4BX9A

Human vps33a in complex with a fragment of human vps16
Total Genus 223
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
223
sequence length
594
structure length
574
Chain Sequence
AAHLSYGRVNLNVLREAVRRELREFLDKCAGSKAIVWDEYLTGPFGLIAQYSLLKEHEVEKMFTLKGNRLPAADVKNIIFFVRPRLELMDIIAENVLSEDRRGPTRDFHILFVPRRSLLCEQRLKDLGVLGSFIHREEYSLDLIPFDGDLLSMESEGAFKECYLEGDQTSLYHAAKGLMTLQALYGTIPQIFGKGECARQVANMMIRMKREFTGSQNSIFPVFDNLLLLDRNVDLLTPLATQLTYEGLIDEIYGIQNSYVKLPPEKFAPKTEAKKLQLNSAEELYAEIRDKNFNAVGSVLSKKAKIISAAFEERHNAKTVGEIKQFVSQLPHMQAARGSLANHTSIAELIKDVTTSEDFFDKLTVEQEFMSGIDTDKVNNYIEDCIAQKHSLIKVLRLVCLQSVCNSGLKQKVLDYYKREILQTYGYEHILTLHNLEKAGLLKPQTGGRNNYPTIRKTLRLWMDDVNEQNPTDISYVYSGYAPLSVRLAQLLSRPGWRSIEEVLRILPGPHFEERQPLPTNRVTLIFFLGGVTFAEIAALRFLSQLEDGGTEYVIATTKLMNGTSWIEALMEKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis of Vps33A recruitment to the human HOPS complex by Vps16.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
molecule keywords VACUOLAR PROTEIN SORTING-ASSOCIATED PROTEIN 33A
total genus 223
structure length 574
sequence length 594
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00995 Sec1 Sec1 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.850 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4bx9A04
3.40.50.1910 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4bx9A02
3.40.50.2060 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4bx9A01
3.90.830.10 Alpha Beta Alpha-Beta Complex Syntaxin Binding Protein 1; Chain A, domain 2 Syntaxin Binding Protein 1; Chain A, domain 2 4bx9A03
1EPUA 1MQSA 4JEUA 3PUJA 4KMOA 4CCAA 4JEHA 2XHEA 1Y9JA 4BX9A 5BUZA 1FVHA 5BV0A 3PUKA 4JC8A 5BV1A 3C98A 1FVFA 4BX8A
chains in the Genus database with same CATH superfamily
3T7TA 2UWJG 1Y9AA 3IE2A 3KPJA 3VPGA 3B8EA 4A3SA 1BCRA 1QYRA 5FUVA 4HSEA 3R9WA 3TFOA 1EP9A 1PNRA 2WXKA 1CR2A 1U04A 4RPHA 3N53A 2BUCA 4WLNA 3COWA 4B48A 4FR2A 1RHMA 3WFJA 5ECDA 1B41A 5FBHA 1YDGA 4R9UC 3GXOA 4BKQA 4IGAA 1SA4A 2P2SA 2OUIA 4BVBA 2COEA 3GVXA 1J5EB 2CMKA 3S2SA 1H2HA 1YONA 4ZAVA 1VL1A 4EABA 3RVBA 2V8SE 4EZJA 4M1TA 7YASA 5E6RA 2WWYA 5C18A 1FYDA 1CK4A 2FSVC 3PUYA 1POXA 4COOA 1ZKMA 4B6OA 4YUYA 3MPOA 1E7RA 1XTSA 1HZZC 1JHPA 3IEUA 5CH5A 5EQDA 2DQSA 3KM0A 3UMRA 3F97A 4MUIA 1CY2A 2P27A 1NATA 3N7TA 4CCWA 2GKSA 1P4HA 4FLFA 3FOZA 4GPIB 1BEUB 2ACWA 2G9VA 3GOQA 4GB9A 3TE7A 3PR3A 4GVXA 4YY3B 2HSZA 4JI0B 1COWD 3V2XA 3ASNE 1HORA 3FUJA 1E7MA 1XMIA 2NYRA 3FYDA 4FFPA 2CMGA 3IAS6 5JSYA 4I4TA 1TN8A 3ZNNA 1D9SA 1SPXA 5DRTA 3EGIA 3QENA 1TR4A 2VDUE 3ZXUB 3HJCA 3N0WA 1F6DA 4IGEA 2FUEA 2GWHA 4R98A 5AI9A 1I6KA 4F1WA 3WG7E 4N0PA 1JDSA 4URUR 2PS9A 5FB3A 1IQPA 2OM2A 2DY1A 5HWSA 3BWEA 3OJOA 4IGIA 1ZEJA 4YJHB 1VMAA 4RH1A 1T36B 1KBQA 1U5AA 5JARA 2EFDB 2BFCA 1KJQA 4H17A 2JBHA 2H5IA 4L73A 3S4YA 2JJ2A 3CR3C 1H66A 4GR4A 1L5RA 3S81A 2NTNA 3ULKA 2ZWMA 1HPLA 2GZMA 4XYMA 1SKBA 1ZESA 1Q44A 2VJMA 4OREX 3DJYA 1A5AB 4JOQA 3VPSA 4A0SA 4C0EA 2HRDA 3S44A 2VHTA 2VRWA 4U0JA 1Y8QB 2ROQA 4KE7A 4E2ZA 3FEYA 1J99A 1MO3A 2OKCA 4FYIA 3FHEA 1MVOA 2E21A 4ZI3A 5L3QA 1EI9A 2ZJ4A 1N0UA 2HNKA 2O57A 3V8PA 4NK4A 1XEFA 4NZMA 3BFPA 4KVZA 2WVIA 1M1YB 2IYEA 3MLEA 3FSEA 4HH1A 4Q6BA 2CYAA 3T0GA 4I9UA 2F37A 5L4NA 1ZNYA 3Q3GE 2ATXA 3DXMG 1E0DA 3C5CA 3ITNA 5ENPD 1K9SA 3LKBA 2IV2X 4M0EA 2ZUWA 1D5CA 5TPZA 4G41A 4BNHA 3DV9A 3IHYA 3FCAA 1JU3A 1Y0BA 4RENA 5ED4A 2DFNA 1UC8A 4TVSA 2IO3C 3V1UA 4TV8A 3G2OA 1JFFB 1SIUA 2OHJA 1QH9A 5DM70 4A3VA 1IIBA 4HWTA 3FTYA 1DO2A 4YAEA 3U81A 5AKHA 3RAEC 4BRWA 5E4FA 4NACA 3FU5A 3E33A 1NV9A 1OXVA 3PQ5A 4JI7B 4IRXA 4ILHB 4MBGA 1CUUA 2EX1A 5FJIA 1C4XA 2VSYA 2OOKA 1WSBA 3RFVA 4EGAA 5ENOD 1SC9A 3HXPA 4MA4A 2O0MA 1II8A 1KHHA 2ZG6A 1MC4A 4IR7A 1CLEA 1EP3B 3UWOA 1HTWA 2PRIA 2ZANA 1WB4A 4BJHB 1T5TA 2BZ1A 2KM1A 2X7JA 4D3FA 4ZQCB 1IY8A 1JIJA 2BGLA 2VZ9A 4CL2A 2X5OA 1D2CA 3ESDA 3IQZA 2QX8A 3H8VA 4Q4HB 2R59A 1HA3A 2B4AA 4C0KA 3SO8A 2OBYA 1DAOA 3LG2A 3WNBA 2IS4A 2FG7C 1CQWA 4NBWA 5H3HA 5EP1A 4KR6A 1P8JA 4HHEA 1CQZA 4GW3A 4G0QA 4YFYA 2YV2A 4NKRA 3UPTA 4K03A 1T34A 2D2FA 3A04A 3VPFA 4ALIA 3HE3A 2AWIA 2PZIA 1G20A 1BXKA 2LP4Y 3KAKA 1DVPA 4KP7A 3VYVA 2Q3EA 3WKCA 4ZVOA 4GA1A 4ZO8A 2C7OA 4LRXA 3ZE6A 1E1CA 4L78A 5IEJA 3VLDA 3OQNA 4G09A 5FV7A 4GP9A 4NP6A 1I5RA 3QVGB 2IOQA 1MHQA 3AL2A 3I4RB 5AJDA 3HMQA 4C30A 4BVFA 3HCEA 3Q3IA 1NF8A 3L82B 4DWJA 1U8UA 4WBNB 2O54A 1DKQA 1U94A 2CFZA 3DSWA 5KVQA 1PD0A 4C0SA 1YA6A 1T24A 2X8AA 2YVLA 3F6SA 1N6PA 1YS4A 3QYFA 4H9GA 4IDNA 4YDSA 3GA7A 5AH0A 3V1TC 3GLFE 1CSEE 2Z98A 4GM1A 1U0JA 4XCXA 5A03A 2FJPA 1XA4A 1KYYA 3WBBA 2V7EA 4LE0A 4L5IA 4WZBA 5FHRA 1XPJA 3GRKA 1JXAA 5B5SA 4R2IA 3HKDA 4IX9A 2XUPA 3U31A 2WMDA 1SXQA 4YJ3A 2QL9A 3AC0A 3I52A 4EVQA 3NMUF 2YHIB 3ZGYA 4BQQA 3UWDA 3O4VA 4NH0A 4AS1A 3ONFA 1KJZA 3GRVA 4IJ6A 1R8YA 1BGWA 3BK1A 5E2IA 1CJTC 4DA4A 4IOLA 1TCBA 4X65B 4MV0A 2EZ8A 3H5RA 4OLFA 2WWVD 3TR0A 4BRUA 1S7GA 3DXFA 4P36A 