFA 4AWXA 1ZICA 2CE7A 1G59A 3HGQA 5MFPA 3T7JA 5HCIA 1DKNA 4O2RA 3CLHA 2PKEA 3ULEG 1ELWA 2C7OA 2INGX 2FFBA 1P0FA 3G85A 4G56A 1XHEA 4D7AA 3AM4A 2VHVA 2P9YA 5KOYA 1W4RA 3ANMA 3X1ZA 1OB5A 2EYQA 4NDNE 4P4UA 1LDEA 3B7PA 3DO8A 2C9ZA 3VNAA 4JI8B 2BHTA 3DZ8A 2QI9F 3G5MA 3INTA 3Q9SA 4KN5A 1AH2A 3C7TA 1NQ5A 1RKQA 4C7MA 2D3WA 1NW9B 1IEQA 2Y77A 3G79A 2YJGA 5FOQA 1W76A 2MYOA 2CKDA 4F0JA 4R4JA 3MXOA 3FPHA 1CQXA 3GJTA 1KH3A 4HEA1 4F46A 1ZOSA 4BIIA 4BMPB 3JV7A 3B9PA 1TIKA 1H2AS 3ZWYA 1VE1A 3FYUB 3LLUA 4O4JA 3NOGD 3H7IA 3ECSA 2RGDA 4XPIB 3QKSA 4ALJA 5BNIA 1BZYA 2Q7DA 1ID1A 3H0CA 3JYPA 3PPVA 5LQMA 1FE8A 2GRUA 2QYHA 4CIDA 2IUTA 3ZHUA 1OGIA 5DX0A 2IPMA 4RPHA 3UMYA 1KDYA 1HG2A 1L5QA 1O96A 1CIPA 1G2PA 4JT2A 3RUPA 3DEYX 4ZAXA 3RWOA 4P31A 5FZRA 3U19A 4POAA 3X1DA 1TO1E 4Q9AA 4FVTA 4P1ZA 3IAXA 1YQTA 4TV8B 1ZH6A 4C07A 2XGGA 3UWDA 3W7AA 3JUIA 2P2ZA 4TMXA 3RS3A 1Z8FA 1Z2OX 1JEQA 2WU4A 3VAAA 3W8DA 4B3BA 2RJOA 2RFLA 1STOA 4WXPA 4DQDA 3IJPA 3IVGA 4FZRA 1Y4UA 3E0QA 1W581 5JD3A 3X1MA 3L17A 3JQQA 3P1UA 1CSEE 4B89A 2ZJFA 4PQEA 2XPCA 3D1JA 1HYHA 1GA6A 3ITKA 4YJ3B 1TM5E 2Q5LA 4UMEA 3RYFA 1RHMA 4PSVA 1R1DA 4FP9A 3HB0A 1ZI8A 2VI5A 2E6UX 3H1GA 1IVNA 1ZS9A 4UAGA 3HA5A 1EZZA 3ZDQA 5C2JB 2C2ZA 3O73A 3AFHA 2FMKA 1FXWF 1V43A 1PUJA 2ZUCA 1RHQA 2I0FA 4LNUD 3KV1A 2YKGA 1UJJA 1T2VA 3DOEA 4WK4B 5AM0A 4EB6A 4EF5A 2PLNA 4MV5A 1H1LA 1OR8A 3RD5A 4B85A 1JL3A 5EJIA 2JAWA 2XITA 5IYZB 4FD2A 5A6VA 2Q2QA 4LYDA 2AXPA 4CIWA 3FJOA 2F2TA 1Q3KA 3RAFC 1N78A 3EMVA 2OV3A 3Q3HA 4KR6A 3H5RA 2JBHA 5E6SA 2QR3A 1DAGA 2CHFA 2BMEA 5CFPA 3QV2A 3PQFA 1X1DA 1R5JA 5C4IA 1YJQA 2NZUG 1GAJA 2PRZA 1DLIA 4IWYA 1NONA 3PENA 2V0CA 4YRIA 3VNSA 4BMVA 2UVQA 3TTYA 3WKCA 3GO4A 4ML3A 3R74A 2NSDA 3WAJA 2PSSA 2Z6UA 4MUFA 4XVUA 3MCWA 2WIAA 5HVNA 4ILHB 1VJGA 3PQ7A 1LS6A 1DAHA 1E9SA 3QU7A 3HCEA 4LZPA 5AHRA 3ZLVA 1NG1A 4HR7A 2PPVA 1ULTA 5B1IA 4QFVA 2OBBA 4RSMA 1BLXB 1PWEA 2QLFA 2PNJA 3JSAA 4YO7A 5K0FA 5ICCA 4IOLA 3KEQA 2W8ZA 4U3JA 4DA4A 4XD2A 421PA 2VZLA 4QTUB 4H35A 2YQ5A 3N8NA 4QEZA 3RUHA 3Q3EA 3KQMA 1E1YA 3SN6A 1ZU4A 1EDBA 1U5BB 4TSKA 1TADA 4CM6A 1X7YB 2G1UA 2Q21A 1YZUA 1YAHA 4F7DA 1CY1A 2P9IG 1CZKA 1ETUA 2WOJA 3WYCA 4F4DA 1R27A 2Y1FA 3WJ2A 2GM9A 1IBMB 1AU9A 5KSOA 2YWHA 3EXHC 1ZUHA 1KJYA 2OQRA 1CBUA 4FCVA 2QW0X 2EDAA 1WB6A 3FNHA 4R9NA 4JHRA 2MHKA 3D5TA 2EP7A 4QOJA 5C8VA 5K8LA 1PP4A 3QQ5A 1LPAB 1QVWA 5CBOA 4ENRA 3GFVA 4K0KB 2NV6A 4AYWA 1O4WA 3UUXA 1R4NB 2O3JA 4ZCLA 2HT1A 3N75A 2PQ6A 1XOIA 2KW5A 5TQ0A 1OYYA 3MTBA 3LSYA 3UK6A 4EI2A 1BXGB 4BNUA 3IBYA 5B5SA 3HNPA 1M7HA 5EYPB 1C1DB 4OGGA 2BM8A 1SU7A 2DPLA 3IIIA 4RACA 4JVSB 1BDMA 3VZSA 5HJEA 1U0RA 4DLOA 3BF7A 3LX6A 4NCHA 1S3IA 3OC0A 1D07A 2X5OA 4Q9DA 3P0FA 4M9CA 1UZUA 2TSYB 4QYSA 1XK7A 3WGYA 4ARVA 4O29A 1IHOA 2DULA 4DMMA 5C8YB 4YACA 5K01A 4TWRA 1YQ9A 4E4TA 1JAYA 3TI9A 2ZXUA 1EDZA 3A9TA 2ZT8A 2Q7OE 2Z2ZA 2VUIB 2HMWA 3SHQA 3IPXA 4OYYA 4QXMA 2ZDGA 3DRAA 4V3CA 5IAJA 1WD7A 4RENA 2XTNA 4OUKX 3PG5A 3IEVA 4B6RA 2QT9A 1B73A 5K0TA 3MVEA 2P9LG 3IDAA 4ND5A 2IV3A 1F5NA 1H19A 1PWZA 1CERA 3EFEA 1TM2A 2XE4A 4AICA 3OXLA 3T5DA 3FPEA 2PY6A 1EBBA 4PO1A 5JPIA 2RGAA 3CUSA 4CCYA 4EW6A 3TE7A 5B1YA 1KSHA 5MFZA 1X8LA 5JC1A 1SHZA 3K0EA 4TVBA 2QG6A 3DLCA 1T5IA 2VZ8A 2FA9A 3ZTYA 1DGQA 2R79A 1A7JA 4BBAA 4I2WA 4OMCA 1I3CA 3RKRA 1U6IA 2YNMD 4WKBA 4UW9A 4RPIA 4A26A 4MP8A 3K2BA 4MDHA 5CM2Z 1CQPA 1QAQA 4DV1B 3FAZA 3Q8XB 1KETA 5JQGF 1ZSNA 7MDHA 4CPDA 2FUEA 1IG0A 3CBGA 4RLYA 3O4JA 2BUAA 3BFPA 1HDOA 8LDHA 3ETNA 2PKCA 3OM8A 2PEZA 2JBAB 2GPAA 5K45A 3U4GA 3EWNA 1W0JA 1X7HA 4QIHA 5DYNA 4DX6D 4EG1A 2NNWB 4FI3C 2QP4A 2X86A 4ZOLA 1FSFA 4WLNA 1RC0A 2XOKD 3ESAA 1OAKA 1JSCA 1SPBS 2OBNA 2XE7A 1NKSA 1N34B 3CLUC 2VDVE 3LEWA 4WAFA 2W2LA 1GRCA 4C0WA 2I4NA 4DPMA 2KSQA 2MSLA 5J4VA 2WAOA 2GM4A 3WL6A 4N6NA 4L4SA 1YRAA 3AG2E 1LI5A 2XMCA 1E20A 1T8SA 2BYTA 2PNFA 3PUWA 4Q3BA 3PFKA 4ANFA 1YRHA 3C6ZA 3G5TA 5HKOA 3RI3A 3DEFA 1X1EA 4X9XA 4RD2A 3E27A 2VGYA 3GW8A 2FSSA 3QBVA 6REQB 1GFIA 3GFFA 1OI3A 4ZGGA 5BT8A 1NNUA 2R5NA 3NR2A 5DN6D 2B98A 2WSBA 5I9BA 2ZI3A 3FHJA 3COWA 4R1OA 2GK3A 2I8AA 1F9AA 2VH1A 4J8DA 3U4CA 3CSTA 1MC5A 4UUBA 2JLQA 4I46A 4YNBA 3ZHSA 1KZYC 1TGYA 5A23A 3D3JA 2OO3A 3O4IA 3OXFA 1QF7A 1QAOA 3GVIA 2P78A 5HYVA 1TX4B 3E5MA 4E70A 1WR8A 2C61A 3VHXA 2X41A 4LXIA 1SB8A 5K8TA 1BCSA 2NZJA 4EB3A 2R7KA 1E7MA 2B1JA 1NY6A 1JKMA 1GTL1 2FSPA 3TR5A 3FOCA 5FIOA 3CVWA 1RYHA 2LUOA 4L5IA 4EBAA 4B6OA 4MMXB 1J0BA 2QY9A 4RQIA 3W5SA 1CDDA 3UPTA 3BMCB 2O4CA 4GXRA 2QUJA 1USUA 4W5OA 3Q15C 3I76A 3OZTA 