4BX9A

Human vps33a in complex with a fragment of human vps16
Total Genus 223
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
223
sequence length
594
structure length
574
Chain Sequence
AAHLSYGRVNLNVLREAVRRELREFLDKCAGSKAIVWDEYLTGPFGLIAQYSLLKEHEVEKMFTLKGNRLPAADVKNIIFFVRPRLELMDIIAENVLSEDRRGPTRDFHILFVPRRSLLCEQRLKDLGVLGSFIHREEYSLDLIPFDGDLLSMESEGAFKECYLEGDQTSLYHAAKGLMTLQALYGTIPQIFGKGECARQVANMMIRMKREFTGSQNSIFPVFDNLLLLDRNVDLLTPLATQLTYEGLIDEIYGIQNSYVKLPPEKFAPKTEAKKLQLNSAEELYAEIRDKNFNAVGSVLSKKAKIISAAFEERHNAKTVGEIKQFVSQLPHMQAARGSLANHTSIAELIKDVTTSEDFFDKLTVEQEFMSGIDTDKVNNYIEDCIAQKHSLIKVLRLVCLQSVCNSGLKQKVLDYYKREILQTYGYEHILTLHNLEKAGLLKPQTGGRNNYPTIRKTLRLWMDDVNEQNPTDISYVYSGYAPLSVRLAQLLSRPGWRSIEEVLRILPGPHFEERQPLPTNRVTLIFFLGGVTFAEIAALRFLSQLEDGGTEYVIATTKLMNGTSWIEALMEKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis of Vps33A recruitment to the human HOPS complex by Vps16.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
molecule keywords VACUOLAR PROTEIN SORTING-ASSOCIATED PROTEIN 33A
total genus 223
structure length 574
sequence length 594
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00995 Sec1 Sec1 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.850 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4bx9A04
3.40.50.1910 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4bx9A02
3.40.50.2060 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4bx9A01
3.90.830.10 Alpha Beta Alpha-Beta Complex Syntaxin Binding Protein 1; Chain A, domain 2 Syntaxin Binding Protein 1; Chain A, domain 2 4bx9A03
4CCAA 2XHEA 4BX8A 1MQSA 3PUJA 4JEHA 1Y9JA 5BV0A 1EPUA 1FVHA 4JC8A 4JEUA 4BX9A 3PUKA 5BV1A 3C98A 1FVFA 4KMOA 5BUZA
chains in the Genus database with same CATH superfamily
1LX7A 1IJKA 2OBXA 2BCEA 3B6KA 4B8WA 4G67A 3O74A 1J20A 3JYHA 2VCHA 1ZOOA 2W4QA 2HR1A 1FMTA 3APCA 1U7PA 1LVHA 4TV8B 4URUR 5EXPA 3T1OA 3UBTA 5F5NA 2Q9CA 3CNNA 3L7OA 3STYA 1EJ2A 3VKGA 1JEDA 2OKGA 2PRZA 2B4KA 1EVEA 1Y7LA 4LKOA 3WGGA 2JCVA 1QIFA 5FPQA 2ODEA 2ZTUA 4WXMA 1KWGA 3C6KA 4ZKEA 5KB3A 1UAYA 1RHMA 4DXAA 1HE8B 3IAHA 2O2GA 1E4EB 5KYGA 4PSKA 1L6IA 1ONBA 5LLDA 1VHLA 1YZVA 3CLVA 2JJYA 3KK0A 2QPTA 3WVNA 3O3NB 3TPCA 1WM1A 4MWTA 4CHGA 5DM0A 2J9ZB 5DI3B 2FR0A 3S3TA 5AVKA 3V4PB 1PS9A 2B7CA 3H42B 5AHRA 3FPKA 5ER9A 3BWMA 1E6EA 4FFBB 4ZT4A 3NOOA 3TS1A 1BE0A 1HDXA 4D9MA 2QTNA 4N0DA 1LBTA 1GZ4A 3S7BA 5IBPA 5K8UA 5HZMA 3KU1A 2VKTA 1AE1A 4BRWA 4ATZD 1PJTA 3I62A 3WRWA 2JLSA 4TTTS 3SJCA 2KI5A 4C4YA 2CLLB 1YJ5A 1FXSA 3L17A 3G0DA 2BKUA 3DGFC 4YRDA 4B45A 2XODA 4YRBA 5L3QB 3ZGVA 1UR5A 1URPA 2DWCA 4CCSA 2I4NA 3VRHA 4AN4A 1JXMA 2PV0A 3G79A 5L3VA 1KY2A 1MEEA 3R3UA 3WB0A 2VNIA 1M2OA 1N5DA 3PNTB 1TJYA 3BB1A 3L0SA 3FVWA 2OVFA 2M63A 3NC4A 1V1JA 4TRNA 5AI6A 5EWMA 3P20A 1RKQA 1K0FA 4D3SA 1VB3A 4EB3A 4B3MB 2Q2VA 2PL3A 4BE9A 3CJTA 2BZGA 3PV0A 1I30A 1E5VA 4ZREA 5E4TA 1PR5A 4YMWA 4B6PA 4BVBA 3U56A 1C3XA 1DAPA 1M5UA 3VC3A 2WTBA 1UBMS 5EE0A 4KITB 2ZRJA 1NMXA 5GM1A 5FWAA 1AQLA 2IQCA 3K20A 3OIVA 1BRTA 5C8YA 4J7AA 1VLLA 3OT4A 1V2HE 5T3RA 2GZSA 4RPKA 3VJLA 2I29A 3CHQA 2PPLA 1WMBA 2JK0A 4LJLA 1FSFA 4M0EA 5KSWB 1XG5A 2FH5B 2A30A 2H1LA 4AMBA 1IY2A 4WZAA 4PYLA 3OZSA 5DNAA 3FTQA 3E9NA 4FFPA 4I2NA 3SJ7A 3TD6A 1XMQB 3D0KA 2V74B 2ZRBA 1CZLA 1E5XA 4LZZA 3ZVMA 1OXXK 4WY2A 4YAGA 1Y8ZA 1N75A 1O89A 2ONCA 5A7DB 1K4MA 2G5PA 3JR3A 4K81B 2A4ZA 4S24A 3UJ7A 5EKTA 1IK6A 4JVSB 4F3TA 5HGJA 1B6RA 3N59A 2UAGA 3DDZX 2WXOA 1EFRD 4MRMB 1Z7BA 4JBIA 2XXAB 4L7TA 1G5QA 2WJWA 2H1WA 1NBAA 2BCGY 2E87A 3MM4A 4XWGA 3ZXSA 4PSAA 1OHHD 2C8KA 3E3NA 3IIKA 4QHTA 5JO9A 3WGLA 5LA6B 4W7SA 1TQHA 4YRKA 2VRNA 3PNMA 4ZRNA 1LKZA 4QKQA 1HR0B 2XYRA 3T3GA 4A2QA 1Y4SA 2I65A 1IC6A 2A9OA 1OBVA 4PRYA 1NQAO 2BISA 3NWPA 2VHTA 2OEWA 4KWTA 1KDVA 2WSIA 2J6IA 1E8MA 5JCOA 3IURA 1I0ZA 2ISQA 5FXMA 4ND5A 4UAUA 4N0PA 4U0KA 4MA0A 4UUPA 4YUVA 4GR5A 2QYHA 4RPCA 3P9ZA 5KX5A 3HDQA 2YN2A 4J1NA 3U4AA 5JA4D 4HQFA 3ROZA 4YV1A 1OJ7A 3PC8C 2F55A 1I94B 5JVDB 2D7DA 4OXIA 2FSUA 3MGAA 3O38A 2Z5FA 3TINA 4TTAA 1VJCA 3DBIA 2QR2A 4RHTA 1E2UA 3V7WA 1PGPA 3FUXA 2FPLA 1MO4A 2YDYA 1HYEA 1XTVA 3G0CA 3ZJ5A 2Q45A 3AG5A 3GLIB 4LX8A 4CF7A 1WOMA 4TUUA 1BVRA 1VCNA 1U2QA 3D0RA 4PCAA 1B76A 2MSWA 3GFFA 3F6EX 3OC6A 4EFMA 4P3PA 3OTQA 1U3FA 4M54A 3V2IA 2FN9A 3TGOA 13PKA 3OCJA 5CCEA 5CEJA 2MDTA 2LKDA 3S1AA 4BNYA 3WG7E 2XKAA 4HNVA 1BFUA 3I8SA 4AO8A 2I22A 4S35A 2ZM5A 3JQFC 2NTYC 3L0IB 2VNHA 3TTYA 4EARA 2QG6A 4QXPA 2FSSA 2ORWA 3FDIA 3FVRA 3HB4X 3H4VA 2WJAA 1I3OA 1RPNA 1TQ6A 2X3YA 3I5MA 1ADYA 3FKJA 3MS2A 4GG1A 2WJ6A 3S1AB 3S2IA 3AMVA 4BQOA 2XCBA 4D6PA 1X2BA 3ENNA 5FA6A 1PS8A 3LP6A 4CNBA 3P9RA 4AJHA 5EC8A 1UF9A 1UEJA 3N6RA 4YQFA 2WIBA 1VECA 1C50A 5K1ZA 2FAXA 4U7JA 4E15A 2A0XA 2GVNA 2ZB4A 5J23A 3JSXA 2C82A 3ZPJA 2P3SA 3DDHA 2VJMA 4TS3A 3TMKA 4BBZA 4TQAA 3LBFA 1WY6A 3LCRA 1H42A 1T9HA 3CSFA 1NOKA 4PAMA 4QC2A 1TKCA 4KO1S 3U48A 3W79A 3N8IA 4A2PA 1HA3A 2X40A 5CDYA 3FCXA 1XYVA 4AMZA 1LSUA 2CSXA 3ISVA 2JDIA 1EJ0A 3RGWS 1YR9A 4QU9A 3MXOA 2J9FA 4UTOA 4IXTA 3EDTB 4QWWA 1N9KA 4L76A 3SBOA 1UPXA 1T8PA 4R8SA 2VIIA 5BN5B 1KO4A 4PCUA 3BFXA 2P91A 2VYVD 4KBYA 4RV4A 5EIBD 4A91A 3KSQA 1WHSB 4UC0A 1R4ZA 1Y7HA 3C39A 4TXHA 4MDEA 4CDRA 2Q99A 2OOEA 3IRUA 