1SKYB 5UKDA 5FIOA 1PFUA 2UY1B 4D0NA 2QX6A 3OWXA 5F3WB 4MK4A 5E4YA 3ZS8A 1E1QA 5E3HA 4RTOA 3EJWA 2G71A 1WZ2A 2E4WA 1S4QA 3OY2A 2GPNA 1MZCA 2R4QA 5TRTA 2E4VA 2F43B 2A6PA 2GCNA 3LCCA 4KLNA 1PAQA 4U5QA 5EPOA 4DSAA 2O7NA 3UEOA 3GDOA 5TMDA 3ZU4A 1I3LA 1SQGA 2EZ4A 1EK0A 1IVSA 2JEOA 5HJ7A 1MFZA 2XUZA 1CZLA 3GT7A 1BS1A 1DP4A 1T9CA 3IBYA 3R3XA 1I51A 2HOQA 2AXPA 2PRYA 5G4KB 1TQ8A 2J09A 1J70A 2DCMA 3AWDA 5JD3A 2FXVA 3WV5A 1FYWA 3MK31 3X1WA 5KU7A 2D74A 3A1FA 1DKNA 3IELA 3QEMA 1FLVA 4R51A 4DSZA 2QJTA 4ZYYA 8ADHA 4COKA 2H18A 3IQXA 4DLBA 1E9CA 5KNBH 5M5BA 4YRQA 3AXTA 4GMKA 2BFWA 1XD2B 3TZQA 1GQYA 3OU7A 5ECGC 3SKVA 4I4TF 1H6KA 3JCKC 1N2GA 4LFCB 3W06A 3H4MA 3D7NA 3SP1A 1AH2A 1RXEA 5AIAA 4C6TB 3QXJA 1AGXA 4MEJA 5E9QA 3D4BA 5JSUA 1JH9A 4UBMA 2IBSA 3H2YA 1BE0A 4O4JB 4DYHA 3L18A 4RV4A 1CUFA 3N76A 4JITA 2AC2A 2ESRA 2IPOA 2JKZA 1XTRA 2NPOA 2NVUA 4I36A 3WZMA 3DR3A 1YS2X 2B99A 3B2NA 3RRUA 3M5PA 5G04J 4FDTA 721PA 3PNYA 1YR3A 4XYLA 4GX5A 4KC0A 5E4JA 3FTSA 1GUFA 3RSHA 2VTBB 3TGWA 2C78A 1I9CA 2C9MA 5KDLA 4E08A 1F3OA 2I7DA 4CKWB 2UUCB 2BZSA 4DLPA 3F5QA 2DXIA 1SUWA 5TVKA 2ZTLA 1MORA 4RZQA 3OE7D 3W5UA 5CDGA 5GADl 4U0ZA 1LLUA 1TM7E 4ANFA 1NW5A 3SXJA 4OP3A 3U7EB 1YR7A 1ZPDA 2RHDA 4FGJA 1W35A 1QHNA 2ZYSA 2VJ8A 3DV2A 1TQ4A 3AVWA 3PT9A 2Z8YM 4J8FA 2J4CA 3PJFA 5JYDA 2VUSA 4OM8A 1DZ3A 3N2IA 4IDFA 3B70A 5EIHA 3TIVA 3V7WA 4BMPB 1IYZA 4LKOA 1SU6A 2IHZA 4JWKA 1U0FA 1YZHA 5DN9A 1PDVA 1YC2A 3LCUA 3UINC 1P0CA 3O92A 4GQAA 4M8LA 4X6XA 4CM3A 5B7QA 2WP0A 3T5TA 6PFKA 3ZTWA 2A8YA 4IFBA 5KOHB 5KC8A 4OU4A 2GK3A 3RR2A 2VJPA 2R03A 3QWWA 3LDFA 2VTBA 2JLQA 1IWPB 2PGIA 4KPUB 5EZYB 3TX6A 3ZNPA 4B33A 4XFJA 4EDHA 5MF6A 5CT8A 4GMJA 3DE7X 1K7YA 1SVOA 3QHPA 3GUYA 2W5UA 4P5EA 4XH9B 2GDZA 3C15C 3LPDA 1FX1A 1GZUA 3BE5A 3GGPA 2R6ZA 4XUDA 3UHJA 3BEDA 3C6BA 1I14A 4UHCA 4QL3A 4ZK6A 4DR4B 2XKAA 4BLQA 2CL6X 1OJ7A 4WLEA 5CEAA 2ZFUA 3EVDA 4KK4A 4ZPJA 4HADA 2F8YA 3BL8A 3WGZA 2ONDA 4RTMA 4JPSA 4GICA 1R9NA 3DQZA 4KGDA 3ZX5A 3M6WA 4UHBA 5KTRA 1E8ZA 4Y3UA 8ATCA 2CNWD 2OO5C 3ZHRA 4IIUA 2HMWA 1B3BA 2R8PA 1DJQA 2ZJ1A 3K9NA 3RC7A 3D5TA 2VNHA 4DR5B 2FPGB 4LERA 4O2BB 1EVKA 4HDQB 3L9TA 5GZ3A 3IXEA 4WBNF 1DS6A 1B42A 2PBRA 3ZYZA 4OQEA 1S89A 3FFAA 2VAVA 3DS8A 3GRYA 3O94A 3R7BA 1GZ4A 2GZAA 3D9OA 2DOKA 2EP5A 1RM5A 2WJVA 4JYPA 3ZDRA 3K35A 4G1VA 3A4VA 3B7PA 3ED1A 3ENZA 3WJAA 5B30A 2IIQA 3I76A 3OM1A 1NY6A 4GRAA 5EJ6A 3G2IA 4IMPA 3IFSA 4WZAA 5ISMA 1WRBA 1WDMA 1JEDA 1XDDA 3I04M 3OOJA 4CRWA 1WLYA 1IEWA 2ZSAA 3G3EA 3PICA 4FBGA 3H9QA 3MOIA 2XF8A 3OQIA 4J7XA 4MS4A 4UQOA 4L4XA 2IY0C 5BR4A 3VGJA 1I4TD 4RVUA 1DUVG 3W5HA 3LA8A 4WXMA 4LPSA 2OZPA 4LOAA 1JIVA 2J8ZA 2H5EA 3EFOA 3EGVA 3K8ZA 3PNPA 3RRNA 3ABIA 5EHXA 2Q1XA 4HRYA 3ZI0A 1UPXA 5KSPA 1REQB 4GXNA 2GNOA 3H9UA 3FMFA 1N33B 4F3TA 2WWHA 1JWLA 4Q1EA 1DJPA 1W1WA 3T3OA 4AUMA 4PQGA 1W8IA 2FHSA 3RBZA 2Z4TA 5A5VA 1XYGA 3PQDA 3BL6A 4KXYA 3VX4A 2L0IA 4BU1A 5CLFA 5JFOA 3EPHA 2P4EA 5FD8A 1E66A 4DI4A 2FW6A 2IVFA 2OQRA 1SBTA 1U7PA 2VYCA 4HQFA 5HK9A 3CE6A 1VPVA 3FLAA 2LKCA 2FPOA 2Q2WA 5ICCA 3FDJA 2IV3A 1PFYA 4YUZA 1OX4A 5JBQA 5KKCA 5KMGA 5L51A 2BR4A 1M74A 2Z2KA 1TC2A 3DFZA 3I3OA 2QG9A 4C22A 4PZZA 1JALA 4M1YA 2OENG 4L27A 4RK4A 2E18A 1ECLA 1HQDA 3PPWA 1DDGA 2ZE6A 4JUDX 4ZA2A 5KI6A 4OI2A 2WU8A 3I6QA 1QVWA 3KKMA 3QVGA 3OJEA 2CHEA 4GTQA 1GPYA 3KKNA 1YHZA 1IC6A 4LV6A 4X61A 2VF4X 3FJYA 5CVUA 2OILA 5AK3A 3FWYA 2P9NG 3DHNA 1FXUA 4JU9A 4MKIA 1U9ZA 2O0LA 2PXXA 2QT0A 1CB0A 3CZ9A 1ZU2A 3HKBA 1NW6A 1S3IA 2ZAOA 3P9RA 4N82A 4E51A 1KH2A 1MH1A 2WMNB 4QIHA 4TTQA 1XG5A 4Z9YA 3A58B 3NHZA 1HKHA 4KOEC 3ZBUA 2VBGA 1SD2A 2PZ8A 5LC1A 3SEFA 4BQOA 4OJQA 1HX8A 3MS7A 4KOAA 2D2EA 1TZ2A 2FZLA 4MUNA 2I87A 2WFMA 2WIFA 5EX3A 2Y0BA 3NEJA 4W4TA 1LC3A 1UP6A 2Q45A 2Y2UA 3F1KA 4XA8A 3C5VA 1TE2A 3DM5A 4IFTA 5JISA 2D0IA 4MCJA 4P81A 3RRZA 1NMQA 4EB8A 2OUKA 4QNRA 3G2PA 2LKDA 3WIVA 4DIOA 1JTFA 3WL6A 1NJ1A 3K9BA 3G2VA 3C74A 5DCWA 5DX0A 1FP6A 3NP9A 5HF6A 1B00A 1MENA 3GP3A 1VRVA 5KJFA 1GT91 3COVA 4G1MB 4MARA 4YRGA 1X1SA 3N2KA 3OJWA 3WNQA 3MHTA 1OIXA 1DMSA 4K8OA 3DOJA 1ZCJA 2RGDA 2NO0A 3DBSA 4UEJA 2B34A 1EP1B 4JYZA 3KQPA 4D46A 5M2QA 3EHNA 3LPZA 1GUAA 2VWPA 4IDHA 1NU8A 1OZ0A 2AFIE 2WWXA 1IWBB 4L2IA 4AVYA 3KYIB 4ZTZB 3DOFA 1A50B 4TV8B 2EJTA 3CNNA 2FGKA 4LCTA 3LWBA 4PX2A 1U8TA 3KQMA 2R85A 4O25A 3DLAA 3S70A 2POQX 1TM3E 2YHBA 4EEXA 1MVLA 4N49A 3HCAA 2JGJA 3IAUA 4FINA 4PYNA 1H2BA 1GWNA 3L1JA 4QREA 1KI2A 3USCS 4OH1A 4KDEA 2YICA 4EKEA 1B2LA 4QECA 1S02A 1XLVA 4I5DA 5CJ2A 4PPGA 4UDNA 3ZZNA 1Y5IA 3KZNA 1IK4A 3MJ4A 4TT3A 4X8QA 3IHVA 3ER9A 1H2AS 2ZTVA 1GPKA 2EG5A 2ZQYA 1MV5A 1TDJA 4GPBA 5KJKA 1E2MA 3AG6A 4MR8A 1VP9A 2RD2A 1SFRA 3ASZA 3QELA 5JECA 5LUBA 5DBGA 1LZKA 2QXYA 2W71A 5KYTA 5INTA 1NL4A 3FTCA 5TMBA 2ID9A 2HF8A 4NC9A 1EFPA 3UA4A 2QXUA 3ADBA 4NPHA 1J8MF 2J1LA 3VV3A 4ZICA 3C3JA 4KZKA 4LX0A 3U3XA 1P33A 2KLBA 3VU8A 4AQDA 3MELA 3QWPA 2X1VA 4NMMA 1R2QA 1TTPB 5BUZA 1EAYA 5BW6B 4QDTA 4I7EA 1NPDA 