3WYAA 4DIKA 3N86A 4MV8A 4FQ5A 4HGZA 5IMBA 2FLKA 4QL3A 3DHYA 3H3XA 3QKTA 1D8DA 1A04A 5BSUA 3K70B 1C0PA 2PQRA 3JZMA 5DDIP 3GLKA 4GZLA 1U31A 5JYEA 4DA0A 3CH6A 4XWKA 4IUBS 1JUQA 1GT6A 3M1YA 1Y3CE 4ZJYA 3R0VA 3IOEA 2NW6A 4HXFB 3K2IA 4PPFA 3TOVA 1PT9A 3LDGA 1EPUA 5WRFA 3ABRB 3B60A 1ISSA 5ISMA 3JXEA 2IK8A 2QUZA 1OWNA 1IXSB 1MB0A 3QA9A 4F2WA 1YACA 1UDAA 4V39A 1NR7A 1Y1QA 2D06A 2PX5A 1EKXA 3O93A 3BIOA 4DPLA 3U81A 3VVBA 5ALSA 2C1EA 1MAAA 1PJ4A 2ORIA 2RGBA 1UIRA 2VTBA 2XUKA 1UW4B 1YOVB 4DFDA 4AM9A 4M0UA 3QF4B 4EABA 5D01A 3B3FA 4ZTBA 4LYAA 4IHJA 2ZRNA 4IZ6A 2MR5A 4QWMA 2OCPA 1SCQA 3WLIA 3ND6A 4L0QA 1TW3A 1DC7A 2UZ0A 2OGZA 5ENVA 2OV1A 3THWA 2RJ3A 1L7BA 5AWFC 2PIDA 4QKQA 4QDZA 2WFLA 3GFTA 2L42A 5DJ5A 4OGLA 4F9GA 5ALEA 3PGJA 3EHQA 4JEUA 4J9VA 2WMOA 4NZ9A 1Z36A 3MWYW 2XAUA 4L0DA 5L9AA 3JD4A 3TIGA 2Q5HA 1HSOA 2C5SA 3PCTA 4F1PA 1M6VB 4BNLA 3EIQC 1C0IA 1SIOA 2CLOB 2C3PA 3CIFA 2QE7D 4Z51A 1OCOE 1O6CA 2G67A 2QNIA 2P40A 3SKXA 1GZDA 4BCCA 1WE2A 2R44A 2HCBA 4DVGA 5DHSA 3TZCA 4OB7A 1K5DA 2G08A 3KU4A 1KT0A 4FJYA 4Q39A 2UUCB 4LGVA 3FDZB 4D8UA 1M2EA 4K9KA 3C3CA 1KBOA 4L4UA 2FN4A 2Q5EA 5M34A 1JDTA 2B37A 5JH7F 4G41A 1JQEA 3HHEA 3JRWA 3ZDEA 3CSUA 2BI8A 1U1EA 1UP7A 3M49A 3K0CA 4DQVA 2NN3C 4EHNA 2F1OA 3KHKA 1TYDE 4ZXFA 3AOEA 3G2NA 4GNRA 1UJ4A 3N2IA 3RVPA 4J1SA 3OJWA 4BUJA 4BX0A 3QPWA 1RRCA 2ID8A 4TSRA 3O26A 3Q12A 1SW6A 6ABPA 3TLEA 4ZT5A 4HQ6A 2LCQA 3INRA 4KKVA 3BG1B 1MHPA 3FWKA 2PZAA 5LP1A 4G84A 4IINA 4CDMA 4KZKA 2R60A 2WZQA 1ITZA 5AH0A 4B7ZA 1X8KA 3GJRA 1QZXA 1GKUB 1PC2A 2VHQA 3OESA 2QMUA 4Y7CA 4F71A 4YUXA 2ETVA 2H7XA 5AESA 2H5IA 1IQPA 2PM7A 3IXEA 2EFYA 1IOZA 3W77A 2WJWA 4RVGA 5IABA 4D10C 2DR3A 1EMDA 1N2OA 3GLHE 4BB0A 1VB5A 2IEJA 5J5VA 4MCHA 3I01M 3FSEA 2P8JA 3QUTA 4D43A 1U7XA 3QEAZ 4IS3A 3I3SR 4B0ZA 4FS3A 2OC9A 1GWNA 2QPAA 5T4YA 4PSUA 4YPFA 2PMFA 4KX5A 3K1YA 3OLYA 2QD4A 1H2WA 2BRUC 3PXAA 3L82A 1H2HA 4H7FA 2LE0A 4YH1A 1KARA 2QV0A 2VEOA 5L8VA 3WGQA 2VP4A 4NBRA 1MBZA 1J2EA 1OREA 1NA3A 3GP5A 1K7SN 3AP2A 3EODA 3SGHA 2B0CA 7MHTA 1CIVA 2B34A 4Z0PA 3M9XA 3FUDA 3WL8A 3VH4A 3L7NA 1OH8A 2HJGA 1UJBA 3BK7A 2CFSA 1XVVA 4UEJA 2QN9A 5E6UA 3AG5A 3Q3CA 3U3DA 4K2HA 3R24A 3DL0A 1CT9A 5DBOA 1QDEA 1SC1A 4TXLA 5HS0A 3PS6A 4RHUA 2FN8A 3WLKX 5BWOA 1Z0FA 4DXDA 1EVQA 4Q1DA 1Z28A 3TLZA 1RLOA 5LMZA 2OGSA 4LJSA 1N6RA 2DCPA 4WOPA 1ODTC 1G7CA 5FYQA 4MH0R 5E3HA 5KQLA 3D6FA 3RRMB 1GGFA 1QV6A 1EFAA 4R3UC 4EF6A 3AIKA 1L4EA 2Y3IA 3FNBA 3ZX4A 1JLLA 5HP4A 4L0MA 4CMKA 2DRIA 1U90A 4ZHSA 2XMGA 2QRNA 1LFAA 2Q4BA 2P6OA 3DP7A 2PUWA 3BIJA 4MWEA 1P9WA 2Q41A 1Z73A 1KO7A 3ONNA 1Z5SC 5A2QA 1KYVA 3T5PA 4E30A 3LPMA 1VJRA 1KI6A 2IWRA 1OX6A 3RYTC 1S89A 2CF5A 3WZMA 3GT3A 5HA5A 2HTEA 1YBFA 2EGUA 1SVSA 2G1JA 4DX7D 1DTSA 3J7AC 4ND8A 3LA6A 1DCMA 1XGKA 3O3MB 4YPVA 2DMRA 4WCFA 3HUEA 4ACBA 3BXFA 2WJZB 3BD7A 3EHEA 4FFMA 2Z57A 3A4TA 4E08A 3JRXA 3D2BA 1A9XB 2FFHA 1BH2A 4HDOB 3T3GA 4BQRA 3D4OA 1JJ7A 1J20A 4OKIA 3ZIAA 3ZV6A 3TD6A 2J3LA 2OLEA 2AW5A 4GMKA 2XGJA 1NXTA 2C78A 2BGMA 1TVMA 4FOPA 3C7AA 1FUUA 1E2MA 4GYWA 4KN8A 4X54A 1QR2A 3H13A 1GGKA 4Q37A 2EX1A 2Y8EA 1UT8A 3IILA 3M1LA 2EFDB 2CNDA 3MRSA 5J2TA 2IKQA 2JA2A 2II6A 1GTVA 2FTKE 4N82A 4UWGA 2DLCX 4KPUA 5DO9A 3M9WA 4N1AA 3MZLB 1P39A 3THXB 4Y9UA 4LCJA 1S3SA 2IPNA 4ER0A 4I5EA 4JYCA 5B3KA 4UTPA 1K86A 1N0WA 1DAOA 5IVDA 3P26A 1XCMA 4I43A 3PEVB 3R23A 4D4IA 2CDAA 3GCZA 3L2OB 1EFVA 2YH2A 1ZMXA 4KOEC 3SDBA 2CJXA 4GOXA 3WGLA 4LG1A 1VRWA 1AHNA 4ZP1A 3GI1A 1OXTA 1RADA 2Z8XA 5TR9A 3OZDA 3DOJA 2PX6A 3UHAA 2DXIA 4B81A 4FMPA 3AR2A 1RVDA 4CKCB 3RVLA 4BZWA 4F9FA 3TEJA 3CWCA 2GJKA 5A5VA 1C9EA 1UJKA 4IVQA 1XRPA 1SZJG 3G49A 3ZWOA 3U1TA 5CVDA 3KC2A 4AUEA 2R2GA 1W96A 4AD8A 1T24A 1YB1A 2R02A 2QG4A 4NOKA 4RYLA 1KAEA 4NFHA 2DY1A 1CK4A 3RC8A 4UUAA 2WWIA 5BNZA 2B35A 4OQFA 4LNGA 1G8FA 5LXTB 1JKIA 3H9UA 1JG6A 3HU2A 1CG6A 3SZRA 1U9IC 2NUTB 5DLQC 4LZJA 2GUWA 1QUFA 4J8EA 3ZYKA 2AC2A 4Q3DA 3PKZA 2WVIA 2KBFA 4BN4A 2ODNA 2ZT7A 3KWFA 4NG5A 4L9RA 5G0SA 4X1YB 1UJMA 1O95A 4ZPXA 5JAHA 2RGNA 1IJBA 3I1FA 1EWRA 2JGLA 3KJHA 5IXSA 3GLIA 3OHPA 3FDIA 3EZ6A 1MOZA 2JLWA 4FC8A 3DMTA 1KJNA 1TAHA 1NBAA 3KEFA 3RC7A 3DBRA 4IG4A 5ALWA 2W7TA 2F1IA 3AUXA 2ZYWX 3H1BA 3ZI4A 4ND4A 1L4MA 2IIPA 3N6VA 3WP1B 1I5EA 3FYCA 1IU9A 1SG6A 5BN3A 2HLDA 4FJZA 4IIXA 3E61A 1XROA 3TWRA 1P6XA 4IO1A 1ML4A 3DM9B 1VHWA 4KYOB 4C0BA 5EE1A 2HO4A 1TD1A 3WQRA 2ID9A 5FNVB 5JCJD 4OAUC 1IIRA 1E1LA 3ND5A 2UZ4A 4K5AB 4OLHA 2XKBA 1XNHA 4HEA6 2B3DA 4U6QA 2PKXA 4EY7A 5DM60 3CJQA 3OEHD 4DSUA 4KE9A 2YXDA 2C8KA 