3V8BA 5CVVA 4BO0A 2QTRA 1SOMA 1C1XB 2O2EA 3JQCA 3KV1A 2X9NA 4JIGA 4LFCB 3U40A 3ZDQA 4B46A 5ED4A 1UBTS 3PS6A 1XN4A 1THZA 4NBWA 1Z8FA 3Q3VA 4MRAA 1A98A 1WL8A 2XQIA 4LXIA 4ZOCA 2FP4B 1ADBA 1GPUA 2XE7A 5AVRA 5ICCA 5ARBA 1GADO 2XCIA 3L0OA 2VF4X 3QF4B 4L5BA 4NMLA 4QJ5A 3M5WA 4OQNA 1RI4A 4Y6RA 1HY3A 3KUUA 4W82A 5K03A 3TR5A 2PT5A 3A1FA 1XRLA 4O0MA 3WGJA 3EMVA 1VCMA 4BNUA 2ZR8A 1MZCA 4KT6B 2J6CA 3UB4A 1KDRA 2IEBA 4MRMA 4ZOBA 1S8FA 4XM2A 3U4CA 4ER7A 1GTSA 1A8PA 3K0EA 1VQ1A 2HPZA 1XPUA 3GLHE 5L45A 4BXOA 3OZUA 4RH0A 3FLEA 2CFUA 3COWA 1PR6A 3KTAA 1U4OA 3ED5A 5G04J 3HHMA 3F74A 1ML3A 4GM0A 4N5IX 3SZMA 4DILA 5JANA 1JLHA 1HDIA 2RGXA 4I43A 3UWMA 2P27A 1JEOA 1P0MA 3B51X 3ITNA 1F2UB 3JZAA 3N3AC 2AN4A 2RHMA 2OAEA 3DYIA 3GUCA 4B6SA 3DZFA 5DM4A 1QPBA 2ZP1A 3GZ4A 2NYRA 4PTZA 3TWQA 4KOEC 3JSAA 4BNJA 1J8FA 1AO3A 5A7FA 5HKLA 1JT9A 1AIPA 1ZH6A 4UHCA 4KXUA 4OVKA 2VJQA 2RB5A 1MIOB 2A9PA 2CMKA 3QE2A 3TOVA 3WGOA 3IP7A 2BKKB 4GZ6A 2XUJA 1TJ3A 4JWTA 4RABA 5KHOC 2ZYTX 3U09A 4YO8A 4Q7KA 3OP4A 2BM0A 1QP4A 2WHPA 4OBWA 1ILWA 2RHOA 4TL9A 4MJ3A 1KDYA 3KS9A 4Q3DA 4CKCA 2PT7A 3R44A 1IULA 2Z98A 4YAJA 4DLZA 5KTOA 1XAGA 3MELA 3T9BA 1Y8CA 1V6AA 3OF2A 3ZY2A 4KFCA 3AW9A 1Z39A 2W2LD 1M76A 2WSSD 3G3EA 4YJ2A 4ND6A 4WPGA 2AOTA 1CR4A 2J4FA 1YWGO 1DBQA 3PNVA 4BFSA 2OBBA 1F8UA 1ZC3A 4ZAFA 3PJDA 1G98A 1SG9A 2NTVA 1CEYA 3RRMB 2FF5A 4NV1A 5AXCA 3NHMA 1I4EB 3HBJA 5FTJA 3ZXIA 1NI4A 1P62B 4K9QA 5JYCA 2PX3A 4Q9AA 4LX0A 3EHRA 1NRXA 1SXGA 3ZW8A 3E9YA 1I2MA 2GBLC 2X1MA 4PQRA 1IPEA 2W43A 3OEHA 4JY7A 2QJOA 4N41A 3EBPA 3OKPA 1RXVA 3KAEA 4GMXA 3SCZA 2IY0C 2AXNA 2EKQA 2YMQA 5TEVA 3TKAA 3J81A 2LD4A 3K6RA 2HZ7A 2YZGA 1IY0A 3PEFA 1TKBA 4GMKA 4PLZA 4QVKA 1M34A 4WLEA 4YP7A 4D02A 4CMHA 1WG0A 4ATGA 2HSJA 4UFOA 5MFZA 2R05A 5EZ5A 1TO6A 3ER9A 4KSCA 1N5IA 2HHAA 3RYIA 1Q15A 3AXSA 3CLTC 4NCNA 1ZISA 1R9JA 1NI1A 4E09A 3VR5A 1IXKA 1VKOA 3ZYQA 1N8NA 3FF4A 3PWKA 4PVCA 3S2AA 2BFEA 2VAWA 1EDZA 2ZWAA 3AIIA 4FMCB 3QMPA 4DGQA 4YDSA 1ZK4A 5EP2A 4AJ1A 1GGVA 5AKHA 3V6LA 4GKKB 1JWGA 3CF0A 2YY6A 4WLOA 1HOXA 3CUTA 1DWOA 4TT3A 4ZGGA 2BFEB 3BB3A 4K6MA 3TR0A 1KSJA 5KU7A 3H2ZA 3QU7A 1XU7A 4YRRA 4EY8A 2CXOA 2W2OA 3EQ8A 2ID9A 5ELLA 2Z9CA 3I23A 2GNPA 3QFHA 1P2SA 4KQKA 5EJEA 5ICGA 5A5EA 1BDHA 4B3GA 4LTNA 1TL7C 3MIZA 4HDNA 3MTBA 1M2HA 2UWJG 4OM7A 3IELA 4NZZA 1YQTA 2VTBA 2XY4A 3EPRA 4ZU3A 1MOPA 2CDRA 1J25A 2IP2A 3WLKX 2BAGA 5HK8A 4B8YA 3BXGA 1T0UA 1KEUA 2NVBA 3MVEA 1SUAA 2DCMA 4C30A 4JLUA 1P3Y1 1XQ1A 1RM3A 3TN7A 2VHYA 3PS9A 4F4IA 5B1EA 5CDHA 4L75A 4MLCA 2OXCA 4A8TA 1KFBB 2FK8A 4PG5A 5B7PA 3MBOA 2CDBA 3FXAA 3RYCA 3IDFA 2B35A 2HADA 3IUMA 4Y6QA 3R20A 5J2UF 3OLVA 4MZXA 1CNFA 1O9GA 1Y7PA 4NK4A 3ZIAA 1NQXA 3HJUA 4BAZA 4KMSA 3KJIA 4B0OA 3V34A 4PE5B 4Q1DA 4RZ2A 4CT4A 2MWMA 5IG2A 3DJYA 4FLEA 2F4NA 4U2CA 1TMOA 5J2UA 3BGVA 4FZ3A 1RPAA 4P8RA 1NSFA 4Q7EA 4YMLA 1AJEA 1SHLA 4RY0A 5HBRA 5LMCA 2ZB3A 1TZ2A 4WXPA 3DD5A 2Q3LA 3SF8A 3KRTA 2GYVA 4JI6B 5LBUA 4P9NA 4L23A 2J87A 2V7EA 4YT4A 1PJZA 4PQFA 1GPLA 5T4BA 5LFAA 1LDNA 3LGSA 3FOEC 4AMUA 5E0KB 3UMYA 5GADl 4Z8YA 1RRVA 3AWDA 2Z9BA 5KYWB 3GFBA 1SRQA 5A3JA 2ZCVA 2H4ZA 2UY1B 4A0QA 5JSFA 5IRCD 3AVXA 4FFNA 4NU5A 3DB1A 5HI7A 2JLZA 1V9SA 3LXUX 2HDWA 4WADA 5DHQA 3RS5A 4AMGA 2FPXA 4CEIA 5BYJA 1QS0A 4BP9A 4XFKA 7GPBA 3RVLA 3E05A 5JYBA 2CJWB 4OSEA 2V4HC 5I01A 4LISA 1W2HA 3FTNA 1V5IA 2QK4A 3B6EA 2UVQA 1V48A 2FFHA 5G02A 2Q6VA 1YZQA 4OVVA 1KMNA 2QLMA 1QGZA 3I9V1 5E9WA 5KIAA 3HK2A 3HABA 3KQOA 3MA0A 4QUDA 1II8B 3JZIA 5CMWA 2GZMA 3DOUA 4O60A 2IEZA 4MPTA 4RVNA 3IEUA 4AKHA 1EAYA 2HAEA 2GCOA 4GCOA 3JYSA 1I2ZA 2GZRA 3LBYA 4QXOA 3CG4A 2WM9A 1GG8A 4NDNE 4II3A 1PGOA 1UL1X 4M8NE 3W1WA 1CC1S 2FSIA 2A3RA 4DQKA 3G0IA 2WFLB 1D4ZA 3FETA 4JNCA 2P4HX 4F8JA 3RS2A 3DFZA 1QF7A 5HQ3A 1CS0A 3ZW9A 4JA9A 4Q02A 3RIBA 3KIPA 4N5HX 4HMQA 3RFFA 5GZ1A 2FPPA 4TRRA 2MINA 4KI7A 1OBFO 4U39A 1L4LA 1BD3A 1Z12A 2XMBA 4AKGA 5T7BA 2GK7A 4X8MA 2FF4A 1NDUA 1SRRA 1FXUA 4Q1FA 3VAYA 3WWEA 3TLMA 4DC0A 4ZGBA 3GGPA 1E2EA 2A67A 1JLLB 1RACA 3H4IA 4RA6A 1CZOA 4RZUA 2GRRB 4BQSA 1AGNA 1NN1A 3FFWA 3RSCA 4W99A 4U2FA 1EYZA 1A71A 2N42A 4P86A 1G5FA 4MRPA 1T9GR 3FUCA 1WW8A 1CQZA 3UM0A 1PAQA 3N2EA 2BI8A 1LVUA 2FO1E 2UYQA 2ZYHA 3N2LA 1KAHA 3EWIA 2M6KA 3EULA 1HLGA 3JRWA 3R4VA 5CLJA 3GDOA 5TPWA 3WP1B 1JRLA 3HU5A 3ZV5A 1A82A 3GUUA 1U3DA 1N2BA 2ZYAA 3AEUA 3GJRA 2G5CA 1U5BB 2GB4A 2DBVO 1U2GA 2JLAA 3K16A 2GJKA 3RS9A 5CYFA 3ZGOA 3A2MA 4HXIA 1HYGA 2KZTA 3M6LA 3TTXA 1GUYA 2ZQYA 4FR2A 4MYHA 2X0EA 4C6HA 4KZKA 2LTAA 3I6BA 4UU0A 3NAZA 3HLKA 4E3WA 3T7IA 1JL3A 4INZA 2YFQA 1L8XA 3QELA 4UUNA 1X1CA 3TI9A 4R8KA 4CM4B 3VGPA 1QFZA 4UQLA 4EY4A 5EIHA 2VNSA 1U3GA 2AI2A 3WL3A 3WMXA 4YRIA 2JK1A 1PLJA 4PINA 2XUOA 3ZU3A 3T38A 3LO5A 5JARA 1CVLA 1U0OC 2WABA 1AGRA 4M6WA 2Q5IA 1KVTA 3NM6B 1LY1A 5BPFA 4C78A 2QV0A 2D2VA 1B15A 4MS1B 3HVEA 2FXVA 2Y0PA 4B47A 4ZYWA 4NP6A 4FM9A 3Q0TA 2VBIA 1U28C 1X5BA 1I7LA 1IBCA 2QP4A 2RGWA 3ACDA 2GARA 4GZ3A 2VDKB 4DNFA 2IBSA 4CEHA 4FC7A 4DV0B 2IIQA 2AMJA 3C5CA 2UV8A 1FLVA 1EIZA 3CNQS 4LJ6A 4KX3A 3ZV4A 3C3RA 1PL0A 1TQ2A 1YQQA 4E7OA 5EJ7A 4CM1A 1L4FA 4IIGA 4YJHA 2LNDA 4XVHA 4B4DA 4Z53A 4IRXA 2PL2A 2FG5A 4GECA 4WLVA 5H59A 4ALKA 1BGWA 5AVZA 1Z25A 4N2QA 1NF9A 4HRAA 4DQDA 3UAZA 2O05A 3LO8A 1BMTA 2FX3A 2P30A 3OFKA 