4YALA 3W5IA 4G0VA 1PLJA 1ABEA 3JRXA 4PHTA 4J3FA 1KH3A 1UWCA 5BV8A 4UM8B 4Z99A 3RIBA 4OSEA 4FEGA 4FOOA 3NB2A 2HIMA 4YO7A 4ARSA 3T0IA 5B4TA 2OCAA 2P6RA 4CGZA 3LPAA 1LA2A 4B7AA 2GS9A 4QHSA 5AI6A 2J4DA 5BSGA 5EYLA 4HOQA 3ONLA 4O3FA 3EGCA 3PQCA 3OLZA 1JTVA 3PQEA 4Q7QA 2XKKA 3F1LA 4BWFB 1RXUA 1SCQA 1TVCA 2R8EA 2WIDA 2YZ2A 5M7EA 2YDXA 4I17A 5KTMA 4GECA 4HMQA 2G9ZA 2JFFA 1TYQG 4NECA 1KY2A 2A0WA 5U4XA 3SJAA 4B3XA 2CFIA 5ALGA 4ETIA 1CT9A 1C3VA 1MG5A 3N8IA 4OH7A 3EBLA 3KKPA 2C7RA 2P78A 4YP7A 5REQA 4J0KA 4CLOB 1NX6A 5L53A 1CULC 3ZVMA 3L0OA 5LDGA 2G7ZA 4OQFA 1G8SA 3RU7A 5LWHA 2ZQZA 1ESZA 3GNQA 2A92A 5A06A 1Z8HA 4ZOAA 4EF6A 1F8FA 2R84A 3E3OA 5L4SA 1TRKA 2GN1A 3P9SA 4X90A 3SD7A 1KY3A 2GF9A 5JY6A 1GPLA 5H3LA 3OC6A 4CM9D 2D62A 2OXTA 4RTJA 1XDBA 1UPTA 2XVMA 4AXXA 3ICPA 3OMLA 4OY3A 5IAJA 1FB5A 4AUKA 1NHWA 1TVKA 1V7ZA 2WPNA 1NA0A 2PAFA 3OX2A 4MDEA 4P7FA 3MXTA 2VHEA 3DWIA 5A04A 3P2JA 2QQFA 1BCRB 1XZGA 2IEGA 4F21A 1YCHA 4OF4A 2NZWA 1YOVB 5AVXA 1X19A 1OLSA 1N5RA 1LDMA 2O7VA 5D2MC 5HF9A 2Q4EA 1CS4C 3B6EA 2H0AA 2XV1A 2ZK7A 3ZY6A 1L5JA 5KNCH 3WK5A 1E3IA 1N7JA 2OHIA 3EVTA 5JC1A 1KPHA 3LCVB 2WABA 4ZXFA 3FPLA 4DHEA 3EXFA 5TLSA 3LXXA 1QDLB 4LDNA 3RC1A 1FJXA 1M8FA 1DAEA 2DPLA 2I9CA 1JMYA 1JE1A 1OZGA 3LXMA 4JJKA 4B2PA 1Z6XA 3JD4A 1NM5C 5K05A 2YJTD 3VOBA 5JDIC 1NFFA 3RSLA 3T99A 2H2IA 2V7UA 1CNFA 4E15A 3JQ1A 2RHRA 1NUHA 5L4LA 3QM1A 3KQHA 3G1WA 4ZEXA 4IVRA 2YL2A 3RSZA 1TNZA 4RDCA 1NBHA 3E58A 4HT3B 3U7HB 3E5RA 4N7RA 4KO2S 4CDRA 5G4KA 5F52A 1I2BA 3GFGA 1DSSG 3AFNA 1SZAA 4N03A 1LJLA 4F3VA 1GVNB 5EKDA 1H6PA 2HHAA 1N2CA 2VJOA 3QK0A 3DTVB 2ETBA 3HGTA 3IPCA 3N8DA 4ZJZA 1JGTA 2BGTA 3KTAB 3ZEIA 1KAMA 3Q4GA 2VDOB 1HZZA 3LV8A 1U65A 4G5QA 3KT3A 4BKRA 2YY6A 2IIBA 3JQ9A 5P21A 3LF1A 2DHCA 1L7VC 3BRWD 3G0DA 5ABPA 1WV1A 3CVYA 2O19A 3QHAA 3HY3A 3CLTC 4QBGB 4BQEA 1XNQB 3D43A 5H1YA 1E4YA 1IEVA 5JJ7A 1CTQA 1GG9A 1J2RA 4NDAA 2XGJA 1LTKA 1I0IA 2FX3A 4BU0A 1H19A 2FF5A 4LN1A 4NMHA 4WXPA 1SHJA 3LKUA 3OCUA 2XNDD 1SVLA 4GLOA 3WYGA 2Z3ZA 4GMLA 2VJKA 1DFGA 3BIXA 1ZGAA 3D4IA 4MUJA 4FUTA 1TNUA 2BMAA 2D1RA 2HL6A 3ZXPA 5HFJA 4Z0PA 4LYYA 5U9CA 5LCXA 2FXIA 4MLCA 5EE5B 1Z5WA 3RUIA 2FB9A 2IEIA 4PYRA 3U3OA 1UBOS 4BN0A 4Z4CA 5BQFA 3BCRA 3KQTA 4KXLA 3N2ZB 2D00A 1Z18A 2NO9A 4ARZA 1JG1A 1QGUB 2B9VA 3G0OA 5C4IA 2J5XA 2B0JA 5A62A 1M1ZA 2Y05A 5FQ4A 3EE6A 3VC3A 5HQ3A 1OI3A 3D3NA 3EX7C 1ORIA 3F4KA 1FP4A 4HLUA 1U0EA 5LMUB 4INPA 4CLRB 2XXBA 3QW4B 4AZ3A 3G1TA 5CVEA 3PEYA 4TM7A 3IP6A 4RLSA 4QYWA 3DLTA 5TIIA 1ADBA 4IHJB 1HLFA 2AOVA 3IV7A 4QBIA 3AI3A 1FTSA 4FD2A 4HORA 5DIZA 1XZKA 3UKOA 1YRLA 4K0RA 5EKQD 1FUIA 1MCZA 5LP6B 5AO9A 2C4VA 1OKKD 3PX7A 3S5JA 2O20A 1U1DA 1HLGA 1NRXA 3VAAA 1U11A 3F8SA 2UYOA 2CBGA 4UOQA 5JA4D 1KP2A 1PQWA 1XVAA 3L7OA 3TPCA 3H5NA 4L7QA 4DJTA 1JSRA 2Y77A 3DCJA 3ZWPA 1E6MA 2O4UX 4QPNA 4J43A 1XRSB 1YNOA 2XOKD 4N3CA 4ABNA 2HSWA 2ZBQA 3ELBA 1DMRA 1GZ3A 5KBAA 2GN2A 2RC6A 2WKWA 3U3JA 5IJXA 3PFWO 3H6HA 4AX8A 1LF8A 1L7QA 3ZJVA 3DSUA 2OV2A 3RC8A 2H8KA 5EJAA 2YC2C 5KTNA 4Q24A 2AZ4A 2JFXA 4J7CA 2CLKB 4RM2A 3E70C 3HDVA 2VO1A 3LT4A 3SIPA 2AJAA 3SHOA 4BBJA 1PZMA 4RY9A 2AJTA 2QVLA 3NTXA 4LVCA 4QQIA 1SG9A 5ALMA 2LXMA 3A6KA 3IP7A 3M82A 1PSZA 2G70A 2UYYA 2I2WA 2V7TA 2PH5A 1Q50A 4BE9A 2BT4A 2DTEA 2RI6A 5DULA 3CLTD 5C31A 3OH8A 4U9HS 5D5HA 3S29A 2QM8A 1E5VA 1ZUHA 4DRZA 3OBBA 3Q0TA 8OHMA 4HNRA 4KIJA 1AK1A 1W5EA 3FROA 1CDDA 4Q00A 4A9AA 4KREA 5IXSA 2J3LA 1FTWA 4Y6WA 2WXOA 2R7KA 3QY0A 5JLAA 2OEWA 4WERA 1T3TA 1NXXA 4OM7A 4O59O 1GV1A 1TQDA 1A71A 2OFXA 3PQFA 1LB1B 3U3RA 2BEUA 4YCMA 5KYNA 4PIVA 1NBMD 3FPHA 2FW9A 2J49A 3AL0C 3EFHA 3TL3A 1Q84A 2V9CA 4DIFA 3VH3A 2IYWA 2EW8A 1V55E 4HI8A 1BQ3A 4A27A 2YFHA 1IOLA 1I8TA 5DTIA 2W2LA 5TNXA 2CL0X 3HB5X 1BKYA 1V8BA 3PNMA 5LOVB 2RGAA 5DNDA 1CX9B 1IPFA 1OXJA 5G2NA 1VYHA 2YHSA 2Z9CA 1VLMA 3LGAA 5FLEX 1Y6JA 1OBFO 1BA3A 1KI3A 3OP1A 4HXEB 5DYWA 3WL8A 2O07A 4CLEA 1X1DA 1C9YA 4KN8A 1VGQA 2X2FA 2KBFA 2Y1FA 4AROA 1XQ1A 4FA6A 2X6IA 4B44A 3OHSX 2E1RA 3C41J 1KRWA 2G77B 3NJRA 3PKZA 2VZEA 1PT9A 2XRYA 2GEUA 2A5LA 5IC4A 1X3LA 1SK8A 2NXCA 3CW2A 1E9VA 3JQCA 3BSWA 1IUKA 4QUGA 4B6QA 3WLJA 1QYWA 2C54A 1LDEA 2REQA 5SZHB 4YV0A 2EGGA 1G9XA 4P32A 3V3TA 1G98A 1LK5A 2VJLA 1HG2A 3DFIA 4J1NA 3ZGVA 2KXPC 3FHJA 4EZBA 5T7BA 3U48A 3M6LA 4C01A 3M33A 2CUZA 3SXPA 3N2GB 3DP7A 4HLLA 5IHPA 5KVVA 1O6BA 3T5AA 4CUJA 1RS0A 2NZ8A 3O9MA 3F9CA 2LDBA 3CWZA 4TTSA 3BGDA 3KYCB 5FBKA 3ULEG 3RAPR 3W0LB 1PKXA 3A6GA 5BNWA 5JCOA 2F2TA 4BQRA 3MOSA 1C1XB 3B13B 3PGVA 2AR7A 3U9TA 4Y30A 4PN7A 2XNCA 5FI1B 1DXQA 3HXEA 1U31A 1V16A 3IODA 3ZHXA 1T8SA 2AOXA 2PL9A 3H2KA 3PR1A 5EN5D 4UVEA 4EITA 3FOFC 3LIPA 2NP6A 4G5FA 2PUBA 4XYGA 4JEHA 5KTKA 3WVNA 4LF6B 5DWVA 4LGVA 3T7RA 2FMTA 4C1BA 1J5XA 2DR2A 1R0KA 4YPVA 3ODGA 3BWMA 1PWYE 3RRFA 4JHJA 3ZUVB 1MAAA 3KB6A 4YAOA 4FJ1A 3HH8A 3MERA 1KC3A 1Q74A 1JDBB 4NBUA 4HLEA 5D87A 5AHXA 1LCIA 1LSUA 4G0ZA 3WNCA 3EZFA 4BZZA 3OX4A 2QTGA 3TDMA 2G4LA 4BX2A 4ABTA 