5E3IA 1YDGA 3MQ4A 1A5AB 2BI7A 1OYOA 4QGAA 2WMNA 2COEA 3E4CA 1Y5IA 2WJJA 4NMLA 1VE6A 1O5IA 2X7XA 5JA4D 4PONA 3G82C 4X61A 3U9TA 3KYCB 1RFLA 4PZCA 1JTEA 1U2PA 1DL5A 4ILGA 3WDMA 1XZEA 2A9KA 5EWJB 5I8WA 3LA8A 5BRJA 3T35A 4Y2XA 4HGPA 3GZ4A 4G1CA 4XLTA 3KLPX 2GTPA 2WD8A 1DXHA 5D85A 2ASVA 3ZXIA 4RW0A 4XWAA 1DXQA 2B8JA 2WD9A 3D02A 4D46A 3RT9A 4OMUA 1TAUA 1CXZA 4XGNA 5AUOB 2CLIB 3B38A 4JI7B 1AUXA 1IWOA 3DLHA 4RGBA 2R7MA 1HE1C 1MMFB 3VPSA 1YQQA 2ZIZA 5T41A 4CG0A 1N2IA 4QOEA 2V45A 3OY2A 1CUUA 2Q3CA 2YWJA 4BB6A 1UXOA 1YIAA 1FX0B 4TRJA 4WVLA 1PV2A 1NF9A 1XXHB 1EWKA 4U07A 4NU6A 5DTQA 4EHMA 4G0YA 3U7QA 1QANA 1N5KA 1VL0A 1SWVA 2NVUA 4UNSA 3U3JA 5C1OA 4ATZD 4E11A 5EHQA 4G5HA 5EQJB 1YA4A 4KXLA 4FB5A 2BMAA 2A7XA 2NU6A 4APOA 4I81A 5ULLA 2HJ9A 3K53A 3AY0A 3AI7A 2GN9A 2XQGA 1M1NB 5AIJA 2GLTA 4US0R 3KWJA 1ABFA 4G89A 2J0QA 2VDRB 1W1UA 1HKUA 3DB2A 1SUSA 3GX1A 3ZK7A 3G88A 3W6UA 4B79A 4JP2A 4KGVA 1ZN8A 3A8TA 2XTMA 4D4MA 2VSYA 4KO4S 3T5TA 3JU3A 2W58A 2A5FA 1EX9A 4H1UA 4BFZA 1F38A 5B4UA 1XFDA 2OAEA 4UXJA 1N77A 2OR3A 5AN8A 3VC3A 3V2OA 2QZPA 1G3QA 4ZQFA 3PKJA 2PL5A 1D1QA 4J16A 4NAVA 1N2CB 5IBPA 1ADBA 1TRHA 3UT7A 4Y3UA 3L6AA 3EEYA 2OECA 2C57A 1MX2A 2XUPA 4KJXA 5AVKA 3KJFA 5DI3B 1XTUA 1RCTE 3S28A 5A5GA 2QV7A 2QM3A 4ZV9A 1AKEA 1FQOA 3G2PA 9LDTA 2QRMA 3EWAA 2ZIVB 3EQ9A 2AOTB 1ONPA 2FPSA 2WXNA 2BHRA 2G6TA 2TMKA 3UQZA 1MB9A 1ONSA 5I5GA 2Z98A 3IH5A 4LYJA 5DP1A 1KI7A 4HFMA 1CP3A 4BNNA 3TUIC 1HZZC 3NKLA 5B7NA 1DHRA 1UUFA 4QG7A 1JIIA 2NSZA 4UNNA 2WAAA 5IH3A 1QFXA 5HCUA 1EA7A 1SHTX 4BJ5A 4D9IA 5CXSA 4L7TA 1B76A 2C03A 4H6WA 2ZOSA 4FFBA 1D8TA 5JU6A 3O48A 1FBTA 3OZVA 4H4CA 1THGA 3CB2A 1JTVA 4PAGA 3GVXA 2Y4TA 1VJ1A 4JLDA 3HEMA 4A2QA 4ESOA 3MTQA 5J23A 1J39A 2KJQA 1N4AA 5HMLA 4UCQA 5L6LB 3T3MB 2GRLA 2IITA 4UU0A 3QAQA 5JS6A 2ZVPX 3LQ2A 2HIAA 1TNBA 3GZSA 1Q7EA 4FU0A 4RHCA 3EULA 3WLRA 3B7RL 5GTDA 4A1GA 1UM9B 1QMGA 1Z7EA 4WW0A 1ESCA 2CNOA 3PPWA 3NDJA 3OZBA 3DPDA 4ZFNA 1XAIA 3TLYA 3ZGYA 4AZ3A 2ZE5A 4PCAA 3UHOA 2JD0A 4BU1A 2AI1A 1HETA 3T7AA 4OP3A 1JNXX 2NTNA 3QXGA 5JPDA 1BHSA 3IP6A 1SXJD 3VR5D 4P98A 1TVKA 1BGVA 5LA6A 4LRQA 4Y0VA 4YONB 4LK2A 6GPBA 2HNKA 4URVR 3RBAA 1GQQA 3T15A 4YP1A 3MYRA 1LPMA 1K6MA 4IY1A 4OQYA 3KOZA 3CURA 1QYCA 4BBPA 4IMRA 1WNTA 4RWEA 1V4VA 4C4XA 5D51S 4DCNA 1W5SA 4EKEA 1V6SA 3ZYQA 3VR3D 5LOVB 1DRJA 5JC8A 3IUSA 2IA5A 5EP4A 3FPAA 1DQSA 3U4QB 3JQAB 4P0TA 4CGVA 1VMIA 4AX4A 1HURA 1SVMA 3WIEA 3C14C 2QTHA 3T1VA 4BLOA 1JIUA 3GL9A 2IVFA 4UBNA 5JZBA 3OCCA 3F5DA 3LL4A 4Y98A 2CYBA 4ZAWA 4EA9A 2D2EA 1ONBA 4RHEA 5FIUA 4WKOA 4QUGA 3KTFA 4KXUA 5I3ZA 5AFSA 3RSGA 3LC1O 3IQHX 2PPLA 4A6XA 5G0VA 2C59A 3WGOA 2CL0X 1O5TA 1QE0A 1H8HD 1RM0A 4MV7A 4F2PA 3CPEA 5K03A 5AXAA 5DGIA 5JWOA 2EFGA 2HQBA 3GEMA 2LVBA 4I4NA 1C1XA 4I9EA 3HWSA 1KVUA 4MYTA 4ZC8A 4KAXA 1XNRB 1HNWB 3TTTA 2KCLA 5C7LO 1JH8A 4MOWA 4L8GA 3ROGA 4RKYA 4KYUA 4HMOA 3KL4A 4B3DA 3IOYA 1U2RA 2YJ5A 3OOWA 1Y9EA 3TTSA 4JW1A 2HZBA 2IYLD 3OTQA 3SXUA 1DBRA 3OLZA 4RD4A 2FSIA 2R2AA 4BEVA 3RANA 5FHQA 4LJ4A 5I47A 3WMRA 4OYSA 2VA9A 3DV2A 1US8A 2ZAGA 9LDBA 2OXRA 1NYRA 4H15A 3UB4A 1WDLA 1SQMA 5DBHX 2PK3A 2FZ4A 2IXAA 1K0UA 2IE0A 3WLNA 4LMBA 4FT4A 1QKKA 1UXGA 3E03A 4JNKA 1Y6ZA 5IJ0A 3V00A 3RO3A 3DB1A 4H0CA 2B1RA 1NVEA 3N8KA 4O3MA 1Y6GA 2CBXA 4JLUA 2ROQA 4B3XA 5M72A 3ELWA 4IDPA 5AW8A 5B3SE 3BSSA 3S7FA 5CB4A 1BRMA 3NVKI 4CEHB 1TEXA 2ZB7A 2IHKA 2ILVA 2WPVA 1ZXXA 2P4SA 2VJMA 3AI1A 5T8KA 1YJBA 2WKPA 4CFYA 2PSDA 5LM3A 1H6KA 1ZY2A 5LZ5A 4RL6A 2L82A 2Q7XA 2DKNA 1JW9B 3VGPA 4LRUA 3RTEA 2C9BA 3I9KA 3E9EA 1Q74A 1RAFA 4NBSA 4JBLA 5EIWA 2QJWA 3N8HA 1U3VA 2EIKE 4YP0A 2CK3D 1XEAA 4XSHA 4TUYB 3G0HA 1CE8B 1RZUA 2SKEA 2XMBA 3ZNPA 2RI0A 4OK6A 1Y7LA 4FGUA 4HQRA 2A0WA 3WGMA 1NJ5A 3KPYA 4J0UA 1B8PA 4YYZA 4JNCA 2GEDA 3H2BA 4AB1A 3NVAA 3WB1A 3T7RA 4X20B 4F60A 3EVCA 1HG0A 2C8LA 1ZEMA 2D5BA 2J6HA 3OICA 3F8TA 5DB4A 1L8OA 3EQ2A 1NN3A 2ZIUB 5DH9A 1L5RA 1C9JA 4B33A 1RXYA 1G6HA 3SHVA 1SUFA 5CXUA 3NUQA 3M9LA 5JFGA 5SZKB 4MVJH 4HNUA 4ASUD 5EYLA 3CPSA 3VZQA 3RG2A 2GPNA 1HLPA 2V1XA 1YZGA 4LCTA 2ZYUX 2X4IA 2BJVA 3P2BA 3QWAA 4HK4A 2DLNA 3LFTA 1D5CA 2Z1NA 4CIXA 1YASA 2BFPA 1AKMA 3EVZA 3FKQA 1KBZA 3GLRA 3QPDA 4DQKA 1UAAA 2ZVDA 1G21B 5AVJA 2JHFA 1EXMA 1HTBA 3E30A 2ZTUA 3UI2A 4MUNA 4KHPB 3QLUA 4IXWA 2WIGA 1A9QA 5DM2A 2R7AA 1XEFA 3FRHA 3Q8MA 1RQ7A 4PGAA 4M1OA 1WCXA 1DO2A 1K7XB 2DT8A 5H7PA 3O91A 2R11A 2H7YA 2LDXA 3U3ZA 4CNBA 2BHNA 3BMOB 4DLNA 2A1TS 4LQCA 2O6HA 2BDEA 5FADA 2VPQA 4YUVA 4UOEA 1UWKA 4JEHA 2GA9A 3N0WA 4QDXA 4ZIRA 2XWPA 