4BX9A

Human vps33a in complex with a fragment of human vps16
Total Genus 223
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
223
sequence length
594
structure length
574
Chain Sequence
b'AAHLSYGRVNLNVLREAVRRELREFLDKCAGSKAIVWDEYLTGPFGLIAQYSLLKEHEVEKMFTLKGNRLPAADVKNIIFFVRPRLELMDIIAENVLSEDRRGPTRDFHILFVPRRSLLCEQRLKDLGVLGSFIHREEYSLDLIPFDGDLLSMESEGAFKECYLEGDQTSLYHAAKGLMTLQALYGTIPQIFGKGECARQVANMMIRMKREFTGSQNSIFPVFDNLLLLDRNVDLLTPLATQLTYEGLIDEIYGIQNSYVKLPPEKFAPKTEAKKLQLNSAEELYAEIRDKNFNAVGSVLSKKAKIISAAFEERHNAKTVGEIKQFVSQLPHMQAARGSLANHTSIAELIKDVTTSEDFFDKLTVEQEFMSGIDTDKVNNYIEDCIAQKHSLIKVLRLVCLQSVCNSGLKQKVLDYYKREILQTYGYEHILTLHNLEKAGLLKPQTGGRNNYPTIRKTLRLWMDDVNEQNPTDISYVYSGYAPLSVRLAQLLSRPGWRSIEEVLRILPGPHFEERQPLPTNRVTLIFFLGGVTFAEIAALRFLSQLEDGGTEYVIATTKLMNGTSWIEALMEKP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords VACUOLAR PROTEIN SORTING-ASSOCIATED PROTEIN 33A
publication title Structural basis of Vps33A recruitment to the human HOPS complex by Vps16.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
total genus 223
structure length 574
sequence length 594
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00995 Sec1 Sec1 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.850 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4bx9A04
3.40.50.1910 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4bx9A02
3.40.50.2060 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4bx9A01
3.90.830.10 Alpha Beta Alpha-Beta Complex Syntaxin Binding Protein 1; Chain A, domain 2 Syntaxin Binding Protein 1; Chain A, domain 2 4bx9A03
4BX9A 1FVFA 4JEUA 5BV1A 4BX8A 3PUKA 3C98A 1EPUA 1Y9JA 5BUZA 4JEHA 4KMOA 5BV0A 1MQSA 2XHEA 4CCAA 3PUJA 1FVHA 4JC8A
chains in the Genus database with same CATH superfamily
1KIFA 2ZJ1A 2HTEA 5KNLA 5NLLA 2YV3A 2R68A 3K6JA 3ZU7B 1YXMA 2A67A 2PUGA 5JJLA 4IINA 4WNEA 2XBUA 2BLLA 4QFMA 1ZN8A 5AW0A 4FX2A 5KWEA 3IYLW 2I99A 1BCSA 2HM8A 1SKBA 3ENEA 4YRLA 5CYFA 1BE8A 4DLPA 1Z2DA 3PRJA 3FDXA 4CRWA 4WINA 4YRPA 5AESA 2O2XA 5EE0A 2RAFA 5CFQA 5A9RA 3WL7A 2WNIA 4BOYA 4JI0B 4EG5A 4EY7A 4O4LA 1VMKA 4EZKA 2DE0X 1J2JA 1ADYA 3RO2A 4S1WA 5A4MS 4GP9A 1DQNA 1VKRA 4REOA 3QWHA 1MTZA 3GQBA 3FSJX 4DQ0A 2AE1A 5CCDA 3OQIA 3L7AA 4L4YA 1U9JA 4DQVA 3TTSA 1T35A 2WV7A 1IAQA 4P54A 1ISSA 4K6KA 5B6IA 3HM2A 5KVQA 4OI0A 1U7PA 1RW4A 3ZVKA 1UBJS 5KNHD 3BMCA 3EIHA 1YI0A 4JUDX 2V45A 1HT0A 2Q7DA 4RH0A 2VATA 5LYJF 4D1YA 4FMDB 1QB8A 1HOTA 1Y3BE 1R4MA 3H2SA 5F1PA 4AWAA 2EKLA 3I34X 1XPUA 1U7DA 3E3MA 3SJAA 4XJSA 1QYVA 4I50A 1PTJC 3WP1B 4N54A 1FSGA 3QY0A 5AK3A 4JW1A 4QPNA 4EY6A 1K3UB 4KC0A 3GMSA 5JO0A 1FFSA 1QZZA 2YY5A 3NAGA 5FULA 4X94A 1AMOA 3Q8MA 3QUTA 5F35A 3KQMA 3JARA 2GAFA 4A3SA 5FJYA 1RRPA 1GL3A 2R1UA 4E5YA 5HOEA 2YH2A 3W9YA 1QV9A 1RZRA 3IQXA 4OKIA 4B74A 4E21A 2BM1A 1F2VA 1NOIA 2FZVA 4POAA 1QM5A 1N92A 1SK9A 1DXYA 3HJFA 4BO9A 4XR4A 2CLSA 3X1MA 3NH9A 3VX3A 4LIPD 3O92A 4XI9A 2VK1A 1UBCA 4NL4H 3KKOA 1O0SA 1I7DA 4FOOA 5KQMA 2H4XA 2HFKA 1LPBB 1N3LA 1LJLA 3KYCA 1TR4A 3M81A 3QPUA 2OLEA 4RMIA 1JEQA 3T8YA 2YHIB 2QM8A 2ADOA 2CNKA 3U4DA 1CQIB 5COQA 4G1UC 5IVDA 2G5CA 4EFKA 1SHKA 3HXBA 4UM7A 1TAQA 2QZJA 4WOJA 4BNMA 3FLBA 4GMGA 4D0GA 5EHIA 1EYHA 2BFBA 4LF5B 3H5RA 1HF8A 3QTBA 5FFFA 1NJ8A 1CY1A 3UA4A 4X6YA 3TGLA 1E0AA 4EGAA 3GAMA 2ZRPA 3EJNA 5AXCA 1JAXA 3N3BC 1D9SA 2WUFA 1WPXA 1RHJA 4RS4A 5BQ5A 1TQ6A 4O2RA 3ESLA 2B69A 4CDNA 1QVRA 1LPMA 4HK4A 3LBYA 1RYDA 3AW8A 3R75A 4PLZA 2PUDA 4NEGA 4LDZA 3SU8A 1N2SA 1H0AA 2IDMA 4AIFA 1KPHA 3WSWA 5LLTA 3PDHA 5LQNA 3H86A 5K3BA 2VYNA 4FS3A 5CECB 1V7ZA 4E22A 3MKQB 4WFIA 2VJOA 4EYSA 2YQ4A 2O8CA 3GRAA 1Q1BA 1XRJA 8AT1A 3KELA 3OF3A 3JQAA 3T9EA 1CZKA 4BEPA 1JQAA 3LT1A 5DH9A 5EQJB 1VJ5A 4WXYB 1LH0A 4IJVA 1SKYB 2I6SA 1FNCA 2ZBPA 3Q6MA 3PKJA 4YCDA 4I3HA 4R54A 4YH1A 1XA3A 5B3LA 2BEWA 1KOLA 1R6AA 1NBOA 3OQPA 4JD5A 3ZY6A 3FPCA 1QSGA 3ZEFA 1OFIA 3CLTD 1REQA 3LVFO 4BGVA 2JLVA 1T15A 1WV1A 2N9UA 1P0QA 4BX3A 2JH3A 2YXLA 2AJCA 2CVOA 2ZPAA 4EO7A 1G3NB 4H7EA 3VC1A 5J2TA 1GL7A 1T1JA 2WZQA 1O89A 3EGOA 4DC1A 3LKDA 3TE6A 4UD2A 6Q21A 3WL8A 2M6KA 1Y48E 5DLDA 2PT9A 2VAVA 4WZAA 4A2CA 5JYEA 3TQHA 3ND9A 1QNFA 4KO2S 4ETNA 1O97C 4EW3A 1QHIA 3ZBUA 3LLUA 1FPMA 1A5BB 1X9GA 1V6CA 2VPXA 3CF4G 1ECFA 2ETXA 2KHZA 1Y6GA 5H7PA 4QDOA 1FK8A 2G4VA 1G0NA 1W581 3EODA 2H00A 3FDZA 4MKHA 1J1UA 3ICCA 3T3EA 1JI0A 4OIFA 4N0DA 1IH8A 3IAUA 2D2IA 3ZD9A 2WMNA 1AWCB 5CK4A 1K08A 3I3SR 3AJRA 4FD2A 1GVNB 1N9AA 1KYQA 5F76A 4KVZA 5TF0A 2HPAA 1GHTA 1I3NA 3FFBA 3DSVA 3UXYA 1J5XA 5F7ZA 3TK1A 5KYXB 1RM4A 4RULA 1HX7A 2KWIA 2OAGA 1IONA 2WDPA 3P8ZA 1UDRA 4EHAA 4QXRA 2W6JA 1EGMB 1FA9A 1V37A 3VHLB 3EVAA 3ANSA 4C4XA 1OZAA 4CCSA 1YJ5A 4YXWA 2BMVA 5JBIA 4PLFA 5IYZB 2BN4A 2M6LA 3ESDA 3BRQA 2P2YA 2BGJA 1D7OA 1CERA 1ULSA 4WD3A 1TGYA 1SA5A 4RVUA 1C7QA 1OX4B 3VKGA 4QO7A 1ONPA 4HX2A 1VXRA 4XEIG 3W05A 2IW3A 5C37A 4KIFA 2ZJFA 2QWXA 2FX2A 4BLOA 1JH8A 4I8DA 2BKUA 2KLBA 3L46A 5EJ6A 1Q44A 3AAAC 1MRZA 5CNKA 4H1WA 2VF2A 3DW1X 1QXSA 1KZ9A 3TRFA 1T1GA 4PTZA 3U1VA 3NOCD 3I6MA 1VMIA 1C3EA 3D9JA 3GBPA 5KWJA 1O96B 1G7TA 3MFYA 4JI2B 3TZBA 2Y1KA 1MP0A 5I7FA 4EA8A 2RGYA 2Q4EA 3K53A 3PEYA 2VDLB 3JCZA 3E7PA 4JP8A 5EJ9A 2IEBA 4IGIA 6NULA 3IP6A 3SLRA 2OGSA 1KMNA 