3QVKA 1L5OA 3UKUG 4LXXA 3R6DA 5A0FA 3ZS8A 3GARA 1Z75A 4K5AB 4AP9A 1SEPA 3GT4A 5C18A 3GJ5A 3KSZO 1Y6JA 2KCVA 5EG5A 3K0FA 3PRJA 3F47A 3RS8A 2L18A 4ZOAA 4BV3A 4PLYA 2SKEA 2P2YA 4W7HA 1UBGA 3H5WA 4CCYA 2CLSA 4MVJA 1XMIA 5C80A 1VI2A 2I1LA 1HOTA 3H87A 5ALPA 1JHDA 3RK6A 2J3DA 1SK9A 4KAXA 3VU9A 4A6XA 3RKVA 2GNOA 1FFYA 2YX1A 1H0HA 3AVUA 3MJRA 3QOWA 4O25A 1HXHA 2NZJA 4OBEA 2MT9A 5FA5A 4A8PA 3DSRA 1NRJB 1LRLA 3P26A 1ESDA 3QW2A 1LPOA 2ZU0C 1QYRA 1Z0FA 4JENA 3GDGA 4EG4A 3NH9A 3NV9A 5ARDA 3KKOA 4LZAA 3GEEA 5BV1A 1JLRA 2PK3A 4NMMA 2GVDC 2VJCA 3D9LA 4HLNA 5IN5A 3UTCA 3R6GA 3OWOA 4LY9A 2ALJA 3G2NA 1M1YA 1W30A 2YNMC 1NXXA 1E58A 4FI3F 4RKRA 4DLPA 2ECQA 3MMSA 3OUZA 3UFXA 1IPFA 4HS9A 3O8NA 5D3ZA 3GY0A 4UZFA 5ALMA 4DHWA 2OM2A 5IDYA 1BVUA 2Q28A 1M67A 3G5AA 3C5RA 4I9HA 3TX6A 4Q9HA 1PY1A 2VGXB 2IIVA 4ZA2A 1N95A 3ZLJA 3V30A 3JASB 2ACEA 3CU5A 2HF8A 3VPXA 4AJJA 1SCIA 2ZT8A 3K9BA 5B7NA 5LP6A 2H48A 5SICE 2P9GA 3RAFC 3PPVA 5AHWA 4BLWA 2O2YA 1SQ6A 1CUYA 2ZIAA 3IAEA 2I0FA 4GM4A 5DGXA 3JTEA 3TKLA 1O3YA 5JEDA 1LQTA 4FYWA 5B58T 5L7TA 3KQQA 4E4YA 4Q9NA 2Z04A 3KXPA 3HDVA 3ENZA 2I03A 1YJBA 2ZK7A 4MH0R 2HDNB 4RESA 3A36A 5KVAA 1IAVA 2BFBB 3B60A 1DO2A 3BKXA 4MNTA 4R1TA 1NURA 1PYDA 3CHOA 2KS6A 4MGHA 1I3CA 1MHPA 3OJXA 1EX9A 4M0UA 1G21B 3KUXA 1C9NA 4UNRA 2Y68A 4P53A 2ZVDA 4YI3A 4QNNA 1CQJB 2G1AA 2F48A 4KN5A 4HT3B 1QGUA 4QDXA 3JUIA 3TXMA 1RDFA 1RXIA 3KAQA 3LUGA 3QBDA 3SIRA 2X3UA 3IT0A 1DRKA 1IEXA 5HVNA 4GOKA 2FZCA 3I6ZA 5HRYA 1XNJA 2O8DB 3CHYA 4DRXE 5TB5A 4DQVA 3REQA 4D0NA 4G0UA 1BXGA 1GJRA 1FJ2A 3HVRA 2WLSA 4ARVA 2B6CA 3T15A 2VZ9A 4F4UA 5IJ9B 1E2MA 1NQ5A 3DBHB 2J5RA 1K1EA 2V6MA 4OQMA 2CNWA 2ILRA 3LA8A 1DMRA 1N2JA 2XF2A 2AUTA 4Q1VA 2MMGA 4U8GA 1S7CA 2IYEA 1D8AA 1ZI8A 2A0YA 2QE7A 3FB1A 5HM8A 3EVDA 1GPYA 3MKRA 1KARA 3WYDA 2AFHB 2PGDA 4B3DA 1BDIA 2AJLI 4HLDA 3TZEA 2PNNA 3Q98A 3T1VA 2P6NA 4CN8A 1J8MF 4BMNA 1BQEA 3B7SA 2F1RA 1U7ZA 4LTDA 4IGAA 1XELA 2UKDA 1IRXA 4HWTA 5TE9A 3SVTA 1XEWY 1PR9A 4A63B 1L8OA 1RC0A 2O2ZA 1CDOA 3DP7A 4C2BA 4EB6B 4F3NA 3KDAA 1D1PA 3IP1A 4NAVA 1I80A 1P5JA 4JVLA 4LDQA 4GPD1 4GPIB 1C3VA 2XMDA 3DT6A 1G0OA 3AQIA 2P79A 1TD9A 5IAGA 3K9QO 5KTMA 2EP5A 3C5HA 4Y2VA 5T3YA 5JYDA 2WU1A 1IIBA 4D41A 3CB4A 2VHXA 1D03A 2YS6A 3HCEA 4HUQB 1U2RA 4DRXB 5I8WA 1AK9A 5EIDA 2D7CA 3SZGA 5JC1A 5FEUA 4FFMA 4KFSA 3VTYA 4TYPA 4W8HA 3T8YA 3WTBA 3X2EA 1K7XB 4HDOB 5IK2D 3OY2A 1UEIA 3T99A 2IOFA 3GYBA 1JPLA 3WLJA 1EVIA 1QH1B 4RACA 4BESA 2FPIB 3NTVA 1TA9A 5CAEA 1P29A 1I1NA 4QJ3A 3REQB 1VE1A 5IXJA 2XA2A 5DTMA 4R1NA 1A5BB 1TEHA 4QUKA 6ABPA 2PZIA 1SA5A 1DQZA 1BOOA 1FQKA 3GJ8A 2ZRQA 4XTCS 2AIRA 3PNQA 5CHYA 3ZDEA 3LDZA 4C48B 3TWXA 4WA8A 1X70A 4PN7A 4NJOA 5L7WA 1QQ6A 3KXKA 2QN2A 5F23A 5I48A 3CUKA 2VYNA 2XE8A 1PD1A 3SXJA 3TMYA 4YR9A 721PA 4D5EA 4FS8A 4QXMA 4JK3A 4JU9A 2AW3A 4MVCA 1QGDA 5IF9A 4PGMA 2Y1WA 3FBGA 5EY5B 2GS9A 3B78A 4IJ5A 3OKCA 1TZBA 1QM5A 2R1ZA 3NAQA 3NJ4A 5AJXA 2CBGA 2LUOA 2JGNA 2OOKA 2FQWA 3UFXB 4E33A 5EHQA 3QPCA 4JSRA 1GYRA 2A8YA 4RWZA 2CJWA 4H59A 8MHTA 2HIAA 2I2BA 3EY9A 4OQFA 1JEJA 2BVNA 1MC5A 4KJZA 1Z5PA 1SXIA 3GMIA 1U2PA 3LXRA 3TL3A 3UIEA 1J0BA 1JFLA 1DIAA 1XUOA 5G2OA 4BKQA 2I67A 1GQFA 1K8QA 3FTUA 4YLYA 1GZ7A 5LP6B 3JS5A 1KJ8A 3RYTC 2Y9PB 3BULA 3E1KA 3JXEA 3DPDA 2A33A 4L0CA 1Q84A 1Y6ZA 3ZKJA 2BFWA 3Q6MA 1LJLA 4LY3A 1MJ5A 4J9VA 4RA9A 3W5BA 3C87A 3W8EA 1KMIY 4YP5A 4LV8B 3CTPA 2C9ZA 4R8RA 1Y6GA 3SEAA 3DONA 2Q7OE 4F3CA 1BS9A 4HVCA 2B3DA 3HB9A 4TMFA 5BOSB 1BKDR 3TI7A 3ZHOA 4U2BA 2KBEA 4BHTA 3CF4G 5K0ZA 1F6BA 5K8CA 1WZ2A 4G1FA 3HDGA 3P52A 3X3HA 4J6EA 4C08A 3PEWA 3F78A 1GV0A 3KB6A 5B3AA 4JEHA 3ETGA 2C5HA 1JE0A 1SUBA 2CLEB 4HWPA 1RRMA 2QW8A 3A9VA 3SYKA 2ISSD 2YJNA 3CSSA 2Y1LA 3H1TA 3RAUA 2V5VA 3O03A 1ZR2A 4R8VA 2Y4OA 3F3SA 3PHGA 1RBQA 3EEQA 1O1SA 5EMJA 2G67A 2YIMA 3SFTA 2BFPA 4BJ3A 2WTNA 1Q92A 4A8HA 5U1PA 1UDRA 2BEVB 2F6RA 1BCSB 1YK0A 3I05A 1GEEA 1RI3A 2W48A 1W0KD 4MWDA 4HEA1 1T3GA 3SVLA 1ISIA 1W25A 3K0FB 1VJ1A 1IDOA 1ODIA 1KH3A 3MT7A 3Q3JB 4MUFA 2F43A 1M2KA 2P90A 3TB6A 1U0NA 3ZLBA 3FOFC 4JP3A 4Z54A 2ZI9A 2HTEA 5KOJB 4EA8A 5IASA 1PR1A 1Z0UA 2D6FA 1FVOA 4MQ6A 1ZHFA 2HDHA 3FFBA 3K30A 3V7UA 1P9OA 3OE7D 1LW6E 2CD9A 4MV0A 1GU1A 3FTYA 4QNMA 1XJCA 4LEUA 5DV9A 2BE7A 4JVMA 3VOTA 3FNHA 1RKBA 4NR0A 4RGYA 5ARCA 3X43A 3OIWA 1I1HA 1NBOA 3OIYA 5H68A 3RRJA 3SQVA 2EIXA 3BFVA 1YB5A 1RI2A 2WWVD 3H8JA 5TT0A 2V7GA 4B87A 1SVXA 3OE7A 4M83A 5JCJA 1IAQA 1I8TA 1G20A 2YQ5A 5FZQA 1P1KA 4RFVA 3UXHA 5E9QA 2CE7A 2DKOA 4X6UA 5CUQA 4NJEB 5IM4F 1M6WA 4NHOA 5IH7A 3WLTA 3JW8A 3QTLA 3WLQA 3HJBA 3JQ0A 1E1CB 4UU1A 2MYOA 3Q5GA 4EI2A 1S02A 1NT4A 2ZAMA 3ZWDA 3KZKA 4PHTA 4R9SA 1SCQA 2GI4A 4AJWA 4F3RA 1MXHA 2FEAA 2P6MA 4GLFA 3DF9A 5CVTA 3VDMA 1NVDA 3E7DA 2WHXA 2GRPB 4EYGA 3ZDCA 1G3QA 4ESVA 2OCAA 3UVEA 2GRAA 2RI1A 3TEMA 3HVKA 1MZVA 3KB8A 3NETA 4UEWA 4C76A 2NVOA 4MCJA 2V9ZA 4A3VA 3OXFA 1FA9A 4LRSB 8ATCA 1I5EA 5K09A 3L7YA 4ZODA 1XF9A 2BTQB 2GSDA 4MMZB 5LYYA 1M0SA 3RARA 2V1UA 2ESRA 2Q0SA 3RCBA 3SDZA 3CPSA 1A96A 5AVVA 3U7QA 1HXIA 4EKGA 4FJ0A 3ENEA 1PW5A 5COAA 3BGOS 3FTDA 1PKXA 3R5SA 4L5CA 4PLPA 2OV8A 1VHWA 3PGKA 3CVQA 3KYDB 1P44A 4GPZA 3WMGA 4DC1A 5C8ZA 5C37A 1Y1TA 3AJIA 3GPDG 3HKCB 1RS0A 1Y0BA 3K1AB 2I8LA 3QV2A 3EVBA 3GCGA 1U6JA 5TQJA 1HH4A 4OYSA 5D86A 2XS8A 