4U8VD 2Z3ZA 3O31A 4NHOA 1G7RA 4BRZA 3S7JA 5EIBE 3SO8A 1TJPB 3UOAB 3EZXA 3EF3A 3BRSA 2IU4A 2X0EA 3LPZA 4EW2A 3ZDFA 3B7TA 3A3YA 3DE0X 1P5FA 4YRMA 4X92A 4EJFA 3RJMA 4CCAA 2B4KA 2WP0A 2RE8A 4G07A 1KS2A 4A2WA 5K3CA 4UVDA 1UBRS 2Y2UA 2QVZX 5LP6B 4PG6A 4HGOA 4IQ0A 1IY1A 2Z3VA 2YBDA 3ENEA 4RSRA 3IVCA 4C4AA 4BZPA 2J08A 3WBKA 2WAXA 3TKLA 1A76A 5JSKA 3P5SA 1J4AA 4JLJA 4Q3CA 3MELA 4K9DA 3EXEA 2JDID 3L8ZA 4IOMA 2WIBA 1D0IA 2C0LA 3ST7A 4X62B 4JJKA 4C0JA 2OQ2A 5HI7A 3R6DA 1C7ZA 2QTBA 1SD2A 1MUUA 1QIHA 4D9BA 3M81A 4XM0A 2F8SA 4Y6PA 4KI0A 5HRAA 1ZIXA 4L16A 2XT6A 1QFYA 4OJKA 4TTAA 3FU0A 3WRVA 2Z1DA 3O6VA 1F1BA 1FS5A 1ND5A 1IBCA 3HI4A 4DNXA 3EK2A 4EJSB 3V1MA 3DFMA 4R1MA 3DEAA 1UN8A 5KNCH 4BO9A 1H9BA 5H7XA 1VRCA 2IDJA 1H5QA 3SJBA 3LXRA 1JG1A 3K6RA 4X7MA 4ER5A 4P8RA 3UICA 1VSVA 2QSUA 2JEOA 3O0DA 1M2VA 4GOND 5BR8B 4U2FA 3RPEA 1IQ0A 1APBA 4ZI5A 1VJDA 3EDCA 4DS3A 1N2ZA 5CD1A 2BKAA 1RCFA 2HA2A 1NLFA 1PS9A 2AE2A 2WHQA 2XUAA 3B8EA 2N42A 3AO0B 1GTG1 4N7BA 1X74A 1KWKA 4HFNA 3TTXA 1C3XA 4XJVA 1M34E 1R66A 5IJAA 1TCBA 3TZ6A 4H3KB 1Q1NA 4RKFA 3UMGA 4XWWA 3ZXSA 3HM2A 4ZAVA 4YMLA 4OGKA 4PG5A 4RKEA 2XUDA 1GCAA 5DTMA 2H2IA 2JFFA 1U9JA 1S02A 1LPPA 1XVUA 3I4GA 2PMWB 5JDIA 3GG2A 3ZHCA 5EXXA 2XKKA 5FWXA 4OQPA 4NS1A 4NZMA 1XTIA 4Z0NA 2C9OA 4F5WA 1VZ3A 3R6WA 1KNQA 4CKYA 3N8IA 1PN3A 1SBQA 1SOWA 3ZIMA 1QVZA 3TRKA 1I3KA 1G5PA 1MFZA 1U0FA 1SA5A 2XPZA 3NBAA 3AQ4A 3BH0A 3G6WA 3MGGA 2LIVA 4IWNA 3GHHA 4CLHA 4U95D 5ER6A 2GX6A 2OSVA 1TB4A 2JFUA 5C7OO 3BXGA 4L9AA 2B5OA 1ECGA 5BVGB 1PX0A 3Q5GA 2GK7A 2DOKA 4Q66C 4AXXA 1V2HE 1GPMA 2BPOA 2Q8QA 3RRNB 1W85A 1SG9A 3NKVA 2I2OA 3DGFC 4MZXA 5DMXA 3LTEA 5IKOA 5DEIA 2L17A 4L2YA 5D7BA 4PGFA 4Y6CA 1HG5A 1XWFA 1B23P 4QQNA 4MKFA 1UBUS 1Q50A 1O0SA 3ZLTA 3KPJA 2VPXA 3KM0A 4WZAA 3L7CA 2QRVA 2C2GA 1NYLA 4GE0A 2CNLA 1HE4A 1OLXA 1I2DA 4H0FA 4IJWA 4JUAA 3VR6A 3II6X 2I4OA 1TK2A 2KPOA 4Y2RA 3IQZA 1Z4LA 1MOPA 1F2UA 4AV7A 4MWCA 4NENB 1R0WA 1Z3YA 4JQCA 4AKHA 3LP6A 4OHWA 5H3LA 3PRYA 1CPYA 1UBFA 2NMVA 3LQ4A 1TL7C 4B71A 3P0RA 3UPUA 4K3UA 4PVDA 4QSMA 3BUSA 1VP9A 2JEKA 2XV1A 3MAGA 1E66A 2GBLA 2AUNA 4Z4HA 5IC5A 2D5IA 2GJSA 1HRDA 2J3IA 3R9XB 2Q6LA 3F3YA 3VDRA 3AUUA 2FEKA 1GA1A 1YZTA 4YV1A 2BTQB 4MVCA 4BO2A 3KHSA 2YC2C 4NCAA 2FXIA 1YC5A 3H2KA 4AZSA 2CKMA 3Q8LA 4G2VA 5FUBA 2JI8A 2C82A 2I1JA 2F3TA 1P5HA 4MQEB 4TM7A 3WNQA 4MA5A 1UEIA 1TMYA 2EKZA 2P7HA 3W8EA 2A7QA 2NPOA 4XYMA 2C29D 4A82A 3L4BC 5ECYA 5CT6A 3E9MA 1TZ2A 2Q9UA 1QBKC 3CZCA 2O8CB 2I55A 3EDOA 1QLHA 1KTVA 3LOQA 3QLTA 5JQWA 1GL6A 1QDLB 4M8SA 3Q0IA 2V1UA 3GEIA 1JHPA 4ZO6A 1CJCA 3EXIB 3NWJA 4KPFC 2J0VA 2V6GA 1R8JA 4JA9A 2X15A 3F1LA 4EYKA 1U98A 3ZTTA 1W7AA 1NXWA 4Q1VA 3NHWA 2K6GA 3QW4B 1E2BA 2YJTD 3ZS8A 2CCJA 3ZWBA 3BWXA 4PS0A 2JKYA 2NLOA 3Q7TA 1NUSA 3G9ZA 4KREA 3L0DA 1PG2A 4I50A 2OBFA 2VHJA 1I3OA 5EJ6A 3IHTA 2DLDA 4JCOA 2PSJA 1U3FA 2H6IA 2IZ6A 3PFBA 5E6RB 4Q0MA 3QP9A 3GY0A 2C5LA 1U80A 3NHFA 5E3JA 1H3NA 2QD5A 4OSOA 2Q6KA 1QH1A 4EQZA 3TNJA 2Y4OA 5KAMA 1XNQB 3P2EA 3H6HA 2PFKA 4FE4A 4GRIA 4G85A 1A71A 1A77A 4ZVNA 4F3RA 2ADFA 5FX2A 3B1YA 4GSLA 5BRAA 4O60A 5CMLA 1AKUA 4NOLA 2Z9DA 1PHPA 5B1EA 1I9CA 1TJFA 3LIPA 1GYRA 4A0GA 3ZQKA 1SCDA 4UU8A 4BVBA 2CG2A 2OHOA 3WHKA 5K3SA 1UDWA 2NUBA 2GFQA 2G40A 3ODGA 2KBEA 3AHIA 1HDXA 4BMDA 5CM8B 3FWVA 2VZEA 4GMJA 3JZAA 5BSWA 1E9BA 5AJXA 4BC0A 4P82A 2V4UA 4K5BA 4BCBA 4QDJA 3G8YA 2AG5A 3AW9A 3HJBA 1QTIA 1T9GR 2LXNA 2Q0XA 2E7ZA 3K6SB 5IKXA 2J1LA 3EC2A 1O0BA 3ZHXA 1FP1D 4LRXA 5ANRB 2BKUA 1DNPA 1USKA 5F7OA 3ZY5A 1JKJA 4TMZA 1ISGA 5J2UF 4DM4A 1RLJA 2RHOA 3TLJA 5FUQA 2C94A 4D6YA 4IRUB 4FKMA 4J49A 2EJVA 1PQPA 1RAAA 1IKND 1EX1A 2DYKA 5KINB 2H5LA 3BEOA 5JNWA 2Z8ZA 1RTKA 2CGEA 5KWEA 5DZSA 2XD9A 1NQTA 2JGDB 2VCEA 3UY4A 4LFCB 1RQGA 4LXGA 5JSZA 1XVTA 2YHEA 5E1OA 2I3GA 5IU6A 3KYDA 2JJ1A 3U16A 3GIDA 2DBZA 3UTCA 3WQBA 1I2AA 1U2TA 2FZWA 4B35A 4I1PA 4Y2VA 3ZGZA 1PV1A 4WXYB 3TQOA 3QUBA 2X7JA 4HQKA 3FUTA 3CTPA 2WPNA 1NBIA 2AH5A 4LJAA 4K26A 1FTGA 3UWMA 3ZDBA 3HR8A 1Y9JA 3E9NA 2GB4A 1SG0A 3AEUA 1D5WA 3KQOA 4JLVA 4HRAA 3PLAE 2OOSA 2ACEA 3NORA 4CM3A 2F64A 3GMIA 1EGVB 4H9GA 2VOJA 4E1BA 3MAJA 1Q95A 1UL1X 4LSZA 2DPHA 2VQEB 1AA6A 1U5CA 3H17A 4ITVA 5HIKA 4WY2A 2VT7A 4QPCA 2RBGA 4BBJA 5ITZA 5BN1A 1GSIA 1KMNA 2R8BA 3HYCA 3M0EA 4PUCA 4C4ZA 4I9GA 1VKNA 3GBPA 1EVIA 4F11A 1L4UA 3MYYA 2XA1A 1HA3A 2IF0A 5DASA 3HRAA 4K6GA 2EP8A 2BDUA 2H16A 2F8LA 2D8AA 4GD3Q 2C97A 4U7WA 1P9NA 1FMTA 1Y82A 1R4MA 2AYYA 3P4XA 3WMGA 5EZSA 4GZ5A 5IJ9B 1FNSA 3AY7A 1Z63A 3FH0A 2PU7A 3K9GA 