2JANA 2FO7A 4MVJP 4A8JB 3OTOB 2PUWA 4JI8B 1AURA 2F3UA 2LPMA 1QC5B 3EA0A 3A2KA 4BFRA 1CUEA 1F2TA 1MEOA 2WC1A 5CPBA 4MS3B 4AKSA 3OFSA 1FPMA 4JYMA 1NUQA 1S8OA 1ONBA 2DKFA 1U9JA 2F3PA 5ELMA 3JWPA 2BFEA 1H4TA 3HO8A 1A2KC 1C7EA 2OPBA 5LIRA 4UFNA 4RE6A 2V97A 4MV8A 3AILA 1FDTA 4A55A 4YCJA 3VXKA 2C2GA 4GCOA 1MA0A 1N5JA 1WNTA 2R5NA 4LSWA 2VPQA 4J0JA 3I9KA 2G0NA 3JTEA 1Z2DA 3AHDA 4MNTA 1V3TA 1V39A 1ZM7A 1FCHA 3VR3A 4Y1RB 1G64A 1ENPA 6ADHA 4QYSA 4UC0A 1JAYA 3C7TA 3AUFA 5A0FA 1P7CA 1MYOA 1X15A 2VHQA 3RABA 2WD7B 4XSVA 1SB9A 1VJ5A 3EXAA 1V0JA 3TLYA 3HVRA 2Y1KA 4ENRA 4WVLA 1EESA 1T0JB 1Y7TA 1X7WA 1ULAA 4TQ9A 5FI3A 3ZDFA 4AF6A 2PRSA 1XTPA 2QLJA 2WUWE 4B2YA 1BAPA 2IOHA 3G6WA 4W1RA 3EF3A 2BW0A 1XZDA 4P34A 3CX8A 3PFHA 4C7MA 4O1PA 2WQ7A 5EA2A 5DN6D 2C7BA 2PX8A 1G20B 1ZBQA 2LDXA 4LJKA 1V47A 1VRWA 1HBJA 4JLKA 4PG6A 3H5IA 3TR5A 4FQ5A 4F96A 2GPWA 5I4KA 3E23A 4D10C 2R4UA 3G6KA 5KSWB 2Z8YA 1INLA 1MV8A 2XNHA 4L16A 3UOAB 2ORVA 1TEHA 1AN9A 3C3KA 3ILYA 1T5HX 1F4PA 2QTHA 3NNNA 3IBCA 3U0BA 1N0RA 3R76A 2VUTA 3NAWA 5H0IA 3O9ZA 3BREA 1R10A 2GPJA 1IXZA 3DEJA 3HM2A 2PS3A 3PVCA 3H6GA 1J22A 3ROGA 1ZAYA 1F4VA 1T6ZA 2JIZD 3NXKA 4MKXA 2X2EA 4QPCA 1FRNA 3F6BX 2O8BB 2YIDA 5K0LA 1R64A 2FMIA 1E62A 3T12A 1KA9H 4M37A 1F5SA 1GDHA 5HZGA 1CEEA 4WLUA 4QKQA 1V11A 1N6NA 3LC7O 3LX6A 1PR3A 1KDOA 2R3SA 3GEMA 2HM7A 3NIBA 1I30A 1U6KA 1IVNA 1JU4A 3OLXA 4WZ6A 3RC9A 3UGQA 1YL7A 4A5OA 5J43A 5TGDA 2I6GA 5KKAA 4D0LB 3FSJX 5JS6A 4AKIA 3WMGA 2WE8A 2HWXA 2DH6A 2BM0A 5DHAA 2XOEA 3FULA 2PBLA 1R74A 1BU5A 3DZDA 4CMAA 2C99A 3LPCA 3OD5A 3OZUA 4QU5A 3OTWA 1P61B 4R2HA 2C96A 4FU3A 3X1DA 4WAFA 3U4IA 3U17A 4AS3A 1KOFA 2RGNA 1PL6A 3BE4A 3LW7A 1DCTA 2XTZA 2UUAB 3O4GA 221PA 3KX2A 4CIVA 4EUHA 4LQDA 4E21A 1PKEA 2IPAB 2QZPA 1H3FA 4B8YA 2D8MA 3CZMA 3G02A 4GZCA 1QVAA 2OE2A 5ESXA 4YGYA 3AUXA 1EJBA 2WB2A 2HJRA 1S1MA 5IYZA 1WXHA 4XIYA 1Y5MA 3T7AA 3FG9A 4YRJA 3H1TA 2YINC 4WIAA 1E4EA 2W0SA 3CQ9A 3LX8A 3OEYA 4IFIA 1HF8A 2QTMA 2H1SA 1DO8A 3L8HA 2VGXA 4KFUA 3VGPA 3WRYC 4K9QA 1JEJA 1DAMA 3MTAA 4LQ4A 4WKCA 1WUJS 2XE6A 3ONKA 1IONA 1G42A 1NR1A 2P2CA 4TKUA 1RQXA 3A4LA 4WESA 5B58T 3DSTA 4D9CA 3GJQA 1G18A 2FN9A 1IFXA 1ZITA 4ZYVA 2V4HC 4QZVA 1RCFA 1UBKS 5ALNA 1XZMA 3I3SR 4F6CA 1MAWA 1Q1AA 3DZJA 3T41A 5I9IA 1MG0A 4OCZA 1N8NA 3D6UA 4JELA 4KTTE 1DAKA 1SIBE 4WOKA 2JJQA 2FWPA 3KJGA 4B93B 1LTQA 3OTHA 4FFBA 1B89A 3L0CA 2Z83A 4AZ3B 3PVLA 1M54A 3ZWQA 4E33A 3ZZMA 1CDZA 1DAPA 3QVKA 4M89A 4RD3A 4DIKA 3T1QA 2JHGA 4F3RA 5B55A 4P7JA 1WTAA 3RK1A 1G8MA 2IYTA 2CB9A 1PS9A 1L5HB 3KWMA 3AHJA 2NT3A 5F1KA 1UXOA 3B7WA 3IVXA 4RWZA 4F2PA 1ETUA 2EEZA 2WJAA 3CE9A 1KDZA 3OJLA 4MRRA 1JZTA 3CX6A 5BV0A 2WG0A 5ILQA 5CAEB 2E89A 3MTQA 3PD1A 5JS1A 3QC1A 4F9EA 3BXGA 3WB1A 4MITA 1LI4A 1ML4A 2B94A 4P98A 4JXJA 4YJGA 1JFVA 1JSXA 3D0RA 1JJIA 4ZI5A 2V1XA 4O29A 3ZUPA 4DQDA 2OP1A 4RA9A 4OTZA 1YZFA 1YZNA 1CR0A 2AKEA 5FBZA 4QFCA 2Z6QA 1SD5A 4PFJA 1RZRA 5CBKA 1D09A 1T8TA 3MCTA 4IF4A 4OXYA 4DC9A 4IJWA 4X62B 2Q4OA 1JEOA 4OHBA 2ZXFA 4NBNA 1R9GA 2D13A 3CSFA 3M9XA 3Q3CA 1PZFA 5JZMA 1LWNA 2HCBA 2XADA 1TW3A 2GYVA 2SKCA 2HDNB 3O2JA 2BEWA 2CCJA 4I6EA 3PC2A 1YAHA 1V16B 3X1KA 1C41A 5FL7A 2XPIA 1PWXA 5HMLA 1DJOA 4YPOA 5E95A 5GPBA 1L5OA 2YWBA 4UM9B 3FNIA 3SQOA 4AMGA 2JH8A 1ATZA 4Q7KA 1V7CA 4PEVA 3RHTA 3RHZA 3D2CA 3R0IA 3NIWA 5HCIA 3ONWA 2LCFA 1ZI8A 3OVMA 4P7GA 2YWFA 3ENWA 4FHCA 5H59A 1JKXA 4N2QA 2O7QA 1ZOPA 3OT1A 2D1QA 5FF9A 4PBRA 4HFGA 4MVJG 4WUTA 3TQHA 3CLSC 4D8XA 1OWLA 1MO4A 3C5WP 4NATA 4WNIA 2A0UA 1F14A 2ZRFA 2J30A 1XDWA 1C3XA 3ORFA 4RSGA 3TOZA 1XXLA 2ZGGA 4J8SA 3A4TA 1O95C 2OTCA 3HJAA 3L8MA 3UV6A 4DY4A 1P5QA 1DX6A 4X54A 4IZHA 4IUDS 3BXXA 1QVVA 3KSQA 3HCWA 2ZRGA 3G5MA 2OHGA 2CHWA 5DM0A 1UZMA 2CVZA 2IOFA 3HVJA 2O23A 1DEHA 2BKGA 1GPAA 1LV7A 3FTXA 2QTAA 3AR6A 3GEHA 3IR7A 4JJIA 1IXYA 1N1MA 2F67A 3QVXA 4OB6A 1W6UA 5AM3A 2PWPA 4DWWA 3VJLA 2WHQA 2CLMB 5IJ9B 3E22A 2Q5FA 3ZCVA 5LLTA 1C0KA 4NFHA 1M34A 2P2DA 3QVJA 2QRVB 4IIEA 3LP6A 5TQ2B 2BISA 4HZUA 3GEEA 1Y8AA 3C8HA 3JQGB 3KT8A 4OXXA 5T3RA 3IQDB 2O9JA 3K0CA 3K5HA 4O2AA 3ZLTA 4AUEA 4WA8A 4PO8A 4BTLA 4W7IA 1SHLA 3V31A 3JZAA 4YN3A 3UC5A 3M4ZA 3FU6A 5JNVA 4FOSA 2C5HA 2W70A 1CUXA 4D81A 2GEDA 4J7AA 1YQQA 4I6JA 3CLKA 4GLFA 4GUDA 5EEHA 3TJRA 2P8JA 3QLEA 2GCIA 4PFQA 3H97A 5BMVA 4K1XA 3DC7A 3WGGA 4W5NA 3QVOA 3AS4A 4FFVA 4E7PA 2PFSA 2XGGA 4FK8A 4PLZA 4CQJA 5CBNA 1O5TA 1ULTA 8AT1A 1E1DA 2PD6A 4FZJA 1E7YA 1CQJB 1GZDA 2VAPA 2V7QA 3DA8A 4TMXA 3VC7A 1NW8A 1TJ3A 3A7DA 2G5TA 3VNAA 4TL8A 3R7DA 3T9EA 4EYQA 2GYWA 4RO0A 4Y0NA 5HXAA 4OXRA 2EOAA 5I9LA 1DI0A 4MV3A 4G56A 1G3QA 3FFWA 4PX9A 2Q5IA 4FFBB 5FUBA 5I7AA 1BW9B 2VAWA 3F3MA 4H27A 3EEYA 2W6CX 1JUDA 3BDVA 2C5EA 2PKQO 4QAQA 2KATA 2HMUA 4HVAA 1C9JA 2YXPX 1YGPA 2VT6A 2I6TA 3L0SA 1XJCA 2RHBA 4L22A 2J85A 1C5KA 2OAQ1 1TJFA 2EFCB 5HDBB 2AT1A 2X9VA 4HZIA 4YCDA 2C97A 2VT3A 4CFYA 5B4UA 1K4YA 4QDXA 2PUGA 2GM4A 5KAPA 5CM9C 1USGA 2EX0A 5FV4A 3PUZA 1HC7A 1XN4A 2VH5R 