1MX1A 4QELA 2IV7A 4RJTA 1E94E 4WNIA 2CLOB 5IN4A 5C46F 3BZUA 2NV2B 1QRAA 3HNRA 3GGJA 2ZI4A 2MCFA 4F6CA 5AM0A 4PGFA 5ENTD 4BE4A 1GGHA 2BT4A 2JIPA 2CFTA 2P8JA 3HHEA 1Q0PA 4BUJA 1NXPA 1SWVA 1W96A 2OKCA 5I9BA 4MKIA 1DBVO 3QNWA 4NZOA 4XIYA 5L4LA 3SF4A 2H1HA 1H3NA 1TGYA 2BM1A 4I6EA 3OQJA 1X81A 4UI9K 2W6ID 5AKZA 3Q8KA 2UZ1A 5I3CA 2ZIZA 3SEFA 1T5IA 4H7IA 3DTNA 1FP6A 2GWRA 3FPJA 3NC0C 2GA9A 5GONA 5BYBA 3I9JA 1RD4A 4ASUA 1UWLA 2V7PA 4HJRA 1M2VA 3BCHA 3VA7A 4YRCA 4OHVA 2PQMA 3ZNGA 4CV2A 1JFRA 5FUWA 5K2MA 4P29A 1YMQA 3ROFA 5A0TA 4LSGA 4QOEA 2HYZA 1E7WA 2CNWD 3EVTA 4Y0VA 5FH9A 1A4IA 1KTIA 1FP7A 4RAOA 5CLLA 3LDAA 3PQ2A 4WNAB 5FT9A 4BECA 3NOCD 1MC8A 1NBHA 1A7AA 3UQZA 4AJNA 1YAHA 2DT5A 1E8NA 1GG5A 1QONA 2CMDA 2HM7A 2CL7X 1D8TA 3LKVA 3HHPA 3N7UA 5JSYA 1D5CA 4DDUA 3QKUA 4C7BA 1XLVA 1O96A 3DL4A 2PUHA 2WWIA 4K9PA 5FL3A 5ITZB 4EGJA 2ZT5A 1XFAA 2V1XA 4F0JA 3I01A 1TZMA 1QH1A 1T2AA 3MT0A 4QRIA 5DE3A 1TZKA 2YRXA 4K1XA 4WZBB 3SR3A 5ENPD 3HCBA 3LFUA 1RM5A 2GFHA 3RBXA 5G3ZA 5JDCC 3ZJYA 3A14A 4P7KA 4BCCA 1IEVA 4DK5A 2ZEJA 1K8XB 1K66A 4QM7A 1ISRA 3H04A 4F9EA 2XRYA 1UDWA 5EYLA 2NPFA 3BL8A 2JS7A 3V2HA 3BCRA 1N0WA 5DMXA 1W88B 5M3BA 4X85A 1BWPA 1VG9B 1VDMA 1GLVA 1ONOA 1GPMA 2HC9A 3L6BA 1NBME 4LKRA 4BV2A 1JLKA 2CUNA 1E3LA 3KELA 3NQPA 1KYXA 1ZK3A 4ILIA 4A6PA 4RIFA 4WJKB 4MYRA 5CFPA 1NYQA 5F1OA 1KLXA 4MV5A 1B6GA 1MEOA 3OURA 4TROA 3DA8A 5AI8A 3EUEA 3PQ5A 3U26A 3ICQB 5ALSA 5IK2A 2DYKA 2HRDA 3VHXA 1U1DA 4YRAA 1B93A 3D8RA 3IEIA 1PZEA 2ZWVA 3ZCSA 4RG6A 4UW9A 4U5XA 2PM7A 1XRNA 3S44A 5B3KA 3GPBA 5CPFA 5C4MA 3LUAA 3AS4A 1LD3A 3OA0A 5JXIA 5HJEA 3ZV7A 3BMCB 4NIKA 3B13A 4U7PB 4WACA 5P8WA 3RVMA 3VFDA 1Q20A 2PMCA 5HNKA 3UZUA 2ZYUX 2RGAA 1YZFA 2VCEA 1NYRA 2H4XA 2YNMA 3GZNA 1Q44A 4QDUA 5HZHA 1OAOC 1TVMA 2QLFA 2VXOA 2Y27A 2DUJA 1OGJA 3TXXA 4TQUS 3KSLA 1X2EA 1NPYA 1TB4A 3JY6A 3OEHD 4G9BA 3UMGA 4OYYA 1A69A 3NIGB 1SBTA 4LJRA 1WB4A 4UNIA 5E6RB 4FA6A 2XQFA 4KYIB 1J2UA 1W44A 4ALNA 1N3YA 2OL4A 3HDHA 5GAJA 5THKA 4E1VA 1TE2A 1UMBA 2A9RA 1JNYA 2WXFA 4UUMA 2VDVE 3CO0S 4BX0A 4P54A 4E5VA 1YTUA 5CW2A 3TCKA 4HQRA 3Q75A 3DKVA 3LSYA 5EJFA 4PF1A 1G21E 2R86A 4OU4A 1T26A 4Q21A 5ALXA 2WTEA 2ZRAA 3B3JA 3N05A 5C1IA 1R0XA 3F4KA 4EA6A 5JFOA 2GILA 2WF8A 4MV7A 2QD4A 1TVCA 1G66A 2ZGVA 3CIFA 4RK0A 1PX0A 4AO6A 2JH3A 1AHPA 2XUKA 1S01A 1HMYA 4GA0A 2PMBA 4UWHA 3C3XA 3OZEA 3H11B 3VLDA 5HHTA 2YWGA 3QITA 3NCHA 2AFIB 2OCXA 1IBSA 2ZIFA 4DYDA 4BMPB 1UXKA 4K5CA 5EXTA 4DV6B 2QZAA 1UJ4A 1WV0A 4C7JA 1ACLA 1ZGAA 3I2HA 2R03A 1RLMA 4R2JA 3AINA 4PVDA 1AXRA 1GGFA 2PYZA 2H11A 3K05A 2EV9A 1J5XA 4GYOA 4LZWA 4A7PA 4JR2A 5IXSA 1W36C 3VC7A 5BT8A 3ZU5A 1TT5B 5AVUA 1E5LA 4CMJA 2KJQA 4GRDA 2B4RO 4K3VA 2AC2A 1KMQA 4FYYA 4BMSA 1HI9A 5K8VA 1GYPA 2GUWA 2VHZA 5AK6A 4YUYA 2YVLA 4OY3A 3GELA 4MI3A 4B2IA 2AQHA 3MJFA 2Q5FA 3VR6D 5AVWA 1GGJA 1ZEMA 1OCRE 3TUJC 2R4QA 4B48A 4PZCA 2JFWA 3C6MA 1O08A 4AJ2A 1EK1A 4YNBA 4GBGA 3VTAA 4CXMA 2PUFA 4AJ4A 3ZEFA 2DTDA 2FEWB 2MR5A 5B3SE 2R1UA 3L1KA 4FGJA 1H6OA 3DEOA 4ICIA 2VT7A 4MEAA 4BEBA 3ADDA 4GL2A 1E64A 5AM1A 2EILE 2V7QD 3KOWA 2CVFA 4TVKA 1Q95A 2JG3A 4RVFA 1UPBA 1QU2A 1I14A 1GCOA 2WWGA 1DFIA 2Q5HA 3M33A 1TADA 1TCBA 4NZNA 1G8KA 4XASA 4XQCA 5CLIA 2M9MA 2VPTA 5ALFA 3RVBA 3GT3A 3TBHA 1D5WA 3WC4A 5LMNB 1PSDA 1W52X 2G71A 1RRGA 2IW3A 3TAUA 3THRA 3QFTA 2B34A 4CM7A 3U7JA 2NU6A 4EB0A 3DCIA 4OEHA 4BCDA 2AYZA 4P08A 4BWGA 1AWCB 4L8FA 1LWOA 4FOPA 4V0OA 3TE6A 4WOPA 1VSVA 1T4CB 4NBTA 3ZBUA 2ABWA 3CNOA 2OD9A 3H11A 2NU9A 3F97A 2DHEA 2D54A 2WJIA 2VJLA 4KH1A 3LTEA 3GJ4A 1CY2A 4FKZA 2NYAA 4DKJA 3VZSA 3JWJA 1PG5A 3OIDA 3FOCA 3WHPA 3RWBA 4CEJB 4ZOQI 2GO1A 1V8DA 3TWRA 1AS0A 3ZWWA 4BN0A 3BXZA 1NU8A 4HWOA 4ENRA 3UAYA 2Z3WA 3F9IA 3L8FA 3NXSA 4UNQA 1N6NA 5CFLA 2REBA 3L6CA 2J07A 3HXPA 3M6XA 2V5QC 3MWLA 4LRYA 1JN0A 1HT0A 1N9ZA 3U7RA 3R40A 2AVDA 1OWMA 3L7CA 4QA9A 4G0VA 1T4GA 1V35A 2YY7A 1DJOA 3HB7A 3KQWA 3MLEA 4I50B 3UWOA 4DZZA 1EZZA 1JZQA 4QPDA 1HTWA 4XM0A 3DT9A 4Q3EA 4ZEVA 5FHRA 4K8OA 3AR6A 1WNFA 5DNWA 1G3UA 2BIFA 2ZTVA 1I4LD 1OSNA 2V9PA 4JVNA 4KV7A 4MO9A 2W9XA 4PXAA 2W6NA 4NHEA 4ZVVA 3AB8A 3MAAC 1BW9A 1P5FA 3DVQX 3RD5A 4J8EA 1BXRA 1BWQA 5K7SA 5FR2A 1GTVA 2LXLA 1YDFA 4WOBA 2H7VA 3BAZA 2OCYC 4ND7A 3STXA 4AZ0B 2CV2A 4P4UA 1E1CA 3E9MA 2CL6X 2D0DA 2NW6A 1UKCA 1BRMA 3FOWA 5AUQA 1YUMA 2J31A 3CM0A 4J07A 3AJDA 1UINA 1YUNA 4PX3A 3TZQA 4ZZ2A 2VWPA 5D3MB 4HP8A 3UH1A 1XLUA 1W5FA 4NOMA 2ZULA 1UAAA 5DLQC 5FPTA 4QQIA 1NJ1A 2RAPA 4GI5A 1SG6A 1T36A 5KNBA 4GGMX 5EL0A 1C80A 4R8MA 3AOEC 5CT4A 4GP7A 1Z3YA 2Z4RA 3PDHA 4CFSA 1O8CA 1QU3A 2V8BA 2IYWA 1HTTA 3IAXA 4CIAA 3AESB 1IYGA 3P7MA 4HK4A 1XDGA 3O4RA 3P0IA 2OV1A 2V0GA 4FDTA 2E2EA 5GTDA 2QMEA 3QFCA 1YCSB 4P36A 1X7ZB 3H6HA 3ZXXA 2JCXA 4MGEA 3ZFWA 4V0NA 5BWLA 3LK7A 4CI0B 2VQFB 3BAFA 2V7WA 3AJAA 4LNHA 1UIRA 3FPCA 3QLVC 4JHKA 3V3KA 3F96A 2I9PA 4ZC1A 3HKDA 5JJLA 3L0YA 3PDIA 3STWA 1KI7A 4AG6A 4JJ6A 2ZSEA 2B2NA 3H5LA 3OQVA 1T9KA 4DX1A 3DP9A 1KXJA 2OYCA 4ZFHA 1M74A 1K89A 4OUDA 2DR2A 1T5LA 1N2CA 4V39A 1TYEB 1L4EA 3MTIA 1LLCA 1YB1A 4X63A 4ZQGA 1SUDA 3WGZA 3EFEA 2I6QA 5AUNB 1PYOA 2FEKA 2JFQA 1PDOA 1W73A 2G06A 3UWKA 3BGWA 1RVV1 1N8KA 3GH3A 4FQ5A 3BTVA 1FMFA 2JIZA 1Y8RA 2AL7A 1J97A 3FDFA 3IMGA 1YJXA 5TS2A 4ENWA 3QA9A 3NWJA 4ENSA 2W90A 1ZAYA 1YJ8A 