3DZFA 1JWBB 3I0MA 4DMGA 2OP1A 3AETA 2OGZA 2JGIA 2BHNA 4JBGA 3ANNA 3CV0A 1TJYA 3ZKJA 3R5KA 5G3YA 1GQOA 1RZRD 1YASA 2QNBA 3QPDA 3QK7A 1Z18A 2GJAA 3OM1A 3S40A 4YQZA 6CHYA 3EAFA 4L4ZA 1O0BA 5DTIA 1OI2A 4NDZA 4NP6A 4MH0R 4L23A 4BKMA 1D3AA 3BT7A 1X2EA 3UICA 4I2VA 3RVJA 2FPUA 1XZGA 1R4NA 3S7BA 1JNXX 1MJ0A 2FX3A 4Y2JA 1FBNA 2F1JA 1R0SA 4NQRA 4EL5A 5FWXA 4XE0A 3KB2A 2JI8A 5BXYA 1YJBA 1H5UA 1Y1TA 2V5UA 1JHOA 1Z7BA 3A70A 2O19A 2V7VA 2BGMA 1Z73A 2JGJA 4ZU6X 2CXHA 3F5DA 4IDFA 1PS0A 3AU4A 2VTEA 2NZWA 4QJ4A 4FU0A 1WZ2A 1RXEA 2XVAA 3B9QA 2PRYA 3DTTA 5LDGA 1NVAA 1ZIPA 4ANFA 5KNDA 2C84A 4O4LF 3Q85A 4MRVA 4MW1A 2ZSUA 5HEKA 4YUWA 1OBVA 2A1TR 1EF1C 3J81A 4ZN6A 1T34A 3TIVA 4Q4DA 3H2GA 5IJ9A 3DEYX 3ZDBA 2EP8A 1SH7A 1Q3KA 5JS6A 3N0TA 5FBHA 3U3WA 3DXKG 5ED4A 2AYXA 5AFSA 1FDIA 3DR5A 4MOWA 1EB9A 4TMXA 1DEXA 2J07A 3CUKA 3JQGA 1JCQA 2WILA 1Z0KA 2D00A 2E5FA 3C7TA 3MWJA 1RJDA 4U7GA 2VYND 3QEBZ 1T13A 4CKWA 4UI9K 3JYNA 1ODJA 1I5RA 2WM9B 3ZZ1A 4OYHA 2QQ5A 1MB3A 4Y9RA 3ESXA 4YPFA 2SCUB 1W44A 4WGGA 2QJTA 4I1UA 4Y7CA 4IXTA 4ZAGA 4I50F 4ASUA 2A9VA 4JJ7A 1M6HA 1I2BA 3LDFA 5KAMA 1DDOA 2DR3A 3O91A 2A88A 2O4CA 2ZR9A 4F8YA 2G08A 3PR1A 3AR6A 1AB5A 2BV3A 1E9VA 3HIZA 1XZLA 1VCIA 3HMKA 5L3SB 3PCXA 3AZOA 2I1KA 1GIAA 3AHIA 5L51A 3KZXA 2FR0A 3BMOA 4RY0A 4EI9A 3CUSA 3SBXA 4RMHA 5EKDA 5FWQA 1ZSNA 4BWYA 1GL9B 4X8OA 2E55A 1RWNA 2AA3A 3DH0A 3V4VB 5FJIA 2CFOA 2XNCA 1QYCA 2YZNA 3WQRA 2YYAA 3IDSA 1DKRA 1XNGA 2V1XA 3QFCA 1R4AA 1H8HA 3HJCA 3H1FA 1HU3A 4JJFA 3QRWA 1NJFA 3H97A 3DJFA 3GT7A 2BZSA 3HDQA 1B1CA 5JAZA 2Q07A 3R5XA 1FF9A 5EHNA 1HEYA 2GVZC 1AN0A 1M73E 2WJWA 4QPDA 1RCTE 2FQYA 3AKCA 3RJZA 4YV0A 4PN7A 4B4KA 4WKBA 2HRQA 2R8RA 2DJ5A 2R5WA 2FETA 1ZINA 2FMFA 3FFTA 5AKZA 4YUYA 4LE0A 2PGAA 3Q1LA 2O5CA 5B64A 1JDJA 2P7HA 4JYBA 4WZBA 4J8FA 1ZA1A 4UWFA 2QRZA 3T1VA 4JWKA 2P9NG 4D46A 1C1HA 1Y1PA 3EDYA 3WKCA 3T4UA 1XDBA 2RGBA 5JPDA 1L7MA 1ENPA 3ZIAA 4U95D 3HKCA 2JFHA 4Q4AA 3BSSA 1UJCA 2G9VA 4ZJPA 1O77A 4B81A 4XARA 3I5UA 2GDJA 4D9MA 4NARA 1UN8A 1OYOA 2W6JD 4I3FA 2O2YA 4Q5IA 4ANXA 4N6GA 4EEZA 2FW7A 2H51A 1Q7TA 2OHOA 2MMGA 2NG1A 1I13A 4X44A 4YXWD 4DNXA 4K9SA 5EIBE 1OTXA 4E5VA 3HCAA 5EC8A 3ENKA 4MMXB 2XECA 3SY8A 5CB4B 3RHFA 4PZYA 3OLCX 2LIVA 3DMYA 2K7FA 4DR2B 4D9EA 5L7WA 5B55A 2IC5A 3EAGA 1RI2A 1SU6A 3I1JA 5AM0A 4DXAA 2GO1A 3C45A 2NUPA 3KSMA 3CCFA 1C5KA 1JSXA 2ZBRA 2PZ8A 5EWJA 2ZYSA 5SY9A 1Y8QA 1I3MA 2X9VA 1B41A 3CJTA 1MV5A 3VUFA 1IM8A 2YQ8A 1K8KG 2GSDA 3HFJA 4KLZA 1WB9A 4QM7A 1E18A 1QRRA 1RXUA 5CB6A 2FH5B 2Q4TA 4OOEA 1SQFA 1XKQA 2Y77A 4IXWA 5J2TF 4KQKA 4FYIA 1PFKA 5E6SA 2J3LA 5AICA 2D3TA 2YWEA 5A7GA 3LG2A 4JK3A 1AKQA 3BL5A 2ACWA 2ZULA 5K05A 4ZI7A 4KMSA 1XDDA 1LNSA 2GI4A 3OT1A 3WWZA 2J0EA 3CIAA 3B6EA 5AUOB 3QVGA 2FY8A 2A8YA 5DTMA 4EJ2A 4PAOA 2XPYA 3HFRA 2FUG1 3DV0A 1JKJA 5FIOA 3LBIA 3GIDA 1CE8A 3JAKB 2O8FA 4W8HA 4AFNA 2BDUA 3RADC 2FN7A 1MORA 3HXDA 4GLOA 2F8TA 4QQNA 2BBWA 4PANA 4EVIA 2AFIA 5BR8B 2V0PA 1WHTA 1CB7A 2A4MA 3HWWA 3ME5A 1E92A 3CW2A 1VIYA 1U6IA 1OXVA 3ZXXA 2KB0A 3LYUA 3ULYA 3B3AA 1UJMA 5T4YA 3S2AA 3WDKA 4HO1X 1YFLA 2OB2A 2W90A 2IUEA 4MVJA 3BUAA 5KVAA 1WTCA 2PDAA 4XUEA 3M4JA 4NCKA 1JKFA 3WP0A 2VXOA 2CLIB 3N07A 3ROKA 3QWAA 5SYMA 3AQ4A 2Q99A 1QHFA 3RC3A 3EG5A 3ILVA 2NYAA 3W78A 2ZJYA 4EFNA 2OM6A 5C81A 5CNIA 1E5TA 4BNTA 1BDIA 1QO0A 1T8WA 4BL5A 2H6HA 4TM7A 1NVBA 4FFNA 1YS2X 4JL0A 2PPVA 1HA3A 1OFVA 1G20E 3T9DA 1EX9A 1FTNA 1JEAA 3HB7A 1X1DA 1RPZA 3OP1A 2ZKIA 2NYVA 1UBFA 1SZDA 4BX0A 2L17A 2OZPA 5GY7A 3CB2A 5D7BA 3GJZA 2WC1A 2MCFA 2P9HA 4Z9YA 2B7LA 2JBAB 4X1KB 3HY6A 1KVSA 1FVOA 4J0IA 1UT5A 2RAUA 3QF4A 4FZRA 3O26A 5M2QA 1RLMA 1AO0A 2WJZB 1B26A 3H4MA 4ASUD 1XL0A 5IT4A 5FZRA 4CLRB 3MZLB 3QWFA 4NZOA 4K9QA 3H05A 1XFAA 4WCVA 2EGHA 4M1WA 4O1MA 4RWZA 5TR9A 2EXXA 2WG0A 1U7XA 4QBTA 5EQDA 1TZCA 2BL4A 3NC4A 4L15A 1I7QB 5FYDA 3F7NA 3NNDA 4JI6B 2J3HA 4AUMA 1Z37A 1Q1ZA 1NP7A 4K5CA 1V9SA 3GHYA 2EIKE 1RLIA 3DYVA 1BD8A 4UHCA 3NBXX 4BQNA 4R1SA 2EDAA 1ACJA 2FRDC 1V55E 1H8HD 3IO3A 1GU1A 1R9NA 3PHHA 1SVLA 1UMDB 1J97A 3GZNB 3ANMA 3EQZA 3MOSA 1E7UA 3M6IA 1KU0A 1DX6A 4BUCA 2X1VA 1FXWA 1O95A 3WZMA 1CU1A 1LVHA 4QDJA 1ZLYA 2EQAA 5GM1A 4K28A 1ZWKA 3ZCXA 4W9RA 4K6CA 3ZIAD 2C83A 1J7JA 2WJGA 2F3SA 3AB7A 1TF7A 1FS6A 2H5LA 4H1HA 3UUFA 3KPVA 3ADPA 1KJZA 4NENB 3S5UA 3L1HA 5LYYA 2PZIA 2QUBA 4GVPA 2ENUA 3JRWA 5DM1A 3GMDA 3UNXA 1YU9A 1S1CA 4WHMA 5I7SA 5ABPA 4WASA 3LGSA 1AG9A 5CM8B 2PSHA 4NQZA 3TWRA 1PWZA 3A4TA 4XH9B 2PBFA 4RSRA 1PJRA 4GVLA 3AS5A 1N0IA 2ZE7A 4IVQA 1ZICA 3UHPA 5IDYA 2VS1A 4ZEOA 4B8WA 1HWYA 3A4NA 5L95A 5TDHA 3P4YA 2ZJ7A 2B37A 3O8QB 4OJTA 4PGAA 3TCNA 5JWRA 3LOUA 4K0KB 2J6CA 2VNAA 2XOXA 3I9OA 3UXEA 4NIKA 1D1QA 4U6SA 5EZSA 4PNEA 2ZYWX 2PVPA 3MSCA 3KZ1E 5FWNA 3BB4A 3UPDA 3I9MA 4FP7A 4XVQA 2YHCA 2AK3A 1TU0A 1ZNZA 5I4CA 1GFIA 4MKTA 5ALZA 4RIGA 4Z7OB 4D26A 4J7UA 2Z1NA 3T7JA 2AOTA 1T5BA 4CF5A 4Q3BA 4QJBA 2Q2QA 1JCSA 3UHOA 1VE3A 2DQSA 4FBGA 1R0XA 3WL4A 3VH3A 3EK2A 3GEDA 1X7YB 2QORA 4RAOA 3AHGA 3RWBA 2WU4A 1P74A 2IA5A 1ZK1A 3BYZA 1EP1B 2XB4A 2GBLA 5EN5D 2WFAA 2W83A 5CLJA 4GM1A 1NATA 1RWBA 3MA0A 1Q7EA 2PLFA 4D6YA 2H31A 3PHGA 3KXKA 1CJBA 5BSRA 4X92A 1J39A 1OZGA 4RVCA 3PENA 4D9HA 3BSYA 3OU6A 2VXYA 3OQ1A 3B6KA 2JFOA 3MQ4A 3FOZA 4A2PA 1NKSA 3ZEAA 3D3WA 5J3JA 5JJTA 