1MKYA 3W9BA 4DBLC 1K8QA 2HMVA 2LRHA 4BP8A 3DAFA 2YOHA 3NYRA 4WADA 5F1YA 3SAJA 1I3OA 3PDIB 3NASA 1BFKA 3VYTB 5SYMA 1I3NA 2XCLA 1UIMA 5KQGA 4L4RA 4UU0A 4AJOA 1OT3A 4GP6A 1JYSA 4WJZA 1KI9A 2P68A 4OHMA 3CHSA 4LQLA 2I71A 3A9RA 4KQ1A 1UBRS 4KWEA 5EJ2A 2WHPA 2PT7A 2HGZA 4EGFA 5KDOA 2DUWA 3BIFA 2Z6VA 4ZAZA 3RIGA 1M2NA 1G41A 4D8WA 3S7JA 2I62A 4KIUA 1NPTO 4BO6A 3E1GA 3U1TA 2FPXA 2DFKB 4U04A 1ZH0A 4I46A 3O8BA 4GI1A 2HBYA 4TV9B 3KJHA 4ZREA 5BSFA 8MHTA 2ZUSA 5CIQA 1AV6A 1YHNA 1VKHA 2EC5A 1LSSA 3RYHA 3TSCA 1PU2A 1UFOA 2M63A 5CERB 1I01A 5BW8C 5CGZA 3ZLBA 2OCCE 1OH8A 3KZCA 1WKBA 4Q03A 1HO8A 5DYGA 1I94B 1W1IA 2GW1A 3H84A 3UKDA 2N1BA 3EY9A 3ZIDA 4EPYA 1LNQA 1H8HD 4WN9B 4AQYB 2AOUB 3NBUA 4G0XA 1XCOA 2FQWA 1IXRC 1N6HA 2CFSA 1M0TA 1FT2A 2TS1A 1NDQA 3DV0A 2XBLA 3HWSA 3LKZA 3NEPX 4LZAA 4LWPA 4XYEA 2UAGA 4JI6B 4M86A 4ACKA 2WVAA 1ISHA 1M3SA 3TEFA 1I2ZA 1M73E 3UT5A 5BT1A 1UFKA 4WOBA 1FVFA 4YWJA 3SBOA 3UHOA 3GGJA 2V6IA 1KE1A 4Q3AA 3V34A 2JZOA 2UZ1B 3M83A 4FFMA 2FO1E 3DXZA 4TTRA 3J81A 2WW8A 1OXBB 5CNJA 5FX2A 3U0VA 1QORA 3EXG2 1DQZA 3HKBB 1KZGB 2YNMA 3HVKA 4EBAG 2AGVA 4BFSA 2X0EA 1NNUA 4G1CA 3NIFB 2IYXA 3K72B 3MW8A 2VOJA 1B8VA 1KK0A 4HNHA 5DM4A 3KLBA 1JR2A 4FYXA 3UUWA 5CB4A 1I5EA 4ZAYA 3RFUA 3RYFB 2QN8A 3EUWA 1F17A 2CLHB 4UQXA 3FA2A 1N2CE 2MTBA 3PDIA 1GARA 3VVBA 2E6UX 5DI3A 5L6MB 2VR1A 3C4JA 2JI6A 2M98A 1O5OA 3HVEB 3OT1B 2HE0A 1Q91A 3CG4A 4HVTA 5HEKA 2JHAA 1KP9A 1T0PA 3G9ZA 1D9ZA 3ZNQA 3PE3A 3NRBA 3SY2A 2HCFA 1VBMA 2GAIA 1FFGA 1NI3A 1U2ZA 2YBEA 3K0AA 3DGEC 3L8EA 3LPNA 3FTEA 5EJIA 4ZZ0A 5SYAA 1KIAA 1C3JA 4OI1A 1WD5A 1OFTA 2IELA 3PFNA 1RBZA 1G6KA 3HWWA 4M9ZA 3KQNA 5CRIA 1YA4A 3RNOA 1H2FA 3H2HA 2FFHA 1M6WA 1B8PA 5CEEA 2VWQA 3GJZA 1Q1GA 1IXVA 1LI7A 4O2LA 4FC8A 4CIDA 1SXJE 3FSGA 2WIKA 3UT7A 4MTCA 5L3VA 3NH9A 2OYRA 4FN4A 2C3PA 1W49A 4ER0A 1U2PA 3A6FA 2YOFA 2P9LG 2YYYA 4P22A 1F06A 5HKKA 1HDXA 1M1NB 1BW9A 1JMKC 3IAM6 1QP7A 3FYUC 4R1QA 4ESVA 1QGYA 1B6TA 4I8XA 4QARA 3HDYA 2OCXA 2RJNA 2Y92A 3I9OA 4FE3A 4F5YA 2K2QB 2WIAA 4BXOB 3WR5A 4GMDA 1AXRA 3ZWOA 1JFTA 2FK7A 4OX9Y 3W9YA 1FPPA 5DJ5A 1XKQA 4YVOA 2ZS7A 4YRTA 1GYQA 1Z7WA 3DO6A 3KPVA 4GI7A 2HJHA 4DPMA 4AXBA 3CG0A 1IQUA 5CCEA 1NW7A 3LC2O 5CCLA 5JAMA 3RBAA 3H1PA 1B14A 5CT4A 4R1OA 2J9QA 2H9IA 3OTNA 2PTGA 1S9DA 2J0UA 2GO1A 3GGCA 2BGUA 5C5DA 1E79A 5JS2A 2EYQA 2BJHA 1MN6A 2C00A 2PCLA 4B2IA 1KEPA 3KFXA 3QJYA 1NBAA 5KCMA 1DWQA 3ROMA 2P5TB 3TXMA 4RQBA 3T06B 2CNLA 3VC2A 1QYDA 3TK1A 1R1DA 1BXRB 4HS9A 1KFCB 1XV5A 2C83A 1PK8A 4ID9A 4IKEA 3PNTB 1ML3A 1NIJA 1G0OA 4NBRA 4MX8A 3D8UA 3FUVA 3WFZA 4BPBA 2QRVA 5TQ2A 3W04A 2DVWA 2G82A 1UKEA 1L6IA 2NIPA 3DULA 3IBFA 3TG8A 1JEEA 1VKRA 4B8ZA 1WCIA 3BB3A 3P0FA 3UTDA 1DKLA 3MCXA 1U2DA 2BHRA 2WSLA 3NBAA 2B0CA 2BIFA 4TKLA 1MO2A 4IP0A 1YRWA 2V3WA 4J6EA 4DRYA 3KQUA 4X91A 2X4GA 2IHJA 1Z2CA 2OO5A 2B37A 1WP4A 4MI1A 4QXMA 4BAZA 3V8QA 1VMEA 5AN8A 4IICA 4D99A 4CKCB 2HQRA 1YR9A 1T0BA 1WMBA 3AHEA 4PHFA 4X6UA 2V3VA 3JQAD 3PLRA 1Z22A 4XWAA 2X6KA 1YE3A 3ZE0B 1L5VA 1X3SA 2GAAA 1YBHA 3SBSA 3AETA 3T1TA 1OHHD 3GHYA 4RXTA 2ISCA 4X95A 3QELB 3T54A 2HIGA 2P2GA 3HBFA 2O5RA 3FU0A 3AEQA 4R01A 4RTNA 4DDKA 3THXA 3TCKA 4YRDA 3PXAA 3U64A 1DNPA 3WB2A 1V1MB 4BO4A 1NI4B 1VSQA 3UO8B 4XKBA 1WY6A 3KWLA 4HQOA 5TC4A 4U7DA 5D3ZA 3RWMB 3TQQA 1TPYA 4FT2A 4NX2A 1W4RA 4JFRA 3STWA 3ROFA 5KOJB 3LYAA 2VOEA 3INRA 2C7PA 1E3EA 2M2IA 4EZIA 1NASA 4YRKA 1NY5A 4DXDA 2PU7A 2XDAA 3O47A 2PZJA 4LIPD 2KS6A 5ILOA 5EJFA 4QVIA 5CECB 4ZQIA 1ZOLA 4I9GA 5E6UA 3M5WA 1P0FA 2FDRA 4JA0A 2ZWOA 3ZQ6A 5FOQA 5JFGA 4D6XA 1GDDA 2W2OA 2ZT7A 1ZU4A 3BGVA 1KI6B 2EQXA 1T6NA 4HX2A 4ISCA 5ENNA 3ZJUA 1NVMB 1P1CA 2Y0EA 1A77A 3AOEC 3QMVA 3QTLA 3EZYA 3I8SA 4C0HA 2XEVA 4CDMA 3Q15C 3II6X 3RS7A 1L4FA 1O89A 4UDOA 2HA0A 2LSVA 3DV0B 2XMDA 4KSBA 1E6KA 5COBA 4OI0A 2NSYA 3PNLA 1AS0A 1V3QE 4FZVA 3TKAA 4Q66C 3ZKWA 3OURA 3J7AC 1VFPA 2P9QA 3WXMA 2IXTA 2WXJA 2OR3A 4CDNA 4I1AA 4WNEA 2VTEA 4PLHA 3RVDA 5HIJA 4M0CA 2MOWA 1YVUA 4Y8VA 3RREA 2FZ4A 2ODEA 1Y7PA 1AQNA 3OMWA 4QODA 2B36A 2P58C 4BEWA 4ZMSA 1N0WA 4XJXA 4JB8P 1F0YA 4IX1A 3GLIA 4P7KA 1N4PA 2XGOA 3J5PA 3ORQA 1VDZA 3VHXA 1LX6A 2JLRA 4E03A 2X7XA 3DEFA 3I0MA 1AKWA 4P0TA 3RANA 1RZUA 4HAWA 3TFWA 2V0GA 1PP4A 4GQIA 3NHMA 3LBYA 4QEKA 3RF7A 1EUDA 1M7BA 3CVJA 4BB6A 3C8DA 1EX1A 2YOGA 5BXQC 5JCJD 3IUJA 2AYXA 2V5VA 5DSZA 5FOWA 5K6TA 3C5EA 4L2YA 1NXVA 4JI4B 3AXSA 1QLWA 2XYHA 5CK4A 1HK7A 3BEOA 3NC4A 3TTSA 1Q57A 2AE1A 5IW8A 2H00A 1HDEA 1MJNA 1ST2A 3KQSA 1RQRA 5CTJA 3RKVA 1ZM3A 5JZBA 4YACA 4FDAA 2ZSFA 4I9EA 1Z4PX 1FLAA 4ZHBA 2RAFA 3R7WB 4BY9E 3ZCTA 4YVQC 3P1UA 4IZ6A 1PNOA 3KDAA 1CRZA 4X24A 4MPRA 3BHMA 1G4UR 2J9GA 3B9RA 3KIPA 4P5DA 2WJ6A 4I1RA 4KQ2A 1ZUNB 4IG9A 3S3TA 5J59A 3NHUA 3ZVVA 2OG2A 3BFVA 4Z1MA 5B6PA 2Y6VA 5DCUA 3D64A 1SPBS 4EVSA 5LXTA 1QZZA 2OBLA 5CDFE 1Q0SA 4YMTA 1J7JA 1FFBA 3ABZA 4FFLA 1GVHA 3AI2A 4KQXA 4ZJPA 1Y9DA 3LXUX 2ZXWE 1FNMA 4JA9A 5L7YA 3RS5A 5T57A 3EXG1 3UM0A 1E92A 1EFKA 1SK9A 