1A98A 1KP3A 3ZDAA 4OYLA 1KA9H 3D7SA 4JC0A 5SYMA 2BIFA 1NW7A 4Z1MA 5HM6A 4EF4A 3O4VA 1PBTA 1T5BA 5A0TA 4EHHA 1MQAA 4YRJA 5K05A 2V9PA 3BT7A 1GARA 2AVNA 3E9QA 2Q6IA 1FC0A 1JAHA 5KYKA 3FY4A 1BNCA 1T26A 3UKUG 2FVYA 3AEZA 5GV7A 4MW4A 5A6CA 1FDWA 1MZPA 4ABTA 4I19A 1E94E 1JT2A 5ENRD 4EQ6B 4KN9S 1T8UA 3R9KA 4RCYA 3GPCA 2C2KA 4C0AC 3A04A 1C3OB 2W2KA 2PSEA 5IN5A 2FI7A 3Q2KA 4C4TA 5KVQA 1S0UA 4M37A 4XH9B 2QM8A 3EVGA 1SZ9A 4PO9A 3JWIA 3FCCA 4KNWA 2AB0A 5C5DA 4KTVE 2PH1A 2VFAA 2JEZA 5I4IA 2JGIA 2VRCD 3L4SO 2I6UA 1FMCA 4FSDA 1KOJA 5C4GB 3VBCA 2QJTA 3WO1A 1G3RA 1LDBA 3X1YA 4E6HA 2GFHA 1QP0A 3DUFA 2V0GA 4XFJA 4DY4A 5BV0A 4GM4A 4COKA 1V1MB 2PBRA 1IN1A 2P41A 4MW9A 2JLYA 4RTMA 1Y3IA 1XRLA 3QWFA 2YINC 3ZEAA 1O9HA 4UHFA 1UEJA 3MOSA 4R41A 2ODEA 3DD5A 3IPAA 4NY1A 5DNVA 4FMBB 3VUFA 1T4GA 1QH9A 4UNQA 3KKKA 5K6AC 4BPBA 1A96A 1OFGA 1H23A 1PJAA 2XEXA 2PWYA 2YOFA 4MVJA 3V33A 3FHEA 4DCUA 5IEJA 4CCSA 1TDJA 2P5SA 3VSAA 1OILA 1F48A 1YZNA 4BO8A 2IU6A 4LC9A 2V4LA 3RS8A 3CZPA 3T7KA 2HMAA 4AKTA 4D56A 3GRFA 3AT1A 2XWBF 2JAPA 1ZCBA 3WB0A 1QRRA 1J2TA 2A67A 3KSQA 4DMKA 2D1YA 2HSDA 3V6MA 3DCIA 3PZ1A 1N2SA 1X7XB 1RKVA 3DT9A 3E8SA 4RX1A 1OA1A 3JR7A 3FN4A 3NF1A 3PE6A 5HJ2A 2BKXA 4DWWA 5BMOA 5EJ9A 3LFHA 1FVXA 4GE3A 2F43A 3NJ8A 4EEZA 1U1FA 4LRZA 2K5UA 1ZKMA 3B1XA 4A36A 1MLDA 2DWQA 3Q11A 1V8FA 2GPSA 3CHOA 4B3JA 5JVDB 3F6PA 4HRVA 1KQ3A 4XW2A 4FGSA 1M5RA 4D1YA 3CF2A 1FW8A 4MUAA 2H1LA 1AV6A 3MJTA 1L1EA 2R00C 2AC4A 1KRHA 2X3FA 3WL3A 4HGRA 1MW8X 2KCKA 3KD7A 2JLUA 1ODLA 1OKKA 3PNYA 4OHBA 3EDQA 1A9SA 2ZB2A 5M7EA 4LUNU 2R8OA 3LXMA 2YN2A 4MB0A 1T6NA 3ET5A 3TR0A 2YZ2A 4GPMA 2QOEA 4DV5B 3COZA 2A59A 4N3AA 3IB6A 3BXZA 3QUCA 1ISJA 1MW9X 2ZATA 3OX4A 1KO8A 3ZOZA 4GBGA 1DRWA 5BSEA 2WK1A 5H9WA 1ZC4A 4AMYA 3JVIA 1A9OA 5DVZA 1B42A 1QPBA 3I5MA 4B32A 4DTCA 4J2TA 2I1VB 1J8QA 3IHWA 2KLBA 4HDCA 3JATA 2X6TA 5KBYA 2W00A 2KE5A 2R6JA 4HADA 4C7OB 3ZN2A 3RHTA 3N70A 2H51A 2WD7A 3MOIA 5EHNA 1V16B 2CDRA 2QQ0A 5I7UA 3ON5A 3IIEA 1E6KA 1N9ZA 3GFSA 5KNCA 1Z15A 5E2AA 1OBCA 5EDSA 3ITEA 5L3SB 1HG1A 3SFXA 3M5WA 5KHLB 1QYWA 4JHXA 3IULA 4F96A 1I2MA 3HKEA 1XA0A 2E55A 1MQ9A 2FCAA 3IE0A 3CXUA 5DLDA 4OXRA 4Q4HA 2J6BA 1ODFA 1YBVA 3RVSA 2H6GA 1TGVA 3ELBA 3FW1A 4HMPA 3V4SA 4HNVA 1SUAA 3VMMA 1DAMA 1FX1A 4WTOA 2O2IA 2R8RA 4UMDA 3R4VA 1WIWA 1RHKA 1PU2A 5CFLA 5G05C 5BOSB 3AG4E 3AI3A 2UYGA 2O19A 3VKWA 2WZBA 4A92A 3B12A 4WESA 3AG3E 4P0QB 1VE7A 3D7MA 1AWCB 1TN8A 1BXKA 3UFXB 1H4SA 5DYTA 1LPBB 5JYBA 3ZBQA 2ADOA 3BIFA 4ZYXA 1XO1A 2IYTA 1I6LA 2VF2A 4XFDA 1NP6A 1KPSB 1GGNA 2BF7A 2G3YA 4QPDA 3QY9A 5BQ5A 4UPEA 1PT7A 3LVRE 4ARBA 2I62A 4R8SA 4QDTA 3CR8A 1OFUA 2MDTA 2C0CA 1CY7A 1S7GA 3PNKA 4BQPA 4HL6A 2OUKA 1Z06A 3TG5A 1I6KA 1L7PA 1NF8A 2PX3A 2VF8A 2R25B 4EA7A 4X63A 4URXR 4EITA 1PTJC 2GZSA 3AV3A 4OVUA 4BMSA 1YMVA 2NUAB 3AKDA 2XTAA 2KQUA 2CUTA 4ZI3A 4PPNA 1PT8A 5D3MB 2FW8A 3O2QB 2EBFX 1GP2A 1U1IA 3H2IA 4EJMA 1GDHA 1GILA 1GZUA 2H1HA 4DR5B 3ULQA 5J4HA 4Q4DA 1SVWA 1ZJ4A 1A5EA 5LLSA 3OPYA 4QO7A 4DIFA 4Z2YA 3M6FA 4UM7A 4LDZA 5FFNA 4QQFA 2OFXA 2IGBA 2XF8A 2F00A 1PTKA 2P9QA 3I04A 2XB2A 3F5SA 2PR2A 4TLMB 2QX4A 2NUPB 1XTPA 4WUVA 1SWWA 4HSEA 4CQMA 1ZCJA 1PCXA 4BTVA 3MF4A 3L02A 5CCXA 3AF0A 4JGBA 1G291 1I01A 2QD1A 2DTDA 2XBMA 3O4RA 4MIEA 1E90A 3FR8A 5KYTA 1E3LA 4G6ZA 2CWDA 4U7TB 3DFZA 4GS5A 3PQ5A 1KNXA 5FPYA 1XZHA 3VFDA 1O6GA 3C3OA 1N52A 5D5HA 1C3VA 1YDHA 2QMOA 1K89A 1QYMA 2ZIXB 1XQ6A 4QBIA 3W79A 5EKDA 1VJCA 1RBMA 2H0AA 3PGA1 5CDGA 1TO6A 2N1MA 2Q9AA 3NT4A 3HWWA 5EHXA 2FR8C 3CLSD 3ZI0A 1GU7A 1RQNA 4OHKA 4BQQA 3SMQA 1X8XA 1LV8A 2DWCA 2O2SA 2IZOA 2XVYA 4KKXB 1QU3A 3BGVA 2A84A 4DQXA 4XVCA 3VC2A 3UM2A 3EB9A 1J42A 1RVV1 3V8BA 3R0ZA 5JI3E 2WE8A 4NBKA 2OHVA 2X0DA 2W42A 2P5TB 4BNHA 3K20A 5CDYA 1CR0A 4ZVQA 1BXZA 3HRKA 3RG8A 4PYLA 1JHOA 5LKRA 1ZK4A 3NHZA 2BKKB 1FP4A 2EG5A 1YMQA 2NSYA 4IKPA 1R64A 1K68A 1MA0A 2PAFA 4V1CA 3HJHA 1SBNE 3ZIAD 1PD1A 2GRPB 1KMHB 3BCRA 3DZKA 4NECA 5CA0A 2QR5A 3E32A 5CW2A 3RVNA 3FP3A 1V6CA 1SFRA 2AF4C 3DDHA 4U1RA 1N6NA 3UAZA 1V6AA 3LUKA 1XXHE 1DXYA 3TWVA 5KEIA 2MINA 3FTQA 2GF9A 5I7OA 1QOPB 2H1RA 1R5OA 1XLUA 1EFRA 1T8TA 3KCQA 2JH3A 4UE3S 1PFQA 1UFVA 4B84A 3ZHYA 1X1QA 4F2GA 1TUGA 4G9GA 3ORFA 2PHZA 4NKRA 4G1TA 5M29A 1X7WB 1GGEA 1Z5GA 3ZR4B 4UDYX 1AZLA 2AX3A 3CKKA 4IS2A 2LNDA 4UZSA 1EUCB 3OOJA 3I01A 4L08A 3CX6A 1IXRC 1U0NA 2QLNA 3AHCA 4R1QA 4PHCA 2QQEA 1G3IA 3DL2A 3KZ1E 2IFTA 3D59A 3GHYA 7ADHA 2RI1A 4WKNA 1CRLA 5IT5A 4KBQA 5C1BA 3EG9B 3QE4A 4J8YA 1DC4A 4E6EA 5KOHB 4XKJA 2OXCA 3URKA 1MX4A 