3NU1A 2KBXA 3AFHA 3QMVA 4JOBA 1V8BA 2X6JA 3PHIA 2FZVA 3ZYKA 3KQTA 1CUIA 2QTBA 4ACLA 3TCXB 2YWJA 3G0HA 3EIWA 4I4TA 1HDGO 1IVYA 1SVWA 1U3TA 5ADUS 2ID7A 2WSYB 3E7FA 2C9YA 4NG5A 1RQ2A 1WD5A 4PLHA 4Q9IA 3FTZA 3DQZA 1X14A 2O07A 3NB0A 4XWAA 2JGDB 3DVRX 3RTDA 5B6PA 2DM6A 3FCYA 5HJ7A 3ZE2B 2RHTA 1GPNA 5CFNA 4G25A 1JDZA 3U4DA 4XVCA 2X19A 3DV9A 2W6IA 3ESDA 1LVGA 5LOVB 2XOKD 4TYQA 3IDAA 3NHPA 2IU6A 4AULA 2CVZA 3B3AA 5J2TA 4TXPA 2ZUWA 3S1LA 2C2OA 1SWWA 2WUVA 3OCUA 4MS3A 3U9TA 4COOA 1E7QA 3GJTA 2B1QA 1TK2A 3ZTYA 2JJMA 3AJ8A 1GTJ1 2H1SA 3VKHA 1NMQA 1OC4A 1VJTA 1D2HA 5B58C 1MB4A 1BI8B 1P2VA 5AJLA 4KQMA 5HE8A 4Z1MD 4CRWB 5MDHA 3WGYA 4FNMA 1AV7A 2A94A 4KH0A 5BQFA 2XMPA 2OHHA 2VHQA 3AK4A 3D43A 2G0NA 4E5YA 5THXA 4J91A 4KE8A 4IF4A 5KUTA 1F6WA 3WLNA 2RHDA 2ZJ7A 2C9DA 3I6QA 4YXFA 1F12A 3MCUA 5JTUA 1P74A 4KQ6A 2EGUA 4KTVE 3VNBA 4JKOA 2WTXA 3FCUB 1N6OA 4R16A 821PA 2H1CA 2ZXEA 3R1IA 3QFFA 3DEPA 1WF3A 5KDLA 4XRGA 3V4VB 1ID8A 2CXXA 4M9CA 3L22A 2B0CA 4PUCA 4BY9E 1C9MA 3HA2A 1P2TA 1XD9A 3BFPA 2H2IA 2O20A 3IUJA 3P9XA 1CG6A 3QEKA 3QVGA 3HYMB 1D6MA 2XKBA 4YMVA 5ITVA 1E3SA 5HSGA 2Q1SA 1ESZA 4E21A 1RM4A 4W5QA 4Y18A 1ZL0A 2FSVA 1VKJA 2W93A 3B6MA 2XPYA 3FU0A 4GUAA 4TLDA 3ZCPA 1NC1A 4OXXA 1DX4A 4DZTA 3I4CA 4BRZA 1R7RA 2QX6A 1YQEA 1E2GA 4OQXA 1T15A 4RDHA 2RKOA 4Z9AA 1ANKA 1JKXA 1Z8NA 3PFKA 4BQFA 2JJ8A 4EIWA 4TQGA 1VKRA 2WWYA 1KKMA 3G89A 5A71A 3IUEA 4YASA 4OYHA 1YVDA 1ZM7A 3AF3A 1KH1A 3QF7A 3N28A 4LYHA 3SYTA 1JFTA 1L2TA 4YGXB 4OGFA 2VH1A 4JT8A 4WASA 3IB6A 4AZ3A 3INGA 3HDXA 1EB9A 1HZZC 3N87A 1THGA 4FOTA 3IMFA 4E2YA 1AH2A 4GRAA 5E4YA 2QVZX 5KREA 3AUAA 5BSEA 2JGJA 1JFSA 3UGTA 4PYKA 3RQIA 2A35A 1GKIA 1UKZA 1A7JA 2DYRE 2PKQP 2X7HA 4YV7A 1F60A 3NYRA 4GXRA 2DQ4A 4N5DA 4LRQA 3OZTA 3O8RA 1ICIA 2ZIGA 4P38A 2FZ4A 3LY5A 1PJ2A 2IYUA 3ELUA 4JMLA 1USGA 3HU2A 2DPGA 5CG2A 3BEDA 5AK3A 2HA7A 3RU7A 2ZI5A 2NU8B 1DLIA 2D2IA 3TECE 5EJ5A 1BAPA 2VGYA 3M81A 4EI7A 5JXWA 2KW5A 1Z22A 1USVA 1ZJ5A 3AZOA 1KZYC 1Z2AA 4S05A 4GZDA 5FAXA 2HT6A 2NP7A 3M5DA 4WKBA 4OX9B 2ZGDA 2G76A 4XJTA 3I8OA 4M1EA 1E7UA 3T52A 1YR6A 2VRCA 4J0JA 3G2SA 4BS9A 4YRPA 2HA4A 1RAAA 1Z4PX 5A4AA 3DBSA 3QH4A 5IBRA 2EJTA 1FU7A 1SIOA 3CKMA 2X2OA 4FYVA 3RFTA 2IS4A 1V71A 5CM2Z 4BB0A 1O0CA 2IEYA 2C94A 3PNOA 2L42A 5KDDA 3J81k 1VSQA 1IXSB 3CUSA 3DE7X 4G85A 1V8OA 2JFPA 5IWCA 1ACMA 3VUFA 4UEOA 5LOZA 2GD0A 3RHFA 1WZNA 1JF8A 2QTVB 3I9MA 3V4OA 4Y67A 3WWDA 4CUZA 4ZCIA 3AR7A 2A5EA 4KN6A 4PPFA 1Y1QA 2FF7A 3ZUGA 3Q9UA 3EVZA 2ZPTX 4MSUA 1UG3A 3U4HA 3NV7A 3KPUA 3MRVA 2GRQB 2JFBA 2ZE8A 5CPBA 2EF1A 1PT6A 1VL2A 3HZRA 3SNHA 1E9BA 4RQUA 1CJTC 3GUZA 5I8PA 2QMHA 2ZJ1A 1SKYE 2AR9A 3L6DA 4MVJE 2XAAA 4R69A 4ZEXA 3UJHA 4YDYA 1BWSA 4D3YA 4EG0A 4KQFA 2H6IA 1EQUA 3D7NA 2PH7A 4G0YA 4RGVA 2QRLA 1F14A 3NAGA 4GYJA 3RFUA 4HJXA 4EK9A 3KT6A 3A6JA 3H1GA 4ZD6A 2IEDA 9LDTA 4I9EA 3JZDA 5K8TA 2X5XA 3KWJA 2HXGA 5JS2A 4JV5B 2P40A 3NHRA 4PDXA 1SC4A 1KI9A 5C32A 1NUSA 5CB8A 2MHKA 3QKSB 5KVVA 1G5IA 3V5NA 4YRTA 1CS0B 2C0MA 1ZGBA 4K3UA 5EUQB 1R4MB 3T9AA 4RMIA 4IINA 2H2AA 2VDJA 3LNCA 4PWZA 5IHXA 3GLFA 1CB0A 1IUNA 2V58A 5DSXA 4L1BA 2H6HA 4LE0A 3UHOA 5JQGA 2PU5A 3CZAA 5EZQA 4CT5A 4EYKA 4PS3A 3ZOKA 4GX5A 4BLVA 1QDLB 3JATB 4BIMA 1BMDA 1QE5A 3B9RA 3WK5A 3NDBB 4WAUA 3GROA 3VPDA 2ISCA 2FQXA 4BMDA 2X6KA 2TECE 1KJZA 2WUDA 4MW4A 1U1GA 3F49S 1EK5A 2ID8A 4L3VA 1E1QA 4PS7A 1DEKA 5LZ7A 1LI7A 2P1RA 5F9MA 1BG6A 1G42A 2AXPA 2IGBA 1YR2A 4FHCA 1EDDA 1T2NA 1W48A 3OJOA 4U7GA 1XX6A 4WGGA 4CG2A 4RJJA 1HK7A 1SQ5A 3QBTA 4NVRA 3CPEA 4Q96A 4MTCA 4UTNA 1U8AA 1W93A 3ZQJA 4DSAA 4EG1A 4H7DA 3P9PA 2RONA 2YHBA 2IXTA 4EG6A 3TVDA 3MCWA 3ZVVA 3LPMA 1HSZA 5AJHA 1CX9B 1E2PA 3U7GA 1TJ4A 1T5TA 2VHWA 1QOQB 4ZOLB 5JAHA 3HJRA 1DGQA 5FOXA 2PIDA 2UXDB 3B6JA 4CGYA 2AH5A 3CVJA 4WVFA 3TTSA 3QELB 1Z06A 4Z9YA 5G0WA 2EWMA 4IOJA 4WY5A 3W6OA 2XENA 2P75A 3P0FA 4GI1A 2VQ6A 1FBNA 1TYBE 4NPCA 2PL9A 3I0MA 4TWBA 2FETA 1L5JA 3VPGA 5DT9A 1DUSA 1IZ0A 2CDAA 4F2PA 3ZBTA 1KI1A 5IJ0A 5ELXA 3RR2A 4JI4B 2CFSA 1QBQA 3FUMA 4GKVA 2QAGA 4Y8VA 1II8A 3HCAA 5TR9A 1JZSA 4J0DA 3WK4A 4ARZA 1QSGA 1MOZA 1OWLA 1P0IA 4WWOA 2AJBA 1NPTO 3LKBA 3PRHA 4QHYA 1TN6A 3R7WB 1SBZA 3PUJA 2Q1UA 3Q5DA 4MIEA 4V02A 4RULA 4RVHA 2YOFA 4FHKA 4LXHA 3N3BC 4RDXA 1PJ4A 2NWQA 4OKSA 4IGIA 5I9MA 4MV8A 1WU8A 3IA2A 4O2LA 1XTBA 1XZDA 3O93A 4UAGA 4ZO7A 2HO5A 1LLFA 5JAZA 1NG9A 3LQQA 3FHOA 2J7PA 3KXDA 3LUBA 3AM5A 3NXKA 4K6CA 4WZBE 3WSTA 3CX4A 2FRXA 2HRBA 1EAMA 5A03A 4W5JA 2JJ1D 4G89A 4HV4A 3FZYA 3E4BA 3NC1C 3KT0A 5D1HA 1WJGA 1XXLA 4B40A 1XHLA 5F2NA 2PS9A 4I8DA 5AKLA 1KY4A 5F7JA 5BSKA 2DOKA 2XGSA 4TXQA 3SHVA 2J7PD 3M6AA 4BO5A 2QRUA 1TCCA 4O2BA 4YCAA 4YC7A 4P3YA 4EUEA 3T1HB 3CE6A 5DTEA 1A9TA 2WAAA 4B8AA 2JH9A 4D57A 1L5WA 4EFLA 3K6SB 3QU9A 5HW0A 1K3ZD 1EX6A 5LKRA 1L7QA 3GFQA 5IJ9A 5J1SB 3ABME 1MVNA 4JWKA 1TLFA 2GEJA 2VS1A 3D3EA 2WBLC 2PMEA 4DLVA 3NANA 1J06A 2BEUA 1QRUA 1L7AA 1HF3A 1Q22A 2D5BA 4HEHA 2UUPA 4E85A 1DAKA 3A6HA 2H59A 1XJ0A 1AQNA 3DOHA 4ECEA 1UBCA 5LP0A 1D2GA 1H0KA 4CHTA 1AMOA 4W6ZA 1KMCA 2XT0A 3SAJA 3T5DA 1UC4B 3CX3A 5KQMA 2ZRKA 1KXZA 1H4SA 4PGGA 3FHJA 1KKUA 4CKCB 1IHBA 3G5LA 1U5BA 3BN3A 4BE7B 1XNRB 3SX4A 2X1HA 1OBOA 1MPTA 2N0SA 4Y2QA 5WRFA 4BL5A 4EF6A 4Q24A 1E7MA 2VATA 3S2YA 4DV5B 4ITVA 4D1YA 1R0SA 1HQYE 2ZTSA 