4BX9A

Human vps33a in complex with a fragment of human vps16
Total Genus 223
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
223
sequence length
594
structure length
574
Chain Sequence
AAHLSYGRVNLNVLREAVRRELREFLDKCAGSKAIVWDEYLTGPFGLIAQYSLLKEHEVEKMFTLKGNRLPAADVKNIIFFVRPRLELMDIIAENVLSEDRRGPTRDFHILFVPRRSLLCEQRLKDLGVLGSFIHREEYSLDLIPFDGDLLSMESEGAFKECYLEGDQTSLYHAAKGLMTLQALYGTIPQIFGKGECARQVANMMIRMKREFTGSQNSIFPVFDNLLLLDRNVDLLTPLATQLTYEGLIDEIYGIQNSYVKLPPEKFAPKTEAKKLQLNSAEELYAEIRDKNFNAVGSVLSKKAKIISAAFEERHNAKTVGEIKQFVSQLPHMQAARGSLANHTSIAELIKDVTTSEDFFDKLTVEQEFMSGIDTDKVNNYIEDCIAQKHSLIKVLRLVCLQSVCNSGLKQKVLDYYKREILQTYGYEHILTLHNLEKAGLLKPQTGGRNNYPTIRKTLRLWMDDVNEQNPTDISYVYSGYAPLSVRLAQLLSRPGWRSIEEVLRILPGPHFEERQPLPTNRVTLIFFLGGVTFAEIAALRFLSQLEDGGTEYVIATTKLMNGTSWIEALMEKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis of Vps33A recruitment to the human HOPS complex by Vps16.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
molecule keywords VACUOLAR PROTEIN SORTING-ASSOCIATED PROTEIN 33A
total genus 223
structure length 574
sequence length 594
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00995 Sec1 Sec1 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.850 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4bx9A04
3.40.50.1910 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4bx9A02
3.40.50.2060 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4bx9A01
3.90.830.10 Alpha Beta Alpha-Beta Complex Syntaxin Binding Protein 1; Chain A, domain 2 Syntaxin Binding Protein 1; Chain A, domain 2 4bx9A03
3C98A 4BX9A 1FVHA 4JEUA 5BV1A 2XHEA 5BV0A 4CCAA 3PUKA 1FVFA 5BUZA 1EPUA 4JC8A 1MQSA 4JEHA 4KMOA 1Y9JA 3PUJA 4BX8A
chains in the Genus database with same CATH superfamily
3T5XA 3SFZA 4L0MA 4TTPA 3RIGA 4HJRA 1ZN8A 4IIUA 4J3NA 4JUIA 1NW8A 3W77A 1ILEA 3FY4A 2ZPUA 4FFVA 1M9NA 5AYVA 3AHEA 2Q5IA 4I1SA 5B1IA 5DSZA 4MUIA 1OW3B 5ICCA 3DSXA 2I2AA 3AEZA 2EARA 2PRYA 4M7PA 3TR6A 2KATA 1RCUA 5K8UA 4MV0A 1P4HA 4ZQEA 4UTRA 4BNYA 1KJJA 5T8IA 1U2EA 1SNYA 4ZFHA 1E3JA 1YOVB 4XDHA 3FWPA 4ZQBA 5DWDA 3U3MA 3MN1A 2Z58A 1GAEO 1H5QA 5TRTA 2RGXA 3VYUB 3E1KA 4IMRA 5CHYA 1KQNA 4QUHA 6PFKA 3VM6A 4XSGA 4AS3A 2DWZA 3I6IA 4IJMA 5I3CA 2Q2NA 3O8NA 4TMKA 3DTYA 1DZIA 3ROMA 3H1EA 1JHUA 2BDUA 2MWMA 2JLCA 5FKJA 1HH8A 5FADA 3PNOA 3FVTA 4TN1A 3V31A 1Q7BA 1ZOOA 2OYSA 3CUUA 3E3LA 3NKFA 3RC9A 2WBLC 1DT5A 4JN6B 5LUBA 1OYVA 2G77B 1YQQA 3OPYI 1QGUA 3UC9A 4FZRA 4BNWA 3O8OA 1BRMA 4QRDA 4HWTA 3ZZMA 5BSMA 4GTQA 4B3BA 4DX5D 4AUNA 1E5DA 3FCYA 5EQJB 5J90A 1R0CA 3O75A 4NENB 3T5MA 5ALVA 1XZ8A 4AZ0B 2NG1A 1CRLA 3ONEA 1OR8A 1NR5A 4JYBA 2PNNA 3GRFA 5AP9A 2A9PA 3U3ZA 3HZZA 2FK8A 1QNLA 2ZJBA 1BXRA 2I3GA 3S68A 4EUSA 5AHXA 1WS6A 3IP7A 1SKAA 3AVOA 2YZNA 4KSCA 4WESA 4Q7QA 4H16A 5JAHA 3FGZA 3FPAA 3HCNA 1U28A 3ZZNA 1K9VF 2VXBA 2XRMA 3HA5A 2O19A 2XYVA 1I4DD 4MROA 2IIBA 2IYZA 3ZWCA 3U4CA 8MHTA 4O8ZA 3G2KA 1R0ZA 1M1UA 3CZCA 3FLMA 1NX9A 3GWZA 5DB4A 4MRPA 1B6SA 2FPGA 3SX2A 4CV3A 1NQTA 4EJSB 4CIWA 2PM8A 3OG9A 1A9QA 4EUHA 4MQFA 1V5GA 3AR6A 5SZIA 2YXBA 4KRFA 4DM4A 3HL4A 2QMZA 5AM0A 3KYDB 2MJLA 1V2HE 2ORIA 4ZCLA 2ZUEA 1Z17A 2QMQA 1Q21A 3ONLA 2W6MA 1J22A 4B45A 3CWZA 3G2IA 1G5QA 1XWIA 4N8SA 4O1HA 1R18A 1SCAA 1WUHS 2FP3A 4OFBA 3DXYA 3WSTA 3BB4A 4I3FA 5BVHB 2O14A 3C85A 2FUG1 3R3XA 1RPJA 2D5BA 2LCQA 3E30A 4FC6A 1GRQA 1V3UA 2IU4A 2WJWA 3QNWA 4ZMRA 4CEIA 1Y5RA 2PKEA 2RFAA 2C0MA 3M49A 1ZLXA 2AC4A 2NTYC 5MN4A 4H7EA 3NR2A 3CHYA 4EI8A 4CTOA 3BXEA 5TMEA 3F9RA 1X92A 1GKIA 3ES9A 1N4SA 1EFDN 2GEBA 4EKEA 2L0TB 2FW8A 2VJBA 2WFLB 3M6AA 3CIOA 1NMSA 3IIMA 4KGDA 1XVAA 2VFAA 4C89A 4TYNA 4N0PA 1MZPA 5EKXA 3C5CA 2ZGDA 1YIOA 3G2MA 2UY1B 4JLNA 3HB9A 5CJPA 5FYDA 4WNAA 1OXTA 1ZQ1A 2WQZA 2BEUA 4NATA 5KKAA 5J2UF 2EKQA 5CTJA 4PTYA 5BXUA 5DCYA 2VAWA 3B70A 5DGHA 5A3VA 5MDHA 1EXVA 3ZWNA 1M5RA 4OMFG 1S9HA 1V96A 4HFNA 1U2GC 3CRRA 1LPOA 2QX6A 1GFIA 5DASA 3D6UA 3U13A 2ZJZA 2C7RA 4AJ2A 1R4MB 2F3QA 4BNJA 2WXGA 2PFSA 4WCFB 4X61A 5ETJA 2VT3A 1VCMA 1R64A 2JIOA 2PKQO 1TNBA 3PWTA 3HCEA 1EXDA 4DB2A 4TXPA 2QIOA 2XMBA 3D4OA 3C87A 3I34X 4FUQA 5D87A 4S05A 2P9IG 2J4BA 4ZICA 4DC9A 2MYNA 1MJGM 2HQRA 1FNNA 3KFVA 4LBWA 1W4RA 2PVCA 4ARUA 3RRNB 4GDFA 3I9KA 3RTAA 4KPEC 4LXGA 2QE7D 3EGIA 1U9IC 2YW9A 2BEJA 3BXXA 5FV7A 1PV1A 2C2KA 3O4GA 4BVFA 1W6UA 4CYMA 4JJ8A 5AQEA 4F5DA 4F6RD 4G1VA 4F45A 3W78A 5FLXA 3V7YA 5B53A 4DLQA 1G5FA 1KP9A 1TJYA 3R7WB 2JZOA 4P22A 4AM8A 1IY8A 2G9NA 1A7UA 2F8YA 3IERA 3KB1A 3OY2A 1PEAA 4RSMA 4IS2A 3TPFA 3RS9A 3KOXA 1XCJA 1NE2A 2BMFA 2OHHA 3ABZA 3BE6A 4E31A 2NO0A 4RXTA 1LVHA 3CYFA 3RRXA 3N8DA 4U1RA 5HGJA 1R0XA 1SRQA 1YQWA 2OV2A 2VJMB 4K9MA 4G1EB 1D6JA 4L6IA 2ZU6A 1KMHB 3K6KA 2JCSA 1NBWB 2HF2A 4IZ6A 1ZBPA 1V8PA 4Y2TA 4F9EA 4YUXA 4U7FA 4HEA6 2VBGA 5CB8A 3KZCA 1G5RA 2QX8A 2Q62A 3NKVA 2DFVA 2H1CA 1LD3A 1BHO1 4JGGA 1GT6A 4DV4B 2ZSHA 4I6GA 4B3HA 1P5HA 1FFDA 1BMFD 2E48A 1M7HA 2MSEB 3A4IA 2C2XA 1OB5A 1N0HA 4O02B 1IULA 1U3TA 2HSZA 2OGTA 4L51A 1FCJA 4MP8A 1W5SA 3AS8A 1DC7A 1RKVA 1Y5LA 3G8BA 4UCQA 2CJYA 2PL1A 4RX1A 1MR3F 1SN7A 2P4EA 1RHJA 1LBEA 5E1MA 2QP9X 1PGOA 3EVZA 4M1MA 1YXMA 3KNZA 4R9UC 4CKEA 3PIDA 2DKFA 5A4AA 4UHHA 4X97A 4AX8A 3N1UA 2O8BB 2HM8A 1QZ2A 4M49A 1X6VA 3R44A 