2ODWA 3EDRA 4CMAA 2WKQA 1U4SA 1HFAA 4YONB 2QGZA 2QP9X 2IL1A 1T9DA 3VI3B 4MVJD 3PEFA 3O4ZA 3VZBA 3OCXA 2FO7A 4GZCA 3W5UA 3LSYA 4LHXA 1FRVA 4G0PA 4QE3A 1CLUA 3SOPA 2VBGA 3GUUA 5AVOA 5AW6A 1HDGO 3T9BA 2VHVA 1GAQA 3L7KA 4ITVA 4DCJA 2R8EA 3OEHA 3H9UA 4M98A 1QO0D 1ESMA 3X2FA 3Q5EA 3QHPA 3IP8A 3RKSA 4NCJA 3DTVB 3TRKA 1KTVA 3SR0A 1H1LA 4FIZA 4UCWA 5JZSA 1P8AA 4DIUA 3EDCA 3BFPA 1SUSA 3LQ2A 1U0OC 1EUCA 4H3HB 3K6SA 3HB1A 4GT1A 3C3QA 4P4SA 5HRUA 3OOWA 5AK6A 5FUXA 1JB1A 1PR9A 4EATA 4J1SA 1U3CA 2VBCA 1E3QA 4JGGA 4EDFA 5E0OA 1K7XB 1CWUA 4JI7B 1NONA 3LPMA 2DY0A 1Z12A 1QQTA 3CJRA 1MEJA 3KOOA 4H0FA 3KR1A 4Y0AA 4CEHB 2X6JA 4A8JC 2WQ7A 4J91A 4FA6A 2YXBA 1YL5A 1XXHA 1LX6A 3AW9A 4HGNA 1VJGA 4IQ4A 3HXLA 4M6WA 3CK7A 2FJPA 4JPSA 3EHQA 4EGSA 4KREA 4G24A 3FJYA 1P0CA 2VKTA 2P41A 1JVBA 4BU0A 5ULLA 1M6VB 2HW8A 4CMIB 5ICEA 2C7VA 4QEDA 4M49A 1J90A 4KK3A 4ZI7F 2WQ6A 4CEMA 3MSXA 4C2AA 1RACA 2H92A 2VRNA 3NATA 2XUQA 3GFFA 4JHRA 1KEPA 4G5GA 3O8BA 4I08A 5ISMA 4H77A 1L4NA 3GPDG 5JZBA 3B6IA 4IRMA 1BDHA 3UCXA 5FA5A 3MJTA 3PGXA 4GVXA 5CDGA 3C1TA 4PQEA 1NZJA 2BFNA 3KLPX 2IQ5A 2OWDA 3F47A 4CM6A 3S7JA 1IYZA 3OAAA 1N0WA 4W5JA 5EP2A 4QBGB 3QKRB 4MHTA 4E6PA 4LBWA 1BCRA 3GUZA 1E98A 3NM5A 1JVNA 5BWBA 2QVZX 5EXSA 1TC2A 2W11A 1KZ7B 4KVOA 1J2TA 4RIHA 3NOOA 1QH9A 3HJGA 1N9GB 3TH5A 3V42A 3RREA 3ZV4A 5BP7A 1UXIA 4AJPA 1O95D 2WYIA 2QMYA 3IJ5A 2CCKA 3OQNA 4NJEA 4NH0A 3E9RA 4MVJF 3VMFA 1P5ZB 2X8JB 5H3HA 1NSTA 1PGOA 3I58A 3NPMA 4CLEA 4QOIA 3B51X 4MQFB 2QC9A 3VLDA 1WMAA 3VAYA 3VNSA 1SUDA 4UQZA 2C4WA 5DNVA 4RD1A 2XNHA 2HA7A 1ZVKA 5JSKA 1XLVA 3ZYZA 1DLIA 3FDIA 2K7ZA 2QF7A 1ORIA 1OAOC 4Q19A 1SCAA 4R1TA 4XFKA 4Y30A 5CVVA 3S99A 3ZGYA 3CSFA 4OI4A 2L0IA 3O90A 3SCZA 1LY1A 1AXRA 2GCOB 3CBGA 5C7YA 1PDVA 4HGOA 3N58A 1E96B 1A9QA 3AL2A 3DXXA 1L0BA 3VOTA 4DSAA 3GZ1A 1OC2A 1ZJJA 4MUYA 2CXOA 3VYSB 3HBFA 1VKJA 1I3CA 3IR5A 4BZZA 1XP5A 2VG8A 4BGUA 4ME6A 5HRCA 1ZM3A 4PNHA 3KOMA 3RAJA 4TWZA 1OHHA 3HUDA 2P3SA 3THYA 1C9YA 1CUBA 3R6LA 1TOAA 2J32A 2ZBVA 1IUOA 3PXEA 3CVJA 2P8JA 2ZAYA 1SG6A 3IIEA 4O6VA 1HF3A 4F8EA 2OV1A 5I9TA 3ESAA 3UKRG 4XXHA 5IULC 1VG8A 1JDBC 4L8YA 3DLTA 6ABPA 3MJCA 2K4MA 1RJGA 3O75A 4WNDA 4AZWA 3LMKA 4DV2B 1JQ3A 1GGKA 1LSSA 3NZEA 5LOVF 4WTOA 1DNPA 5A3QA 4KQEA 1NSFA 5E1DA 1RWOA 4JL8A 4MDYA 4H17A 4YJ2B 2BC9A 1UEIA 3IIJA 3ADBA 4WDQA 3OX4A 3WHIA 2A9QA 1XNJA 3W06A 1AUOA 4QFBA 2P1RA 1UK9A 4S1PA 4BVKA 2I4MA 1JG7A 3R7LA 4HNGA 3N8IA 3NFRA 5A4DA 2B78A 5A4FS 4EHNA 2QJWA 1IJKA 2D0IA 2QSUA 5EHXA 1VLHA 4FWTA 1NUSA 2CJXA 3UTCA 3ECAA 4DDMA 3NDJA 4JP2A 1BQ3A 4ENVA 5LMCA 3C8DA 4RJ2A 3KWFA 4HADA 2EZTA 1M2GA 5ALLA 4UTXA 3E22A 4CL3A 3ASVA 1KY3A 2P6NA 4B73A 2IS2A 5G0WA 4B0ZA 1U7HA 3REQA 1J21A 1T0HB 2I4OA 4HN9A 1YRQA 5AVZA 1Y9EA 1QZ2A 2W6NA 2J9RA 5JDCA 1KBZA 4P4NA 3ZW9A 4BQIA 1XEXA 4B5KA 1Q2UA 2BFOA 1PVOA 2QAGC 4NFYA 3E3NA 3NS7A 2IBTA 4G1MB 2QOEA 1EWQA 3OEHD 4DTIA 5FTWA 4LUCA 3ZW7A 4KW7A 1KI4A 2OOKA 3ZQ4A 3N75A 2P67A 2J3JA 1GNSA 4RPGA 3E37A 4RZ3A 1KYTA 1V5GA 2R96A 4G0YA 1KO8A 4Q7KA 1SULA 4C48B 2QTBA 3RH0A 1M5RA 3EZFA 4XB1A 1GGJA 4AKEA 2VNSA 4UMEA 1LD7A 2UZ0A 2P77A 5CDFA 1ZS9A 5ESRA 4UBKA 2BZGA 4D79A 2J45A 2NT3A 3NHYA 3SXUA 4YJ3A 1DDIA 2OXEA 3ML9A 1NUPA 2JCXA 1K7SN 3R1IA 3PTAA 2C98A 4FYPA 3TAUA 2VH1A 1VGRA 3D6HA 1KNXA 1SHZA 1KHTA 1EUZA 2FSGA 2Q4RA 4YY3B 2D2FA 3E33A 4KIWA 5THQA 2DWZA 1JIVA 3AUSA 4AI6A 4BNDB 1CUWA 4CFSA 1BKDR 2C07A 4J8DA 2GFHA 1IB0A 4WA8A 3DVRX 2IH5A 3JQ6A 1RYBA 4PO1A 3GK3A 1P1HA 3CLHA 2QQFA 1YBFA 4L5IA 1BH6A 1XHLA 2W6PA 2EEPA 1Z68A 3JQ8B 1U8YA 4P4LA 4GX1A 2POCA 2WBLC 2XEHA 4UCFA 2HQRA 1P29A 4G41A 3LHKA 3C7AA 2MIIA 5K6AA 1IQRA 4DR6B 2NP6A 2UYCA 2C1XA 1N52A 4UUPA 1J9EA 1B00A 3HO8A 4OHXA 2IXEA 3Q7FA 3IUJA 3KXDA 3OAAD 3VLEA 2EF1A 2F62A 2XKAA 2F90A 5FZQA 1HR0B 1L5MA 1EP3B 4RC9A 3OZFA 1J9GA 2QL5A 3D8TA 4BWGA 4LHVA 4FJ2A 3WC4A 1R8JA 5B6JA 3DC7A 3TBFA 5HPYB 1HRKA 4OD0A 4HVBA 3Q8WA 2QX6A 4O4JA 3K4QA 3SXJA 2JFQA 2IUYA 2IFTA 4J0KA 1BAPA 3K4PA 1V7QA 1B73A 4WZZA 3MJ4A 1EEXB 1WHSB 2IRWA 3QFTA 1YRLA 3VZPA 1MHQA 4YCAA 3QVUA 4INPA 3C6ZA 3AEZA 5D2CA 1YZ3A 1EVJA 3U3XA 4R2MA 5AQBA 2WFLB 4FWBA 3A3PA 1QIFA 1NBHA 3FR8A 1I2ZA 2HC9A 4D4IA 3LC0A 2QV0A 5JSQA 2B30A 3TWXA 1GZ6A 3E9EA 4O63O 2ZU6B 4QLAA 4WE3A 3TLAA 2G5TA 2YQ5A 4W6ZA 1SMKA 2CFSA 1EUYA 1YQTA 4W5OA 3IUSA 5IFLA 4ILHB 3SHVA 4BFZA 5NULA 3CGWA 4D0SA 3ND8A 2EERA 5TQ0B 6ADHA 1CF2O 5B1SA 1TLLA 2I87A 2QLMA 3BIWA 5HQ3A 4B6FA 1HT2E 4KIJA 1R9MA 2H17A 5IHPA 1LUAA 5JNSA 5H3CA 3DA8A 4YECA 6YASA 4GBJA 3T3NA 3ZGZA 1GAWA 1UWVA 2P6MA 3D5EA 4BMPB 1RBZA 1QHHB 4DE5A 1YDEA 4DM3A 3RSCA 4F45A 1WPRA 1CR4A 3QTLA 1USGA 3LZDA 4AZTA 4ZT3A 1MFZA 1KAHA 2HRCA 4MSUA 3GRRA 4GUAA 4OBBA 2LNDA 4AJ9A 1DRJA 4EA6A 4WFKA 4X0EA 3JQ7B 3IA2A 4FWIB 3UYLA 1ODKA 1ATIA 4ESVA 1D2GA 3SFYA 3PQ4A 2CNBA 3MINA 1TIBA 1TKBA 3TNLA 3A9VA 1QX4A 3DE2X 3P9ZA 2WMOB 5T8IA 1ZUIA 2KX7A 4HD8A 4TYPA 4L28A 2OD2A 4NU5A 3D9HA 3GBVA 3LIPA 4G0MA 1BEUB 3T0GA 3N3AC 3NP9A 4JC8A 3EISA 3CXRA 4LSZA 1DC4A 2VXCA 4B8ZA 4KQMA 3GOQA 4AZSA 4HL6A 1YOBA 2V3CC 4RA9A 3DF7A 3P52A 4WFQA 3PGA1 1GA4A 3SO8A 2NVBA 4APOA 4OK6A 4NYIR 3E15A 2NU8B 3WB0A 1E3WA 2EKQA 1N5RA 2WVHA 3DULA 1U3GA 3F6SA 1OIXA 1YBVA 3CBQA 4M0CA 4EZBA 3TI7A 3GUVA 3WIDA 1VC2A 3R3WA 2YIVX 2C88A 2I1JA 3HGMA 3BDAA 4N40A 