3NKFA 4I1RA 5AW9A 3T1TA 1XZMA 2XTZA 3MS4A 2IUUA 1IPHA 1EP2B 5ESXA 3UPDA 4Y2TA 4BASA 2EKLA 3OFND 3NNNA 3SY8A 3WHIA 1YFLA 4UHDA 2QD1A 1UANA 1G3NB 3QMWA 4K6OA 2BGGA 5E9AA 2WU4A 5LJIA 1FTNA 2VK2A 3IO5A 3HMKA 4WN3A 1HNWB 3IIMA 1C7IA 4YVQC 1R0KA 2FYTA 1CR2A 3AI7A 3QWHA 3K4PA 3K6KA 4FMPA 4M98A 4M9RA 4Q3AA 4YHBA 5F2KA 4C0HA 5A0VA 3C1UA 3MINA 4D97A 2I4TA 3GVCA 3SMQA 2BFDA 4BBAA 4XX5A 3F3YA 5L51A 4DPLA 2XQ0A 2B0OE 2C92A 3OOYA 2BI7A 4GCNA 2EEZA 2GDZA 1MF7A 3EDMA 2IXGA 4A5SA 1OUVA 1OX4B 1UT8A 4G63A 4UXJA 2G9ZA 3WISA 5A9TA 2ZS9A 1LDYA 1PWZA 3DLIA 3HKBB 3ZQ6A 2R59A 3RC7A 4UNPA 5FBLB 4FX5A 4CG1A 5AYWD 2XNHA 4G84A 1P5QA 3W7VA 1ZU2A 1F2UA 2O54A 4BSZB 3EUFA 5CYOA 1MHTA 1RNLA 3KZCA 1GPBA 4B7ZA 1U8YA 3SF0A 4A03A 3CH5A 4MP8A 3ZNQA 1T1GA 4RVBA 5FBZA 3KX2A 3HCOA 1KS9A 2WVIA 1I2BA 1XZCA 3WZLA 2RG8A 3U7EB 3OWXA 4WBSA 4CV3A 1H2WA 1PYGA 2R66A 3U4IA 4GLLA 4O1IA 4R4JA 3EGIA 4XEUA 3GLRA 5DZSA 3T61A 3ZGNA 4KCGA 5B2ZA 4N5QA 4IV5A 4MCAA 3T9DA 2RAFA 2P5TB 4JUAA 4YUWA 2LIVA 2LUHA 3TL5A 3GJXC 3LZ6A 1B26A 4PS8A 3PITA 3HG7A 4HXGA 3D9PA 4AECA 1UZMA 2MIIA 5CD9A 1IXVA 4KQEA 3OJLA 4F2DA 1G41A 1LV8A 4R2MA 2BKAA 3VNRA 1OXKB 2G04A 5EXSA 4UMDA 4XZ3A 1FK8A 1LJUA 4YJ2B 2F8YA 1LRJA 3BK7A 3FYCA 4LBYA 4X7RA 2Z5VA 2LSUA 3AHEA 4TT3D 5BRNA 2BBTA 3JWEA 2P1DA 3LVFO 2GEVA 5TF4A 2HPHA 3RVRA 1DEAA 1Y4ZA 5JO0A 1F8XA 4ZRDA 4P2BA 5FLEX 2WTAA 1I3KA 3BH0A 3M70A 4RNCA 1JEQB 4AJLA 5K8LA 3D4NA 4KNYA 1FRZA 3MCTA 3GZJA 3VZDA 4KN9S 3QOUA 2QPOA 5GY7A 3O21A 4MRNA 1NF3A 1RCTE 2X8WA 3ETDA 3L01A 1CF4A 4O2AA 1XEXA 4RJIA 1UQRA 4UWFA 4EF5A 2BDUA 4G1UC 3RRYA 2GN6A 2E4XA 5DLDA 3IJ5A 3ECSA 1N6HA 1Q7RA 4EBFA 1GFSA 4DSTA 1GU0A 4F6RD 1K4YA 3KYIB 3RYFB 1W7AA 2FR8A 2VOJA 3RRNB 2ODAA 3KL2A 2OQRA 3BWCA 3O1JC 4G8JA 4OHBA 4URFA 2Y4TA 4F97A 2P0EA 3VKUA 4J2TA 2W98A 1RE1A 1ZD2P 5A04A 2UUBB 2JHFA 2OOSA 4YPVA 3T12A 3H2SA 4RIGA 5AQ7A 1SG0A 4RH3A 4WUVA 3RYFA 4E08A 4CEIB 3IQFA 4KBFA 5G04C 1CZRA 1ZVMA 4R5MA 2LKCA 4F4DA 1LPNA 4MS6A 1A8IA 2R6HA 4BXOB 4IZHA 1C4OA 3UXEA 2EQAA 4GI2A 4X1YB 2IXAA 4F3KA 4ZV4A 3MT9A 3C72A 4N7MA 3Q87B 5JMTA 1XMXA 2RCYA 4QXQA 4JYCA 1NXQA 5J40A 1B8OA 1GA6A 5C34B 1PV4A 2PZAA 3BQMB 2XECA 2CN1A 4FHFA 4I99A 2HU5A 1GOTA 5G0TA 1E1QD 3VSAA 2VPXA 2B7BA 3GV0A 3FDZB 3ZDYB 5ISMA 4OKNA 2ZWOA 4OU5A 4XPZA 2XGMA 5G40A 3TRJA 3VO1A 5K4GA 1YU9A 2DWOA 2NSHA 3D7RA 3RUDA 1HDRA 2KMLA 4EW3A 1AVTA 3PCTA 1W36B 3FHEA 1NOIA 2XGGA 1YQ9A 1J2TA 3OQIA 4L4XA 2CYCA 4GPEA 1AQUA 3GJ0A 3SI5A 1SHKA 3AUTA 5IVDA 1BD4A 2JCBA 3ICVA 2VI5A 2Z3ZA 3FNRA 3DUWA 2PRSA 4W9NC 2O2XA 5AOVA 2XZTA 3UAVA 3IA7A 3VAZA 3WLOA 1TFUA 3EOZA 2LV8A 3KKQA 3QKSA 4J16C 5A02A 3SIPA 4TGLA 5E3JA 4IBOA 221PA 4ER0A 4YCSA 4C87A 4WCFA 4PG8A 3P9IA 2R79A 3QZUA 2G17A 4JD5A 1GZHB 4EPTA 3GLFB 2R6FA 3KCQA 2VPIA 1N2ZA 3L8EA 1CXZA 2HSGA 2WIAA 2QQEA 4LXGA 2I3ZA 4OIMA 3SOZA 1XVUA 2O1WA 2C4KA 3BH7A 1LH0A 3WFIA 5FOVA 1C9KA 2Q6KA 1P2UA 2E49A 3OCZA 3RABA 3S27A 3VMMA 1NKSA 3AUXA 3FGNA 4YO7A 1T8WA 1B74A 2LPMA 1KAGA 3ZHBA 4JJIA 3EU9A 4P4TA 1DHTA 3RIEA 3EARA 1IEWA 3C24A 4GR4A 2YYZA 1S63A 2CNLA 3JQBC 4B33A 3DOJA 1WABA 1YRHA 1NZJA 4YACA 1QK4A 1JQ5A 5EERA 3SBSA 1YDGA 1VCOA 3JD2A 2XCQA 1N8SA 2J3LA 2VT6A 5FADA 5HF8A 3LJKA 4GOMD 4RKEA 2J5KA 3VR6A 2GDJA 4KXVA 3QBVA 4ZHQF 5ICMA 3N86A 1FUIA 2DH5A 3OTWA 4Q9LA 3BJIC 5CNIA 4C7XA 4EHIA 2WJ4A 2ZIXA 2WYHA 4CIWA 1QGAA 3K15A 2FZWA 3PD1A 1D7AA 2FOIA 1TW3A 2G5GX 5CCLA 2GVZC 1M1YB 4QTZA 4UATA 4UMVA 1C0IA 5U4QA 4M1ZA 3ESKA 3PZ2A 1G8HA 2D3WA 3KLBA 4BNVA 1FFSA 4D9CA 1SKYB 4LYGA 4QDOA 1Q21A 3EEOA 3OCWA 1FB5A 3BVPA 1ZUIA 1JDVA 1FMJA 2QN3A 3IXQA 4K5QA 3EZGA 2ZXWE 4UE6A 2OXTA 3OLXA 3EXG1 2HCBA 3VV3A 5IT5A 3OOHA 3S81A 3AR5A 1CZKA 2BRUC 3JASA 3T9CA 3TIGA 1OZAA 2B36A 3UUFA 4UTPA 1K08A 1ISHA 3MYRA 1K75A 4HYTA 1HQDA 2H7XA 4A10A 4ZT5A 3WFJA 4RO0A 1OTHA 5IAAA 4I1OB 4FZVA 3GRCA 5AK4A 1XZJA 5ALIA 1J4AA 1OREA 3ED1A 3LVQE 4FYIA 4PFSA 4WW0A 2G70A 2XB8A 5LQNA 4YB8A 5IC6A 4ISBA 1X8JA 3HP1A 5GVSA 2J9GA 1U7DA 1SQ0A 2FRDC 4E5MA 2PZEA 3PXAA 4D10C 3TSOA 2FB9A 3N70A 1F7UA 2LVBA 4YFYA 4B43A 3AH8A 1MC4A 3TQHA 2W58A 2DBYA 2PWZA 3BG5A 5FINA 3JU3A 3R8XA 4A5OA 1MGOA 5BV8A 4FGLA 3WYNA 2DR3A 1HFKA 1XKLA 3PC2A 2VQ3A 1NVUQ 3EF1A 3H2IA 3NUGA 1NVGA 1T9GS 1U7HA 2FPWA 4G0PA 2DY0A 4K9KA 1U9JA 2Y71A 3KAPA 1RRPA 2D0IA 3MINB 4JGGA 1QIKA 1J22A 1JUQA 4CZ2D 4IIVA 4X91A 4B75A 3OFNA 3K8QA 1KEEB 3GFRA 3STVA 2C58A 2V6IA 2VYVA 3C15C 3WAKA 4EG7A 1FTQA 3KWMA 5K05A 2GAAA 1N5OX 2J1LA 3RU3A 1OZHA 3CGWA 5H1YA 4F3VA 3IE2A 3N0VA 3L7NA 1JFFB 4TLEA 5K6AA 1KEEA 4BYGA 3IL2A 1KDPA 4W9RA 1N1DA 4JJ7A 3BT7A 1Q91A 5BNZA 1J70A 2WXQA 4QUGA 3AF4A 1ZIPA 4MUAA 5JCJD 4RTSA 4ZIRA 4TS1A 2B4QA 2B8EA 2FA9A 3KSUA 3L77A 2AYYA 4KXYA 4YWJA 2IYQA 3V1UA 2CD7A 3PX7A 3CH7A 5D5PA 5LM3A 5DX8A 1XB2A 1NPDA 3B5JA 3BHIA 2QVBA 3AEZA 1COWD 3WLMA 2FMIA 4WN9A 4EPRA 5IDXA 5KNBD 5KWDA 1S8NA 3F6SA 4KNWA 1TXGA 1PK8A 5D6NA 1GFZA 3HP7A 3W9GA 4D9GA 1B6TA 3LBIA 4IZIA 4UBMA 5JC8A 5KNGA 2L6JA 1UOEA 3TKYA 3M6IA 4F6LA 3C16C 4RPIA 4LNGA 5HCUA 5E75A 5KKCA 3MKQA 1PEKE 5F21A 4B7AA 3DEAA 1CUCA 3RJZA 1Y8QB 4IHQA 1F51E 4MULA 5ENZA 1M7BA 4OQQA 3BWVA 2GPTA 2Z09A 4JB3A 3RROA 4LJAA 4MWCA 2QM8A 1R74A 2BSXA 2NP6A 3D9HA 2ZRCA 1WMEA 4N3NA 3HH8A 4JQCA 3UI2A 5JWRA 3ZK7A 4EPWA 1WTCA 2R751 5BSMA 1OVGA 3EHMA 