1BVRA 1G2PA 4WOBA 3H1PA 2ZETA 1TJPB 2ZREA 1UKAA 5I7HA 1NXOA 1O7JA 1Q2ZA 1I14A 3DPDA 1KJ8A 3TSCA 3HTXA 5LQRA 3ITKA 1EBFA 3LC0A 3RUCA 2HK7A 4MS1B 1L4UA 4BFXA 2H08A 2V7PA 3MILA 2YMLA 5KYKA 5H9WA 5F7XA 3DZ8A 1FMCA 3NAZA 2A3RA 4UCFA 5JZ9A 1H6OA 3CR8A 4CMBA 4KG7A 1BDJA 4MYRA 4RF5A 1W75A 4DX6D 1NA3A 2NYVA 4GDMA 3TOVA 5JMWA 4WACA 5KTSA 1VJDA 1A4XA 3H5NA 1LV7A 4D9NA 2X4LA 1QYIA 1VLQA 1JA0A 1K7CA 1KPSB 1C4WA 1NVKA 2WTBA 3OCCA 2ECQA 2CMGA 3U7QB 2GCIA 2FZ5A 5EKSA 4MGIR 3HJNA 1YB6A 5D1NA 4GHWA 2X9NA 1JWFA 3GB9A 4JKIA 3CZMA 4BNXA 1US8A 3R7LA 5K8JB 1B6TA 1VB5A 4MNTA 2ZIXB 4GP9A 4NE2A 4H9GA 5ENZA 2OM2A 2PUBA 2P2GA 4LXYA 3HPRA 1VKOA 2XTNA 1ZSNA 4IDEA 2YHIB 3GG9A 4WOCA 5U1PA 1R0RE 1P5FA 3S7ZA 2VNSA 3OIVA 1O1SA 1CIPA 1UJJA 1QKJA 3VV3A 4YQYA 4Y1EA 1SGWA 2DGDA 4US2R 1LZKA 4C06A 3EMDA 3LWNA 1F2TA 4DBLC 3NTOA 3FPHA 3LVFO 2X6HA 2IOFK 2WIGA 4L2IA 1DTSA 3N6VA 2I2CA 3LQ2A 4K5BA 1E2LA 5LB4A 1IAVA 2E4VA 4DMMA 1M8KA 2ZUCA 3FNRA 3S2ZA 3SYLA 3V8MA 4C0KA 5B57C 2PL5A 3DOUA 5KWEA 1CQPA 2IU3A 4CQLA 4MYSA 3FOFC 2PBLA 3AKDA 1E2QA 3ZXIA 3WMWA 3ESAA 1JLMA 5FPQA 1HNXB 1RI2A 3PFCA 2CMKA 4ZAGA 4ANXA 3DOCA 1FUIA 3PHBE 3NBZC 4GUAA 1XPUA 4HBDA 2DLDA 2XQVA 3P2YA 5FV4A 3FULA 1MGOA 4PUCA 1G42A 2DF8A 3R7SA 1D0SA 1GWNA 3PIRA 1K4MA 3UV3A 5BMVB 4RD3A 1Q0HA 2OHJA 3RK1A 2IYPA 1FJGB 4RVDA 1GL7A 1MORA 3GARA 5EMKA 2PMBA 4D79A 3P2KA 1ESMA 2VA8A 2X4DA 2ZR9A 3CEPB 4LMPA 1W7AA 3FAKA 1XDDA 1XEXB 2YN0A 4DNOA 1IZ7A 2GARA 3D9NA 1PNOA 4M36A 1CY8A 2FKAA 4ZHSA 5IKPA 2M9MA 1OV4A 2XF2A 1XQYA 4EVIA 4YFYA 1M1NA 1X13A 1I2ZA 5LOVA 4KNYA 3PUVA 3PUWA 1HZZA 3HACA 3ZE2B 4C6HA 5BNTA 5K7SA 4K88A 1T2EA 4K9NA 3R0VA 3H5IA 3OWXA 4DGQA 4N6GA 5KNCH 2WP0A 3PH0C 1JU9A 1V9LA 1OREA 3KBBA 1U2DC 4LTMA 1NSTA 2XS8A 4KXVA 2Y1LE 1X42A 3FJYA 3Q85A 3KXPA 4MRRA 4D4KA 3EPLA 1ODJA 1NASA 2P9PG 1CHNA 3QKSB 3E1SA 3G88A 5TF4A 4YRFA 3K9FC 1T3LA 4BRWA 2PX4A 4M1YA 1Y7TA 3VX3A 1WQ3A 4GPD1 1IXSB 2QG9A 4JKYA 3D9KA 1G1MA 4MPJA 4W5JA 1A9XA 4G1TA 1LC3A 3ESCA 2VLBA 1YKGA 3F9CA 1LK5A 4NCNA 4RV4A 3C70A 1PJRA 2B2NA 3NNDA 4J0IA 5K51A 4MUXA 3OO0A 1ZK2A 3NOQA 1JEDA 1S2NA 3UW1A 3RUAA 3ZHEB 3SG0A 4TTQA 4CF5A 4U6QA 1N3YA 1XEXA 4P31A 2XI4A 2HDNB 5DX0A 1FMFA 1L5QA 2BAGA 2R751 3IAXA 4HEA1 4R2JA 3WMXA 4MVJF 2QDKA 3HR8A 1NM5C 3KHSA 3I37X 4WINA 2M98A 4QVIA 3EK2A 2PMKA 5JIBA 1YU6A 1KF0A 4DNXA 4Y2PA 3CLTD 2ORYA 5CCDA 2XKKA 2I3BA 2JIPA 2J08A 3KYIB 4M1OA 5BSTA 1ZMXA 3SBSA 2ZE5A 4FDVA 5AM5A 1GZUA 2CNLA 4V03A 4Z6KA 3Q8MA 2JLSA 5HS4A 1EK2A 3BE5A 3UKUG 1JDVA 2R84A 3FOWA 5CK5A 1HDYA 2D2VA 3RBVA 1JQ5A 3RWOA 1U1IA 2EEPA 5AW3A 5CCEA 1PK8A 3BSWA 3K8YA 4A0SA 1WOMA 5AMXA 2D2EA 2QQGA 3DLAA 1TCBA 2BMWA 4JHXA 4EB0A 1YRBA 4WNEA 5LX8A 4JB3A 5HQ3B 4UREA 1XUOA 2WRZA 2XKAA 3QENA 5D1HA 1O5TA 7MDHA 1ZL0A 2QI9C 3D54D 5TPZD 1M67A 2VHQA 4FCCA 4KQ6A 4M0PA 1JZQA 5LOZA 2VUSA 3C8ZA 3PXCX 5DP1A 2ANBA 1SUDA 1JDSA 3HKDA 1U1FA 3ZV4A 2ILVA 2PLAA 2ZRFA 1U1GA 3JD0A 5B6PA 4EY5A 3ZI0A 5CCBA 4XVCA 1ZH0A 4PZ9A 3CSDA 1G20E 2PKQP 5BN4A 4KVMA 4ZJUA 4LZJA 1QOQB 3D9IA 3S7JA 2GCOA 3TD9A 1MO2A 3S5UA 4CFSA 3L8CA 1LPPA 2Z0MA 3TDNA 4EGAA 3W7BA 3BHJA 1R8XA 1GUYA 2KS6A 1OWOA 2LE0A 2X8WA 3OLQA 4M4SA 4M1WA 4ITUA 2H06A 4CVNA 4ZI2A 1ZD9A 4CLDA 1M3SA 2QHXA 1ZNQO 1JU3A 4LTNA 3RYHA 3WGVA 4ER6A 3I61A 1DG3A 2JI6A 4K87A 4EG5A 4WFKA 4M3OA 2DKOA 3KP1A 5H5JA 1JWGA 2V7QA 4DR4B 5A3SA 5EAIA 2GM9A 4FU0A 2PWYA 2CZCA 1ZM9A 4CF6A 4UHDA 4EI2A 3LDUA 1NV8A 4I4NA 1TD1A 5DI3A 4BN4A 3LP8A 4AOFA 2DMRA 4H7DA 1GNTA 2EERA 4O4IF 1IJEA 3F8SA 3MIIA 5KQMA 1J0AA 1CS0A 1CTQA 1UKEA 2EBFX 3BQNB 3BOSA 3MTGA 4L9AA 1Q12A 2ZCJA 3P96A 3CE6A 5D3ZA 1BW9B 1P9NA 1H4TA 1D8EA 4Q5IA 1AN9A 1CQXA 1E3TA 1S2GA 3BB3A 2XB2A 4W5OA 2FR1A 4LJ9A 2PZEA 1XJ5A 2FWAA 2Q3FA 3D3KA 1Q16A 1KMNA 4KQJA 5A05A 4YX9A 1N77A 5J58A 2PGNA 3I1YA 1G3IA 2JI4A 3NHRA 1YVUA 4ZEMA 2DWCA 1EEXB 3DLPX 5ESRA 1MFPA 3RYIB 1E2GA 2AI1A 2PX8A 1U2GA 2HE0A 5BYAA 2R11A 5CH5A 3W6OA 4B3XA 1I36A 5JCXA 1A5ZA 3P9XA 1WMEA 5JMPA 4BQSA 1VE6A 1L4BA 3P9YA 3A6LA 2ZXUA 1U3FA 2J9FB 2H6FA 3ADOA 3MWKA 4XX1A 4G37A 1HKHA 1HLDA 5IFKA 3ZWXA 4LDQA 1ELOA 2RI0A 1XVUA 3HU5A 1MJGA 3DP7A 5DBKA 3SK0A 4DDKA 1PL7A 3ZJVA 5MN5A 3ZWDA 1SXJC 2Q4TA 4EHAA 4NXNB 1QDLB 2NXWA 5GV8A 4YJFA 1XZIA 2AG6A 1K8YB 3IQHX 1KDYA 3RRZA 2C3OA 2OVBA 2ZRHA 2Q1WA 4FD3A 3WK7A 3PS6A 4XUGB 1YMVA 2XCTB 1YFZA 1PFQA 1W1UA 2HB6A 4N3NA 3LI2A 5LP6C 4OX9B 5GIOE 4JCCA 1JH8A 5E6SA 3VR6H 5CBPA 1YIDA 5CT6A 2FB9A 1QG6A 2FXIA 2OCYC 1PEKE 1OLXA 3DV9A 4X41A 1N0RA 3K30A 1L0BA 1U9JA 2GZ1A 1U7UA 2XT6A 4YUWA 5HXAA 2ZG6A 5AI6A 2JJ2A 3TQSA 4KPYA 3DL0A 4OIMA 1WY5A 3A6KA 4R1LA 3D6HA 1UOPA 1ZHOA 1H2AS 3AINA 2PYIA 1QU2A 4J4TA 3I5YA 3OE7D 2YYYA 4KNWA 4L02A 5DM60 4D26A 2DERA 2PKYX 5JZMA 3KUUA 1R6DA 1E8DA 2JAQA 5CA0A 4GM1A 4LJ4A 4LXUA 3CZPA 1CHDA 1ZHFA 1QE0A 2J3IA 2XQIA 5ADUS 3QE9Y 5EPUA 1RVV1 1KIAA 1PZHA 2P75A 3ZXSA 3DOEA 2UWJG 4J76A 2Q4EA 1YHYA 5B7PA 2H63A 1G291 1IHYA 4L9SA 1AE1A 1ENPA 2Y1KA 2Q3HA 4KP7A 3WSWA 3W1EA 3DLTA 3QHAA 3OZSA 3D0RA 5BPPA 2Z8XA 1QZXA 5AJZA 5AJHA 3SZ3A 1KYQA 3T3MB 3ZXUB 1KI6A 4WWOA 4UMVA 1LW7A 4GBMA 3GRKA 3CUYA 4O8CA 4OH7A 4PW0A 4XQCA 3RQIA 4A8JC 4D9KA 4K86A 2LD4A 3DE7X 4S2UA 5KCMA 2ORED 1GU0A 5FB3A 1IHOA 3T9EA 4Q4LA 1L1FA 1YI8A 4NYIQ 4I2WA 1Z4KA 4Z68A 3B9RA 3VZQA 4DQVA 4EMTA 3T9BA 4QM6A 