1SA4A 4HORA 4WUTA 4UOQA 1RPTA 4DR5B 1JWLA 2P9CA 5CURA 1MN6A 2A9RA 2QZAA 3CNQS 1ZRSA 2Y1DA 1VJ1A 3W2TA 1PSWA 3F2IA 3HU1A 1E3TA 3D9NA 4YRAA 5BQPA 4QQRA 1GUYA 3QJ5A 2EKBA 4YB8A 3OIYA 4AQDA 2XPZA 1V8FA 4S1TA 3SK0A 4Q37A 1YZVA 5EHQA 3DHNA 3ETHA 4UXIA 3IHTA 2RH4A 5DLQC 1DXQA 4WBXC 1D0SA 2PUFA 4KLNA 1Y1QA 1JQDA 1S2LA 4WVFA 2HTFA 4L02A 4GYJA 4R2WA 3GLGE 4FFWA 2G1AA 3ZWWA 5DHFA 1QVWA 1E4EA 1J0AA 3SICE 2JRLA 4RY8A 2QMOA 2VJBA 1MJGA 2XBMA 1L7OA 4OMCA 2QLJA 1N4DA 2GPTA 2FFRA 2FW0A 1IK4A 1JZSA 3G8BA 2AN4A 2ZJ0A 2A0WA 3HCRA 4WIAA 4DWJA 3SYKA 3KZMA 4EW6A 4C9BB 3TW6A 4V2UA 3ESYA 4HNAA 4HUQB 3K9HA 2C42A 1F5SA 5CM9C 2WA2A 1PNRA 4N5CA 1GKUB 3HO6A 4DILA 3U6KA 4XVRA 5ERXA 1UFKA 1NR1A 2EIXA 3GPBA 3SJ7A 2BWJA 1F4VA 2GFIA 5BOSB 4YDRA 5ENZA 1JHQA 4LZAA 1KP2A 4G8KA 4MKZA 3PK0A 3KWMA 2WF6A 1P17A 3U26A 4QRHA 4B46A 1TW2A 1C9DB 5AJDA 4WWPA 4CKXA 1HSZA 5CH5A 5LBIA 1OKKA 4FYVA 3HB5X 5JCOA 5KTRA 5FQNA 4HRMB 4M7CA 2GOYA 3BQNB 4W1PA 5AKYA 1APBA 4WXHA 3BF7A 1KS9A 4OQLA 2JLYA 3U7HB 3C98A 3S7DA 4G5QA 1J42A 3TE7A 2AVPA 1Z7GA 3LY5A 4BJHB 4KZ0A 3A04A 5KYWB 1T1EA 3KKMA 5DHPA 1YJ8A 3K8QA 1IQPA 4W8GA 4J0HA 3PIDA 3BJZA 3OC6A 4BNWA 5KJKA 2H85A 4H31A 1CT9A 2WINI 4R05A 2XCLA 3PA6A 3KU4A 4UMFA 1I51A 4E5DA 1D1SA 3OHSX 4MK4A 5JSHA 1M54A 1ZAYA 1SU8A 4RPIA 4IQ0A 5K99A 1XZMA 4MMZB 2XQIA 2GM4A 2E1RA 3V97A 5DW0A 2XUDA 4M37A 3N0RA 2HK6A 3UGKA 4YJ3F 3ZNNA 1NVGA 2FE4A 2ZRDA 2HK9A 3ULEG 1YIDA 3UUGA 4AS1A 5GZ6A 2ZANA 1ATZA 5DM0A 3EQ9A 4YCBA 4G2VA 1GQRA 3F8TA 4O29A 3IESA 1J09A 5BWNA 4HT3B 1L5LA 2XLBA 3TW8A 4L4SA 2EZ8A 4Q24A 4ZCIA 4EP1A 2Q5OA 3LUFA 1FYEA 5LOZA 5HJEA 5C46F 3M1AA 1TVKA 3WNZA 3K5HA 1JE0A 1B0PA 5ALGA 3OXLA 3QA3E 4HLEA 1GZSA 4GH5A 4OFBA 1TK2A 4LVOA 4ZO4A 1OFUX 3JQFC 4S0XA 2K2WA 3RE1A 3OZIA 3ZBTA 1SQ5A 2E4VA 3EQ6A 3AVYA 4P98A 5H4HA 3D9OA 4ZRMA 4MWCA 3W5SA 4BVEA 3ZBPA 1GSHA 1XQ6A 5FTPA 4XUCA 3QKIA 4OKSA 3OJLA 2C78A 4QGGA 4LSGA 2GF0A 1KZ6A 4BLTA 2BIFA 3QLTA 2JCVA 4C21A 4B79A 2J46A 1ZU5A 4OQ4A 1N0HA 4OK5A 5C32A 2Q5CA 2IYLD 3KEMA 1WM5A 4F84A 1F60A 4IIEA 4O4JF 1KO4A 1Y9DA 5HQTA 1KWKA 5D86A 4RA6B 2HWWA 2VPIA 2IOFK 4BVJA 3MZ0A 2OY0A 1B43A 1H2FA 2OZLB 3LT0A 2HSWA 1MLDA 1XAJA 4XSGA 1N4RA 5AVSA 1UJBA 4G1EB 3FPJA 4JJIA 5AM2A 3BMXA 4LF6B 3BX1A 4CEJA 4MUGA 1QU3A 4C89A 4OQDA 3TF5A 5LA6F 4FHEA 4QBHA 4AKHA 1NPYA 4KNYA 2F9LA 3KYIB 2I0FA 1FNNA 3VR6A 3PLAE 3MBOA 2F1HA 3PKIA 1DKMA 3IO5A 2OEWA 1NW5A 2QN2A 1R6DA 2QY6A 3CIFA 3CK8A 1RXYA 4X45A 4B6PA 1PBTA 5I9MA 1L8LA 2BFCA 1TE2A 4TSRA 4HUJA 1S2IA 3P2MA 1GGMA 1MOPA 1PGJA 2ZVDA 2ZCJA 3ICQB 4C07A 4P9NA 3MEQA 5AP9A 3GJTA 1U0RA 1ZXBA 3F6PA 2D1TA 3DEKA 3BKWA 4YJFB 2XNKA 1YWGO 4II2A 3N5KA 1H2HA 4GUDA 5G2NA 1CP3A 4H15A 2ZP1A 4DUYB 2HSDA 2QTWB 1ULUA 4JLAA 3HK2A 2OBLA 4JNCA 5K0ZA 1W6RA 3TQRA 1QKIA 4N8DA 4PGHA 1ZXXA 4U4AA 5D6OA 4LXGA 1GLVA 3EXFB 1GUDA 1UBEA 2VJDA 2VWHA 1K8QA 1QRTA 2GKSA 3RNOA 5EIHA 2X2FA 3RU0A 5T6MA 2UVQA 3W2GA 1XQYA 3RK0A 1ZITA 4KPUA 1BGWA 1E7WA 2X1HA 5DGXA 4HNAD 1NJSA 3MWLA 2OT3B 5TSDA 4M7RA 2ZIXA 3HA2A 1LQUA 1UKZA 3H65A 3FUIA 4PAMA 3BM5A 2OBNA 4ZO7A 1KQ3A 3TQFA 2I6QA 4Q01A 2AX4A 1S7CA 1ID1A 2XZLA 1JBQA 5FZSA 5F4ZA 3DVLA 2QTZA 1NVXQ 2O1XA 4UPEA 1W85B 4M9RA 4KRGA 5JHHB 4UQOA 1TLFA 3PNLB 2J4BA 3CHMA 4TMTA 2PA3A 4XWYA 2WJ3A 3MAJA 3QNUA 3CURA 1OKKD 5BXUA 3V32A 1DZIA 3G82C 3MRSA 5J4YA 1VECA 2D1QA 2AW6A 3ZVNA 1VIMA 4PZPA 3GN1A 3RVRA 4AD8A 2H4FA 2AXEA 1GU0A 4D3YA 3RU2A 1VKNA 4L78A 2XTNA 2VGYA 2BY4A 4UBOA 2D13A 2XXBA 2BFFA 1M83A 3EYWA 5BSHA 3RARA 2OKGA 5I7UA 2HSGA 3SBOA 3GA5A 1W34A 1A9OA 4YAWA 3P0HA 5DGCA 1WMEA 1TFUA 2GK3A 3NTUA 2Q50A 4PVDA 1NI4B 2LD4A 1FTWA 1GYRA 3G2JA 3ANTA 3ED5A 1P60A 2FMXA 3JQAD 4P92A 2BMWA 2JFVA 3PDIB 1DCMA 2HA0A 2IYNA 3ESKA 1S0UA 1LLQA 3ITKA 4ENQA 3TGOA 4DHWA 4IL5A 3DHEA 1IOLA 3RVSA 4I5EA 3AUFA 1U6JA 3KVOA 3PDWA 1A4RA 1LEHA 1L3BA 3HDXA 1Y0BA 4ZJUA 5FUYA 2LCFA 4B0OA 3PZ4A 3MCTA 2ZUVA 5ER9A 4EUKA 1U0SY 1SG0A 2AWIA 5HFNA 3QFRA 1UODA 1FP4A 1DMSA 3F2VA 4RJKA 5L4SA 3WBKA 3AF2A 3B8EA 3NO4A 1BJKA 4J7CA 3EU9A 3V1YA 1UOPA 4OUKX 1NDUA 5E76A 4NU6A 3PS6A 5DNEA 4GOXA 3EXHB 2YFHA 4LOHA 1ZEMA 2VPYA 2BR3A 2W2KB 1E20A 4TWIA 3T54A 1EDZA 2IDKA 3NEAA 4AQYB 5CVCA 3EVFA 4U7JA 3KD3A 4H0CA 5H7XA 1EKXA 3N2EA 2DWQA 3VLFA 3PHIA 4IIXA 3H5IA 5ITWA 1ECCA 1E2IA 1NW6A 3KPYA 3OIGA 1CK4A 4GI5A 4KE8A 2EJTA 5ADWA 4LVUA 1T5IA 721PA 1UJKA 2YUTA 1W9HA 5TX7A 3Q72A 2P35A 1MZCA 1US8B 3KEFA 3ZHBA 3KG2A 2J3KA 3D6JA 1WA5A 3H04A 4Y18A 4N2SA 4K6FA 1F1JA 4D3FA 4U2FA 4OJKA 4PRZA 1EB8A 1OPXA 3ZZ0A 4ABNA 3L6CA 4IDQA 3CR3C 1U8XX 1XU9A 1N9KA 5B58T 4Y2RA 5CVDA 1TTQB 5EEHA 4RS3A 3U1BA 4ZVNA 1RAEA 3MTDA 3QU2A 2DBAA 5JNLA 1VPTA 4M3NA 1Z26A 3NFYA 2ZRNA 1XQ9A 1OA0A 2FEKA 3I9KA 4HAXA 1Z6XA 3ZWVA 1KPGA 3WYAA 4TXRA 3PZ1A 4YDWA 3KJFA 2PT5A 4WW0A 4EB0A 3CUTA 4CQJA 1E77A 2VT7A 2BJVA 3IDZA 2JFBA 2Y0BA 5DHAA 5HKOA 2XA9A 4EUHA 5FPKA 3EXAA 3K35A 3DEPA 3NGMA 4KBYA 3MTEA 3SNHA 1SUFA 1FP6A 3IAEA 2B8EA 1U81A 1N57A 1TJ5A 2LE0A 1WCIA 3CRNA 5IABA 5D1NA 3HUFA 3K1ZA 4EUFA 2L42A 1K9VF 4B4VA 1MQAA 5ENRD 2H8KA 5HS6A 3WZ2A 3ASGA 3PVZA 1VIDA 4A92A 3VR6D 1M9NA 3LGAA 2J4DA 2AMLA 3I92A 2VCHA 2HPHA 3STWA 5I48A 3W9SA 2FKAA 1E1KA 3ZEIA 4MB2A 4OVUA 2X76A 4ZJYA 3BIXA 1U80A 1VMDA 1X8LA 4TS3A 5ANLA 3G7SA 3MRTA 2AQKA 3NIDB 4LJ4A 2XQGA 4MV0A 1CLEA 1H3NA 