4MQMA 2VAPA 5AN8A 1UK6A 4O4JB 4ZVPA 5JBQA 3AIMA 3H86A 2O0MA 5DCYA 4MPJA 5JLJA 4EZBA 1RHQA 2GR9A 2DUMA 2Y2VA 4NF2A 2Z4TA 1ZD1A 3VDXA 3RSGA 3GZSA 4J6IA 4CMKA 4RCYA 1P9NA 3A4IA 1EFHA 1GUDA 3N8DA 4ZT3A 3S40A 1DKNA 3BXPA 2VP9A 4RVSA 4DLNA 1XTTA 4ZYZA 5JH7B 5IVHA 3PG5A 2JRLA 2P9BA 4MB2A 3UW1A 1DU4A 4B0PA 4DVJA 6Q21A 2WTMA 4HLQB 2X6RA 4AKTA 5I5EA 3WQQA 2CLCX 4BRSA 5LYJB 3DJFA 1DTWA 4LSZE 1PS0A 1NMEA 2ZAYA 1JPUA 1N6LA 3CH4B 4RKQA 2HU2A 4RLSA 1KZOA 1G4HA 4RAQA 3CBGA 2VJPA 3DZHA 3K9IA 5DGIA 2FR1A 4HS4A 2BM8A 1W76A 1NWHA 2CZGA 4MQEA 3UMRA 4EJ0A 5ANRB 4PX5A 3WMWA 5TPWB 1WXIA 4E32A 3ZWVA 1WD7A 2EWVA 3SC3A 3U3MA 1OLXA 3FKSA 4P7JA 3AT1A 4QEDA 3WKAA 1NJSA 1G2OA 3EPHA 1ATIA 4ZOEA 2RHJA 4B9EA 5HRUA 2HLHA 2RGDA 3NHBA 4M8KA 3ZHTA 1ZKMA 3K8YA 3ONLA 4Q19A 1B1CA 1OIXA 2C57A 4YT2A 2OVBA 1HYQA 1N1EA 3BZWA 2PUWA 2FFBA 1G16A 1E6LA 4P31A 1AB5A 1GFWA 2V59A 3DBVO 3H05A 3LLCA 4F5YA 4ENVA 3QPWA 3OT1A 2AV6A 3OY7A 4LN1A 3VJMA 2IQIA 1Y1LA 2QRHA 4FSXA 1YDWA 4ERXA 3NJ8A 1WKCA 2Q4RA 1SHJA 3ZWXA 1RJFA 1QAOA 2NSLA 3BERA 4WCDA 2WQHA 1X86B 4PAWA 1MU0A 4CMCA 2W2KB 4BETA 4BSXA 4N4AA 4DUZB 1NVEA 2DECA 4H3KB 3BG0B 4I3FA 1L5HA 3UT5A 3X44A 4CKXA 5M2QA 1EVYA 1QFYA 3D6VA 1XDSA 4RHXA 2DCPA 3ORFA 2XDQA 2ZE6A 4ND2A 1U0LA 4RZHA 5U4XA 3UKRG 1A5ZA 4MW1A 3LWDA 1ECFA 3ND8A 3ONFA 3KOXA 3AIKA 1RWKA 5D66A 1Q7GA 3LM8A 4G81A 4TSFA 4A0SA 4EGSA 1B0UA 1U2DC 1UEXC 2IU4A 1N2GA 1X3LA 5BT1A 4LYAA 3SC4A 3U4GA 3TOCA 1U31A 3NVKI 3D0QA 1Z37A 2BGWA 4G0OA 1E4YA 4MYSA 1Z08A 4QIHA 3H5RA 4X8LA 3AFMA 1VE7A 1QYXA 3BMXA 3GGSA 1W5SA 5KYTA 3UCFA 4TWRA 4JLNA 4TSFD 1X39A 3HR4A 2ZJ3A 1JDUA 2PT9A 1XZBA 1TCUA 4ZEMA 1AKWA 4CDNA 1AQIA 3HVJA 5FPSA 3PHHA 5I9IA 3D3KA 1XLTA 3LA6A 2KM4A 2Q4OA 1X19A 2RHLA 5K51A 5A4DA 3ANLA 1NOJA 4KB5A 1W19A 2VO1A 3VU9B 4EUNA 4ZI3A 5K01A 3DBLA 4OH7A 4LYEA 4RPGA 3SPXA 5AJYA 1X94A 3G5TA 3KAJA 2PUAA 1PJLA 1XF1A 2PGJA 1E63A 2JB9A 2GA8A 1X7GA 5AKIA 1Q1ZA 4H1HA 4AQDA 4Q03A 5B1AE 5IT0A 1PQWA 5INTA 3FN4A 4OL0A 3H2KA 1K7YA 3G49A 2X7JA 2XT6A 3FH7A 2YC4C 3DBRB 5BMVA 1ZR4A 4KFRA 2B94A 4ZCLA 1NYLA 4UPDA 3SQLA 2WOOA 1DV1A 3Q3EA 5EMHA 3DTYA 3HYSA 4UUCA 3IQWA 1BW9B 1G2QA 1I4TD 1KFJB 4MS4A 2XPIA 1T1EA 1NMYA 3MRSA 1VLMA 4HDCA 3ADCA 1EI9A 4IQ8A 2NU7A 1PT8A 3MHTA 2CXHA 4MAFA 3DUFA 3DFUA 4RKWA 3SHFA 2WVGA 4IVQA 4YRJA 3T06B 5K6TA 1OH6A 4X6LA 1INLA 4EGFA 2CXPA 2HU7A 4MS4B 3KLNA 3SP1A 3SEQA 5DLYA 3RRXA 4Q69A 1P2DA 4TYWA 5D2MC 4R1MA 1YZTA 3ANYB 5I7SA 1DARA 2HSZA 3U3JA 3AWIA 1NJ2A 4Q3OA 3EOAI 5LN1A 3ZJVA 3DOFA 1BI7B 4PC7A 5AI4A 3B1JA 4Z0NA 4IX1A 4ENPA 5BW8A 1T6YA 2EKDA 3PUKA 2GBLA 4L0QA 3TD2A 2ONDA 1R5NA 2J8ZA 3DEHA 3TEJA 3QWWA 1F6DA 2EGHA 3W9YA 2IVZA 1OFUX 3BIOA 4DDWA 1C1HA 1NBWB 3HGMA 3UTDA 3K92A 3IHYA 4JJZA 3QK0A 1DC4A 1AUXA 2OBLA 5KTPA 1DDIA 2BFCA 2R8EA 4XLZA 5F1YA 1H6PA 1NLYA 5T64A 3THSA 3W1VA 4E94A 3ISMC 5ALVA 4MI9A 3N5CA 4WBNB 4YFVA 3DEKA 4C1NA 2CNOA 3COVA 5DASA 3IAS1 4J1SA 3EEFA 1GSAA 3ZIDA 4GTTA 3SIXA 2A5FA 1A7KA 3AEKA 1XTZA 2ZRGA 1EBBA 2XI4A 4TV9A 3P2KA 2CHEA 5AKGA 5BO5A 1SCJA 5I7EA 5KJ6A 2IE8A 4MEJA 3VTKA 1HZ4A 2EW2A 3OOSA 4UBLA 1TA0A 3K5PA 1P39A 4HFJA 2YINA 3T5MA 2YWHA 4FNAA 1FNMA 3BRQA 1ZIXA 2HGZA 4FULA 2P2LA 1ST3A 2R1VB 4FFLA 2UVPB 4J0EA 2PX4A 1R6VA 4UXHA 4YXWA 4LF7B 2ZJ8A 2AN5A 1EBUA 5K3AA 3DO5A 1HX8A 4EVQA 3WY9A 4F46A 1YZHA 3BE6A 3KR9A 2VXCA 4NURA 3R7BA 4XWKA 4PV7A 2HCFA 2OO7A 4YMIA 1XQWA 4XYGA 3TM5A 1YS4A 4RQBA 4XYEA 4R84A 4Z4QA 2LR0A 1B43A 1N5LA 3S4YA 1C8BA 1VHQA 1RBMA 2PZMA 1JA0A 5DMHA 4D2IA 1JHYA 3AY3A 3BK2A 3QNKA 3L1UA 2PKRA 4QARA 4D74A 2ONYA 5ETJA 3CKYA 4V03A 3VSEA 4LRUA 4HDMB 1XGWA 5KPJA 3WYBA 3D3MA 2JABA 2WINI 3ZW7A 2EQBA 4EG3A 3PDUA 3IQIX 4LF5B 4AY3A 2WV7A 3FGZA 4KQIA 4IJMA 2AOXA 1LF8A 3LG2A 1HO8A 3SZLA 1MX6A 1ELOA 1T2DA 2R6JA 4RM2A 3SLGA 1WKVA 2P3LA 1K8ZB 5EUBA 4HPJB 3U17A 1JR3A 1SOUA 2ZJBA 5HF9A 3PZDA 2PX8A 4U9HS 3FWYA 4M55A 2IYXA 3DMGA 3NRBA 3EH2A 3F6PA 1C9DB 3RUPA 4C7OA 3W9UA 1IQ0A 2ILTA 2NUAA 2HMTA 3GYGA 1NJ6A 4RKYA 3TXAA 5IKEA 2B9EA 3KVVA 3TAXA 1R00A 4INAA 5F1PA 3F4BA 1N6KA 1TUIA 2I6XA 3DH0A 2IYNA 4LF6B 4U7DA 4DCTA 1YGYA 2OLKA 3I28A 2YQ8A 3EHQA 1IATA 1S3IA 1ZCZA 2CXQA 2OLEA 3PXCX 4NFSA 5ES4B 3DWIA 2PJUA 2V54A 3LCAA 4WFIA 1JEYA 3K3PA 4KBQA 3ZV3A 3LUKA 1AKEA 1VE3A 3W1EA 2C2KA 2W2XA 5H3HA 3NMUF 2MSLA 3A3YA 5EZ6B 4GH5A 2NZUG 4AZTA 2FWAA 4U7WA 5EPOA 3IR5A 3PF8A 1OI4A 4PSVA 1BXZA 3SY2A 3P45A 2CHGA 3WQSB 1EWKA 4E5DA 3PYMA 3DLAA 4M21A 4KX5A 1KP2A 5BSVA 5HM6A 5KNLA 4NYMQ 1FZTA 3GG2A 4F1KA 4WTOA 1MUUA 4R9RA 2JJQA 1R5BA 4HSGA 2JFXA 4FYPA 4ISCA 2PQNA 3D2LA 5D51S 3RBZA 1EA7A 3V9PA 4OOFA 3S8YA 5I6DA 4B82A 1ZITA 3OQOA 4WNDA 1I9CA 3CHRA 1YYHA 1XJQA 1ZCFA 5DX0A 3I2GA 4Z4CA 3DSWA 5FBWB 3L8GA 2FX2A 2JATA 3DSTA 3NATA 3PFNA 1IM2A 2B9VA 3RIYA 4LDRA 5TMDA 4YAIA 4BKOA 5IVKA 1IB6A 2ERCA 3RU2A 5BR1A 4FWTA 3NBKA 1KZ9A 4PG6A 2NAFA 3VDRA 3I6IA 4I4TB 4P7BA 1H2ZA 1M10A 3CX6A 2DIWA 4DA0A 2J3JA 4ZU6X 1H6CA 5EXDA 1PX2A 3F5MA 2XTMA 2VBFA 1UK8A 2E4ZA 3F4LA 1T91A 3DDWA 2ZRNA 3ZX5A 1GUFA 1QHNA 4L9SA 3ZCTA 3SLRA 4I8IA 4XX0B 1PL7A 4BQPA 3VZCA 5FOSA 4NPHA 1G59A 1KZ4A 4PPNA 1PZNA 3GBPA 5CFQA 4DLUA 3GLIE 1K9SA 5CP8A 3UKOA 5SZJA 5I47A 3FULA 1RYHA 3CJRA 3K53A 2QTWB 3DAPA 3L7AA 1DADA 4H1UA 1VZ3A 1P7PA 2H4YA 2QUBA 2OGUA 1OPXA 2DWQA 2ZOSA 4S1WA 4D9HA 4ME6A 