2R79A 1EVEA 2FPSA 2PNFA 1EA7A 4EUKA 5AUPB 5G02A 1DAIA 1P4RA 1QH0A 4H1TA 1P2UA 3S6JA 5A4IS 1KAGA 1Z56C 4FHGA 3WAJA 2VJDA 3GFGA 1SVKA 4LYYA 1K8RA 3KX2A 1ZU2A 2VDMB 4PLCA 1KWGA 4JVLA 4E22A 4ZDWA 1N95A 4Y6SA 3VVLA 1E2DA 3D6MA 5MFZA 4PWZA 1ZN2A 4DLVA 2NSYA 3F6PA 3ZD9A 4D44A 1S0PA 1EMDA 1M72A 1PR0A 2YIJA 2PG3A 3BMQA 1XP8A 1H69A 2FUG6 3KKKA 2O59A 3RSQA 4CM9D 1U9CA 3F2IA 2WM3A 1APBA 1KQGA 2YWCA 3TXNA 1T36A 5CB4F 4ZODA 1MG5A 2IPLA 2EBUA 5ALKA 1DFGA 3NDBB 2FHPA 3K9NA 5A7FA 1HFAA 5EG5A 3RAEC 3HQ4O 1K6MA 4Y9RA 3F3YA 1SQSA 4GOMD 2UXBB 1SUEA 1Y42X 3U4AA 4QXOA 4QE3A 5L7TA 4B48A 4ZYWA 2XADA 3MK31 1PJTA 1PL6A 5JZSA 3JQAD 5DRYA 4K0RA 4MUJA 2AR9A 2C57A 2FFAA 3A27A 2VXYA 5I9MA 1UM9B 1CS4C 4B7CA 2Y9MB 1NULA 2BMEA 3V1MA 1I3LA 2Y1CA 1UFKA 1YK1A 3ICCA 3KSUA 4X8OA 2YVKA 1W19A 2NNLD 2AFRA 3LPAA 1BLXB 4UHJA 4AY6A 4Q12A 521PA 2WIDA 5EPEA 4I36A 5EWMA 1Z5ZA 2YX1A 3F1KA 4IDNA 5CBOA 2F1RA 1F8XA 3DEKA 3K2EA 3KG2A 4UBOA 5D5HA 5DMXA 4C9BA 4CM6A 4I4CA 1R5NA 5KWIA 4LF4B 2ZYVX 1UANA 4RZHA 4YDSA 3SEQA 2PD3A 3N28A 1E2IA 2H2IA 4GCNA 1I9GA 1Q3TA 1KP2A 3QUSA 2NXNA 4LYDA 2V4LA 5FUVA 5ADHA 4A73A 4DANA 2A5UA 5DBOA 5LN1A 3L1JA 4E4YA 5KX5A 2IYEA 2OCDA 5T8KC 3LHSA 4YRQA 3S27A 1P2TA 1J97A 2QUIA 2QVZX 5K0BA 5A23A 2YQ4A 1LB1B 3H5OA 4HAIA 1A9SA 1H85A 2D59A 1AQ6A 1AKYA 3AUUA 3FF4A 3MVEA 1N6IA 1PR6A 3QK7A 4NZPA 3KSZO 3MJSA 5ICFA 3RYTC 2CKMA 4A3SA 3HVEA 2DUMA 3UJ3X 2PJUA 2ZUWA 1LI4A 3N75A 4TLLB 4EF5A 4GE3A 2JLUA 3QW2A 3QMPA 4GNRA 1ISHA 4UI9K 2FG5A 2YW2A 3A2NA 1AUQA 4JBHA 1HOXA 2WZBA 3M5CA 4G4JA 5LBTA 2XUPA 1BDHA 2W4QA 5I9SA 1NAIA 2IHZA 3GIWA 1FSPA 1K6IA 3SEFA 3C3XA 4JBIA 3EOAI 3QF4A 2FW1A 3ZDAA 3KXLA 4K6FA 4LSGA 4JI8B 1ADYA 1ZIDA 2H1HA 3FPSA 4AZVA 2VSQA 3WKDA 4G0UA 1CY7A 3OZCA 4QUIA 4RK7A 4E2YA 1N34B 2P9NG 1SVIA 5BSFA 5JAOA 8LDHA 4YAKA 2FLKA 3A1EA 4DABA 1OZGA 2YNMC 3OLCX 3A3NA 3PUYA 1Z8FA 1E7VA 3EGEA 4XWWA 3UT4A 3TLZA 4LUCA 4ENRA 3ETLA 2QTAA 1Z15A 4B7AA 2OHXA 1Z9BA 4ZALA 2NO9A 4KQ1A 5ALQA 4ZVNA 4NOLA 5IAAA 3OZAA 3UBTA 1HE4A 4R2MA 3FGNA 3V3TA 4PZ0A 2WTAA 1OWLA 5C8ZA 2R1TA 5JSHA 1H8EA 4BMSA 3ISJA 3FCXA 1A9RA 2C7QA 2VDNB 3IVCA 2FPWA 1BX1A 4GI3A 4XR4A 3SBTB 3HKBB 5HKKA 1LPMA 3FPBA 3IP5A 3PFKA 3VR4A 5A0FA 4ENUA 1JZTA 1RM3A 3KT3A 4ABTA 2NVWA 3L8HA 1QDEA 3IV0A 2B61A 3FUUA 3M1LA 5DXJA 1E61A 3PTLA 4LZPA 4RPLA 3BXGA 4QBHA 3CNQS 1TGYA 1YCSB 1WA5A 2I7CA 2ZSBA 3F3KA 4KO4S 4AZSA 4C0AC 4CT4B 3IBYA 3AZQA 2BE7A 2RGWA 1BVUA 1WXXA 2FOXA 2NU6A 4JOSA 3SNKA 4RTLA 3FNEA 1QGOA 3GJ3A 2OFXA 1G8JA 4FGUA 5CMWA 4KQ9A 5JCOC 2J6IA 3ORFA 1DBSA 4N7MA 4Z1MA 3UT0A 5EIBE 4BMPB 4PYNA 5FWNA 2D1RA 4MITA 3GVIA 3MCUA 3G2PA 3RADC 3ORSA 3B3JA 4N6NA 3ZU5A 1L8AA 5A6CA 4AVXA 5LLTA 1PHRA 2JD0A 3OJEA 2EF0A 1WNFA 5EHGA 4IIEA 4BE9A 1FJ2A 3DB1A 2QLFA 3NAQA 4UVGA 4D4MA 3NAMA 4MKZA 3OIDA 3P97A 4BGDA 1KYTA 3GZTB 5AW5A 2C42A 1Z8DA 2C78A 1TC1A 2BGGA 1HLFA 1G7SA 2IYOA 1TCCA 4A1GA 2WU3A 5DHSA 4J75A 1M2OB 5DF1A 3NW9A 2DXIA 1DEXA 2AJCA 1YB4A 2RSLA 2XSZA 5BSEA 1MJHA 4RJLA 3JXEA 4H7YA 5ED0A 2HR2A 4O25A 3IP9A 1DBWA 2CXRA 3K9HA 2FZCA 3G82C 3RUPA 4F60A 4XUCA 4EW1A 3QTLA 1Z5NA 1NW5A 2EC5A 4IJKA 1JSCA 4KQCA 1FFWA 2EYQA 3Q2OA 5B55A 2GZRA 4KQ2A 3ZWMA 4UNQA 1XX6A 2HHCA 1J2UA 2YJGA 1T0IA 3M5DA 3OKFA 4ID3A 4JY7A 2XXBA 4DIMA 2BDTA 2YMMA 4S0XA 4KO2S 3RGGA 1H2UA 1F9EA 3O4RA 4IDQA 4UBKA 4ZJYA 4CKWA 2WTUA 2H2DA 3VDQA 1ETUA 2YYAA 3G0DA 2AMYA 4EBFA 3F7MA 4CEHB 1T5OA 2DOKA 2Z8YM 2ISCA 4LG1A 3A31A 1JWLA 2BRUC 3AJRA 1AZWA 2VWGA 1CVIA 3UGQA 1V7CA 4IYRA 4OMCA 2HA6A 3G0BA 4DLNA 1DFHA 4N03A 3NHSA 4I08A 1E8YA 3DOOA 1ISGA 1QP8A 2QTVB 3F1LA 1J25A 1CWUA 2H4JA 2NT4A 2Z9BA 3ZCTA 6CHYA 4GTSA 1H0SA 5HRCA 5BVGB 3IJRA 1VJ5A 1LS6A 5IVPA 3SF0A 3JYHA 1OLUB 3EGDB 4GVLA 4B6GA 4YMLA 1SBQA 4L1KA 1SD2A 4QOIA 5KHAA 3MWEB 2QUAA 5DNCA 1GFZA 1TYQG 2II6A 4RYDA 3B2QA 1F8GA 3V00A 5EKTA 3EF3A 3L16A 2HN9A 3EXIB 3G02A 5J4KA 5IKOA 2ODPA 5EI5A 5ALUA 1BHQ1 2QUHA 1SWWA 3C8HA 2QVGA 4BFLA 1RP1A 1ESNA 1BXRB 4KQWA 2I1LA 5FTWA 4I6EA 1HT3A 2GF0A 3OF3A 4BJHB 3K0EA 1F3OA 1ADJA 2UYGA 1VDMA 2V7BA 4FKMA 4J7CA 4BAZA 2H65A 3IALA 1HQCA 2QPOA 3GZNA 3BSSA 1T5SA 5HZMA 2R05A 3WG7E 4D46A 5IJWA 4IDCA 4K28A 4OSEA 4PLVA 3EH1A 5FOVA 5CEEA 3GEMA 1XCPA 2GQ0A 5AAOA 4WLFA 4DMHA 2R4UA 1T6BY 2I9CA 1W5TA 4M87A 2VAVA 4IICA 3GJXC 2J9GA 3JR7A 4FBMA 4GL4A 3W5IA 2IHVA 5LMNB 4JW1A 1GQOA 2NZXA 3WHLA 3NVDA 4FFNA 4MRAA 4TLMB 1HG2A 1XCGB 1UJBA 2YINC 2O8DA 3OC6A 3CK7A 1U0GA 1TMKA 3IPXA 3FB4A 2UUOA 4JODA 3CW9A 1BH2A 1W581 3V30A 4R2IA 4C1NA 2ZSEA 4D8YA 2Y1OA 2C3YA 1E99A 1DX6A 1UWKA 3A7EA 5EJIA 2JDID 1RWXA 2WK1A 1NGSA 4KB5A 5AHRA 4F0JA 4EPXA 3TW4A 3OXLA 2FLVA 3NBAA 3PGA1 4RQBA 4BGUA 5C5DA 4RQTA 5BN5B 3AJEA 3B1YA 3VC7A 4Z7JA 1SOUA 2HFJA 4TWZA 3PHHA 4HMOA 1QQTA 1UK9A 2GBGA 5AM4A 1UOEA 3VUFA 5LMCA 2HLNA 4OLBA 1X7ZB 2GFIA 2CXUA 2LSVA 5E76A 1VA5A 1MKYA 2NVOA 1MIOA 2PCJA 2GEKA 3MS2A 5DEIA 1IN1A 2BC9A 3MNFA 2VP4A 4DDMA 3HS3A 2V7EA 4WESB 3T12A 1MC5A 1FXWF 2QZZA 3M6IA 1T5BA 3AY3A 3E7PA 3Q7PA 5CW1A 4R8VA 4LZWA 5EZQA 1A1SA 1ZW1A 4HOQA 3UYLA 3ZDQA 5CBPB 2JJ1A 4W7SA 1Z0KA 3KXIA 2O3RA 2G40A 4H17A 1GKYA 1G18A 4BQOA 4WN9B 1Q2XA 2WYWA 2NVBA 5IANA 1PR5A 2KJQA 1RKXA 2GO1A 4KVZA 3J5PA 1T0BA 2SCUA 1ZCZA 1O87A 4JH0A 4LTDA 3SJCA 1BSVA 3HHEA 3KZNA 3P2EA 3INGA 4L15A 4PSKA 2IHBA 3EDQA 4W4TA 