1JMVA 16PKA 1J9ZA 4M88A 3FDFA 3GCZA 3X1XA 1WOYA 1XN1A 3SBSA 4YV2A 1NA0A 4U7TB 4M9ZA 4NXMB 3AG3E 2GSWA 2EKPA 4KWTA 2M63A 4UBLA 4UU8A 2QXUA 4HMPA 4YPVA 4GPAA 3GGOA 3L3BA 2NU6B 2YWJA 1O8CA 2I54A 1OI3A 4UU1A 3U3DA 5K0TA 5T3UA 3QXSA 4PM4A 3EA0A 3HNOA 3U9TA 3MOIA 2OG1A 3BK7A 2PPLA 4ETWA 5CCMA 4I4TA 2QMEA 4DZRA 5JE8A 1LQTA 1M1YA 5KJLA 2RARA 2FEAA 2UUCB 4HFNA 4S1NA 4L0DA 1X1RA 3I6ZA 3OA2A 1P61B 4IRXA 4WNGA 1PNQA 3ROGA 3BJEA 3HU5A 1H1DA 4MITA 1V3UA 4ZCPA 5L3VA 3MGAA 3QPBA 3UJNA 3D9PA 2IKSA 4BGEA 3QEMA 4DV6B 1L5JA 2Y1XA 2ROQA 1NVVQ 5LXTB 3BCSA 4PQFA 2H54A 3BH0A 4ZZIA 1SR8A 2ZTSA 1U2ZA 3NMUF 2YC2C 4YRZA 1BMDA 2KM1A 3MRVA 1DVPA 2AZDA 1UINA 1NC1A 2YRWA 3WA6A 2A9JA 4DS3A 1P9OA 2E4AA 3IDQA 2V4ZA 4CPDA 3HNRA 4UJ5A 3E0XA 3R3HA 5KNDD 4UNPA 2IHKA 2ZXWE 3KEZA 4CMEC 3CH4B 2B0CA 2IF0A 4IGFA 4E5NA 1LRKA 2IOSA 5K4GA 5KYNA 3NJRA 2WPDA 2I2BA 3DAYA 4HNSA 1PR0A 5ALOA 3WB2A 1PQYA 2ONKA 4YNDA 5ES3A 3NIGB 3N2GB 4U2DA 5C52B 2PZEA 4RD2A 2CVHA 3PBKA 1XC7A 4Q4JB 4RHYA 4OP2A 1J00A 1E8MA 3GGJA 1G2QA 3UMMA 1K3TA 4K5AB 1DBRA 1SVNA 2YKGA 3MELA 2JCGA 2J0UB 3UATA 5CDTA 3AJIA 1VYHA 4FMCF 5EXPA 3VI4B 1Y6ZA 3QKWA 1TN7A 1R6XA 1V8OA 1PAQA 3AVPA 4BYGA 4BUZA 2J9GA 4ZIRA 5BVHB 2PUWA 5EIOA 1DB3A 1MYOA 1UK7A 2H16A 3AI2A 2GCNA 1VJDA 3A58B 2AKEA 4RVHA 3HCOA 2G25A 1TCVA 4FYYA 4XPIA 3HN6A 3E84A 1E8DA 1E5VA 3JV7A 2MTBA 5FUQA 2ONZA 3ZD6A 1SVSA 3RVNA 1K1EA 3FIJA 1QYDA 5U4QA 1V6SA 3RK1A 2GYVA 3COVA 4Z6KA 2XXAB 1GGFA 4JLUA 5JFTA 1MOQA 3VA7A 2J7KA 2C4NA 3H5WA 5CEDB 4P5PA 2CF5A 1BHQ1 1RRKA 5E9AA 4P1ZA 3V4RA 2PWAA 2R8BA 2FPKA 1Q1AA 3BIOA 3KLNA 5AW5A 2DHEA 2XZDG 2YWXA 5LOVA 1GAEO 3UT5B 5E0KB 1DQZA 3VO8A 2IZOA 3L41A 1FMCA 4FSHA 4F9EA 2QTMA 3WAKA 4TVSA 1XJCA 1SBZA 1WY7A 4Y2YA 2G40A 3WY9A 3UFBA 1KYYA 2AQ8A 3KSAC 2VT6A 3ZU6A 2IXGA 4OHBA 2HRDA 1QV6A 3DEAA 5J5CA 4E4YA 5JZMA 1VHJA 1X77A 1BVHA 4L8FA 4L07A 2FPIA 2FEMA 2JFNA 1FBTA 3BWMA 4WADA 2JGMA 4DLTA 3AU8A 2QPOA 2YVAA 1ZGAA 2GEJA 4R8RA 4CLOB 1RYMA 1VHDA 3UMJA 4ZQIA 1UBHS 1KMHA 4AO8A 2B0OE 3INYA 1HSOA 2GZMA 4LQLA 1XEFA 2Y76A 2AL7A 4RQUA 4PZ9A 1W36C 2PQ0A 4OOFA 4QU0A 4MRNA 3I32A 5F9FA 4TYNA 3GEIA 4NOKA 4Q66C 2I7TA 2GRRB 1ISMA 3HU2A 2COKA 2VQEB 3DUFB 1A4UA 4BN4A 3WKEA 4M1ZA 4AM8A 3DEJA 4M0DA 1C14A 1MXHA 3GT3A 5IDWA 1NGSA 2D0DA 1T3TA 4DB4A 2JIDA 1Y6QA 3LWBA 3VU9A 1CBUA 3I62A 2FBNA 4HDAA 5ADHA 3ZDCA 1X81A 1TUBA 4FGKA 4NNPA 2AW3A 4UM9D 4RTOA 2OXFA 2XDAA 5DT9A 1S2GA 3ZZTA 1S3FA 3MTGA 1PS8A 5E6RB 2Q2OA 4BTBA 1GQFA 4M1SA 1A9XB 4X20B 2FPPB 2YWBA 2XADA 3V6MA 1DAHA 2WIDA 2GPSA 1HKHA 4DDVA 3L82A 4DIOA 3CRW1 2QX4A 3AL3A 1QF9A 4EENA 2PWPA 2QG4A 3HI4A 1W25A 4MUAA 2ZUTA 3AB8A 4L76A 4IJUA 2BUAA 4MZDA 5LVAA 3VAZA 2NU7B 3HM9A 1GQYA 3UIOC 1QQEA 4Q12A 1TECE 2V5FA 3HDJA 3D7RA 4EPVA 2X8AA 4ZVTA 2DT8A 1NMXA 5A3SA 2X5XA 2Z0MA 4EPRA 2BJWA 5IM4A 5DSXA 3W7VA 1AUQA 3TTTA 1XRLA 1FFYA 4MDFA 3PNYA 4YO8A 1W1WA 3RK6A 2XMGA 2LUOA 1CF4A 2Z2YA 3D43A 3GUYA 2I6UA 4I6JA 4W1SA 3K1AB 5EQFA 4KO3S 2FKNA 2FDRA 3L49A 1F9EA 5K8IA 3IILA 5F51A 5BXQC 3AC0A 3WIBA 3MIZA 2XCUA 4JHJA 2J9YB 3O4HA 3C97A 5J63A 1T3GA 1DRUA 2LPMA 4PLTA 1EAMA 1RRGA 4M9CA 5IZ4A 3HRHA 3UV3A 1TYEB 1KK1A 2PD4A 3ENNA 1XLTC 1K63A 1FX0A 3OESA 1S7GA 3TD9A 1NW3A 2FN3A 4AP6A 1U1DA 3JAWA 2Y92A 5CXQA 2AW5A 1ZM2A 2P2SA 3DBLB 3VRHA 2VO1A 4KAAA 1RC0A 1T5TA 4FR5A 2GMWA 4WEOA 3T3HA 4F2DA 4TM8A 1NYTA 1YVUA 1I4EB 2RGCA 1PHPA 3C3YA 1LPSA 1U5BB 3AUTA 4IULA 2R7MA 1E61A 2G9QA 4Q7EA 4PZAA 5E8JA 4IXMA 1P80A 1YOVB 1XR3A 2BKXA 2XQKA 4HS2A 3A6LA 4D4HA 4NYMR 4OGGA 2X0NA 3F96A 3P0JA 1AGPA 3Q4GA 5CTAA 5ENPD 1NLMA 3A1EA 2B7BA 4AB1A 2FLVA 5J2UA 1A4XA 5HIJA 1T9BA 2WPDD 2PS3A 1HKUA 4TKUA 3WJ1A 3OZDA 3PGLA 5BNZA 3P9QA 3W3ZB 5K51A 1USWA 4G3XA 1V11A 1PI3A 2C7BA 1P9LA 3G9TA 1JJFA 1GDDA 1WW2A 1CUZA 5MGBA 4RKYA 2WWRA 1Y89A 1SFRA 1LA2A 4EFMA 5BT1A 1FUEA 3VHQA 5LR6A 1DAKA 3DE4X 3FF4A 5HRAA 2IP1A 2WU3A 4RIEA 421PA 3PXCX 3VR5A 1KMMA 3VPHA 4N8EA 1M2VA 4E7OA 2QA5A 4YUXA 1JX6A 4C2BA 2H63A 1DQRA 1EFPB 2CHUA 4KX3A 2JIBA 4L9PA 3PC6A 1KMIY 2IOHA 4CU2A 4NYJQ 1LPOA 3A14A 3AUAA 4DDHA 2OUKA 3K92A 4URYR 4TMWA 3TLJA 3S1AB 1R0LA 4P5EA 3W8RA 3FM9A 4QDXA 1V43A 4LDAA 1E0JA 1A8QA 2B9EA 2Y1WA 3U40A 3ZQ6A 1GGNA 5C18A 3ZWDA 4QDKA 3T9FA 5FNVA 5BSKA 5HBRA 3H6HA 4G0QA 3DMNA 4Q1BA 4TXQA 5E1OA 3VV3A 2CNDA 4I4NA 5J90A 3AFIA 3M4YA 1CJUC 1MO6A 3KZKA 4I4TF 3DPSA 3H1AA 2GWRA 1PL6A 5KJFA 2A0FA 4DUGA 4HMOA 2ASVA 3LPDA 5C5EA 3KFVA 1Q77A 3KEQA 4XGNA 1LF8A 3DPIA 3ETNA 4LMBA 2QLTA 5TPWB 1SZ9A 1VYVA 3SS8A 5K1ZA 5FLKA 2VHCA 2A1IA 5ENVA 3QQPA 3IPAA 1U0GA 3SE7A 4G4JA 3GT0A 2FRDA 1QMPA 2SHKA 4ES6A 3X1KA 4EBBA 1JB9A 3HHPA 4H59A 4KWIA 3C43A 3LQFA 4A8TA 5AHXA 1O87A 3A37A 2HU8A 2ZCUA 5K8CA 2YWGA 4IO0A 1DBQA 4J4TA 3LHDA 4UZEA 1JIXA 5FWYB 1EFVB 1XVLA 1XKXA 5B12A 1Q0ZA 1WF6A 3MLBA 1SUEA 5E9JA 1NXSA 3WHKA 5KVCA 1S3IA 2Q45A 3IEIA 4R2IA 1UXHA 3D4LA 2BEVA 2O1SA 4CL0A 5FHQA 3QW4B 1GDTA 4WY2A 1P31A 2BFEB 5AOVA 5LYJB 1IXZA 5C5CA 1MO2A 4Z51A 4GA2A 3BSFA 1A77A 4IGKA 3IP1A 2O7NA 2FWNA 4I9NA 1D2HA 3WRVA 3CUUA 5FWDA 2QLLA 2PUAA 1G8FA 3SQOA 3UGQA 1U28C 4KO8A 2PZAA 2GEFA 3ECSA 4YP1A 4QULA 1FUUA 4CL8A 3QIAA 4J0DA 3TMKA 3H8VA 4ZQHA 1CHNA 4U6QA 2H9YA 1ETHA 3UXGA 1GTVA 1TNUA 1SVWA 5CT5A 1FJHA 4P80A 3L9WA 4A6XA 1YR3A 1E7QA 1VLZA 1VTKA 1CJCA 1FQWA 2JAQA 3NHWA 