1FFHA 1V96A 1N9GB 2DR3A 2X41A 2G17A 3BAZA 4FVTA 4N5NA 1UEIA 5K45A 2ZB7A 4WWNA 3FLMA 3LX5A 3TTWA 4BMZA 3OIWA 5D01A 5KIAA 3FMOB 4KWCA 4CMCA 3BQ9A 3B7SA 3AEXA 3ANLA 2HPHA 4MLZA 5JMWA 3NKVA 3OCZA 1ZU5A 2OGTA 7MHTA 2OHFA 1SXGA 4I66A 3SJBA 1K0FA 3PNLB 1Z07A 2AI2A 3TNFA 3TVDA 2ODNA 2NN3C 3VR4D 3W5DA 1OT8A 3RPEA 5L45A 4RMHA 1ZLYA 3TWVA 2DBQA 1P0IA 5FOUA 3AIOA 1L1EA 1YR8A 4PXYA 3R7AA 1FQKA 2O2JA 1JLKA 3DGFC 4IIGA 3HDTA 1RKQA 3LUHA 3QPDA 2KE5A 1KAQA 5KSYA 3M4XA 1SZJG 5LZ2A 5IX8A 2YCLA 3OQOA 3EZ7A 4R1TA 4QICA 1WBDA 3AZPA 1PTKA 2IJGX 3RI3A 2NVOA 1WX1A 3TQRA 2R1VB 4BLUA 3LZCA 2XB6A 3IMGA 3KXPA 5CRUA 1XTBA 3MTGA 1FUEA 3V8MA 3AY3A 4AI6A 4P4GA 3GJXC 2RH4A 4LWQA 3L4JA 1N3BA 1ONOA 4MULA 3TEMA 3TWWA 1Y8CA 3EZNA 4J6FA 1KNQA 3BQMB 4ECEA 1YMPA 3JWIA 4XI9A 1QH8B 1VBNA 1W25A 3UATA 3UKJA 4B09A 4HAOA 4IL5A 1NN1A 5CVTA 4GOXA 3MQFA 5EJ9A 1Q0TA 4G89A 4EWLA 4BNZA 1IUPA 4TTVA 3ROZA 4QUJA 5K0BA 5D3MB 2BELA 3IA2A 4GWLA 3THXB 3QARA 5LKRA 1SM4A 1P2SA 3HFRA 4UWKA 3R7QA 2Q7DA 4IH1A 2PUTA 3R6DA 3Q8LA 2GAJA 3ED5A 1R0XA 4KMMA 5IJZA 3MJRA 3ZHEB 1SCUB 1T8WA 2RK6A 3A0RB 3GCXA 2QZJA 1YTUA 1NVGA 4B0OA 1IBLB 1EFDN 2QAJA 3NM5A 4J1TA 5DXJA 4WDQA 2C2YA 1E3JA 1UQRA 2XQKA 1DQYA 3ETGA 3VPAA 5TS2A 3ZXSA 4XX1A 1JHUA 3P2BA 4EP1A 4L50A 4XARA 3OTIA 2X5JO 2XWBF 2AZTA 4RQTA 4IIBA 4O4LB 2IWRA 1L4LA 3ZXXA 2PKEA 3DEPA 3RK0A 4DW8A 2BUBA 3F78A 3QKRA 4XPIA 2XH8A 3L0DA 5EMHA 2Z08A 2NW6A 3EEQA 1AN0A 3AKZA 4E2YA 3EDRA 4LGMA 4BS9A 3VA7A 1U1CA 2E6KA 3L6CA 4HUJA 1YQDA 2GI4A 2BDUA 1YT5A 2H4YA 3IQGX 4NEGA 4EQZA 3OOEA 3N0RA 2DMRA 2XJ4A 3L5OA 5CX1A 1IEQA 5AESA 1S6YA 1Z7YA 4JYBA 4UXHA 2C7QA 4OUKX 2WFLB 4M49A 3G2WA 2O2YA 2ENWA 5FQ8A 4PUCA 2Z57A 1F38A 1NXOA 4NZ9A 3OIVA 2L0TB 2PHZA 4MS3A 3UK1A 5HM8A 2BTEA 2PTHA 3L8CA 1FS5A 3N8GA 4PSUA 3FB4A 1BH2A 3IT2A 3O1JC 4PR3A 1GCGA 2JRLA 3GQBA 4U5XA 1SXPA 2XOXA 4II2A 3I92A 2P3LA 4J16A 2PMFA 5A9RA 4TYYA 5IULC 3TRIA 2PANA 2Y6UA 3C6XA 2XXAB 2GCOA 4RJ2A 1W0KD 3PIRA 4YAGA 1KI4A 1DKRA 1T36A 1YJCA 3C3DA 1EGMB 2DWQA 2PBZA 2C4MA 5IK2D 2FSIA 3OE5A 3CA8A 5BVGA 2HRBA 3TW0A 621PA 1G3MA 1Q1ZA 1ZSVA 3HB4X 2IHYA 4HB2A 4BP1A 3MCAA 2YFKA 5FINA 3TG4A 2YNMC 1ESCA 3ONNA 2IGBA 4FHZA 1GV0A 2WXFA 3CGHA 4JI2B 3AU8A 3MAJA 4F11A 4GXRA 1XBTA 2W2MA 1SAYA 1OFVA 3HDJA 3IMKA 1IUOA 4L6IA 3H11B 4E5DA 1ZH8A 5LQSA 4KPFC 3ZWVA 1TVMA 1L5HA 1AQLA 1LD8A 1OIVA 1HQCA 3Q8XB 2FDCA 5ALHA 3SSMA 5CB8A 3J80A 5JNUA 1Z6QA 4M0LA 5EIWA 4BQFA 1WL8A 1ZIXA 3EGEA 3IOCA 4GAAA 1DFHA 4UWLA 4FI3C 3X3HA 5ALDA 4CEIB 3ML9A 2ZRDA 4YMSA 1CY4A 1K27A 3AP1A 4RVFA 4RUKA 1V8PA 4JC4A 1N4AA 1U28A 4E5MA 2FP4B 1XDGA 5BP7A 4TMWA 3EVCA 4V0KA 3PWKA 5IVIA 3WWEA 2R7MA 3GP5A 4MR9B 3EOAI 2YVAA 2B1IA 4NAHA 4AJ2A 4DNXA 5ALXA 2ILRA 2NU7A 4KR9A 1P7YA 1ZJYA 4KQMA 3LNCA 4F3CA 4G86A 4QBKA 5B1DA 3WDSA 4C6SA 1Z29A 2IUEA 1D8EA 3KLPX 4Q34A 4LFAB 4LY3A 1NW3A 3GLTA 3E4BA 3KJFA 1DQNA 3C98A 2G8NA 1ZD1A 4DQ0A 1GXSA 1EUDB 1UJCA 4BSZB 4ZGGA 4IQ8A 5KYWB 2FWRA 2JAHA 2XUKA 2YQ5A 4HDOB 4Y2UA 5AXAA 1K3ZD 1YB4A 4UNSA 3TB6A 3WLKX 4EYGA 3DSXA 5FBLB 1JR6A 1A3CA 3RARA 1Q16A 2VBFA 1C14A 4L9SA 2B3DA 5E0KB 4AZ0B 4BTAA 1L1RA 4G1UC 4HPWA 5TQJA 5IHXA 4PYMA 1T4MA 5DLEA 3NOCD 3GIWA 1O96B 2ODBA 1FCJA 1M8KA 4U7EB 3B82A 3L1VA 4R71A 3G1UA 4L3OA 1CUJA 1ZHFA 1G7SA 3LDHA 2D7JA 5GV8A 2YWRA 4YNBA 1LWOA 1JB1A 3E37A 2R87A 3H1GA 2FPMA 2LNDA 4KODA 5BQ3A 1M0WA 4B3DA 2WM9A 4EKIA 4A16A 3G2UA 1GSHA 1AHIA 2QDKA 3GVPA 3SF8B 2R2LA 4RS3A 5HOEA 3K96A 4DX5D 2OCIA 3D1LA 4R7GA 4FWTA 1W75A 1QCCA 1HYBA 1S2GA 3DRAA 4DRXA 4TLEA 3AT1A 4ERNA 4D3YA 1KRHA 3HLKA 3U3KA 2XPYA 5AQ7A 1X14A 3HZOA 3AKYA 2CEKA 4XLZA 1HX7A 1UJ2A 1OXXK 2P9FA 2J7KA 2VZ0A 1NMZA 3L7MA 2Z56A 4TTPA 4BBPA 1NQWA 4UBKA 3H4TA 3UUXA 5C1IA 3SG0A 1Z5NA 2WJ4A 2ZYTX 1TGYA 1UP7A 4RHUA 3R6GA 5C1BA 2F8SA 1LTXA 4LHEA 5AKYA 3WYBA 5EE1A 4HRMB 3E2IA 3DNFA 4O4HB 4H7PA 1AGYA 2WZCA 5HKOA 2AMVA 4KAJA 4OAOA 2IEYA 3NHBA 4LRZA 2FZEA 3NR2A 5AHKA 5FTJA 2P69A 1E32A 5BW4A 4CGVA 1BX0A 2QPOA 1ZBPA 1U9YA 3CY6A 4YCBA 5CLLA 2X1MA 3TECE 5JCXA 3MS2A 5KCZA 1QJ4A 4PZCA 5H02A 3THYB 1DKMA 4QG7A 1IZ0A 4L8GA 4PZ9A 5KZMB 5GJBA 1N0IA 2OVFA 2B1QA 3D4LA 3GIDA 3F98A 4G2NA 1XMJA 3I32A 3JZMA 4QUEA 5I4CA 2DYSE 1GHTA 3KOWA 4XCVA 4XM1A 1NP7A 1T5LA 3HSSA 5AW7A 1H5QA 1WZEA 3TRKA 4AT1A 3EPLA 2POCA 3CKYA 3ZI7A 2C3YA 1CUYA 5F9HA 4JGGA 4Q48A 3PZDA 4MYSA 4OAUC 4BAGA 3NI2A 5FRDA 3UG6A 4JMPA 1DTWA 1GGFA 2G9UA 3MT8A 4EB0A 4R31A 3M3HA 3WAKA 4EL0A 1E0AA 3Q73A 2QYJA 3HP4A 2ZSHA 4ZJYA 1RAEA 3FYCA 5JJLA 1HL3A 1CEYA 1PGJA 3B9PA 1Y9EA 4JLNA 1SN7A 2NX2A 3WB9A 4D1YA 2WXPA 4Q7MB 5I5EA 1TFRA 2X6TA 1K1BA 5JZOA 4RPGA 4N41A 4BETA 4JR2A 3G2JA 1Y4AE 2PX2A 1KGSA 5TJ9A 3FTDA 5F5LA 2Q2OA 3NHFA 5FNVB 4HDSA 4DIUA 1AB5A 1J90A 4GZMA 1M34E 3SFTA 2W00A 3EBPA 4GNKA 5IWCA 1HDYA 2JGRA 3I1JA 3WLSA 4DZRA 2IT1A 2XVAA 3K3PA 2VJMB 1E2KA 2M1ZA 1TZKA 3BCSA 3ZWCA 4ECAA 2YJGA 2GK7A 4CM8A 1YRAA 2F1KA 3MCZA 4QATA 2AXQA 1LS1A 4DG8A 3I6YA 5EZ5A 4OHYA 4Z8XA 3FYUA 4YDHB 5CNIA 