3UMFA 3PZRA 5AW1A 2H3HA 4D6PA 2JAHA 3A1WA 5F35A 4ZC8A 2H59A 2NO4A 4KKXB 3I9V1 5D00A 2YFKA 1ZNXA 4KPFC 4B79A 2AEMA 2CNBA 4EQ6A 3PD0A 1U11A 1TJ5A 4X1OA 4GPKA 4AZ3A 1C9DB 2F8SA 2PZ8A 2O8CA 1WZEA 2PGAA 3EZ2A 5LP0A 1DV1A 1Q91A 2L2QA 4G5RA 2L18A 4HMQA 3BRQA 4XB2A 4DHEA 1T5HX 2Y6VA 1CIJA 2ZLBA 5UKDA 2RHTA 5FWXB 4CXMA 4NR0A 1Y80A 2C82A 2IL1A 4N0EA 4Q3KA 4TVKA 4UNNA 1F2TB 4HYTA 5AK3A 3DLHA 4PX3A 3B5JA 4UUNA 3HO6A 4NK5A 2MOKA 1PI3A 2RG7A 3O38A 4LYJA 4MSUA 5F2OA 3TGPA 1JAYA 2DFTA 2R60A 1DP4A 2ZYGA 3AZOA 4UOZA 1PW7A 2ZJOA 1M34A 3NUQA 5IMSA 1NT4A 1LFAA 3I6MA 4MWBA 3KAJA 2O8FB 3BE8A 1GQYA 3L7NA 5JQGF 2PSDA 4NYMR 2ZRJA 1U0SY 3QOUA 1VKHA 3QEOA 4RK4A 4YJ3A 1C4KA 3QKYA 1KZGB 1TL7C 2A78A 3KLPX 1IQPA 4PQEA 4XTCS 2JLWA 4C5CA 1YTLA 2EFHB 3IXMA 3W9YA 4C7MA 3ABRB 3KPUA 4OMUA 4K9KA 4UARA 3RPEA 3TO5A 1Q20A 5AKHA 3SQMA 3O1HB 3P2JA 1E6UA 2UY1A 4I1YA 4JA0A 3WRXC 1HQKA 2EKPA 2OGSA 4KAJA 3N2GB 2WU0A 4JX8A 4L9RA 1B8UA 1DJLA 2HA7A 2OMKA 3KAKA 3SDZA 2JLVA 4ZQHA 2DQSA 4GVXA 5FTJA 3OFVA 3BMCB 4EI9A 2QRQA 2P2NA 3V48A 4Q19A 4Y6PA 4QXAA 3CKYA 1OKKD 3RFXA 2IPXA 1ZMOA 1E0DA 3I0ZA 4DMKA 4AVYA 5KX5B 3FNIA 1J1UA 4MTLA 1AUVA 4NXMB 1A98A 3J80A 1IK6A 4DM7A 5IZCA 1SXHA 3PUJA 3MWFA 2PRKA 4REOA 4ZTBA 4F93B 1M1ZA 3W3ZB 4X3CA 4PGHA 1QANA 5ECDA 4ENWA 5DHFA 3ZE8A 3OEHD 4JUDX 2BMVA 3QUBA 3GJ5A 4B0OA 2I2OA 4KFCA 2Q9CA 4DA0A 3QY9A 3WLAA 4AJLA 1OH7A 4U0UA 4N7BA 1C81A 1EVYA 1U7OA 2J0UA 3KT6A 4IKOA 3RARA 3GMTA 1GD1O 1VLZA 3UXGA 4LC1A 5JQGA 1BGVA 2C97A 2CD9A 4GZLA 2VJKA 3AR7A 5JS8A 4L8VA 1UEIA 3UWSA 4LK2A 1NJFA 1R1DA 1RAFA 5HE8A 4OGWA 3KTAB 4D0LB 2RG1A 5IUJC 3P9ZA 3PDNA 2QUBA 3N5KA 3QF7A 3GLTA 2DT5A 1GL9B 4KYTA 5E7JA 1CY4A 2C5SA 2RAFA 5CTAA 3V80A 5K9ZA 1XDWA 1ZD5A 2YNMA 3ETJA 5KSZA 3WO0A 1EAYA 1X9GA 3WOVA 2IFUA 1OBHA 4IS3A 2VSOA 4MZXA 3NU1A 4LFAB 4HS9A 1ARZA 4MI1A 1DB3A 1WB4A 1CU1A 4I14A 3MCXA 4IQ0A 5AVXA 5DTRA 1SD1A 1X1EA 3FOBA 2VTKA 5EP4A 3VZDA 4ALIA 2BHNA 3KE8A 3HVKA 3E5NA 3VNAA 2ID9A 4BTBA 2ZROA 4IWXA 4BB0A 4A92A 4B3SB 4CDMA 4G8KA 2VHTA 3WJAA 3S2EA 1OGIA 1LWNA 4E85A 4WA8A 2X0DA 4ZIRA 4GZ3A 2DETA 2FWMX 1RAEA 1P1CA 2MTBA 5IX8A 4M2LA 1UEXC 2J3KA 1Z18A 4GA1A 4LKRA 4YMVA 5H4GA 3V8QA 1T2VA 3JQ6A 2OEWA 5E6UA 4RF4A 4JBWA 1T4CB 4LYGA 4C30A 5CG1A 1XD9A 4NJOA 1TD9A 4I1MA 1XQVA 3CTPA 5KCZA 3UJAA 2ZRQA 4CR7A 4S0ZA 4Q4DA 1UDRA 3QTBA 5EWLA 3L46A 5K3EA 1KYVA 3FI0A 1FDSA 4F2DA 3LWBA 5BRNA 3N7AA 2ZBUA 4BRUA 4KN6A 3DE3X 1JDJA 4B3CA 5DNUA 3RVKA 2CJFA 5LQNA 1LNZA 1PD0A 3KEFA 4MWSA 4TS4A 4DDVA 3K9WA 1ZFNA 4WOKA 4AN0A 4MHOA 2WWXA 5DISB 1EFVB 4D98A 1QIFA 4RY8A 3JAMA 4YCAA 5KJCA 2JPDA 3ZI7A 1GU1A 3N8NA 3WX0A 2JGDA 1PAUA 2VI5A 3DZDA 1U7HA 5G4KA 5F23A 4MR9B 2CXNA 2TRSB 3KAPA 2ZWOA 2C92A 3WYFA 1EDDA 3ZYZA 4C21A 3DBRA 3SQWA 3BF8A 4GO1A 4AJPA 3CVWA 4BE4A 5GVSA 2ILRA 1E7QA 4NURA 4N0QA 2R8XA 4A2PA 2JGMA 3GNTA 1M1XB 4OAQA 4PPGA 4ZMSA 1E4VA 2DFDA 2B4QA 1RIFA 2X76A 2XEEA 3F5DA 3RLIA 3STTA 5IBRA 1I7DA 3ZHBA 2DUJA 1P91A 1F2VA 4TVOA 3A9VA 4JU8A 4X1YA 5TQ0A 4E5NA 2P8SA 4AEZC 4M0LA 3NZSA 2GVNA 2YIDA 3OT1B 5HCUA 2DTDA 2E87A 2XNJA 3TLMA 4EL5A 5I8ZA 4GEKA 4ZYTA 3T5BA 2IYFA 4DTIA 4DLSA 4ZEXA 4Z3KA 5C32A 1HKUA 1CLUA 3VAZA 2Q6LA 1G3RA 2WU4A 4OTZA 3HJHA 1P62B 3FU5A 3LBHA 5JBQA 2CXOA 3L0YA 2Z6UA 5IAJA 4AIRA 4I4LA 4RNDB 3KCNA 4TM8A 5F76A 5HJ7A 2M1ZA 4D82A 5K4AA 1D2MA 3LZCA 3CF4G 4RUKA 2HR1A 4QX6A 3OU7A 2RGCA 3GX1A 3RSHA 2ET6A 4KAXA 1KY3A 1NUTA 2XUQA 4A55A 1L9KA 1XVTA 1G8GA 2IKQA 1AGPA 3AI1A 4W1PA 5J47A 1K6JA 2NM0A 4QQ8A 4BNKA 2EJWA 4CM5A 1ICEA 2VPWA 2CG3A 4OREX 3TE6A 2XZPA 1EWTA 4HVLA 2NNWB 3EEIA 3OO1A 5CDFA 2PXXA 2Q2WA 1F2UA 3MXOA 4X6UA 1NW4A 4FHKA 3CJRA 2BKLA 1CETA 2RAUA 3A3OA 3WLLA 3ZJ5A 1GY8A 5BOSB 3KSAC 1QONA 2PZJA 5DOVA 1MO3A 3IURA 3KEGA 4YEDA 2I1WA 2HGZA 3T54A 3L82A 3I05A 3RAPR 1C3JA 3UXEA 3PQFA 4XUDA 4Q1DA 3S70A 3KSMA 4RIIA 3BWDD 3DEAA 1YS6A 3P9CA 2B5VA 4M7WA 8OHMA 1RHKA 2V5UA 1YF3A 2BYTA 2DSNA 4W5TA 2ZJAA 4L5CA 1GXSB 4M9ZA 5CVUA 1E59A 3UTDA 4FYMA 1AWCB 1AT1A 1QZUA 2WD9A 3MINA 1W93A 1RJEA 3NC1C 4A2CA 3C1UA 1R4ZA 1FSZA 2NOAA 2PL3A 3D6NB 5JYDA 5D7BA 3L43A 4K40A 5KYYA 1XF1A 3HDYA 4D8WA 3GDFA 2BP7B 3UXMA 5L9AA 3RYCA 2VQSA 2RD0A 3UVEA 1L4YA 2ZR8A 3GEEA 2QTLA 3ILXA 5HHTA 2JFNA 5J3JA 1XD2B 1M2OA 5FPKA 2Q4BA 3K6JA 2MYUA 1S2LA 1N32B 1EF1C 1JDTA 4XD2A 2O2ZA 1PYGA 5EWMB 2C29D 2YINA 3C6BA 2GN2A 3RS2A 5JS2A 4BBZA 3GHYA 1XU7A 3D5EA 4CMGA 4WLEA 2EZTA 1A9ZA 3CH4B 2C5FA 4AP5A 1XAGA 2FYTA 2F1OA 1GQFA 1Q83A 2GAIA 3UK1A 1DKRA 5LA6A 5FWQA 1D8TA 3HN6A 3PQ3A 2C9MA 4DIDA 3RJVA 1NVDA 3ONNA 2W98A 3KUDA 2OVFA 3CG0A 1FDTA 1KEKA 1A2OA 3Q15C 3D4LA 1N5MA 1TCVA 4V0QA 2PUVA 2X7HA 1MEJA 3BFVA 3EFOB 3V4RA 3EXHB 1XMPA 2GILA 1XKXA 4EQ6B 2Y2VA 3OSUA 2APJA 2DUWA 3AIOA 3EXHC 5CT5A 2NXCA 2AK2A 3SDBA 4QJIA 4QOHA 3UC5A 5JD4A 1K7SN 4E3ZA 4QZVA 3ASVA 4RLHA 2EW1A 4ZAVA 4ZTZB 4XI0A 1IHUA 1KBZA 1Y0BA 5ANRA 2WW8A 3EOZA 5EJ2A 4HS2A 3RAUA 1XZGA 1C9YA 5EEGA 1TN6A 1Z6TA 3GZ2A 2HIAA 5G1OA 2JI8A 4NNOA 5IWCA 4AMGA 2QRUA 5HWSA 3CEMA 3GDGA 5KAMA 3ZI4A 2I6UA 1FDUA 4JDUA 4CM7A 1OT8A 1YZUA 2ZANA 3N8IA 2X3MA 4OLJA 5A04A 4LDRA 2YMPA 2PQ0A 4I4IA 4WKPA 5JS1A 3R41A 1AM4D 3U3WA 1JJ7A 2C2YA 2I6XA 4NTZA 1IZ8A 4BNFA 2BMAA 2AN9A 5TMDA 1EYZA 2FPUA 4F12A 4TKVB 3JQFA 2J9FA 5CH3A 3CLSD 3U48A 3NB2A 2B98A 4XRRA 3D9HA 4ND7A 