4ZO8A 2OYSA 4YROA 4ARAA 3TJPA 4D92A 4OM8A 3GDFA 4L0MA 3TZCA 3Q9UA 4WFJA 4JC4A 1ZKDA 2G6BA 4Q34A 4XJTA 4F6RB 2H1FA 4I2NA 3N7UA 2ZXUA 4PLVA 1NV8A 3OLYA 3IXMA 5REQB 1H4VB 2E21A 3NWEA 1RAIA 4X64B 1M66A 2BCEA 3B1WA 4H1TA 4ZAYA 3STXA 4EBAG 4YJKA 1C8KA 1PFGA 3SIXA 4HI9A 4ZVPA 2PNNA 3KS9A 3T4XA 3R4CA 2IPOA 5BQOA 3CKKA 4WJLA 4RCYA 3Q0EA 5ICCA 2A0KA 3KHUA 2WU1A 3PXGA 3T4PA 3WYGA 4I9FA 4X1YA 3WFIA 4I55A 3U1TA 1KZGB 1ESNA 1OC4A 4WBNA 2NNLD 3CHSA 2OGTA 3C6KA 2VTDA 5BQ3A 4IZIA 5A4IS 3PFBA 1R66A 2JEKA 3SC3A 3ORRA 3PFKA 2CN1A 2GN8A 4N5NA 1DKUA 3BS4A 2UV8A 1JYFA 4LKRA 1MUUA 3AG6A 5HP4A 3O47A 3VNRA 4IDAA 1Q3HA 3MG9A 4BE4A 1PJBA 4IG9A 4F3CA 4X63A 1CZRA 5C9ZA 5DBOA 2HKIA 3OJXA 5BPFA 1UDWA 5AUQA 4LJSA 1DI0A 2HEIA 2OFOA 1XZCA 2IHZA 2QT1A 4UCQA 2X6IA 4EY3A 2PKXA 1C0PA 3JD2A 1ONNA 1N2ZA 3R7QA 1XVIA 2QR3A 2WJYA 3SF8A 5CMYA 4F5ZA 3OE7A 4R3NA 1ZUD1 2WLTA 2C57A 2JJQA 1W52X 1Z74A 1YRAA 1C50A 3VH1A 5AW9A 5KTMA 3I9FA 4LYDA 1J33A 1YR8A 4G8JA 3PPWA 1J2YA 2DUWA 4CTNA 1MJFA 3MLAA 4K88A 1EEHA 3AHJA 1YRBA 1XYYA 3IAM6 4UEWA 2YNQA 1GR1A 1Y37A 3VR5D 1GYPA 2C61A 4Q18A 9LDBA 2WWWA 4WXPA 3TWQA 4M8LA 3ZK9A 3IT2A 4A55A 2Q62A 3BMNB 3KX2A 3NORA 3KJIA 2Q0XA 2UXBB 2QM3A 1QE0A 1ZH4A 3RO3A 3D3KA 1DV2A 2NTJA 4QVIA 2AC4A 1RR6A 3IVRA 1FFXB 3JATB 3HCPA 5IM4F 4A8JA 2YS7A 3ZLJA 4RLSA 2L0XA 4OMDA 4LF9B 4JR1A 1TJCA 3NJ4A 3WRYC 4J0EA 3BWDD 2XB6A 1ML3A 5IK2A 4AO6A 2P6UA 3DAFA 1JBEA 2JFYA 2PY6A 5IUNC 2IY0C 5AHWA 3CW8X 1L4FA 3Q3JB 1K06A 3NXSA 5BRJA 1U1EA 1KEEA 4A1GA 1GPJA 1T36A 2JS7A 2Z8YM 4MW5A 4M9QA 4N5DA 5C4MA 3R9XA 4F4UA 3HLYA 4BB5A 4DUGD 1XEWY 3T7DA 1PE0A 3DFZA 4BQEA 1AE1A 3IOYA 5HYVA 5TF4A 3AVVA 3WYCA 2OHIA 3QKTA 1NNUA 2BJHA 2EBHX 1W4RA 3PGJA 1UJ5A 3FMIA 1LSUA 4OI1A 1OJ7A 1W88B 2XVMA 4YUZA 3A2MA 4IZ6A 1B6RA 1E5QA 4B3GA 2ZIEA 3G8YA 1PFVA 2EFHB 4P58A 4GRIA 4BNFA 1IHYA 1I5EA 1VQ1A 4ZD6A 2OCXA 3E4CA 1Q7RA 5T4EA 4HQFA 3BC1A 1WKBA 2O4UX 5AJHA 3NG1A 1ZP6A 1H9CA 4MAAA 5JCZA 5FPHA 4ACBA 4KPGA 1XB2A 4H0NA 2QBYA 3KUUA 1G8PA 4IGAA 4YAKA 1X42A 2XUJA 4ER5A 1C30A 3R0QA 4K1LA 2GPNA 2PX6A 3PREA 4UD6A 1NRJB 3T35A 3EEYA 3WGIA 4F5YA 3KRTA 4GF5A 3P9IA 2D2VA 2QYTA 1VKZA 4N7RA 1UKEA 4FP9A 1TMYA 4FGSA 3HE3A 3N59A 5JAPA 5J2UF 3DWGA 3DDUA 5CBOA 2RE8A 2V8OA 2RCNA 3DDNA 3R5TA 4DMUB 5CT4A 3MMXA 2H5IA 5LA6A 2VTBB 4R1PA 1ZJ6A 3ETLA 5J47A 1NP6A 2BUCA 4EDHA 3JW8A 1VCMA 1IPEA 4PFQA 1QS0B 5CB0A 3I4LA 4G8BA 1JHAA 4TX1A 3DKIA 2H6FA 1A88A 1KRXA 4YCLA 2OORC 3NBFA 3T5BA 1OAOA 1PDWA 1IZYA 5AW2A 1PX2A 1I7PA 3D9MA 3VKWA 4HH3C 2IUSA 3R7SA 1EQ2A 1RXVA 3R4VA 3U5TA 2NTYC 5TS3A 1WUYA 3CEJA 4GO1A 1OHHD 4GRAA 5IUJC 5K0GA 3SGLA 4WESB 4NAHA 4JIGA 1NULA 5BV8A 3R6GA 4B76A 3OOHA 1TYBE 4EKDA 2ZETA 2KW5A 1X92A 2I6FA 5D3MA 3LV8A 2ZVJA 1PNVA 4KI7A 4XKJA 4YN3A 3ER9A 5AVVA 1Y81A 2I80A 5AJLA 4NU0A 5FNVF 3UGTA 2QLBA 2V54A 4XYBA 4LXUA 2HJGA 4ZYUA 4E03A 2BHRA 3AIOA 3NDBB 5HI7A 3V1LA 3V9PA 1LC3A 1X8JA 3P9NA 2HQOA 4J03A 5FKJA 5HIAA 4RH1A 4F9GA 3MERA 3EA4A 1BCSB 2ZI9A 4LKOA 2WG1A 3LZCA 3QXJA 5E9QA 3LRTA 3OEYA 1OAKA 2O8NA 4EG1A 2PA0A 2J49A 4LMAA 3RS3A 4LRXA 4L2LA 4MHSA 3ELUA 4O2AA 3W4IA 3DSTA 1C4WA 1HEUA 5AM1A 3SX2A 4NV1A 3CSSA 5G0VA 2MR5A 3CN9A 3VJLA 3CRQA 1CPYA 2I4NA 4NFSA 4LTMA 4N3NA 3QEKA 2QYHA 3AF5A 1KIMA 3TOVA 4RM2A 3P9YA 4L8VA 3GQBB 4PLCA 4QVKA 4UXHA 221PA 3DMDA 4FE4A 3OQIB 4W7SA 5F2NA 2O8DA 2Q5FA 5FTLA 4DBLE 1PUJA 2YVUA 3ZXUB 4FKBA 3BFXA 3S2YA 2XWSA 1KMCA 5IDQA 1H05A 3ECCA 3BMCB 1L5ZA 1BMTA 3DBVO 1W0KA 2P9QA 2GYWA 1R4MB 4ZAFA 1SEPA 5CNMA 1TA9A 5DF1A 2Z83A 3EIWA 3OE7D 5AXBA 4IKPA 2I4IA 2I03A 1DQYA 4X60A 1JJAA 4DG9A 4I50B 1HZ4A 3SYMA 3VNAA 5I8PA 4CT4A 1QMGA 4NESA 4RADA 4F2WA 3Q73A 6REQA 3WO0A 3ABIA 2WJHA 1W93A 4L5AA 2MYOA 3QFHA 3VO9A 3QE3A 3AVUA 2HU7A 4DCVA 1G2OA 3TQCA 5JHGB 4RHCA 1YJCA 4IMPA 2QVLA 5JW6A 2IYQA 3BQMB 3RTAA 5E1MA 3P27A 1ZSYA 4K9MA 4PLGA 1QG0A 2X7JA 4BMDA 4JEIA 3OZSA 3EC2A 2PUHA 3CKYA 1XWWA 3EZ7A 1QC5A 1VG1A 3MCVA 1EP2B 3D9QX 1JI3A 4B43A 3KQTA 3FNQA 5CH3A 5LQMA 1KI9A 4XM0A 1RD4A 4G1VA 4CETA 5IK2D 3K30A 5EWLA 5EMHA 1SIOA 2MSWA 4GBGA 4ECEA 1ZQ1A 2FF5A 4RD0A 2KMLA 3KYCB 4XVCA 4UZFA 1JEQB 4D5EA 1I6LA 1MDFA 4MS1A 1GWNA 4Z3KA 1R0ZA 1P3JA 2WZBA 2PQ2A 2VP4A 1H2EA 3CC8A 3ACCA 2PCJA 1VP3A 2EX1A 4DIEA 5ILQA 3R6DA 1S8FA 3ZHUA 3PP8A 2W8BB 4OHVA 4I55F 2QTTA 4ZAWA 1T8SA 3RKVA 1JXQA 2QJFA 4OHFA 4OHPA 4WBNF 3EJ6A 3FRJA 2B1IA 1BFUA 5COAA 1YA6A 2QZSA 1DWPA 1QCZA 1W1IA 5CIYA 3T38A 2YRXA 4OGWA 3ROTA 1VE7A 2CMGA 1T3HA 3ZX5A 1PUIA 3AEUB 3IBTA 2EWMA 3A9SA 3CUVA 4CKZA 1SUBA 4PO3X 1ZUNA 3FUVA 4EHKA 3ZH2A 1G21B 2B9VA 3AVOA 4KXVA 3ZY4A 3IUYA 3FOBA 3HWX1 1G2IA 3JWGA 4MCAA 4URXR 2XKBA 3SVTA 1CSEE 1LDEA 2F6RA 5TQVA 4LJKA 2O8CB 5CP8A 4TWBA 5DULA 3GW4A 4ZQEA 3TR0A 5AW7A 5JSUA 4MGHA 2XPCA 2I7VA 3K94A 3FOEC 1SUCA 3QBVA 2W2MA 1BU9A 4PLHA 4P3YA 4DR1B 2GAJA 2PR7A 2FSSA 4PBSA 4JI5B 4GOJA 1L6IA 3DHVA 3UMBA 3WHLA 2GNAA 1UBRS 4M3OA 1Z39A 1SVUA 3Q4AB 5TE9A 3DRAA 1DV1A 3GNLA 1REQB 5A05A 1UM9A 2DAPA 4GXRA 5JV5A 3RLIA 3G68A 1AQYA 1R8QA 4HQKA 2A5JA 4XDGA 3FTPA 2IU3A 3PJDA 3ND6A 5IC5A 3AESB 4K87A 1O5OA 4BO0A 1D4OA 1PR5A 3O6VA 4PYKA 3FW1A 5B3SE 1HOXA 1A50B 2IZ7A 4U3JA 1RMQA 4XKCA 3FGOA 3USZA 4MKRA 4JA9A 4WSOA 3BDVA 2H2HA 4WZ6A 3WTBA 3PL1A 2X6TA 3LC1O 3RAPR 1U3FA 4L72A 3RIGA 1R6VA 3NVKI 3QX3A 2CXSA 4M0PA 