1XAIA 2VDWA 2QRZA 1BA2A 4B31A 2RGUA 3RUEA 2RMKA 4F9FA 1B2RA 1NQWA 4FJ1A 5BUSA 1M1NA 2FEMA 4OHKA 5JVDA 2GT1A 4OCZA 3RKSA 4M1WA 1U1CA 1DPFA 4YK7A 1TU3A 1UAGA 2V45A 1F8YA 4GI3A 1T6BY 4XLTA 1FSPA 1G4AE 3WBJA 4KDFA 1T10A 2P5SA 3OF3A 3PVZA 1F2VA 2I6SA 4M46A 1L5LA 4AC9A 2GYUA 2GPYA 4BX3A 5AKJA 5KKAA 6LDHA 2HHHB 3ETCA 1GCUA 2VSOA 2BMFA 4UEJA 2KC7A 1CVRA 2GEUA 1DCKA 1VJ5A 2GN4A 4QVGA 5IDVA 4ECAA 4ES6A 3L4JA 2O8FA 3S2GA 1W4RA 1J8VA 3FYUC 5FTWA 3WXMA 3JVDA 5FAKA 3VJKA 2RGRA 2X4IA 3UMBA 4G0XA 3IEXA 3NZEA 3R6LA 3IDOA 3B20A 1P72A 4LBZA 2FW6A 1OXBB 4FDUA 2XKKA 3PC4A 4C0BA 1GV1A 2FG6C 3BOSA 1IY9A 3ME5A 5FP0A 4R1PA 1Z3IX 4MUYA 2PQ0A 1KHTA 5CH3A 4NBKA 3AF2A 4OUDB 4AM8A 5JPDA 4DLXA 5FRDA 3FDJA 3CR7A 3E70C 2P9HA 5ILQA 3K94A 1S64A 4OI1A 3L4KA 4PLCA 3WKEA 2VHUA 1O0SA 1XRPA 1W4BA 4HZIA 2ILVA 5IBCA 2G72A 2WSBA 2IUTA 4FSDA 1ZJ4A 2YZ7A 3ZDDA 4XQEA 1HZJA 3FWVA 1NY6A 2XVMA 3PGA1 3PNBA 5FWYB 2KQUA 3RHTA 5C1BA 1ZMBA 3C7KA 2J4CA 4U63A 1NUTA 1Z2EA 3BXFA 5LXTB 4YRNA 1FP4B 1N5JA 3HRKA 1L5QA 2AMVA 3KJFA 3H4MA 4CKZA 2QXTA 5EIOA 1XROA 4J03A 3TO5A 2ODBA 4XAQA 4JP1A 4K9RA 4R2HA 5FIUA 1TTQB 3FSGD 4D8TA 3GRVA 2COEA 3E0XA 2P67A 1OAAA 1I2AA 2SCUB 1G55A 2XXBA 4D25A 1PD0A 5EZYF 1MNQA 4WE3A 1R12A 2YWCA 4YDWA 3IXMA 4ALJA 16PKA 2ZSUA 2BGIA 4ME2A 2H07A 3D8SA 3BSWA 2XDWA 4L8LA 4XWYA 4NMWA 4ON9A 3TQCA 1KY3A 4K86A 1XA0A 2LRHA 3EHNA 5I3ZA 3V1TC 3TNDA 3ANNA 2FWJA 2EP7A 1NW8A 2L0TB 2VP5A 3HADA 4GLJA 1C3JA 4LSMA 1LI4A 4LY0A 1X42A 3CZCA 3JCKC 5KYUA 2AEMA 3GOQA 1QQ5A 3C6QA 2OA0A 3VHXB 1O95C 3MILA 4EQ6A 2QPLA 1WBBA 3C7DB 1QCZA 1A04A 2MYUA 3P2BA 5KJEA 3DSUA 2VK4A 4LOKA 4DQXA 5HCNA 4X62B 1IHXA 2R8YA 5FJJA 1ZD4A 1H2XA 4NENB 4OJYA 3PUIA 5FB3A 1V5EA 1QK3A 4G8CA 3UAGA 1E7YA 1K6JA 3TG2A 4KXFB 1KSGA 4ZJPA 2ARKA 1GZ6A 2FHSA 2PKCA 4Y2GA 4ZQIA 3TLGA 1J5PA 1GKLA 3FPAA 4FGWA 4JBHA 1BXRB 1CZNA 3ZHUA 4IJVA 4YRMA 5JXHA 4BJHB 1EESA 2I1QA 3EY4A 4R05A 1FDUA 3PUYA 4OAPA 3SZUA 1E3IA 3WWZA 4BFVA 3RI3A 3SNXA 1I24A 2FVYA 4LG6A 4CFZA 4WLUA 2WXIA 2H06A 4BO6A 2ZSAA 2VN8A 2NN3C 4HZUA 1CBUA 5AICA 1I01A 5G05J 3WWPA 5KTYA 3QYJA 2IUFA 2DBRA 3DE1X 4OJMX 5JU6A 4Q7MB 3C97A 3LBAA 3LLUA 1S2IA 1RC1A 1PHPA 3MZLB 3MV3B 2BONA 3TJRA 4C0JA 1Z6YA 5DCLA 4F2GA 1P1IA 4GM1A 4EKYA 5B3LA 2AA3A 1J07A 3AM4A 2CJFA 5AQ9A 4CI9A 3D54D 1PCXA 4KGVA 4N2SA 1K97A 3QKWA 2F59A 2H4JA 4H6PA 3IRVA 1Z47A 2X5OA 4RV9A 5CA1B 1Y1RA 1ZNZA 5LJLA 3L92A 4HDSA 4XB6B 4FX2A 3W5SA 1QP0A 2HKIA 4HUTA 5CA0A 3GHHA 5ITWA 4I46A 3NP9A 3DL0A 3HUDA 3R5HA 4IDCA 4EG8A 2G0TA 5A3SA 5JJKA 1X1BA 4KLCA 3GLUA 4XRRA 2HYDA 3FWHA 3A6KA 3PQFA 1BX0A 2BEWA 2C2WA 3N8NA 3MWFA 5DIFA 3T3IA 4HX9A 2GPBA 5B1YA 5DBEX 2NZ8A 5HBGA 3TYXA 2XKJE 3ORQA 4AF7A 3L1VA 1YONA 3IERA 2RKBA 3MTJA 4FQ7A 3OHPA 1ENOA 1NHGA 1LNQA 1R3DA 1QKIA 1KZPA 3L07A 3RNOA 2J0SA 4OAUC 1FTYA 4X54A 3I04M 2H9IA 1DRVA 5BSRA 4POAA 5D00A 3DXYA 1MVOA 1JCSA 1ZN2A 3LIIA 4Y9SA 1JPNA 5T4HA 3L16A 3TZHA 3ZHEB 3W2IA 1Z2OX 2F1OA 1D07A 3U60B 2QNBA 3NASA 3R8FA 1ZUWA 3TAHA 4NZMA 4XI9A 1J2JA 1ENYA 4QATA 4WESA 3WV5A 3N58A 4UBJA 5LZ9A 5EDSA 5EIBC 5ENOD 4D4GA 5IKPA 3DHNA 2A92A 3FB4A 2NO0A 1E3JA 1V39A 1CK4A 5DH9A 3TJMA 3HJCA 3TWSA 1RYNA 5C5CA 3NR2A 1XL1A 2PR2A 1J9EA 3QY9A 4MUGA 4ZP1A 5EE3A 5ALEA 2JBHA 3PT9A 5G53C 1R0RE 4L1KA 5KTKA 2D4HA 2BZ0A 1TRHA 3LJ3A 1A0OA 3AP3A 3M7IA 3ZLVA 1L9XA 2OB2A 4V0SA 1U3WA 3SI7A 5A5FA 3T1YB 4W8GA 1JSLA 3F9CA 4A1OA 1XXHB 1E8ZA 3N39C 3CJQA 4JJKA 3LYAA 2BD0A 3AVYA 2WMOB 3JWHA 2KX7A 1I1QB 5H4HA 4KQHA 4BO1A 1LC0A 3IQZA 1P5ZB 3QRWA 2OCDA 3M34A 1O9HA 4Z2YA 1OLOA 3T94A 3DMPA 3MGCA 1Q1NA 1YL6A 4LHYA 3FH8A 2Z8XA 1FT2A 4MV3A 2OB1A 3BWDD 4ARZB 4US2R 1HFWA 1SU4A 5T5QA 5KNDD 5J4LA 4LHVA 1BDBA 1R8XA 3L40A 2XWJI 3OETA 1Q3TA 1SCKA 1V3UA 1ARZA 2EX0A 1Y42X 5KEIA 1A72A 3CS3A 1TUEA 2IZZA 4IICA 3UJ6A 4CNQA 1Q0ZA 3OF5A 2BR4A 1Z33A 2YBEA 3BX1A 3IPRA 2WNSA 4H0NA 5EGSA 4ZJYA 1FU4A 1N57A 5HS4A 4NENA 1L4GA 4QNRA 4L8WB 5JS7A 2XH8A 3AKZA 2XT9A 4LF4B 4JJGA 2XNCA 3Q7TA 3R9AB 4GBJA 5CX1B 1XTJA 3IE1A 5CVEA 2C7GA 1G2IA 2GF0A 6ADHA 1OW3B 2IU0A 2DZNA 1YKGA 1YE3A 2G6TA 3VH3A 2ZUFA 5DI3A 2GZHA 4DCUA 1LI5A 2ONZA 1EDUA 4RSHA 3R7DA 5FX2A 1QH8B 1O95D 1U8TA 1Z5ZA 5J2TF 4L2IB 1SUWA 4GBMA 3ZCQA 3L8DA 2O2HA 1Y4UA 1QHYA 1JTVA 5IULC 3ZE0B 3F3KA 3E9ZA 3CF2A 1DJMA 4ABTA 1V3VA 1PQUA 3UOWA 1V6CA 1QZTA 2WC1A 5DRTA 2DUWA 4PICA 1CWUA 2DFLA 5BT9A 4DR7B 1R0LA 5F3DA 1HG2A 1NONA 3HL4A 1E9RA 3NIBA 3HWX1 4FADA 1KFEB 2OK7A 4FVTA 5A3VA 1DQNA 4QDKA 4NBRA 4D7AA 3EJNA 3HCDA 1E4VA 4OHRA 1GG9A 1MR3F 1N2OA 3PGJA 2BEDA 4EPZA 1AU9A 1F20A 3OOWA 5KHLB 2O5RA 1AKNA 3K32A 3QX7A 4PXSA 3G8YA 1E6CA 1KZ6A 1ZA1A 4GLOA 2YS7A 1E3TA 3CEPB 2OLJA 4JA0A 4QGSA 1ZJZA 4R41A 1W47A 2YIVX 3MWJA 4P7FA 5HGXA 3VC2A 1YZLA 1TK9A 3C6YA 1BJRE 3ZNNA 4UVIA 2BKGA 2PX0A 1G8AA 2C2BA 3DLCA 1Y3FE 3MERA 3PFFA 4UU7A 3UWSA 2FEZA 3WLRA 3ASUA 4XSGA 3GFPA 1X80B 2WWRA 3KZ1E 1HZZA 4GSKA 2X2EA 4ZT2A 2XZDA 3AR8A 1KS2A 2I8CA 5JDIA 3GFSA 2X5NA 5BSGA 4I7EA 1I7QB 1M3SA 1WUTA 4TTQA 2AQIA 2DLNA 3JALA 1SXJD 4KXNA 3GRYA 5FBKA 4DMFA 2QLLA 5TARA 4OO3A 4BVGA 4KHPB 2RHWA 1P6QA 1KE2A 3LX5A 4PHHA 4DV3B 1E0SA 1V3QE 2VNKA 4B4WA 1Q1AA 3K9GA 2I7CA 2V5AA 3TDNA 1H9AA 4NS4A 4RSRA 5GJVC 4CIVA 1UBKS 1E2KA 2GMWA 2K4MA 4LYDA 3LKDA 5TS3A 1CKEA 2QX8A 3QV1A 3FNEA 5DGTA 3VMFA 2FSVC 1WXWA <