5LFAA 1TN8A 3GPCA 3QKSA 4K6CA 2Q6KA 1YAHA 2AR0A 3SC2B 5M29A 1W87A 2QU8A 4MUAA 4AJNA 4TTTS 1YQUA 1Q1GA 3E53A 4XASA 4NBWA 1YL6A 4U6NA 1JIIA 3UUGA 3CN9A 2REOA 1LSUA 2JIZD 1PT9A 3OFNA 4BBAA 4DLPA 5HOQA 4OCZA 3O4HA 1M1NB 3IUSA 5FNVA 3NC0C 4Z4QA 2PK3A 2IEGA 3E3OA 3BGDA 2WWRA 3NT2A 2E37A 4XLTA 4DZRA 4E5UA 1OH8A 2IK8A 1U8EA 3PCXA 3IL2A 2CHZA 3D81A 3IT1A 5G1PA 4ARIA 2G8NA 1KY4A 1H2TC 2C83A 4YRIA 4J8DA 1BS9A 1BN6A 4KAAA 2AZMA 2WFLA 3UT6A 2EL9A 1RYBA 2G82A 4HUQB 3EARA 7YASA 4LRQA 4M7OA 3OAAD 2GEFA 2X13A 3LXUX 2YUIA 3RM3A 3I92A 4HNTA 2FSUA 1UODA 2OV6A 4TKZA 4F5YA 1NA5A 1G2IA 2AF3C 1CQIB 3G5LA 4HXFB 4MVCA 1XZJA 4D56A 1N0IA 3DLCA 3VO2A 3KR9A 2AD1A 3LV8A 4M9XA 2FMTA 2P6RA 4FN5A 5F5LA 4EATA 4GPAA 5ITSA 4HP8A 4IMJB 1YJBA 1FTYA 1NL3A 4XARA 5H3HA 4ROSA 4ARVA 5T3YA 2ZRPA 4J07A 5EY5B 3SQOA 4DLOA 5HZHA 2V7WA 3SKVA 3FTWA 3UMBA 4FOPA 2QLBA 2UZ4A 3PKIA 3KV3O 4N3CA 5JCPA 2NP7A 5DTJA 1YVPA 5KWDA 3QNKA 3H2JA 2P41A 2WXIA 3QK0A 2A9JA 1QK5A 1GDTA 3A9SA 2QXUA 1K06A 3ELUA 4C4YA 4JI3B 1OBCA 3QVJA 4JL6A 1WUYA 4ZN6A 7ABPA 3MGGA 3WLMA 4NZ9A 1Y8RB 4XTRA 2DY1A 3AOEC 1G60A 4L50A 2PH7A 1SQ0A 3QARA 4RHEA 5ICEA 1ZAYA 2QZJA 1G7RA 2A2ZA 1Z29A 4CG2A 2P8JA 2EKZA 1C2TA 4PS3A 5TGTA 3TFOA 1HG0A 1VHJA 3DULA 4QQNA 1T3ZA 4AF6A 4O5AA 3AERA 5F98A 3QWBA 2IDJA 4FGJA 5D51S 3TKYA 1XROA 4NG5A 3BX1A 3FYCA 3JY6A 4H59A 1SELA 2AFIE 2L9BA 4IRXA 3UIEA 2JLXA 3BMQB 2IJGX 5DBGA 4R1SA 4EX6A 3PWKA 2UYOA 3HYTA 3L6EA 1DIGA 1L7QA 4MIKA 5TS3A 4F4UA 1D04A 4F04A 1RLMA 3SFXA 4KQMA 1J21A 3G9TA 2FV8A 2XNDA 1Z4QA 5DT9A 2HBYA 5G0VA 4OBBA 1HE1C 3SMQA 4C4TA 4Z7OB 2W83A 2ECFA 5JJIA 1TECE 1JTVA 4DIEA 1M0EA 4RLYA 3FU0A 2WXOA 4MVJE 4FR0A 3PEWA 3UMRA 2XSZD 1NN0A 3IMFA 5GIPE 3I5XA 1IPFA 3FBWA 5I7RA 3FVQA 1L4HA 4MS1A 2GPSA 2ATXA 4E7PA 1RW2A 3FHEA 3X43A 1QH1B 5TB5A 5DPMA 1JLLB 2D0DA 3RYHB 3V34A 5JW6A 5LZ9A 3CHQA 5K99A 2ZPTX 1YUBA 2PEZA 4X7BA 3ZC3A 4JI4B 1BQEA 1H6CA 1V47A 1QLWA 1XZEA 1KJZA 1JEEA 3W1VA 3GP8A 2V03A 4D0NA 3PF8A 4MRVA 4P3YA 2DPLA 1MVLA 3NM4A 1O0BA 2E82A 3E9NA 4YI5A 3W6NA 4GB9A 1E1YA 3M33A 3EUWA 2P9JA 1W25A 5FL7A 3ID6C 4TV8F 4V1CI 3N0WA 4H1WA 1P74A 1X0XA 1BE0A 1E2MA 1VLMA 3RNOA 3T7EA 3UAOA 3F4LA 1OIVA 4D5GA 4DLKA 3FZYA 1GNPA 5JPCA 3PEYA 4MEJA 1XDGA 1H5UA 1NFRA 1SBZA 1WE2A 2GW1A 5IY5E 1Z3YA 1NNUA 1TVMA 1SWVA 3I8OA 2EIHA 3H5LA 3QV2A 4IQ8A 5B7NA 2XTZA 4JI2B 4YQEA 1XRNA 2QY7A 1TZBA 4MJLA 2JEZA 3RYFA 2IV7A 1WR8A 2FZWA 1FVXA 4I5EA 5FIOA 5EHIA 3HB5X 1AQLA 2E1PA 1IG3A 1WHTB 3AESB 5ALLA 5A5EA 1Z75A 4JROA 4U2DA 2D2IA 3ABLE 3NUGA 3E3MA 3E6AA 3RSCA 4D9CA 2OO5C 1H1TA 2QZ4A 3DV0B 4GI7A 3DSTA 1N57A 2VNAA 2PA0A 5IZ4A 2VRCA 3DQZA 4MVXA 4FCWA 4FCTA 3T61A 5E6SB 5JC1A 3AF4A 2YFYA 3ICEA 5CYOA 1M2VB 1XV5A 4FSHA 2G1PA 1AN0A 1E7UA 2WIBA 3GV0A 4I7EA 5JCJA 4TRMA 3TQQA 4CMEC 4F6RB 4GTRA 1CZHA 4KLZA 5BUZA 4MW2A 1OUVA 4F21A 3DLIA 1POXA 4OXKA 5CDFE 3TE7A 1GQQA 3U62A 4QQIA 4P0QB 3EAGA 1MC8A 3GU3A 2VHZA 4IPTA 3FA2A 2A1IA 1N7JA 3PFHA 3VPSA 3IMGA 3OIYA 4GR5A 4DLLA 2AKEA 1G55A 3QGMA 4GYJA 2BFCB 3DM5A 3IELA 4DCTA 2DY0A 1FRNA 1D0VA 1ULAA 1IM2A 2VDQB 3KEOA 1GGFA 3PHIA 4NYIR 1LI7A 2HDOA 2XE7A 1FQOA 1PNQA 2FUNB 4JHLA 1ZX1A 2AE2A 4WNDA 2E49A 3AR9A 4RL6A 4U00A 3FSJX 5HK8A 1NOKA 1RM0A 4A3VA 1B76A 1KO7A 1II8A 2KBXA 1VFNA 2FW7A 2IE8A 2XHZA 3BH0A 3M70A 2HHAA 3LYHA 1QRDA 1IJBA 3NH6A 4L0DA 1UAYA 4MQEB 5LP1A 2P5SA 5T4YA 2ODBA 3QELB 3FMIA 3LDAA 4XQGA 5SV2A 4CUJA 1ODFA 1RXSA 2DECA 5EC8A 4BU1A 3W6PA 4CTJA 3FXAA 5HK9A 2HAEA 2YRWA 1TAHA 1LX6A 1M6VA 2GHQA 1JDPA 2WWTA 1FP1D 3BMXA 3CSTA 1N8TA 1GA1A 2B1RA 4NS4A 3WJ7A 2PT6A 2Z2IA 3CIFA 4PM4A 1A2QA 3HXQA 5K0EA 3X0DA 1CUHA 4IEIA 3TTVA 4BLQA 5J63A 3JQDA 4DCSA 2V8BA 1J0XO 1OFTA 1B1AA 1YZYA 1C1YA 3LUBA 4ENTA 2AQKA 3IMEA 4NARA 2WHEA 5IJXA 1WTCA 3LEWA 2FFBA 2HJGA 2R5WA 2HRQA 3B7WA 3KJEA 3NDIA 4RAOA 4DYVA 3TUZC 3U60B 2QYTA 1X80B 2JGAA 1FQWA 4KWEA 1UDBA 2RGNC 3L1HA 5K20A 1OXJA 1V1JA 1L5RA 2Q3MA 4Y1FA 4TWJA 4UXIA 3ZE7A 3R20A 5C1PA 1EEHA 3DPYA 1C7JA 3WHIA 1P75A 1Z5PA 2E9SA 1X1AA 4B83A 5JD6A 1GRVA 4WK4B 1MTOA 5HQJA 3B6IA 2ZATA 3B51X 4HNAA 2NAPA 1YR2A 4RM2A 3IBGA 3VSAA 4H6VA 5DGCA 1VXRA 1TXGA 1DBQA 5ELLA 1LRLA 5B6JA 1RT9A 1SR8A 4HF7A 4TM7A 2KMLA 4UUMA 2WTNA 1GPUA 3VAYA 2J7KA 3TGWA 3KC2A 3TXMA 3PA8A 4TMYA 4KLRA 2PLRA 3PX7A 5K3CA 2J85A 4NAVA 2FPGB 4AROA 2N47A 5KDDA 1CRWG 1PWXA 3EFEA 1Z2CA 4LY0A 3G2WA 2WPNA 2WC1A 2V4HC 1E3WA 1WTAA 4N0DA 2WJAA 2FX5A 4NJMB 4JEMA 1YBAA 4EVQA 5A4KA 3QYPA 4R9VA 2ICAA 2DBZA 3BS4A 3K92A 3KU1A 4UFOA 5KC8A 1FYFA 3KL4A 3UUXA 4NVRA 4X8HA 1T8WA 2FJPA 3GPDG 3JPYA 4Q82A 4NCBA 3UJCA 4HDRA 1KZPA 1JDBC 2C00A 3BWBA 2CK3A 3RF7A 2WKPA 4Y0NA 3UAXA 5AENA 4HH1A 1NPYA 2B8TA 5HRUA 4ZZ2A 5KPJA 3AY6A 5B58T 3KKMA 1H1DA 5A03A 4YO8A 4EK9A 5LL6P 1F48A 1I13A 3RJ9A 4BCBA 4HRAA 2HW8A 1AU9A 2FR8C 3UQYS 1B73A 4DPRA 1Q7RA 3F5QA 1Y81A 1PU2A 1E7WA 1FSGA 4IO0A 2NQ2C 5BYBA 4ZOCA 1QMPA 5ENOD 4LRUA 3LCRA 3KVNA 5IDQA 3ZW8A 2I6TA 4J0JA 3V6MA 4KREA 1ZD2P 3PHLA 5JJ6A 1EK0A 5JBIA 5FTPA 1E9EA 3UPDA 2AHOA 1TNOA 1V8DA 4M1ZA 3CLHA 4ZKDA 1MPTA 1F4LA 1NP3A 1QGZA 4CE6A 4HYEA 4FDMA 3HYSA 4NDZA 2GVDC 2AH5A 2CLKB 1WETA 1FJHA 3DG9A 2K7FA 4C08A 3PRZA 3RDPA 3K9CA 4YV2A 5AYWD 2B5OA 3AGPA 4KZKA 3NGLA 4Y7DA 1JHDA 4PAQA 4C20A 2DR2A 2JLZA 1NPDA 2C4KA 1NI1A 2PKXA 1NUUA 3Q5MA 3ER6A 3FPEA 