4ZDJA 1TN8A 2SICE 3W34A 1NASA 3BXFA 3FDZB 1W48A 1P6UA 3VHXB 1S4QA 4BXOA 1AHIA 4KQFA 4AS2A 4XQGA 3QKUA 1OLSA 1DZ3A 3U7IA 3U5ZB 1JR6A 4URWR 1T8PA 5CT8A 3ZR4B 5AOAA 4J4BA 3NNSA 3Q75A 2DZDA 3IAS6 5DXFA 4H3SA 3B5JA 1UXGA 4CR6A 2J33A 3T61A 3B48A 1UW4B 4CKBA 1L9XA 3DVAA 3TMAA 4ECAA 1UP6A 5DEIA 3G2WA 2D0OB 2O1WA 2V6MA 4EX7A 2X14A 3S8EA 2GEKA 4KDCA 2YXPX 3HG7A 2YDYA 1LSOA 1MENA 4QATA 3BXOA 3AEQA 3V8EA 3WHPA 5U9CA 3TWUA 1RHRA 4DAEA 4ZU1X 3D0KA 4R0NA 3AZQA 3FUKA 4GECA 4LRQA 4XUGB 2GNPA 5LQJA 4GA1A 1OFUA 1XTJA 5ALVA 4U0UA 1KOJA 1UP4A 3BA6A 2IY9A 3ADDA 3ZDZB 2OCGA 5I7VA 4DKJA 3LDZA 1V5WA 1VE1A 4G11A 3Q7SA 3EMVA 2BGGA 3VTZA 4OGLA 3DE7X 1O1SA 5EJGA 2WYVA 3Q98A 2PX3A 2NUAA 1D1TA 1T9GS 1DGQA 3LY9A 2BH9A 4NMXB 1W0KD 1XRSB 3X1WA 4PZCA 1HPLA 1GUZA 1JSCA 1G8SA 1ENZA 3UWPA 2KCKA 4DREA 4FJ0A 4Z4GA 4U2CA 1KSHA 4O1PA 3MYRA 3TVTA 1Z82A 4J8EA 5CNJA 4E70A 2QL7A 1II0A 2XITA 3JVVA 4NONA 4BSZB 2GK6A 1SCIA 3DO8A 2FZ5A 3W3AA 5H59A 4NCNA 3EVBA 5MFPA 4BECA 1M34E 2E4XA 3OZBA 4X6UA 3S27A 2YYYA 5EAIA 3PVSA 2FFBA 4JASB 2ZJ8A 1R5NA 3LLSA 3MC1A 3GH3A 4M7PA 3CFYA 1BQ4A 2CHEA 2QRPA 2DFNA 1EK5A 2ZBDA 3IMFA 4EITA 4RV9A 1JFVA 3WWCA 2PBLA 4D97A 4WOBA 3NBMA 3OMXA 3WB9A 1PTJA 5H80A 2BUBA 5FD8A 1PJLA 3HYCA 4BV2A 5H82A 1SC9A 1KE2A 3O2NA 1HG0A 3BRWA 4LHWA 5AVXA 2BGNA 1CETA 3KKKA 4ZOCA 2HCFA 3IALA 1FE8A 4GYKA 4OXYA 3RKUA 2R84A 2WWHA 3N6XA 1U4OA 1TKAA 5DDIP 3ZPXA 3QBDA 1TT5A 2W6ZA 5BYAA 4OBEA 4RPLA 1ENOA 4LC9A 1SKUA 4J8SA 5FOTA 1D5WA 2ATIA 2YIJA 5SICE 4GEKA 3S5JA 3E6AA 3N86A 4OFXA 1YCGA 2DX7A 4LVCA 1FW6A 4O2AF 1K7FB 1ORVA 5L9AA 1EGHA 2FSHA 3JSXA 4M1MA 1JR2A 2Q1TA 5EE9A 5JRJA 1TJ3A 1X1QA 4RF2A 3H7AA 3KJEA 1NURA 1EBBA 4URZR 4Z9XA 1T4DA 3MAGA 4AJWA 4PSAA 4ZQFA 1FYFA 1FVHA 2V1UA 4AJJA 4LNUA 1XE3A 1LBEA 5DTRA 2ZI5A 4AF8A 2HDWA 3ZUPA 2PO7A 1XAGA 4WLFA 2RDMA 2XRFA 4P38A 3KFLA 3QMPA 1D6JA 5EIFA 4ZAZA 4XQCA 2FJUA 1BXRA 5JADA 2IYSA 3JQGB 3MHPA 3NHRA 4C3UA 4MUMA 3VSBA 4IMRA 5LD2B 1AD2A 4LBYA 1Z0JA 4WNIA 4CKWB 4U7PB 5CYOA 3UMRA 1IY0A 3GJRA 1YS9A 1M2NA 3V00A 3ZIDA 3VOBA 2P9IG 4E3WA 3KR2A 4GLJA 3IVAA 1LBIA 4B8YA 1SXQA 1VPVA 4HPJB 3EG9B 3WWPA 2WSMA 4EA9A 1EBFA 2QXTA 1B76A 4FXPA 4KMRA 4BS9A 4LZLA 5J58A 1ZC3A 5LIRA 5KDDA 3CVYA 5JUWA 1E7SA 2PRIA 4P81A 3HU3A 2FMUA 3VR4H 3BZWA 5M72A 5ALPA 3AUXA 2I55A 3DMRA 4AMUA 2GRLA 1PFQA 2ZB7A 4RW0A 4RTLA 2BEJA 4Z0PA 2YX1A 4S04A 4ZXPA 1R6UA 4LWPA 2BE9A 4I1SA 2PH3A 1ECBA 5KX5A 3F7OA 3BMOB 1HETA 3NKLA 4BKUA 3ZJ4A 1B2RA 1ISPA 4MI6A 3VR3A 3F3YA 2QD4A 2O3TA 4WA7A 1HQKA 4ERNA 3IMCA 3BXHA 3QWBA 2B3DA 4S3MA 4KI0A 4O2LA 4PBTA 3BQOA 4MV1A 1EUDA 4KK4A 2FPWA 1HYBA 3L79A 4QNMA 1D9ZA 4HJXA 1VLVA 4N0EA 4J1TC 2F9MA 1XVUA 4EECA 3S1LA 1QFZA 1XA4A 3F9CA 3HXKA 1E2BA 1NN5A 3AHHA 5KNCH 1A9TA 4YT4A 4QUDA 3G5AA 1EM8A 1Y4SA 2PSFA 5IG2A 4C6SA 5TGDA 1WB4A 3ZNQA 2IYUA 1L5QA 4KXYA 3TL3A 3VTAA 5BSTA 3DE6X 1SBNE 2FB9A 2WVGA 3E9DA 2DYKA 3D59A 3INNA 1L7PA 3IT3A 1HNWB 2PK3A 2QE6A 3DJYA 2BKKB 4RCVA 3JQFA 5F73A 5IH7A 2F3RA 2I3DA 4DCMA 3D0RA 2DCPA 4MUXA 1E79A 3ZWXA 2JJYA 2RI0A 4N6NA 4Q4AB 3V1MA 1E1CB 3DWLG 4KR9A 2F17A 2I1LA 1GGHA 1N2CE 3GEGA 3N7AA 4F21A 5TPZA 3L8MA 5JU6A 2ST1A 4GMFA 4BMZA 3CQGB 1H3EA 3PQ2A 5EWMB 3HVEA 5FTNA 3RO7A 1CDEA 3EGDA 3COPA 1XZ8A 3MMSA 1K9SA 4KBGA 3GC6A 3ONFA 1DEKA 1KIAA 2DKFA 5K01A 5IZCC 1V2GA 1IK6A 2IUTA 1VIVA 3OQBA 3VPXA 4YQEA 4LECA 5JD5A 2HT1A 3NYRA 2J7PA 1DX9A 2WSYB 1GFSA 3TNFA 4F1PA 4XGRA 3OKAA 2ZPTX 4J43A 2OCIA 2FFAA 3SLGA 3SDZA 5B4VA 1UP7A 2OO7A 2IJGX 2QN9A 3KAPA 2Y1FA 1U3WA 3GLHE 5CVEA 2GD1O 4KDRA 5A6VA 4LI0A 5LUBA 2LGJA 2ORYA 3CEAA 4EMBA 1DCKA 4WWNA 4XD2A 3FCXA 1YVDA 1MT3A 1VBKA 4F3VA 3W3AD 1VE5A 5E6SB 4YRRA 2A7XA 3VTXA 3AB3A 3CHPA 1E1DA 1U1GA 1CUGA 3C3EA 4A15A 1LW6E 5KDLA 5TXGA 3DS8A 2ID7A 4Z0TA 1HK7A 3AR5A 4UQPA 3MB5A 2C9OA 4L7QA 4YDQA 4BX9A 3EHRA 2EJVA 2RH9B 1KAQA 5ELXA 2MYPA 4QUKA 5CU7A 1LV8A 3DV0B 5K45A 4HUTA 1JKJB 1NIPA 3TTUA 1CE8B 4G6ZA 2O8FB 5JTTA 5AVYA 4YGYA 4GTVA 3L7OA 3AY7A 4F0JA 4Y2SA 2HXYA 2GM5A 4DB2A 2QSJA 1QV7A 1BKYA 3BRWD 2FMIA 2AFIB 2HJHA 1ZK0A 3HC7A 3RRXA 2C9BA 1IY8A 4R1OA 4ZVLA 4NAVA 2I7XA 3UBMA 4YVFA 4Z53A 4EJSB 4UDXX 3FTZA 3RT1A 1JSRA 1QE3A 4ER3A 1Q0QA 1ZMXA 2UY1B 4FSXA 3TJMA 3I5AA 1RRFA 3FKQA 1JYSA 1J8FA 1SWWA 2O3SA 3WISA 1XPRA 5KTSA 1KRWA 3MT9A 1Y7TA 3TJZA 2Y1LE 4CGYA 3B2NA 1OGIA 4PXYA 2QR2A 3HCCA 1M74A 2G9RA 1ULZA 1DJQA 1KL7A 2GHTA 2WTXA 3WGOA 3ZWAA 2AWNA 1AQJA 1F17A 1DIRA 3SZLA 3PVLA 4Y3UA 4Z2YA 2DYSE 4Q9AA 4LNUD 2QN6A 5B7PA 3PDCA 1P18A 1UMKA 3B1VA 2VYVA 5K2MA 1CJVC 4NX2A 3NYWA 4S1VA 2JNWA 3AF3A 4YR7A 4E1BA 1XLUA 3FH0A 1ZD8A 5AWFC 3VYWA 1P1BA 4GTTA 4GI2A 4OQZA 3LW7A 4KXLA 1PEYA 1P5FA 3ZDEA 2QYUA 3QF4B 1OPRA 1KDVA 3D8BA 1THMA 4DOMA 3ZWOA 4Q05A 4OSOA 1N6OA 2WD7B 2N1BA 3PFIA 4MW6A 5KJNA 1SU7A 4WGFA 4MP6A 2VSOE 3J80A 4RHEA 3T94A 4JELA 1PLKA 1J0DA 3NAQA 5AW3A 2YXNA 1H69A 1PV2A 5CLLA 4U0JA 2XTMA 1MA0A 3M34A 3HA5A 3KPWA 2J48A 4MUBA 2XQFA 3QVWA 4L9SA 1YRHA 3NPAA 4ZVUA 4YK7A 3VR3D 3UHAA 2I2CA 5ALDA 4Y0NA 1QFSA 2GZ2A 4WKGA 3NWJA 3ADOA 4F4IA 4D44A 4IOJA 4DI3A 3ZWMA 5BT8A 4HF7A 3GEEA 4PSDA 1PC2A 2CJYA 3EXG2 3ZX4A 3ICPA 5HS4A 1Z75A 3L0BA 5AVUA 1UANA 3OXFA 3DFIA 4CIVA 4RWEA 4ND2A 4C6TA 3BFJA 3RC8A 2D2EA 3USES 4F4HA 1VRWA 4KFCA 5KYYA 3ZGVA 3U4MA 2CLDX 3TIGA 3D5QA 4EG0A 4TYYA 3EGEA 1JG1A 