5ALFA 4O1OA 4NYIR 4C4YA 1TF2A 4E6PA 3FMGA 3T5DA 1NJGA 3R9XB 1EK5A 2RG8A 1KJNA 1HM5A 4YJHA 2GXSA 3FYHA 3R0JA 3SICE 3U80A 1FMLA 4G1EB 1QVZA 1W48A 4LG1A 4N47A 1XQ6A 3TGOA 3DE5X 4TLCA 5IM4F 4FB4A 2X7HA 3LGSA 3ELYA 2ZCJA 4WHMA 4H0CA 5G0TA 2NSDA 3QBVA 1VJ0A 4MS6A 3UG7A 1KAOA 1T2VA 3OU6A 1JS1X 1U7DA 4D9BA 2NTVA 4IULA 4F8YA 4MUKA 4F4IA 3E3LA 3WRVA 4C7KA 1HI9A 4RZUA 3S1LA 3WBJA 1QR2A 3K0AB 1QZTA 4KXQA 1CY0A 2AA3A 1E1YA 1QS0B 1W2HA 7REQA 3F5DA 2C31A 3WGIA 1DIRA 2X0IA 3GPIA 1XMOB 2V7QD 4C3ZA 3GLQA 2OOSA 1HQKA 1OW3B 2BI7A 2OCKA 3O8OB 4PFKA 4TWBA 4Q9KA 1Y6FA 1YZUA 1LBTA 3K1TA 1GO2A 1UQUA 3GI1A 3GOHA 3O7MA 1Y7HA 3SF0A 1JR4A 2DZOA 1VHJA 5KVAA 1Y3CE 4XQGA 3I5AA 1YFLA 4MVJM 1PV1A 2ZJ0A 3FWVA 4FJYA 4RSRA 2SBTA 3S2IA 2AH5A 5JPDA 1TUEA 4JXKA 1KO5A 5K4HA 5HTKA 1CVRA 1UXIA 1CPYA 1YGYA 3K0EA 4KRYA 3V1KA 1RAFA 4K3VA 2H2AA 2QM0A 4YV2A 1CR1A 3BRSA 3U26A 2PSHA 2Y1GA 4F3NA 3VJRA 1TT5A 2YUTA 1XMSA 3M6XA 2FQYA 1JIXA 3HV2A 2DT5A 2LO6A 1W4BA 1ZI6A 1FLNA 2Q28A 4KQKA 4EMBA 2B5OA 3USZA 3T8KA 3C48A 5T3UA 3RG2A 2A0YA 4TV9F 3Q87B 1YCSB 5EWJA 3QZUA 4JLUA 4QUIA 5ES4B 5J2TF 1XU7A 2QTVB 3ZEAA 1VHWA 4KVFA 2VKQA 4I8IA 1YXMA 4KBQA 1YZYA 3QI7A 5REQB 4F1PA 1K89A 5KO2A 4YJGB 1XRLA 4A8JC 4JHXA 1TNOA 1Y9JA 4TV9A 3RODA 4JV5B 5J90A 5LA6A 3DLPX 4KYUA 4EPRA 3BB1A 2A1UB 5EE3A 1S2IA 3VYUB 4H1TA 3FOWA 2CNBA 1WCXA 1GRQA 1ILEA 4JN6B 1GEGA 4F4DA 1Q0HA 4REQB 4YAIA 3NP7A 3C6MA 5H8WA 1PQYA 3ZDDA 2IDKA 1HV8A 3F6PA 4RCYA 4WX2B 5K3OA 4DLNA 1GNQA 1NTOA 3H5OA 2RIRA 1SU4A 1DXOA 2JJ1D 4AN1A 4EFMA 3OXLA 4GR5A 4I3HA 4J9VA 3CNLA 3BILA 3Q7PA 1E94E 1IHBA 2QNIA 3Q8KA 2I65A 3KHKA 3F7TA 4PTYA 4TUYF 1OAOA 2VGEA 2EXXA 4V0LA 1BPOA 4CFSA 5H4GA 2F43A 1J2YA 1CKEA 4H15A 4UREA 4BVLA 9GPBA 4Q3DA 2PMDA 1RRVA 4HXIA 1ZY2A 5DHTA 3CK7A 2PZLA 3H9JA 4MGIR 4V1CB 4BJ1A 1MEEA 4M9QA 3N0VA 3CJQA 2EVWX 3H8SA 3AW9A 4D0RA 5HF5A 3Q75A 3DEKA 1HS6A 3SHWA 5ALOA 5D0OD 1QK3A 3QMMA 5T6BA 5IT5A 3TW4A 4L7TA 3QU4A 4IRMA 1VZ2A 2ECQA 3IESA 4MKHA 1JP7A 1RMTA 5IAEA 3AFOA 1JG7A 1Q21A 1P9NA 1UBGA 1XQ9A 2P4QA 3HB9A 4IS2A 4K7JA 2A4MA 5KNCA 2HXYA 3O9VA 2WUGA 2E85A 1H0SA 2PMEA 2HMYB 3EAFA 3A3KA 3RSOA 1KDYA 2FN4A 3EXIB 5CVVA 1WXEA 3CF4G 3D0KA 4UDYX 2FFQA 4DPRA 3HA7A 4DQVA 2C77A 2ZRMA 4MVJE 4PLWA 1LC0A 4IILA 3O3MB 5FUMA 3T4EA 3WHPA 2M9MA 4HDMA 1KVUA 4J0GA 4KO3S 3P19A 1C4WA 2CKDA 1KK3A 4G5SA 3NS7A 4HI9A 1UJMA 3EXHB 1YH3A 4PO1A 5CJPA 3RU2A 2OFOA 3TVYA 4FULA 3OQHA 4KITB 4LJLA 4KE6A 3ESAA 4UWHA 1CP3A 4WK0B 1CFJA 4GPKA 1N0HA 5TDHA 1K5DA 2QXTA 5F77A 3PITA 1JIUA 1LRLA 2D1FA 3A8TA 1RVDA 4B2LA 1IZ9A 2G5GX 2XTJA 3I9LA 4C4ZA 4R2LA 2J6HA 3BXHA 4MVJD 1XTKA 2HAEA 3FOCA 2X0FA 5K3FB 2RJOA 3KALA 4MXDA 2YINA 2CNWA 1UDXA 1E1CB 5AYWD 2O3JA 4LXQA 3AB7A 1V11B 4OU5A 3QU7A 4P08A 3TZBA 4RK0A 3DFFA 3IE1A 1RLUA 3EIFA 5I6DA 1WHSA 9LDBA 4X5OA 4NBVA 4TVBA 4E07A 1QP0A 2MT9A 2BEVA 3UM3A 3IP3A 3VBEA 3RGWS 3G88A 3F4BA 1VKZA 4EX7A 1IOWA 3GLHB 4YJFA 5AYVA 1W5AA 5HJ5A 1QIJA 4E5KA 1AHPA 2AXUA 2HA7A 4L0MA 3DDWA 3I62A 4KUGA 4EHMA 1BFUA 1I33A 3T15A 3PD0A 4UNIA 4EEZA 4RJLA 4DIEA 1HT1E 2BTQA 3DMHA 4RYDA 1U8YA 3GG2A 4PVDA 3BWCA 4GBMA 2ZRQA 3AEKA 4JQCA 3UT6A 5CG2A 1TYAE 1FDSA 4KW7A 4HN9A 1E89A 3B1XA 3LLSA 3NQPA 3JXIA 4MQ6A 5EIOA 4EG0A 2AK2A 2ENUA 3EW7A 4XGIA 3PXGA 1Q1QA 1EIWA 3IEPA 4WTOA 4EFKA 3AR2A 4IHJF 5CA0F 3ONVA 2R65A 1QIMA 4G4SO 4BYGA 3QEKA 1VHLA 1EWTA 3L6AA 5F98A 3NTRA 1E79D 1W4AA 3QFCA 1ZI9A 3H2JA 4G0YA 4RAQA 3Q8MA 2GK4A 4WK4B 5EZ6B 2YNMD 3CUKA 1F2DA 2AUMA 5ICSA 1U3GA 3KDSE 4TX1A 2P9EA 1MFPA 2JK0A 1V4BA 4XEHA 2J3DA 4I9HA 3RW9A 1DO0A 2I29A 4JNKA 3N7AA 1QG6A 2XECA 4H77A 4K6GA 1JT9A 1R6UA 4C06A 2GGSA 4M21A 5G1NA 1W7AA 4YJ2A 4IIVA 4N48A 4OYSA 1E9BA 2AOTB 3BRCA 1YBMA 2M6RA 4W6ZA 3WGMA 2Y1DA 4X8LA 4QNNA 2H31A 4BE4A 3U56A 4DUIA 1L4GA 3WYEA 1B1AA 3Q41A 4RAOA 1VHQA 2WJZB 3DL0A 4EF5A 2FPWA 3AJDA 3RVPA 2O2HA 4Q9LA 4B31A 2WPDA 3HY4A 5CT9A 3ME5A 1C81A 1Q14A 3DBLA 3FGOA 1F6BA 1XKLA 2IFTA 3HCCA 1YOBA 5AUOB 1XB2A 1XL1A 2XX3A 3SZLA 3VSEA 1VSVA 2OHVA 2VCEA 1JT2A 4N2SA 4U2CA 5JD4A 2BVNA 5A2GA 1TQHA 2IZ0A 5THQA 2WWIA 4EI2A 4Q9HA 3WGNA 2P9TA 4AG5A 3VU3A 1EWKA 3CRVA 2P9HA 2QLLA 1P60A 3DQQA 4A8JA 4BL5A 2GNPA 5BSRA 3GZ2A 2MRIA 1IIRA 1E64A 4MRVA 4CMEA 1ZMRA 4GZDA 3GYGA 7ADHA 1DPFA 2BFCB 3U60B 1I3KA 4XXHA 4Y1EA 3QSGA 3SM9A 4B32A 5JJKA 2DAPA 4E6HA 2VHYA 4KACA 3FRHA 4QASA 1IY9A 5D5PA 5TXGA 3WFIA 1MX1A 2MYOA 1HT2E 1X1BA 2V7GA 3B48A 3PP8A 1PYOA 3BGSA 4P4LA 4XUEA 1WB9A 3WLFA 3L0BA 1V4VA 5K03A 4LX8A 1QO9A 2C4WA 2HWWA 3ZNGA 2LD4A 2PFGA 1SU7A 1G5TA 4D74A 5JMPA 2AW3A 4RQIA 1XEWX 4JVNA 3DEIA 2B8WA 5EZYF 4D9HA 3TNLA 2VG8A 1RYFA 1B4DA 1P7WA 3K9CA 3P2IA 3P4YA 3VC1A 4WK2B 1CUAA 3WJ7A 4J3NA 1W4LA 1EVJA 2JI7A 5FWQA 3HP7A 4I4IA 4ZVQA 2QMYA 2R6GA 2WA1A 2YV3A 4R16A 5GMOA 1U90A 4FMCF 3ZX4A 3NVDA 3AIIA 1G55A 3CH6A 3WGQA 3AR9A 3GAZA 1ZN2A 1E4VA 2B21A 4UW9A 2GEFA 2AFHA 1QO0A 5D7BA 4C4PA 3C39A 1Q7EA 4V1CI 1XNGA 1XROA 4RBNA 4TZ6A 5CDFA 2DBYA 3OCYA 2D7CA 4POOA 1CY7A 4EDFA 