3NIDB 2YV5A 3C3OA 2YS6A 4LC0A 4AYTA 4J6EA 3AWDA 4NBVA 5CP8A 5DHRA 2WIAA 3RRFA 3V33A 5DYTA 2Q49A 2RC5A 3LZ6A 3AKCA 2WKQA 4ZT6A 4DV5B 3IS3A 4DBLE 3OX4A 2PWAA 4OL9A 2JG3A 2W5UA 3UUFA 3QYAA 4B3RB 3NBXX 1G9XA 4QTTB 1OXBB 1WCXA 7AT1A 2UZ1A 3ECAA 3IT0A 1WXEA 3D8UA 3Q9UC 1NIPA 1V4BA 1W4AA 4TMTA 3HCBA 4BKOA 3IQIX 4U7HA 1IM5A 2XQJA 3EVAA 3FPGA 3IQEA 1CJCA 3RBXA 4ASUA 5CXQA 1QYWA 1ONSA 5EE5B 4AWBA 1T2DA 3EPRA 4MO2A 1TUGA 4GI1A 1T29A 3GGOA 5JDIC 2WIFA 3FU3A 1SXJD 2P9FA 2I33A 4DM3A 1UJ2A 2JDIA 4A8PA 2W71A 4RPGA 3T38A 5GVRA 1FLNA 2PSSA 4XZ4A 4D41A 1OAKA 1PFKA 1GKUB 2V74B 4IR7A 2VJMA 1KO8A 1R27A 1QCDA 2AI3A 2VG8A 2F64A 1WV1A 3IP8A 4B73A 4AECA 4A82A 1C8VB 1NVMB 4CUKA 5AUNB 5FBRB 2XXAB 1RQRA 3AVTA 3I04A 3NWJA 1OA0A 4HYQA 5B2FA 1TNUA 1JECA 1HG1A 1XK6A 3K8ZA 3A1TA 1P7ZA 3L0ZA 3O9ZA 3HXDA 1SB9A 2R1VA 4G5HA 3EIJA 2I22A 4I50A 4PYLA 3RKRA 3S1LA 1NWCA 2ONZA 3KZXA 3TKAA 4CIBA 4TKLA 3D64A 3KIPA 5ENRD 4U7EB 2VDVE 4Y2QA 5EN4A 5IUKC 4C4SA 3DEFA 2IEIA 2VBCA 1PT5A 1ZUNB 2IXAA 4ZEVA 1H9AA 4UJ5A 1GTG1 4OXQA 5F1KA 2FCAA 2P4QA 2C58A 1IHDA 2QRHA 3AW9A 1XZAA 2WHYA 3EZXA 2LIPA 3HABA 3Q40A 2HMVA 1RXCA 3QLJA 4R8RA 2EIKE 3CVLA 1Z0IA 2A4KA 5T6BA 4QASA 4MVJA 1AOXA 3IYLW 4IX9A 1DAFA 1YYHA 1ODLA 2QVLA 3HG0D 3N58A 3PQ8A 1Z5SC 4MWOA 4JS0A 3WLHA 1T0UA 2ACVA 4J7WA 1ID8A 4ZDJA 3QJGA 1EUCB 4Z0NA 5HBRA 1PX2A 4GA0A 1Q14A 3GDHA 2Q1SA 3RABA 1M33A 2OHVA 1VHQA 3SAJA 1SEPA 3FNHA 4KSYA 1R8JA 1NJ1A 3U3XA 2NTVA 3DW1X 1WPRA 2C88A 4O60A 1ETHA 3AUAA 1VKZA 3ZEAA 4AZ0A 4P0TA 4P4UA 2ZBDA 2V6MA 3I01M 4DSUA 3TSOA 1REQB 1RBYA 3UXYA 2PIDA 1UZLA 4BC0A 4WZBA 4Q1BA 3PU6A 3VKFA 3EGXB 2PWBA 1USIA 1HE3A 2NLOA 2AYZA 2WAMA 2B7LA 2WJZB 3E84A 3M83A 1D2AA 2JIDA 3CPHA 1X9HA 1AXGA 2RHGB 4M7RA 4MA5A 5EZYB 3SVZA 1RYFA 2QT9A 2GJKA 4WKNA 2E4UA 1BX0A 1ECPA 1E20A 1HYEA 4BJ5A 2A5JA 3JV7A 4PLHA 3LC7O 5KNDH 4CPDA 4K9DA 1ORRA 1THZA 1PWYE 4QDOA 1ADBA 1HMPA 1EUYA 3RANA 2P2YA 3NVMB 4TXNA 1BYUA 2NO1A 3B1WA 3ZV6A 3LY9A 5EHNA 2C2BA 2JAPA 3MLBA 4QDUA 4E6PA 1MABB 3HDQA 1RWWA 1T8TA 4EUNA 5LP6B 1QKIA 2O9JA 1VLHA 3F4BA 1K1AA 4U8VD 5ER6A 2EIME 1AO0A 4BBPA 2J67A 1ZM3A 3AX6A 3NTLA 4QPJC 4BASA 5IXYA 1J1ZA 1SOVA 2JD2A 3DYVA 1IHGA 3SVLA 1N1MA 3E2MA 4F1SA 4FHEA 2G6BA 1J5PA 3ILSA 2P9GA 3ZWPA 3FU6A 3GRRA 4N40A 1H6BA 3SZ7A 5CAEA 5JNUA 3FI9A 3D4NA 3SHFA 2JATA 1YU9A 2ZB8A 3JUIA 3R8XA 4GOOD 1GSAA 2A0UA 4GPIB 4O0MA 1VPLA 4LI3X 5L3SB 5BUCA 1M83A 3COZA 2QVBA 1RLOA 4OHBA 5DSXA 1I32A 1KE2A 4J16A 1SC4A 2KZTB 2PX5A 4XQ0A 3K5IA 4YCDA 3BEEA 2ASVA 4EHKA 3TNLA 1QVZA 3BEOA 3PBKA 4O2BB 4QRHA 4QBKA 3I5UA 4WBNA 5MGNA 1LBQA 5A5DA 1AUOA 1M2EA 4YDRA 1N8SA 5JYBA 2GI4A 3C3YA 3ZY6A 1M6NA 3MTQA 1VDYA 3Q7QA 4R69A 3P4XA 2QRKA 1JLSA 1QFMA 1WUTA 3B9QA 4F6RA 4O6FA 1XRQA 3NHBA 2RD2A 1N7HA 4OQXA 3VAAA 1G5TA 1GR0A 5AI4A 3SI7A 1RWMA 4Q9NA 2BI4A 4J7UA 1ENOA 4NHEA 1RWPA 4CWAA 5HMMA 1H2ZA 2IY0C 3PQ4A 1QS0B 3FDHA 2VQFB 3H3FA 4NEQA 2X42A 4L4UA 4NRDA 4GLBA 5F78A 4HLNA 3A4VA 4S1WA 1R10A 1IJFA 2MT9A 1NMYA 4Q05A 1TEVA 4FI3F 5AJXA 3T7CA 3THXB 1U0FA 2R2GA 2OORA 3DKRA 4URHA 5CX4A 3WR5A 2FWBA 2OPBA 1RMTA 3V4PB 4OL0A 5BUSA 1XN1A 1GVNB 2PLFA 1O1YA 1KK3A 5ENDA 1KVUA 1MJ0A 1QP7A 4G0MA 2JLYA 4YDEA 3OJFA 3NRBA 3MQ4A 4RTOA 3JYNA 1OH6A 2OXFA 4WKGA 2OG1A 3V4SA 3A70A 3CQCB 2ENWA 1D2GA 4MW9A 3PX2A 1Q84A 5DNEA 3C3WA 2D8AA 3TZ6A 1FY2A 4EJ0A 4FE3A 1JQJC 3IKVA 4L5BA 2OQIA 3B52X 1A72A 1PV2A 1NVTA 1JR6A 5DO9A 2OB1A 1X8LA 3GJ4A 1PTKA 2QGFA 1CJUC 2JFYA 3NC4A 1JKMA 1E6EA 2P69A 4CM4B 3LY5A 1RYZA 4UBJA 2WSYB 1QV6A 2IP2A 3VC1A 1TLTA 1UUFA 4S1NA 4Y98A 4HRNA 4HXIA 4P32A 1TM3E 5IN5A 1BNCA 4MRNA 1ZIOA 4BRSA 1PL0A 3R9XB 1PFGA 4NE9A 1R7RA 1FK8A 1ND6A 4IYPA 1KORA 2Q3CA 3IQWA 5A9RA 3K96A 2XYPA 4EM6A 4LUNU 3TB6A 4B2PA 2EU8A 2WUFA 2YOHA 1EH5A 2IVFA 2RGNA 3QFCA 1JFLA 3T0FA 4ZU1X 1EQUA 2V4ZA 3OEWA 2X0FA 3FTUA 2OBBA 3C6QA 5KNDA 5LM3A 3IKTA 4A63B 4G9EA 4XM0A 3RS0A 1C7QA 3RASA 5IG2A 1GQSA 5ALWA 4P6VF 3PLNA 4DIBA 1UKVY 3CNHA 3MTBA 1G6OA 1O6CA 5BNZA 3R9AB 1SQGA 3I45A 1Q0ZA 3T1VA 4LCTA 3QOFA 1I7NA 1CT9A 1L7AA 2G76A 4L27A 4Y2XA 1EDZA 4P84A 4QO7A 2XWQA 4QECA 2MIIA 1NJ8A 1PFYA 3WMFA 2P9QA 5MF6A 3HK2A 4Q94A 2Q41A 3HB7A 2WOJA 1K5HA 3COPA 4WBSA 2X1MA 3P8ZA 3FCSB 3ASZA 4NLLA 1EX1A 3FD8A 2BFDA 1DXYA 4DR6B 2JFHA 2GBLA 2IF4A 1B7GO 1KSHA 3PXAA 2G09A 2VWQA 4UUPA 5YASA 4GQIA 5IM4F 5KB3A 4KN8A 3IX7A 1I1NA 1OTYA 2KLBA 4YR9A 4Y0AA 1ECGA 4FW9A 1GL3A 4E70A 2JEKA 1WO8A 2IYXA 1E8ZA 3MMSA 1QV7A 3EIQC 2O8CB 1YAJA 3DR3A 3V2GA 5JAPA 4HX2A 3EEQA 3LPZA 4NC9A 3V8VA 3E34A 4ZZ3A 5CB4A 5EKQD 1RR6A 4DMFA 3DHVA 4EHMA 3ENWA 1LSSA 3RSLA 3W3AD 3P27A 3ZV5A 2P2DA 4CNQA 2N9UA 3PXEA 2YHCA 3ZFWA 5IJ0B 3I53A 3BFJA 3IUBA 1CF9A 1NN5A 1ECCA 5FZSA 4YJKA 5FNVF 3R9MA 1KMIY 3B20A 4Q34A 3I83A 4ARZA 1E2FA 2H1FA 3JVDA 2Q7OE 3MA0A 3QPUA 3W1WA 2W6IA 4D0RA 3PRKE 2AXPA 5I7VA 3G5TA 2NTNA 4R5HA 4EI7A 3O8LA 2GXQA 2OCIA 3D0OA 4DBVO 3GQBA 4JP2A 5E4TA 5THKA 4MWGA 3TLAA 5IS2A 4C6RA 5FQOA 2PUEA 2WHXA 3Q3EA 4HDKA 3K72B 3MTDA 5DYWA 4KDCA 1EQAA 1V35A 2CHFA 1Z8NA 1IWOA 2KB0A 1U3WA 4UJ3A 3VX4A 1E2JA 5FCDA 4JJZA 5FNVB 2AMLA 2BGRA 5C7YA 3AV3A 2CGEA 3WGOA 1SC1A 2CXTA 4ABNA 3GJ7A 3VH4A 1XHFA 3LT2A 5ECGC 2DPHA 1GZ6A 4RY0A 2GEVA 3ZTWA 3V1LA 4FP9A 4XM2A 1TNDA 4K5CA 1UOQA 4XDZA 3AI2A 2QRPA 1SBNE 2B9VA 4JVMA 4WNGA 3QE0A 