4KL8S 3AEXA 4I0WB 2PRJA 4TXPA 3PITA 1O97D 1FNSA 1GT6A 2RB4A 4P32A 3N8DA 4R51A 1E79D 1ISJA 2X4IA 3J7AC 4A16A 5T5QA 1JIIA 2VWPA 2VWGA 1YB7A 4A0HA 2LKCA 3JTEA 4A0FA 5TPZD 3ZDQA 4H4EA 2OBBA 1JFFB 5HUQA 3OWXA 2VNHA 1UUFA 3Q7EA 5DYYA 4NWIA 3DQQA 4DNQA 4JROA 2A58A 5CRUA 1CYDA 3FVWA 2DLNA 4H7IA 1JT2A 1FVXA 3Q6NA 2UDPA 1KXZA 2GRMA 1XU7A 4EW1A 3GAFA 4UBNA 1J1IA 2B1QA 1A7UA 2WF7A 1EHYA 3X2SA 5AI0A 4G4SP 2O5EA 1LI7A 5F33A 3KDPA 3S81A 3EEFA 4IFIA 4ATZD 2LXNA 1EVZA 1SXJB 3SQMA 3DM9B 2AXZA 4JU9A 1WZEA 2QW0X 2D6FA 5BWOA 3ZJ5A 5IWAB 3NWBA 1YQDA 4TRNA 4B17A 3UHJA 1G5PA 3F5FA 5C1BA 4MWDA 3AR4A 2V7BA 2JGDB 4E4TA 2XUIA 2SKCA 3T9KA 1ZRMA 4MYDA 4FUQA 4TVKA 3IVXA 1YIOA 5JWOA 2AOTB 1RCFA 1MPXA 1AQUA 3RVBA 5H9VA 2ODBA 1Z6AA 3KHKA 5KX5F 3ZYCA 5FBRB 4DT1A 1JN0A 3L07A 5AHKA 1UAYA 1S8OA 5BSUA 3P5BA 1OXXK 4G0NA 1T2AA 3A05A 1QLWA 3CE6A 2X8WA 2RHWA 2EINE 3STHA 4JUBA 4DLNA 4ML3A 2A33A 3H87A 4ROTA 4R98A 1JEDA 1K4MA 1GQQA 2C3YA 3HXTA 5HKAA 1UXOA 1WUTA 1G19A 3RC9A 4HGZA 4KR7A 2JAWA 1R8XA 3KLMX 5KYVA 2EJBA 5IDVA 4KVGA 1DBWA 4CIWA 1AZLA 1T8UA 3PWKA 5U4XA 1RQXA 1CQPA 1ELOA 3PSHA 2QQGA 5JSZA 4LYYA 4Y2TA 4U02A 1D6MA 3WJ2A 1P33A 2ZSEA 3D3WB 1FDOA 4AN4A 2OCBA 3KJQA 4C06A 5A5EA 4ZC1A 5C4GB 4F5EA 1OREA 4O4IF 5CCEA 3WFZA 3FUFA 2E0IA 2PIDA 4JBNA 10MHA 4H1VA 4YBZA 4H7PA 4PSVA 1XMSA 4RHUA 3NT5A 4PG4A 3TSWA 1DCQA 1K6XA 1L7XA 3WLQA 4U0ZA 3HY3A 4FXOA 1I6MA 3KP1A 1QYWA 4BTAA 1XMVA 4RENA 3I9V6 4B94A 3EVDA 4J1NA 4HKTA 3FWKA 4Z86A 5FTKA 1Q50A 5IAAA 2C2YA 5FA8A 3SQDA 1TCAA 5CPFA 3G2HA 3A4YA 4WQMA 4QELA 4TTQA 2B1JA 2G76A 5B57C 4UUQA 3P9KA 3K6SB 4P4SB 4AP2A 4D42A 1ZK4A 3K16A 3ONDA 3HYSA 4M8IA 4A1FA 4F06A 4BLUA 1E2EA 3VV2A 5ALYA 4MB6A 3BTOA 2AXPA 1JHZA 1N5MA 1WSWA 2P5UA 4LZOA 4F93B 1VHWA 5H0IA 4E51A 1B4DA 3C48A 5I9NA 1M8GA 2ZS8A 5DJ5A 2F8XK 1KORA 4CMEA 3QENA 4NPCA 1EJBA 5EIDA 3F6EX 4O0MA 4TYQA 1J5PA 4ID3A 3PEVA 1N6PA 4ZHQB 2FPRA 5TQ2A 4PGMA 1Z33A 1L5WA 3NOGD 1PJZA 3HVKA 1A82A 3T41A 4UM5A 1GNTA 4M6WB 1MZVA 2HDHA 2IBMA 4H60A 2VN8A 2QUHA 2JEOA 2L18A 1E6MA 1FFBA 3AUKA 1YZFA 1GNVA 2ETAA 1YNSA 3IERA 4KQHA 1QYRA 3TXAA 2QL6A 3K2EA 2OQVA 1H2RS 1C4XA 2C4MA 1QHGA 2XNDA 1N32B 5FFMA 1GP2A 3PXAA 1M1NA 3TXXA 2VHYA 1ONSA 1ZYUA 3VFDA 3OSUA 2HCBA 4ZV7A 4KPYA 1QJCA 2BBOA 3QSGA 1IBSA 2XRMA 1TD9A 3O8OA 4HRLA 1EFUA 4B8AA 1GG5A 4EKGA 4AQ7A 1O1TA 1IU9A 3GROA 4YLEA 1BCRB 2KCVA 3D4BA 1L1FA 4KE6A 3Q9NC 4RHTA 5ANRA 4OHMA 3RRYA 2L0TB 4OXKA 1XTUA 3BXGA 4ZREA 1Q92A 2FMTA 5LU9A 1XWFA 4NU8X 1N78A 2Q7OE 1A9PA 1NQUA 2AEEA 2FLWA 4D9CA 2VF4X 3AJ9A 1M0SA 5CIQA 2M1ZA 3I5YA 5KPJA 2GS9A 3QPWA 2OXIA 3TAHA 5C80A 3WLJA 1OYVA 4PLPA 3NV7A 3NT2A 5C1PA 2FUNB 3OX1A 4AF7A 2QMHA 1VSTA 3PUJA 1YDWA 2IONA 5E9WA 5JH7A 3SX0A 3UMGA 2QRNA 2OO3A 4BDTA 3E9MA 1QHSA 5C8YA 4R7TA 1CUXA 3VR1A 2YV1A 5LP6C 4RJTA 5F7JA 5JPIA 1K6JA 2ZT6A 4E88A 3LQYA 1GKIA 2CDBA 4KRFA 1GCIA 4MI3A 1IB6A 2AOXA 4LCTA 5KOIA 4URVR 3WKDA 2B25A 2EBUA 3C5RA 4H7FA 1TYCA 5T4BA 4OLBA 2H1SA 3DBSA 3PUHA 5CXXA 3THYB 1TZ2A 4CIDA 5A9SB 3P0EA 3SHWA 3KT3A 2CHGA 2R65A 3OTOB 1LTHR 4I6EA 4EQ6A 1X7GA 4JENA 4RSGA 2BEKA 3IIIA 1KETA 2QUAA 5CJJA 4QDTA 2FW8A 3NBZC 3KXPA 1PHRA 2WXNA 4DRXA 1E1MA 2R11A 1AHHA 4P4GA 1YUMA 3K15A 1K4KA 1RJFA 4YV7A 3B3JA 5JCXA 3L7DA 3ZHQA 3W5DA 1PZNA 3J5PA 2IZ6A 4JSRA 4XGKA 2K2QB 5DLPA 1T5LA 2QX9A 1Z5WA 4OFWA 1PTKA 2XYHA 3RUPA 4UATA 1WMSA 1A17A 2VJPA 4GZMA 4ITRC 1SEVA 4GQIA 3AMVA 4TQ9A 4GSLA 4S35A 4BY6A 3QKSA 3IPCA 4TSFA 3JZDA 3HSSA 4AN0A 4YAFA 1OU4A 1YD7A 5KQGA 1KKUA 4ZDWA 1VDMA 1WXQA 1MZPA 5CHEA 1N0UA 2B82A 4JYPA 5KDOA 2VDRB 4Z4EA 2Q6IA 2YWHA 4UAUA 1U2QA 4TV3A 4LZJA 3A0UA 1WD7A 2XMQA 1SAYA 4HTFB 1SKYE 4FFOA 4GKJB 1MRNA 4MXDA 1FP2A 3CTMA 4GGOA 2HV9A 5BUCA 5FJJA 3V7UA 5IBRA 5GV8A 2WE8A 1YMQA 7REQB 3REQB 1VB5A 4OBWA 5CT9A 4BVAA 2D7CA 2RJ3A 2Z6AA 3PUYA 2HAEA 1EFHA 4J07A 1C2YA 2Q6LA 1BVRA 3SNXA 4Q9LA 1XEXB 4V0OA 3QBEA 2C2MA 4NZMA 1UC9A 3M49A 2J5RA 1XLTA 3PZRA 3TOZA 3GA7A 1Y7PA 1WUJS 5DU2A 3R3ZA 3C87A 2P1DA 3A9UA 4JMLA 3VR2A 2YZ7A 3M9WA 3H11A 2I78A 2QVYX 3DDSA 1E4VA 4L9RA 1EVYA 1NUTA 3CINA 5I7OA 4PV7A 5CAEA 2PV7A 4P0TA 2M2IA 4O2BA 3M6VA 1PFUA 1UPCA 1D03A 4DIFA 4JLPA 3I01A 2HQBA 3SSNA 3K9WA 3S2ZA 5C34B 3C5WP 2V0CA 4R3UC 2Z9BA 3NP7A 2J9FA 3RC7A 2JFPA 3UAGA 2FCAA 1YE5A 2XPIA 3SXUB 1ADCA 4YJ3B 1IEQA 1O03A 2AOUA 2Y69E 5HBGA 3ET5A 2VDJA 2VYCA 4CQNA 4OX9Y 5DN9A 3ZOZA 3SYLA 3A36A 1XF1A 4TXLA 1FFEA 3KWLA 3CNLA 2QIOA 1FB5A 1E8WA 2MWMA 5KYUA 9ABPA 4GOMD 4FFMA 2R85A 2DBVO 4O4HA 3TB4A 2I66A 4IIBA 3IEGA 4HFGA 4BZWA 4OJMX 2P6OA 2CFZA 3O94A 1QIJA 3CNOA 4B4UA 3LCVB 3K09C 2F7SA 2ZT7A 5JC1A 4ZK2A 3WLPA 2XNDD 4H7XA 3VC7A 3LW8A 3L93A 4IEFB 2Q5EA 2OILA 1U4NA 3K0AA 1IPFA 2G70A 4UTPA 3FWPA 3SM9A 2X3UA 5JASA 4EHMA 2LUHA 5DNWA 4BT8A 2EBFX 1MX5A 5A7DB 4D4KA 3ODGA 5IH3A 1VIAA 1UZLA 1ZMTA 1E99A 3MXTA 3WG7E 2GRPB 4R16A 1DFHA 4ARBA 2R3SA 1F6WA 3NVMB 5BPHA 1JAIA 3V30A 5AHOA 1NBAA 4IDHA 4EABA 3MYVA 2WHRA 5HKLA 3WLEA 3T7SA 1KQNA 2EW2A 1B74A 3NALA 2CYCA 4CUJA 3ZPJA 4C3ZA 4BSXA 4D9FA 1DELA 1NSYA 4K8RB 3PG5A 2O8BA 4RGBA 3W6PA 1K88A 3WLMA 4L51A 3K0KA 1AP7A 4TOIA 4AJEA 5AIJA 2EARA 2AEMA 2V9ZA 1OLUB 4OEHA 5HZHA 3T0IA 3NBUA 3HDYA 2FPSA 2DG2A 5KYGA 3RJ9A 2RFAA 4RZSA 3UMYA 4UEQA 5FB3A 1GPBA 3B85A 2ATVA 4PZ0A 3QE9Y 1CX9B 1W36D 1MH1A 1DCFA 5LQDA