3EGDB 3SC4A 1N2CE 3CB4A 1JFSA 3PDNA 3PQ2A 3RS9A 5KJ6A 3OF3A 4PAMA 3SC2B 5C46F 4OJMX 1HT1E 1JJAA 1ZCZA 2GRMA 2BGUA 3NT5A 2PH7A 5IC6A 3FUCA 1EWQA 3FSRA 2Z5GA 3NIWA 1EK1A 4MPPA 2QQGA 5ESXA 3ASZA 4HC4A 2PUDA 3JPYA 1W4LA 3W4KA 1JWAB 2VUUA 3DOIA 1JPNA 4CLOA 4D92A 4Z3KA 3DE2X 3BWYA 3VLFA 3F73A 3DBHA 1BROA 3UYKA 3MJHA 3KQSA 5G04C 3FYUC 1OCRE 3V79K 3FFXA 4QX6A 4LVCA 1Z2AA 2PDAA 1QB8A 1TTTA 3KKNA 1T3GA 3SQOA 2OZKA 1RR6A 2A30A 2H2GA 4AQ7A 1Y42X 1NZFA 2GEUA 2VJPA 4QYIA 1Z0UA 3D9LA 3X2QE 2O6LA 3K09A 2EQBA 1PBNA 4OB8A 4QD3A 3IHVA 4B4KA 4L85A 3UMVA 2I8CA 4YMWA 4A15A 4R8RA 1LFDB 4DSOA 4MRNA 4HDKA 4II7A 2H07A 3S8YA 1KSJA 1KVSA 1CUDA 5CLIA 1QUEA 2C5AA 2POQX 3EFOB 2LP4Y 3CT4A 5L4LA 2RHRA 2B69A 5DOZA 1PYOA 3VR6H 4X5OA 2HREA 4AXHA 2VT3A 1OGJA 3L9WA 2SCUB 2QFCA 4EW1A 1FP7A 4I6GA 1RT9A 5CDFA 1XN4A 3VYWA 3COJA 3IKMB 3O47A 3HCCA 4MWZA 3A27A 1ZM3A 1IM8A 1HNZB 3PUIA 5HRYA 3RC1A 3EWIA 2JAHA 2XIJA 1ZRMA 3I2KA 2OT3B 1XZCA 4NCBA 1LBHA 4DLAA 2XCUA 2WABA 2EBHX 3ZHBA 1UP6A 4LNAA 3C8ZA 5MN4A 2WPDA 3DF7A 3CX7A 3ANYB 1X0XA 1PAUA 5CNKA 2C7GA 4C4PA 2FZEA 4PS3A 2DUWA 4QARA 5EWLA 4MW6A 1DC6A 3JVVA 1E8XA 1L4YA 3OFNA 1LK7A 4KAFA 3E9RA 4QT0A 2B0OE 2O0LA 4FM9A 4LXYA 4C0KA 1THTA 1VIYA 3ZY2A 2QN8A 1I4TD 4E46A 1AMUA 2C5BA 5AK0A 2YWDA 1Y7PA 2DBRA 1MO3A 2ZTLA 3HNOA 2Y93A 5TT0A 1X87A 3R1IA 4HEQA 5EIBC 1MRNA 3EC7A 4BS9A 1DAPA 3ZHEA 3VJKA 3LS8A 3BA1A 4TL8A 3RYIB 4K6MA 4GKKB 1M10A 5IPFA 4JC4A 4BWRA 1XTTA 1YAJA 3VNQA 4O4IA 3WHIA 5LQDA 5CW1A 1R6TA 3U6BA 2NZWA 4QFMA 2NVOA 1XA4A 2IUSA 4PHGA 1H9CA 4IKEA 1Q7GA 2K4MA 1FYFA 1QSGA 3W5CA 4MGZR 1M8JA 5JZOA 4FBMA 1QR6A 4ZJPA 3CEAA 3C1OA 4FR0A 4AJ1A 4WVFA 1NNI1 1CYEA 2QYOA 3H9JA 3VI4B 3GEGA 3DPSA 1SKUA 4R5HA 2P9JA 3ZE6A 1PVDA 2Q1UA 4L2IB 1WDYA 1H6OA 4MLCA 2YDYA 5H02A 4ID3A 4YLGA 2BMFA 4B3IA 1EAMA 2HSGA 3IPLA 1FFXB 3O21A 3LNCA 4P08A 4MYCA 2D7JA 3TIIA 4E07A 1HFJA 3MJEA 1FLNA 4IRXA 2J9ZB 3RHZA 3CV3A 1FT1A 5IDQA 1WMAA 3VPFA 4GC5A 3DEZA 5BUCA 4R7GA 2AG0A 2ZUFA 1CUGA 1E3SA 2W11A 3MUNA 5F52A 4EHBA 2IEYA 3GJ5A 3K5IA 3VAZA 3IQIX 4EMUA 2O3TA 1XP5A 1LRJA 3PQCA 3ZU6A 4BEPA 2R96A 2HEGA 1D03A 2RHWA 3VTYA 2BFMA 2BUCA 1JYSA 2WSSA 2AQKA 4BMNA 2HPHA 2UUPA 3QVLA 4M9XA 3HXDA 4JOQA 5EN4A 4G37A 2B1QA 1E3IA 1NC1A 4TWZA 2WTEA 1JBQA 4AZ0B 4B93B 1EM6A 4AO6A 4ADSG 3ZVRA 1NV9A 4DANA 2AWIA 4IN3B 1E2UA 4KRFA 3D5QA 1BC5A 4D5EA 1T8YA 4UOZA 4O4HA 3B1WA 3CE9A 4TRMA 4YJFA 4NSNA 2X4LA 3UGTA 3SIWA 3QLEA 3P27A 1ECCA 4LZLA 3ROXA 1T5HX 1RYBA 4RVHA 5DULA 4JUIA 5JH7B 4A0QA 1IL0A 1RXSA 3SJ7A 1W1WA 2XZOA 1ESDA 2PUHA 2D5CA 4Q9JA 1FY2A 3FZEA 2J0UB 3TBFA 2RKBA 4PLPA 4YMUA 3D0OA 1LH0A 3OOEA 1R16A 1V96A 4G4JA 3VKGA 1TD9A 3HFRA 2IYZA 3U37A 2GJ9A 2NYRA 4MWOA 3RJ5A 4NE9A 5C52B 3ABOB 2BCGY 3V30A 5TDHA 4DCPA 1UK8A 2DC1A 2VGXB 1OWOA 1ZONA 2K2WA 2O54A 4EUNA 5J1TB 2H1VA 4JI3B 3NG1A 2GNOA 1DEKA 1LBTA 4Q3LA 3R77A 3W5AA 1MVLA 4BDSA 5K9ZA 3DEJA 2WWXA 1U7TA 3ICWA 2PD3A 1OPXA 3E82A 2P9BA 2ESRA 4J0KA 2X2PA 1SXIA 4J3NA 3GEDA 2Z8YM 3SF0A 3GT7A 4A16A 1PS0A 3AM5A 4PS1A 1RYNA 4ZVUA 2F3UA 5MGBA 3RUIA 3TWXA 2NZXA 4BTAA 4FDAA 2ZQYA 1N9GB 3NH9A 2D3TA 2AEMA 1OF1A 2AN5A 2M6KA 4ETMA 5I9NA 4NPHA 1N5DA 2VHUA 3HB5X 3MW8A 1XL1A 3O4HA 3OE4A 5LYJF 4EH1A 4F86A 4PQRA 1SRQA 1PR6A 1JH9A 1TMGE 1FPPA 5D3KA 3IPCA 4Y8VA 2RGGA 4ZEXA 3NHKA 1T2CA 3JQ9C 4GO1A 2V3WA 5I51A 5JSFA 2IP4A 4G9BA 4P92A 4OL0A 4IHKA 3JYNA 2ORVA 3AEKB 5A0FA 3FA2A 2N1BA 3MCUA 3U4AA 3DZFA 3K6KA 5DN9A 5BYAA 3ANLA 4YCBA 3KCNA 2ZTVA 4CYMD 2G70A 4E5MA 3I8OA 2J7PD 3LCVB 4QQ8A 1ZU2A 3QYPA 5BV1A 1MF7A 1DRUA 1AIPA 3JQ0A 3HP4A 1PRYA 2CE2X 5HWSA 3MD0A 3STVA 2FW9A 2A2ZA 3WP0A 4D98A 1NI3A 3VXKA 2VCHA 1TLLA 3GUYA 4REMA 3MUFA 5ALNA 4ZYWA 1WDWB 5G02A 4KN6A 3KYBA 3FAKA 2RMKA 2OEWA 4ND3A 1IM5A 1YHYA 1WVIA 4I1SA 5EIFA 3KS9A 1ZN9A 3KLMX 2A0FA 2VYFA 3B7BA 2VSXA 2NO7A 5J43A 1UPCA 5JJ7A 1TC1A 5JV5A 4P2GA 4GPZA 4UI9K 2VYNA 3H0EA 3R5TA 2V03A 4TS3A 3HY6A 1C1YA 3AUYA 1BWQA 1S3FA 4WN9A 2YICA 1KPGA 4NNPA 4E2FA 3Q2IA 1O6ZA 5CBPB 4EELA 4YRDA 2CJWB 4NXNB 1NLZA 4KIGA 3MWJA 4EP1A 1XDBA 3ZCUA 4I1IA 2H06A 4LQ4A 1IN5A 4MI3A 1XZBA 3AB7A 4QXOA 1UBHS 1FFEA 1GN9A 2P4QA 4NE7A 4CL0A 4IWXA 1SR8A 2V4MA 3T9DA 1TCAA 4RV5A 1LD7A 5JNSA 3LGAA 1JJVA 1SMKA 3CSDA 5IJWA 3MTJA 3VC7A 1SQ5A 4I7EA 2WJAA 5KYWA 4K6OA 1X94A 4RFSB 5GP1A 1NIPA 2O1SA 4FFVA 4OFXA 3NTUA 2IU3A 2AR7A 4OFWA 3M6VA 4JJ7A 5JZSA 2FF4A 1C7JA 2G09A 4Y2YA 5B64A 2I1KA 4XCVA 2HN9A 1QS0A 2A6PA 5U4QA 4EI8A 1UDXA 3D7KA 4ZEOA 3M7IA 1FS6A 3QEKA 3ZE1B 3WGUA 4F6RA 1I1NA 3UMCA 1IULA 3K0FB 1S8AA 3HYRA 3N0XA 