1RPTA 4G0ZA 3JVUA 3SLRA 4A5OA 1NV9A 2OFOA 2OOKA 3BF7A 1EHIA 4O2AA 4A91A 1PGPA 1G41A 4DPLA 1CJMA 3O1LA 4WXHA 4BLTA 1TVKB 3DGEC 2Q9BA 3NNSA 2BGNA 4DIKA 3M6LA 4HRYA 2GFQA 1XMSA 3FZNA 3OZTA 4DC0A 5C5IA 1Y5MA 2J41A 3AM3A 2N3ZA 5JAQA 4HFMA 4XLZA 1JLKA 5LDDC 4G85A 1T43A 3ENVA 1FNMA 3FTNA 4UM9B 4Z54A 3D6VA 5ELXA 2AWIA 4PS7A 1EFUA 1O4WA 1SHJA 1UC9A 3G85A 4EL0A 3IB6A 4MQ4A 5I7OA 3W0LB 4DEXA 5FD8A 2RGDA 4WUVA 1CBUA 1Z47A 3NS7A 1C3LA 4FNGA 4LJ6A 5J40A 4FM9A 1K3FA 3OFKA 1WHSB 5AQAA 2XB6A 3CBGA 3CLUC 3PFWO 1KZ7B 4JU9A 3KR2A 3PF9A 3QKRA 5IC6A 1HZJA 2JRCA 1R9JA 3GZNB 2XD4A 1HFKA 2J6BA 2IO3C 3ZN3A 2YS7A 3P9IA 5AIBA 1JPNA 1E5XA 1XLWA 4DX7D 5BRAA 4WZAE 4B8AA 3GFFA 3JX9A 4BO8A 3PXXA 4HFRA 1VE3A 3PXBA 4LZOA 3Q9NC 3A2KA 2PUDA 2R8EA 3K3PA 3TWTA 1M66A 1TVKA 3KZKA 4DFDA 2HIGA 2J31A 4EA6A 5DM2A 1R8YA 1AMNA 4K3VA 2MSLA 3KKOA 4ZA2A 2B0CA 3UHAA 1ABEA 2XCSB 3GLSA 3HDHA 4GXTA 1N2IA 1U6IA 4CBVA 4ISBA 5EJ4A 2WA1A 2B34A 3PNBA 2RHDA 1TQ2A 3EXFB 4JVSB 3KEZA 1AS0A 1H6AA 2V8SE 1E3DA 1M1YA 1QR6A 2AL7A 3B38A 3QE2A 4EJFA 3MBKA 5JY6A 2BVNA 7REQA 4HZIA 3LP5A 4AG3A 4GAAA 1BKSB 4RVOA 2ZT6A 3FM9A 3INTA 1CE8A 2RAVA 1Z0UA 1DQRA 1V3TA 1U5BB 1G20B 1HETA 3HVIA 3GLHA 3NO4A 4FEGA 3A58B 5E2AA 3ZD8A 4AZTA 3JZIA 2ECKA 1ORVA 2ZWVA 3QKTA 5TMPA 4JZYA 3ETDA 3LUCA 3A0UA 2I8LA 1X8KA 3ANXA 3CEQA 1NLUA 1S2OA 1QSGA 1VP9A 3LUJA 4FYJA 2Z95A 4HS4A 3PEUB 4OATA 4RL4A 4YAFA 3ENZA 1GFSA 3EGXA 5H81A 4JLMA 1FUYB 1L7EA 2GUGA 2QNBA 3ZJTA 5F5XA 2NVUB 1P7YA 2D0IA 2GN6A 4TXMA 1E7RA 5ALTA 4A5SA 3EY9A 1V9SA 1LLCA 1DGQA 3HA3A 3U0BA 4JLKA 3TMKA 3DQPA 3MRXA 2QRVA 4GG1A 2WMNA 2E4ZA 4RTQA 5BR1A 2HJ9A 3NALA 2R6ZA 1JG4A 2X0KA 1YJCA 3B1ZA 1UOHA 1M75A 3FCCA 4RFSB 1GUFA 4QQRA 2GPAA 3H2GA 3L7AA 4BLVA 1OBFO 5EIDA 1SUBA 5JNTA 1ACJA 2C5EA 2JVKA 2QVCA 4IHAA 1NT2A 2A67A 4BVGA 5KYUB 9MHTA 1LK0A 1SC3A 3CHMA 1WVIA 2AJLI 2H7VA 1N5DA 4U02A 4C0MA 2B1QA 2CZGA 3AG6A 1JUQA 1KVRA 1WG8A 1ATIA 2HRDA 2NADA 4AXBA 2YL2A 3ZEIA 1L8LA 1WP9A 2VYVD 4C87A 1O5IA 2XIJA 2FK7A 1BU9A 1KO4A 3CNBA 4G4SO 4OY3A 3WC4A 2AK3A 5T7BA 1TRKA 2YVAA 4JMLA 1ZHHA 3CCBA 3OESA 3SC3A 3WWOA 4O1OA 2B8NA 4NBTA 3NPMA 4R1NA 3UANA 1AHPA 1G8SA 4O4LF 5FI0B 5LIRA 4ER5A 3TWXA 2I7TA 3PDHA 4X3PA 4F86A 1X38A 2X8BA 4EGSA 4RIEA 1TA9A 5CX1B 3SKXA 2RH4A 1JE1A 4LRYA 3K7EA 1M8PA 3IOYA 3OZFA 3RU0A 3KR1A 4DCNA 3VTYA 1D1TA 5CGQB 2XXAA 5E0KB 3ZS8A 1JDZA 1PVDA 2DH6A 2I7XA 3WB2A 2GK7A 3SXUB 3ZNPA 3ISMC 2JJMA 2V9CA 1VSUA 1KIMA 4A3TA 4CETA 3R6DA 4U7WA 5DP2A 4MVJI 5FZRA 1HBJA 5G0WA 5IJ9B 2J87A 3N2LA 3H1GA 5KWJA 2X1LA 2VTEA 3BWXA 1KAEA 1C7RA 4Y0VA 1IM8A 3SS9X 2IV2X 1UPFA 3LWDA 1Y33E 2I8AA 4J8EA 2VK8A 1K98A 4ZGWA 3EQ8A 4EB3A 4KYUA 5AKGA 3WYAA 2PX6A 2H1OA 1F2DA 2PT9A 4ZI3A 2WMOA 1B0UA 4BMNA 3HL0A 4E03A 1D3AA 4EPYA 5G4KB 1XKLA 3R76A 3TH5A 1WKBA 3OQHA 3C8MA 3GDWA 1BA2A 4R8KA 3KQUA 4A1FA 2OORC 5JS6A 3RROA 2HA4A 3IQZA 3M6WA 5HS6A 1EDOA 1D2HA 1OGYA 3QQ5A 4Y2VA 1Q1NA 4QYSA 5JZBA 1ESDA 1XLTC 4QUKA 1E2UA 2C54A 2G83A 2OZLB 5EE0A 5BP7A 5JZVA 5JWHA 4KC0A 2HO4A 3GWGA 4UPVA 3LAWA 5HFNA 3LLMA 4U0SA 3E9YA 3GEGA 1LD8A 4DLBA 1NVGA 3C98A 4BKUA 1TUEA 1QB8A 2V7XA 4YJHA 4QTXA 2B6NA 3CC8A 1B0ZA 1QQEA 4QEZA 1S3SA 4IW3B 1UKCA 5LXTB 3IHVA 1T3TA 1QH1A 4HNAB 2EATA 1XE3A 2F9LA 2FN9A 1L4EA 4MUYA 2RGGA 3I4LA 4RMIA 5KU7A 5ERGB 2CHEA 5GAJA 3IAFA 4UUCA 3ETEA 5HIJA 4JLBA 5ICMA 3DT9A 3NBKA 3C3AA 5KQSA 1WBBA 1EGVB 3E33A 1W0JD 2M6SA 3H9CA 4ON9A 5AHKA 5D85A 1N3IA 2QTBA 2YH2A 3ROFA 4X5OA 2DYRE 4H4EA 1P81A 1SU6A 2Q3DA 3I5AA 4BMYA 3R7DA 3OMXA 4X63A 4XVUA 2O2YA 2O3TA 2AW5A 4FYYA 2A7XA 2EQBA 2REQA 4Q39A 3WGJA 3GF4A 1H2WA 3UW3A 3N71A 1F6WA 5AN8A 3PCRB 3PJGA 1TJFA 4FDUA 1Z68A 1RIIA 1XTVA 3C6MA 2X41A 3KETA 3UXHA 4C9BB 2Y1FA 3ISTA 4RK1A 4P1ZA 2DUUA 3AERB 3P0HA 3PYMA 2Q45A 5IDXA 1P4JA 2BFWA 1TU4A 1MN6A 4GGOA 1OUMA 2QZ9A 2DFPA 4YP0A 4HDRB 4WLNA 3PPWA 5G3YA 5LQSA 5AW7A 4AZWA 1V0JA 3UUWA 3EFHA 3S2GA 5HKAA 3BD6A 1DIBA 5FBZA 4BLWA 5KSWB 3MXTA 4BV8A 2GEJA 2CEAA 4AY3A 1QCCA 3NTUA 1JQBA 1Q7CA 1EG2A 2O4CA 3GLQA 3H87A 1K7YA 4RH3A 3KSLA 4ZO9A 3CH5A 1NRXA 1T8UA 1KSGA 3WXBA 1PV4A 3PQ7A 1QFJA 4RFSA 1XQWA 3I2FA 1IPHA 2CXSA 1F17A 4RMGA 2F48A 5LXTF 3ZKWB 5CEFA 5K4GA 3DCYA 3IHLA 3PJEA 4ZZ1A 3SIRA 4GWLA 3PEVB 2CK3D 3D1JA 3OQ6A 3FUJA 2GN1A 5T3RA 4ZOAA 3KQHA 1KAQA 2CMFA 4CQMB 4QT0A 2IIQA 2D13A 4CCYB 3PHCA 3VVCA 4LK3A 1UBGA 5KYTA 2NW6A 1DBVO 1DC8A 4OP1A 4MDYA 3SZLA 3PICA 4DEVA 4KSBA 3TVYA 1B8OA 1VHTA 1OPRA 1QAMA 1H2VC 1MRSA 3D3WB 1IJKA 1DEHA 1CUJA 5ENTD 1LU9A 2B35A 5I7SA 1XHLA 3H5RA 1ZICA 3PTZA 4HLQB 3THWA 4EELA 3I73A 2RI6A 2GD1O 4AO6A 4QFDA 3UB3A 3RCBA 2YZKA 4R81A 4S1VA 3NOVA 5E7MA 3ZHUA 5ALZA 4UVIA 1H05A 2ZRNA 1RHRA 3TQRA 1XZCA 2O5VA 3PZ1A 4KR7A 3K0AA 1XTKA 1O96A 1FLAA 1FFAA 2R6R1 3D9QX 5K6RA 2HBRA 1UXKA 3TR5A 2IOYA 1UZAA 3TX2A 4C43A 3NHAA 1MGPA 1GAWA 2QM7A 4FN4A 2AW3A 1A8IA 4NU8X 4L78A 4D0GA 1SK8A 3TZHA 4P7GA 4JXZA 3LK6A 1O57A 3GVXA 3FUDA 3BSYA 4JP3A 5J2UB 3GAMA 3JZMA 3AI3A 3VR3A 3S7BA 1KI7A 2BKUA 2B1IA 3A9UA 4MP6A 4F9TA 2ISQA 4XX5A 1G6KA 3BUAA 1AKQA 3JD2A 4TQGA 3LJKA 5DNVA 4C7OB 1Z6YA 3MJCA 1EXNA 2VDRB 3D0QA 5JY1A 2G71A 2QMHA 2QN6A 4RCYA 5HMLA 2ZRDA 4ETMA 3YASA 5D86A 4ID9A 2C5LA 5AM3A 1ES9A 3IIKA 3PD1A 5CFLA 5AOCA 3IXLA 4ZK2A 4HRXA 2V4MA 1JSXA 4XGQA 5JU6A 2H52A 1TJNA 4ZD6A 4IHKA 5FBVB 1PRYA 2GOYA 1OCCE 2NC9A 3R9IA 4OLAA 2GGFA 3PUHA 4WSOA 4I50B 5AWFC 2AJBA 3KCQA 1N7GA 2H1LA 3GRAA 2XUKA 5DYGA 1AX9A 1L1QA 3P0RA 4M9CA 3ZWBA 4AY2A 2OGZA 4H35A 1L5KA 4H6XA 4RH1A 3CS3A 3PB3A 1EX9A 1YQ9A 3GCGA 4AMVA 1K92A 2IZ7A 3FLEA 4F3VA 3P26A 4M76B 3ZE1B 5ES4B 3AF2A 2WVJA 1M2VA 3DBSA 2R86A 3UWKA 4LVNA 5KJ6A 5FA6A 4GKBA 3DPIA 1VJ1A 3JQ7B 1TU3A 3F0TA 2JGFA 2W22A 3X44A 1HLPA 2WNIA 2DZNA 1N2OA 4N39A 2ZSIA 5ALYA 1N0WA 4K0KB 3HYMB 3LHFA 4HDAA 5AXCA 4CTKA 1IDOA 1BI7B 2QR2A 1X8JA 1USKA 2WM9B 2XMZA 2PO7A 1HR0B 1ZYUA 3EDTB 4P2GA 1KR2A 1KMQA 3GZ4A 1A17A 3LOQA 4J8SA 1YL5A 1H8ED 1YT5A 2MCFA 1NN1A 3T3GA 4MCAA 3UJ7A 1NDHA 1XZMA 2OAP1 2WJ6A 5JJKA 2JFXA 4HC4A 2OUIA 4TS1A 1AS3A 4D5EA 1MZVA 4NBLA 4A26A 1B8VA 2CL7X 2NXPA 1QZTA 3GIDA 2IQCA 2YXPX 2WSIA 4NKRA 1XNFA 1VHLA 3V2HA 4G25A 5DV9A 4URFA 3C72A 1H0AA 3ANYB 4F06A 5CRVA 1JKFA 1QX4A 1I2DA 1SZCA 5IC5A 3FUCA 4DSZA 4CLOA 4CZ2D 2JEOA 2Z4SA 3H4VA 4O0LA 5I48A 2ZIRA 3IEVA 4ML3A 4P0PB 1NJ5A 4LWZA 4BZXA 3ZHYA 2FSVA 4QYMA 3GGGA 4FX2A 3FTVA 2RKKA 3KQSA 1D2NA 5KTOA 2C4TA 5DTMA 5ENQD 3FG9A 4RZXA 4ARZB 5KYYB 3MKQA 4EYSA 3HXFA 1SJ9A 2HNAA 4QVKA 3RSEG 4GKJB 1LQTA 1XVIA 1R74A 3HUDA 1CUSA 1XRSB 1I1OA 4G2NA 4ZVSA 5BSWA 4D8UA 4M6WB 3K53A 3AONB 4UQOA 2OB2A 1XEFA 2VAPA 5CLLA 2M6RA 2ZYSA 1RADA 3EMVA 3R5KA 4IH1A 5A4MS 1KTVA 1RJFA 1BMTA 3N0VA 4MJXA 1U1DA 2HPVA 1PX0A 1ZZGA 1A8UA 1BXGA 1ZEMA 3PLAE 4LXIA 4RV5A 4WERA 3U4QA 1DPGA 4TT3A 3QVLA 4K46A 1SCUA 1D4FA 5JO0A 5ANLA 4MR8B 1OVGA 2J9RA 2CXQA 3OECA 1IYGA 4FFOA 1DI0A 2NT3A 1E92A 1M6VB 1U0OC 4YAEA 3WIDA 5EMMA 3HMKA 1TIBA 3EGWA 3NYWA 2Q1UA 4JFRA 4YRMA 3S1SA 4ND3A 1K4KA 3T1HB 2XXJA 3U4TA 1Z83A 1YJ5A 4OFXA 4QDKA 1K08A 4X6YA 2OCLA 2I34A 1VQ1A 5JJ7A 2QSUA 2HA2A 2ZSAA 1QPBA 3BTOA 3O3NB 3WISA 5U9CA 3A6PC 5IASA 1Y1QA 1E3WB 1MTZA 2QXYA 3VHQA 4U3JA 2VHWA 4OH1A 4PS1A 4CEJA 3ZDYB 3JYQA 1N8NA 3VGJA 3MKRA 2HXYA 2ZBPA 1Y3BE 3GNLA 2R1VB 4KDRA 4TSFA 1HDIA 3NORA 1FVFA 4ILEA 1V25A 3HJTA 3IQFA 3U37A 1YHNA 3UHFA 1UMBA 2OFWA 4UNSA 1JHYA 5TX7A 3RC7A 3RWMB 3TL2A 1KO5A 5HNKA 1RZRD 1U9IA 2GZ3A 2W2MA 4RTNA 4CEHA 1IHBA 1II9A 1XKTA 4N5NA 5FRDA 3E7WA 5SZKB 3VU9B 5L3QA 4FHZA 4M99A 5CGZA 3T1QA 4AIFA 5IKEA 3GJ8A 1PT7A 1T1RA 1U8XX 1P9WA 2V7VA 1YJQA 2Q5OA 3E7XA 4ND2A 2HZBA 2SCUB 4BNUA 5TQJA 3K0CC 3LXXA 2IY7A 1SVNA 2W6CX 1GTRA 3NOOA 1ONNA 1HURA 2NX2A 2I6FA 2ZRLA 3FMGA 3NJRA 4U7TB 2QOEA 1XTUA 3LCMA 3TQOA 4WGGA 4KQXA 1N6PA 5HIMA 5FTMA 2BEKA 4E2XA 2OV4A 1RYYA 3QOWA 2C9BA 3LCAA 2P1DA 4M53A 1DPFA 2ZVJA 4PNPA 2ZJ7A 4PTZA 2WM2A 4JOCA 3VZCA 4D9FA 2JRLA 2ZYIA 3L7CA 3MCZA 5J5VA 4ZI7F 5EEHA 2EINE 1COWD 3M2PA 3PGLA 1KZ1A 1MU0A 3HBFA 2FF5A 3TTSA 3WTCA 2CE7A 1QTNA 3NP7A 3X1DA 1ZR4A 1CEYA 1R9NA 1WF3A 4BXOB 4BAUA 1M5TA 3T5PA 3M4NA 1I3OA 4KWTA 2AHRA 2XYQA 3K9IA 1DAMA 1P4AA 5EXTA 3WWZA 1T9DA 4LISA 3U3OA 2C9DA 4KXFB 3FJ1A 4OHZA 3JPWA 3RTGA 1FFBA 1NW7A 3I2YX 4MIYA 1E5VA 3G8YA 4DY4A 4ZGGA 1PR4A 3E7DA 4MGEA 2DPMA 5JDCA 2PT7A 3BTSA 4BQFA 4WD3A 4GE0A 3HGTA 4QARA 1UDWA 1YZFA 4ZPXA 4TTRA 4IXDA 4EKDA 3CF4A 3DZKA 3ER9A 2D1TA 3JALA 4FYXA 1UR5A 3TX6A 3ECCA 1SOWA 2WFMA 4MWEA 4TV9A 1PBTA 3AUSA 4D96A 3UJDA 1LPBB 4MCJA 1TAQA 2XS1A 1J0BA 2YXEA 3V1NA 2OAEA 3DBVO 2L0XA 5DK6A 2BGUA 4B43A 4XPZA 3D8NA 1A2KC 5B30A 4X93A 2FCRA 5FJJA 4QYIA 3X2QE 3GVPA 4FMPA 5AVQA 1INLA 5AI0A 5BXOA 1SD5A 3LXRA 2I1KA 3C39A 2EJTA 4I8DA 3EHRA 1S8OA 2UUPA 2JNWA 1EU1A 1PGQA 4DXDA 3LK7A 4LXQA 5F9MA 4F7DA 4KXLA 1JX6A 1ZI9A 1P1BA 3K1YA 3HXCA 5AJUA 3OOEA 4TWIA 1KJNA 5B37A 5L3SA 3B9BA 4L8LA 5ADVA 3SQVA 1M6YA 1R6TA 3GJ6A 1ZXXA 4ZP1A 1BC5A 2X3YA 3WQHA 1S64A 3I9NA 1MJNA 1XTZA 3OLVA 4NH0A 2KQUA 1ZGZA 2OK8A 4MW0A 1F06A 4ZCMA 4XKCA 2GJ8A 1KZ4A 2AOXA 3EIOA 2EX1A 4RTPA 1N36B 2JZNA 3ET5A 4JBNA 3A6GA 4G0OA 4MUFA 1XN4A 2XCRB 1UFQA 2P4UA 5K03A 3C3CA 3CK8A 1OHHD 1YULA 1ZIXA 3A28A 2FO1E 1QJCA 2EGUA 2PYDA 1NRJB 2GFHA 5IYZF 4CTNA 5AFSA 2ZI3A 4KTVE 2ZUUA 1IHXA 1NU6A 1THGA 4BATA 5HA5A 1RRPA 1SIOA 1YCFA 1ZY2A 5HI7A 2AMFA 1HTTA 2R8RA 1DWUA 1IH8A 5DTIA 4DV1B 1AP7A 1N92A 2JVJA 4TYYA 2IPMA 3NIBA 3UJHA 4BLPA 1RPZA 3U09A 4XM1A 1KI9A 1TVCA 4C0EA 2XRZA 3BRCA 2WF8A 4XD7D 5TPWB 1TYEB 3PI7A 2PU7A 3PC8C 5KTKA 3E35A 4DBZA 1SCQA 3MJTA 2PPLA 2HT6A 3SE0A 3MYRA 3VNQA 2Q4DA 4CJXA 4OV6B 4DG5A 5JEDA 2WAYA 3HZOA 3PI6A 1EE1A 1U81A 4GXNA 1AF4A 1G8FA 1OILA 3CZ5A 4O08A 4YCLA 4L95C 1IBCA 2XJ9A 1Y9JA 4CR8A 3K0HA 4C2TA 5AI8A 2R8PA 3SXJA 2YY5A 2A1TR 3COYA 4UI9J 3L93A 4CT5A 4U63A 2W43A 1MX4A 5AK6A 5DKFA 1CD5A 1D4AA 1OFIA 2CLDX 4ATNA 3C43A 1B0PA 2XT0A 3M3PA 4I17A 1QYDA 1M2WA 1ZJ5A 3GMDA 2GR9A 2V6GA 4CLEA 3QPAA 1Z12A 1Z45A 1V1RA 1V9CA 1GILA 4R5MA 1MX6A 2O2CA 1PE0A 1JKJA 2LSUA 1C2YA 3V97A 5JEEA 4L23A 3O95A 1FMJA 2C5BA 2ZIGA 2VK4A 3IEXA 3SSOA 1EHYA 1JJIA 3KQQA 3NT5A 5AOVA 2B4AA 3IEGA 2GUWA 1I2AA 2GN4A 5IYZA 3FYDA 5IP5A 2W2LD 1MC4A 2R6FA 1T5LA 3PGJA 3DMHA 3CW2A 4IHJF 4OAPA 3G9ZA 3MGKA 1GPKA 4XCQA 1NKSA 2IF2A 1KAMA 3EGCA 5KMGA 1NU8A 1ZW6A 1YWGO 4J4HA 4QPDA 3H8JA 4BOYA 3SI5A 4U6SA 4BLRA 3FDXA 4R7ZA 2HUPA 4LCBA 1Y5NA 2FZLA 3FH5A 1O0SA 4LCJA 3HIZA 4ZT3A 5GZ6A 1B15A 3EWAA 2D00A 4OF4A 1EGHA 4FMDF 4WDRA 2I6QA 4JELA 5DSTA 1H4VB 4B81A 2QV0A 3VLFA 1JLHA 3MW8A 3PZ2A 4JWTA 1G8MA 2RHLA 2ZWMA 4N5DA 4FFMA 5JCJD 5KNDD 2VDWA 1XTPA 4J1QA 2QW8A 2VSNA 1OWPA 1PC2A 3ICPA 4DI3A 1XG5A <