5HHTA 4DGSA 4HUQB 3SG0A 4MTLA 1WXGA 1GPH1 2FUCA 2YS6A 4RMJA 3KP1A 2ZWOA 3QK7A 2HUNA 4JI6B 1ORRA 1CIJA 1XBTA 221PA 4V3IA 3O8OA 1G5FA 3I4FA 5CCDA 4DWVA 4NBNA 3ZDXB 1P17A 1OZ0A 3Q4AB 1P1KA 1IBRA 2FWJA 4O5AA 3B6MA 1W5AA 4I1UA 2YYSA 1ZGHA 3IR7A 1MZCA 1M2OA 3EUFA 3IALA 3O7MA 4J3FA 1O1YA 3BFXA 4CJXA 1P0IA 1XQXA 1DZIA 1QKIA 4F5ZA 2Z83A 4POOA 5KU1A 1PNRA 4C4SA 2ETBA 4YVFA 3ULKA 1EM8A 2EKDA 2QNRA 5JSUA 3UJBA 3EQ8A 1OLSB 3RUFA 1EAYA 4QUAA 3VTAA 2WF8A 1T2UA 3LSTA 1YCHA 4IV8A 2PXHA 4CI0B 3G0GA 1X42A 4CTMA 5IJXA 1XEWX 5LQJA 1PZEA 5MGNA 3RTCA 1NLMA 2C4MA 1DG1G 2HA7A 3GNQA 4KB5A 2P69A 5BXUA 3O90A 4BY6A 3OQJA 3O75A 2NM0A 3A6GA 1UOQA 5DK6A 1LDGA 1QKJA 4NMXB 4GICA 4UCXA 4R9SA 4RNDB 3EOBI 4EUFA 4MULA 1O97D 2I03A 3DYBA 3C43A 2YN0A 2X5KO 4XZ4A 5MN6A 3SJUA 3REFA 4CQNA 1RYMA 2XGSA 4ZEMA 5B57C 3Q2OA 3ZCQA 1N3YA 3T9KA 2GNAA 2AMJA 4QOHA 3HN7A 2DUJA 3C3PA 1Y8ZA 4Z49A 4MINA 1OTYA 3VSBA 1HFKA 1EP1B 5CRUA 4ZZ2A 1HXHA 1IHYA 1KZGB 4N01A 1T0BA 1MNAA 4F3CA 1DINA 3MJ4A 1I1HA 2GAIA 1WL8A 4YI5A 2WY2D 2DVMA 1DG3A 2I91A 1DIOB 3BHJA 4PQFA 3DBOB 1U1GA 2V7TA 2D62A 2PS1A 4DRXA 3RREA 3RAPR 1CY6A 4LJ5A 2VRWA 3ZGLA 5EPOA 1JAXA 4JWKA 1XCGB 4XVQA 4CM7A 4I55A 1GKYA 3GEEA 2ETAA 2RK3A 3FCAA 3D3NA 2JAUA 4K9PA 3HZRA 4D8YA 5EZ6B 4TGLA 1V3TA 3PZ3A 2VHYA 3BXHA 4N7JA 1R37A 3PZ4A 1G20A 1N6IA 2YXEA 2ZBEA 2UVPA 2PRIA 1CQJB 3AKZA 4N76A 3O4ZA 1JHUA 4NEGA 4HWKA 2X9QA 4FEEA 1KQFA 2BE9A 4ZXPA 1D2EA 1GG8A 2PWZA 1KK1A 3G8AA 2VUHB 2WAYA 2FPWA 4AO7A 2VDMB 3BTVA 4G1UC 1SU8A 4CI9A 4MV3A 4ARAA 1JSZA 4EUEA 1T4MA 3QX3A 2MSNA 2DPXA 1D0VA 4RTRA 3QHAA 2J5BA 3BSWA 4X90A 3GCGA 3RU2A 1KMIY 2R4QA 2FPXA 4M0PA 1HQYE 1W0KA 5BQOA 2QAGB 2VEDA 1IPEA 4BX2A 5JBNA 1Y34E 2Q27A 3WNVA 3T5GA 3G6KA 4P84A 1E5DA 1XD9A 4IH4A 3CZ9A 1MYOA 1E2JA 2PH5A 1XCLA 4LERA 3EU9A 3B48A 4U00A 3V2UA 3RUAA 4AT1A 4OHPA 1SJ9A 2FK7A 2DYRE 3PF8A 3VVLA 3TQSA 3VM6A 3I42A 1DX9A 1BE6A 3D8RA 4QBGB 4LFBB 3GZ1A 3U3WA 3U7RA 3WZ2A 4K1XA 2OFWA 4FFDA 3OXGA 1TKRA 2JLRA 5K0GA 2VP6A 4Y2GA 2BP7B 1YO6A 1ZBQA 2CHUA 5LSAA 1G7TA 4BVEA 4WY5A 3OEEA 4P3YA 1Q1ZA 3R6GA 2NQ2C 1GPAA 3BPSA 4GDMA 3IFSA 4Q1CA 5SY4A 3EGWA 2X23A 2GN0A 4YBRA 5KCMA 2W43A 2P5UA 4CU2A 5L4SA 5KYNA 1I4DD 1J99A 3V8NA 3QKIA 4GTQA 3NOXA 2OMKA 5G1PA 1QU2A 3QUSA 2P3OA 1U7OA 1D1SA 2PRJA 3FWPA 1ZJ5A 5B3JC 5TMPA 2AN4A 3H11A 4JFAA 5CT8A 3ANNA 1OY1A 4Q9KA 1C29B 5KX5B 1RYEA 5F9HA 3NDRA 4JYPA 4QVKA 2I7DA 2VNHA 1E6LA 4ZCIA 2OKGA 3GRRA 3ZKAA 4U0KA 1TQ2A 2JD2A 4CR8A 1NUHA 4N0EA 1WMDA 2MMCA 1HMPA 3V7WA 3BBLA 4FLEA 1RJFA 1SQSA 2RGEA 1NP3A 3VZRA 5CBNA 1G8HA 4PHTA 2VAPA 5COBA 4QG3A 1PDOA 1YA8A 3TFQA 4B31A 4W5RA 5C18A 5JR3A 3QYAA 2MRIA 1CNFA 4GF5A 5BRNA 4RY8A 3B53X 1U63A 5BR1A 4YASA 2JFXA 2Z2YA 2WFZA 4PVCA 2C9DA 2C5GA 4RD0A 1XEXA 2Q3JA 4ANUA 3L43A 5AK4A 1NPYA 2JGKA 3BORA 3HV2A 4BYGA 3DJFA 3QVKA 3WNDA 2HEIA 1X1TA 3PJRA 3UAVA 3WYDA 1P1FA 1KYYA 1OIXA 4L51A 2PE5A 5I45A 2AJ8A 2EZ4A 5EJ8A 1YBAA 1T9GS 2VZ0A 2GMWA 4PEVA 1V47A 1ZH8A 1JDUA 1U28A 5FOUA 2RCNA 1E18A 4ZAZA 1DTEA 5C2YA 3IUYA 2LSVA 3CINA 2VN8A 1HFWA 1HH8A 3GAZA 4MRMA 2X6JA 1OY3D 4N3NA 5LPNA 5HMMA 5CT5A 1T2EA 3OPNA 3SFZA 2LDBA 2D8MA 1X1AA 4O4LA 4A0HA 4JB3A 3FPGA 5LOZA 3HJTA 3SHOA 3R2JA 3CW2A 1RWPA 1VB3A 2CFUA 1OLUB 3T8KA 1GUDA 4B75A 4H7YA 3TBHA 3SFVA 4WOJA 4G26A 2W83A 5FQ8A 4N8SA 3DF9A 4B46A 3DFIA 3AJRA 1N1GA 4NESA 1U9YA 4HYEA 5CX4A 2H4WA 5EZYB 4HXGA 4MV1A 3BDAA 4UXIA 4WA7A 5F2OA 2GGFA 2ZEJA 5KYVA 3LRTA 4RY2A 2R6R1 1Z47A 4FDTA 2FRXA 3KQVA 1DQNA 4AM8A 3ZCTA 2WWWA 2D5AA 2RHHA 1DTWB 1YGPA 4EKYA 3BUAA 1X80B 2C20A 1WTAA 3LFUA 2VNSA 4YNDA 2HM7A 4X84A 4UFOA 2RKWA 4FC6A 2EHJA 2YZMA 4J1QA 2E87A 2JGNA 4Y0NA 1EEXB 3L6DA 2ZRLA 4KH1A 5AQBA 1E1CA 3AFOA 1XTJA 1NX9A 1XRNA 1JALA 5JDCC 1Z12A 2Q8NA 2HIMA 5DEOA 4U7PB 2VWPA 3OAAA 2UZAA 1KI3A 4NCJA 3R3HA 4PPYA 3L7YA 2Q1SA 2BFCB 2J4DA 4PCUA 2WDZA 2V8BA 3T9AA 3PYLA 1GA4A 3SSAA 1OD6A 2JH9A 4AJPA 2WF7A 3DLAA 2XS8A 1HWYA 5CA1F 3J7TA 3FNQA 3IUEA 3N76A 1CUZA 1NDHA 4QFCA 1DAKA 5IHPA 1NU8A 2Q1TA 1H8EA 1GKLA 4ZVVA 3FCXA 1KXZA 3TQRA 2E4ZA 4EPZA 4RANA 2WA2A 4B2IA 1W0JD 1T6ZA 4I9UA 2XODA 1SULA 2JJ1D 4LYHA 3VTFA 3HM9A 3FSGA 2C3YA 4HNSA 3WXXA 5H9VA 3W5IA 1QGAA 3NS7A 3W0LB 4XR9A 1LC0A 2XCIA 3DYVA 5IFKA 4P3NA 2GSDA 2YZKA 4C4RA 4EG3A 1NUUA 3NP9A 3ZU2A 2W2LD 1W59A 4AS1A 3HO1A 3WLQA 3PPYA 1RJ9B 1X9GA 4F93B 4OU4A 5ALMA 5AOCA 3PUVA 2OORA 5CERB 3DTNA 1VLMA 2FR1A 3K8ZA 2W4MA 1M2HA 3E33A 1VRVA 2EATA 3DWFA 5F23A 4DWJA 3A31A 1E60A 1GTZA 4I14A 3ZNQA 3BB3A 1I9GA 1HEIA 3ZHVA 1JDBB 3UW1A 3OT1B 2YBEA 1U8AA 3DZHA 4H2DA 4BYMA 4DBVO 4Y6GB 3C3JA 3RT7A 5A4FS 1NQWA 4RY0A 2VT6A 1X8JA 2NQTA 2EFEB 1V95A 1P31A 4UVGA 1S1MA 4YN3A 3PX2A 5FA6A 4RJJA 4JD2G 2IFUA 5THQA 2OV8A 4RAOA 1OE0A 2JG3A 1FRFS 4MPRA 4D9CA 5HKKA 3HB4X 3ABIA 2J9RA 4BESA 2PUVA 4C0SA 1NG9A 3ANTA 2HBQA 4ME2A 3ML1A 2ZWAA 1V11B 3NH6A 3E70C 2QRLA 3PX3A 3WBJA 2MU1A 3HNRA 3OZCA 3BB4A 3QIVA 3TBKA 1XG5A 2AJAA 3GQBB 3K9FC 3D6JA 1CR2A 3FTDA 1D09A 3MFQA 1ZA2A 2JC3A 4Z4QA 4YV2A 1NURA 4J7CA 3IVMA 3AINA 4MEAA 3LX4A 4CE6A 4DDHA 3F71A 1O77A 4C5AA 3JX9A 1PZXA 1E2KA 2FW6A 2RHDA 3DXYA 2DECA 1Q14A 2VK2A 2F7SA 3JD3A 3WFJA 4MS3A 4XZ3A 1KMMA 4WDRA 5CNJA 1KY4A 4JS0A 1AS0A 1XVLA 2CNBA 1JN0A 1DU4A 2UZ1A 1PGQA 2KMLA 3KPVA 5JBQA 4XJTA 2P77A 2WEKA 4Q4JB 1VFNA 3SZGA 1UXKA 2FP4A 3HG7A 4NBLA 4B09A 1BCRB 1NFFA 1KC3A 4JZYA 4GCNA 2VS1A 1GZ3A 1RIFA 1J5XA 1VDMA 3DDCA 4WEQA 2B6NA 2R03A 4HG2A 3WRXC 1MC1A 3H8SA 3GMSA 2LD4A 2WQHA 1TU3A 4DYHA 1FUIA 4BNMA 3I1IA 4N3CA 3VC1A 2QW1A 4U63A 1C9DB 4W5NA 5IK2A 1AMNA 3IUJA 3GGSA 4R7LA 4M9QA 4YQFA 3N2GB 1L9XA 4RQUA 4KGZA 4ESVA 3BCSA 3NV9A 5DTIA 5FWYB 2OAGA 3W8RA 4MCIA 4HQDA 4HTFA 1II8B 4LDPA 2BTEA 2F48A 4RIFA 2GVNA 2PWAA 1WF3A 2Z3WA 1KK3A 1Y1PA 4U2CA 5L3RA 5G4KB 1JQAA 3UT5A 3AAAC 2IBMA 4Q6BA 1C14A 3V8MA 3KWMA 4FHZA 5T4HA 1PIWA 5JJBA 3INYA 4D3YA 4RVBA 2RIRA 3KU1A 3PA6A 4A27A 3WRYC 4MVJD 4ZT7A 1BE0A 4NG4A 3TRFA 4KAJA 2ANBA 2ZT6A 1WDTA 2PZIA 3HV0A 3R3YA 4E31A 3QFSA 3GMDA 2Q6VA 2FGKA 1JEDA 3ZV3A 4KYVA 2AMFA 4WLUA 4CL8A 1O08A 2ZXFA 3T3DA 1YSCA 1HE8A 1P44A 4WECA 4M99A 1W29A 4ZN6A 1ICEA 4QOGA 2YQ8A 1Q0LA 2CB9A 1ATIA 4R8MA 2AOUA 1B41A 5G2OA 4BX9A 3SE7A 1RLIA 3Q88A 1IUKA 3ESBA 1GVHA 4QHTA 1P29A 1LV7A 2HQSA 2ZE7A 1XRJA 2QU7A 1NBMA 1QORA 5I9IA 3CRRA 3I5YA 4EFNA 3U64A 3CIOA 3C7CB 1BJKA 4QPJC 3T7CA 3QVGA 1ORTA 3EPPA 4CMBA 3I0ZA 4GAAA 4UUNA 1Q11A 1JWLA 3Q3IA 4ZO4A 4ILKA 5SZJA 3ZVLA 2GQ0A 3QU5A 2GVZC 2ZIGA 1MT3A 3DEIA 3JYQA 1WBBA 1OFIA 1OKKD 1KEUA 5NLLA 3RBZA 3AVVA 1TMKA 4ARZB 1P7CA 5JATA 4RV4A 3G59A 3WVNA 4ZJUA 4R9RA 1CR4A 1NBWB 5AI6A 1WZCA 2E2WA 3B1FA 5BN4B 4D0SA 4JJGA 1VXOA 1B14A 2VYCA 3ZBTA 3DHNA 1Y8MA 4AUMA 4A8HA 2ZUSA 2QZSA 3AF5A 5GGYA 5F76A 2NU7A 4M22A 1VLQA 3S44A 3UUFA 3P9CA 1IUNA 2W71A 1G42A 3U9LA 3COVA 2EBWA 4B4OA 1CEYA 1HDRA 4J76A 1E3WA 2ZM5A 4TYYA 2CLKB 1CUCA 4G8JA 2CMDA 3AZQA 3RQIA 2A57A 4F1JA 3EC1A 2YL2A 2P2DA 1JU3A 3T94A 2B6HA 1KFCB 3R7BA 4E7PA 3K1AA 1SVIA 5TMBA 3SQDA 2IO2C 4UNPA 4B2PA 2R9VA 4NV0A 3M6MD 4CMGA 5KNCD 5LWQA 3OZGA 3DKIA 1FNMA 5A1TA 2IIQA 3HVEB 2QR2A 3PBKA 5FOWA 1MNQA 2IZ5A 2GTHA 2Y1XA 4KMOA 1KRWA 3ZEIA 4P9NA 1WSAA 3NIGB 1BDBA 4FQ8A 2RC6A 4BLUA 4WQMA 2QTRA 3DAHA 2F8MA 3KT8A 3Q0TA 4CCWA 2F9FA 3ZEFA 1AQLA 3ADPA 2VDWA 3IAUA 2RIPA 2JJ2A 5TY0A 4HNAA 1TT5A 5AJZA 2UAGA 1WHTA 1OBFO 5AUPB 1B6GA 1A2BA 2BRUA 5H3HA 3MNFA 4I8IA 1V41E 4WNDA 2QS9A 3Q73A 3VHRA 4XUGB 2ZYDA 2FOIA 3ZNOA 4CKEA 2EQAA 2QZZA 2HL6A 4HYTA 4KQXA 2BW0A 4G65A 1TKCA 2PXAA 1IVSA 3HUDA 3G9XA 4NYMR 3TK1A 5A3SA 3UXGA 3SI5A 2KWIA 3NGLA 3QEMA 2VK1A 4D4LA 4TMWA 2OYRA 1KL7A 3L0IB 1FB5A 2X6FA 4B7XA 1E8DA 1L7XA 3UOWA 2VUTA 5KPDA 2BEVA 2X0IA 1W5TA 4CM4A 5AW0A 4OQEA 5J5CA 1JV2B 1Z6ZA 1EXVA 1GRRA 2D1QA 2P9HA 5FBWB 1E8YA 3CRMA 2V6BA 5DHRA 3UKOA 2PZFA 2A9RA 2MSEB 2JHAA 3GGJA 4JYAB 2I99A 2XB4A 2ID7A 1DVRA 4RESA 2J8ZA 4B6QA 5AVUA 2VF5X 3O94A 2Y0BG 4HLLA 1Q0ZA 2F3QA 2QN3A 1RQPA 3A32A 2YY7A 2ZYTX 3RYCB 2CLHB 3CNBA 3TLAA 5A4AA 1XMSA 4F85A 3OIUA 3U7HB 1C8VB 2XZDA 4RIHA 1GGVA 3GWZA 1DRKA 2XUFA 2WQ7A 2AQIA 5I9MA 3KTAA 2CMKA 1N3LA 4MUGA 4CQMD 4FUTA 3TZEA 1E69A 3VJMA 2FEAA 3BRWA 3IOBA 4FYYA 4RQBA 5ENSD 4KBYA 4KUHA 3PICA 2HXGA 4WBNF 3BQ9A 1N7JA 5F7ZA 5DWVA 4I6EA 3AGQA 4IMPA 5IKEA 3P96A 3UK0A 1BO6A 1ZMRA 4GGOA 5SYNA 4IDQA 4NTZA 5B1BE 4IR7A 3TX2A 4ANWA 2WG1A 4RDCA 2FF7A 1RS0A 1QE3A 3CF4A 2Y9PB 1YIOA 3LOPA 4UQZA 1SBHA 4WD3A 1JFFB 2V7PA 4BEBA 1W87A 4IAOA 1JHXA 1LPNA 5CLFA 4A4DA 4TYQA 1DEHA 5FB3A 2HK8A 2WUDA 3WO0A 4FHJA 2DF8A 1E6MA 1N8KA 2X1VA 3OO0A 4FU3A 2V7WA 1Q1EA 2C92A 2G6BA 3HO6A 4INZA 1IXZA 2ZI5A 2ZSKA 2J5XA 1EX6A 4HZIA 4GSKA 4FYXA 3SSOA 1FU8A 4WUYA 4FGZA 3NEJA 1L5OA 2O8DB 2GARA 4PY2A 5LP6C 5G0UA 4IILA 4I66A 3MERA 4FW9A 2HWYA 1QC5A 2X6HA 4URUR 5F5LA 3W90A 4KFSA 3ZGOA 4I1OA 4MQLA 2CMFA 2ZR8A 3ASFA 1OXSC 3NWOA 2VQDA 3MM4A 4HDMB 2ES4A 3M83A 3E0XA 3ICOA 1G3UA 3GD7A 3MQ2A 4TN5A 1SPXA 5KPJA 4HF7A 3Q7FA 2CWWA 2GHRA 3NXSA 2AEJA 3KLNA 3RFUA 1KZ4A 2OOEA 1SUEA 3KEMA 1EFRD 5J2UB 1A2OA 4YRTA 2QTVA 5JQGB 1LNZA 3TW8B 4BQEA 1Y81A 1QOQB 1R6DA 4QSHA 4NWIA 4NMMA 4OCZA 5H4HA 2R8ZA 3ZWVA 2EZ9A 3EIUA <