1TLLA 3IR6A 4EW3A 3VKHA 3PHBE 2G67A 1P45A 3SJCA 3VYRB 3HJGA 2B2CA 4LJYA 4UMDA 5F4BA 3CEPB 4EPWA 4FBMA 1RYYA 1JFLA 3QE4A 3CFYA 5CU7A 5LQNA 1VL5A 3ZLJA 4JKYA 3OOWA 4GDFA 3VU0A 2HRCA 3CKCA 5AW2A 4KLRA 4EMUA 3KQKA 1EB9A 3GY0A 4PZDA 1LBSA 1WY7A 2XZDG 1EXWA 1T0IA 4H7EA 4OBWA 3V1MA 3W2EA 1TYBE 3W9FA 4HQKA 1E9SA 3ZY2A 3VSCA 2AVPA 2OV8A 3O31A 3FY4A 3UT4A 1DWUA 1Y4SA 4R2XA 1FYXA 3AKCA 2PZAA 3PXBA 4R2MA 1KAEA 3SMVA 4Q1AA 5HW0A 2ZDQA 1RM0A 3SJZA 3K70D 1GGVA 3G5LA 4EUSA 2FWBA 2ZCUA 1E96A 1ODCA 2V0PA 1V45E 4MKZA 1XZQA 4XJVA 3ORSA 2LZ0A 5AUPB 2ZSBA 2D0OB 1B0UA 1PDOA 4FJZA 2ZBFA 4WXHA 1Y8MA 5ALIA 5FPKA 3BH0A 1W19A 4XPIB 4M1KA 1I6LA 4LA4A 5K6RA 2EW2A 1CHNA 1NVXQ 1A8PA 3DDUA 2I03A 3ENQA 4NVRA 1H22A 1EWQA 3MFYA 2I1KA 1OXUA 3OJ0A 4Q3NA 1ZR2A 2FK8A 4N39A 4IHKA 5DWQA 2IEZA 2HK8A 1ZHHA 1WM5A 3O0DA 4J29A 2EJBA 1RZ3A 4RD4A 3ZWNA 3NDRA 3WDMA 4A03A 4A23A 10MHA 3ZDBA 2W90A 3E7DA 3B7BA 1M1YE 2WY2D 3JUEA 4QULA 2FLWA 3BXPA 5EIXA 5IT9A 3TG5A 1ZEMA 1SURA 3IXQA 4FMPA 1G6Q1 2O7RA 3CVUA 1USIA 2PIDA 2X0KA 4GEGA 3T9FA 4AO8A 1XXHB 4YECA 4K6CA 5K8VA 1TYCA 1BWPA 1F9AA 4DIBA 2ODTX 2OM6A 4UPEA 4R8SA 3G59A 4HRLA 5KYKA 3KKQA 1IULA 4LHWA 3CUUA 4GOLD 4LMBA 5L7TA 3WTCA 1ANKA 2JPDA 2XSZA 4I2VA 4MR7A 4H4EA 3TRDA 1VRCA 3VRHA 4BMDA 4HLNA 1L9KA 2JEYA 3EVEA 1QRUA 2VDVE 3NWPA 3GEGA 4OHVA 1QWOA 2VZLA 3ZV4A 4ZKDA 1AUQA 3GMSA 4ZIRA 2J48A 3SZOA 1E0SA 3A2MA 2BHTA 3CKMA 5IUKC 3CW9A 3JQBA 2V6FA 4RGYA 1TB4A 1TU3A 3E81A 3QX8A 4U7GA 4B81A 1FDIA 1G8JA 3PZRA 3QF7A 5JC8A 3EVFA 5J2TA 1JLMA 1XLTA 4U2KA 1GEEA 1X7XB 1FUYB 4BEJA 3SQWA 1JAXA 3HCNA 5F3DA 3DAPA 4JLAA 3ZZTA 4GWGA 4Q69A 3FOAA 1GCOA 4TS1A 3HA5A 4TXQA 2BCEA 2BMFA 2VQ6A 2DQZA 1OI7A 2I3GA 3NU1A 1TQ2A 4DM4A 4G8BA 4Z4HA 4HC4A 2CDAA 4UHFA 3SHVA 5IY5E 3AZOA 3UFXB 3WSWA 1MBZA 2QWXA 2WSIA 5KJCA 3CLRD 1WCWA 3A3YA 2HJGA 2IYPA 2Q0XA 3MWFA 1ORTA 2B4QA 5ESRA 5H16A 4ZI7A 1SVNA 1J5PA 3U44A 1NSTA 2I2XB 4JEIA 1XQYA 2YQ8A 4EZLA 1USKA 1R4MA 2JEKA 2Y1LE 3D0QA 3VZPA 4DCSA 4KDCA 4UWFA 3HMKA 4QRDA 2IHTA 5A3SA 3N75A 3UTCA 3PENA 1YQUA 4URFA 1XYYA 3HN7A 4P3PA 4TWRA 2AHRA 3CO0S 3P0RA 5HQ3B 2F3QA 2EILE 4L7VA 1CS0B 3JATA 3QOYA 2ZI3A 1DBWA 3RIXA 1RRCA 4XX5A 4YR7A 4X8OA 2FSUA 4WXEA 5ARGA 1HTBA 1PBNA 2HXGA 1SBCA 2APJA 1DTEA 1C0LA 1ZN8A 2PGNA 3KOMA 4KQCA 4MJ7A 4CV2A 3O4IA 3S7BA 3P2KA 2XENA 4ICIA 1BROA 4FP7A 2FBNA 1YS7A 1JHDA 2H11A 5K3CA 4LXHA 5C0OE 3TCXB 4RIEA 1K7EB 5KYWA 1A4IA 2ADMA 3O4JA 2M1XA 3U4GA 1FS4A 4G8KA 2CNOA 2EBFX 2I4MA 4G65A 3LBFA 2QVYX 4A1SA 3PF8A 4EPVA 5K09A 4JXXA 1GM5A 3UH1A 3KEZA 2WOOA 4I5IA 3S2EA 2WUVA 3AX6A 3PQ7A 4NHEA 3TMYA 5IG2A 3EDTB 1JWBB 4B47A 4CCYB 4TZTA 3VU9B 2VPXA 2QTLA 1CQIA 4JJAA 2ZZNA 3D7SA 3C3PA 4E3ZA 1MQ9A 4BV9A 1HDGO 4MUGA 1WBBA 2QN1A 4MINA 4QDJA 1O0CA 2UV8A 4IO1A 3HHPA 2DE0X 3L1KA 2HU8A 1Y3HA 3DHVA 5BRAA 3I12A 5HRYA 2P65A 1B15A 4MWZA 3REQA 4NENA 3MC1A 3R5SA 1B26A 4V3CA 3QAQA 2ZB2A 1A72A 1MRSA 2DBZA 1NNLA 4CCSA 5CT6A 4BNFA 1FDWA 1K3FA 5DDIP 5A4MS 2FPGA 4O2BA 1ONPA 1DJMA 3WGHA 1AKTA 2X9QA 3WL7A 1T91A 3MMXA 1E69A 2C7GA 3O3OB 5I51A 3OXGA 2A35A 2EKZA 4W5RA 1UKZA 1J6UA 1BHO1 5CBOA 3VR4A 2AVNA 1OBCA 2CLFB 4I1PA 1N2ZA 4HAXA 3ZTYA 4F1KA 3DBVO 1QFXA 1BEEA 3LQKA 4QBHA 2LSUA 1T9HA 3IOEA 4A8PA 5IUJC 5ALSA 3HYMB 3EXFB 2FMUA 3FYSA 3KS9A 3N5KA 3APDA 2FUG1 4B73A 4DYVA 2EJWA 2F8LA 5DLPA 1G5IA 1JYFA 3KOOA 4JJ8A 4TSKA 2PGJA 3DL7A 3PDCA 4P3YA 4UVGA 3RYHB 5AWFC 4CM7A 1RYMA 4K5CA 1UZAA 3LT5A 1OQAA 3Q6IA 1GG2A 4LYJA 3T9AA 4GX2A 3UUFA 3WKBA 1PR4A 4B0ZA 4EHJA 2QU7A 1RKUA 4K5AB 2ZRLA 4P4TA 5AVSA 3W2FA 1P5FA 1FU8A 5E1DA 1JNYA 1KTVA 1XKTA 3QW2A 4UE3S 4UTZA 3DDOA 2W2LD 1BTOA 5F9MA 1RC8A 3NV7A 2O1XA 3O84A 1E2IA 4Z1MD 2H4JA 3V33A 1A96A 1N6LA 4AJHA 4FOLA 4PWZA 5AOBA 3VR6H 5A4FS 2OCDA 2QW1A 3LP8A 4BPRA 1XTUA 2ZISA 3BMQB 3KHUA 1X13A 1SELA 2O50A 4CF3A 2G1KA 4RTSA 1G291 1KK1A 4J8EA 3M9WA 1X7GA 4LJRA 2VDNB 1JB9A 1E8YA 3KJXA 2BONA 5IJ0B 1MH9A 4IWNA 3VAYA 3X1MA 1W2GA 3RTGA 2B5WA 3ESYA 5DCYA 3O4RA 4JT4A 4ZANA 1XVTA 1DKOA 3DZIA 3QYAA 4FN5A 2ZRNA 3UIPC 3C6YA 4CIYA 5BV1A 1LGYA 1IB0A 1A9XB 3OPNA 1NE2A 4CN8A 3KLOA 1E2NA 2Q5OA 1V95A 2VP3A 2QGFA 1SC4A 2PQ0A 3E5MA 3QQPA 4AUNA 5A3JA 5LMZA 1OCOE 2XRZA 1K4KA 1STOA 3AGQA 1Z4JA 4UHEA 4ZT4A 4XE5A 3CMCO 4DSNA 1FFSA 3HA2A 2ASEA 1VLQA 3AR3A 4K0KB 1Y1PA 1M6YA 3D6NB 4MZDA 1OC4A 1ORDA 3GJYA 3O90A 1J8VA 4IUCS 3EQZA 2ZT6A 3WZLA 3AF1A 4A2WA 2YQ4A 3EQ6A 1J24A 1IDOA 3CHYA 5HK8A 1A5TA 1QMGA 5K0JA 1W4CA 3JASA 3PEVA 1V41E 2QQEA 2VJAA 4IXTA 1B16A 1BDMA 2VTKA 3PZBA 2HWUA 3C1UA 4M88A 5I4IA 2ZKIA 2RD0A 2BMEA 3VNSA 2YJ5A 5EILA 1JPLA 1L7MA 1Z5PA 4N5QA 1D4FA 2JDID 5I7HA 1C1DA 1OD6A 3A6LA 3AJAA 4QUBA 3WX0A 2QLNA 2GB4A 2ZIEA 2J67A 1O03A 5DPMA 2XT6A 3D7KA 1WEKA 3JWHA 4V0ME 3ZCXA 4EBAA 1PC2A 3UJBA 3Q11A 1FC0A 2CZGA 1G4HA 3DDHA 4R7ZA 3W1VA 3SHTA 4ZO9A 1B76A 2VHJA 5BR7A 1Q83A 4CQMA 2BKXA 3ZWKA 5JROA 3FOEC 5IDXA 1UJNA 4YXWD 3S2YA 4YMLA 4OX9B 3C4VA 5ARCA 4QQKA 4FHJA 1I7DA 1LD7A 4JNCA 4BKPA 3PDJA 1CQIB 5GINE 4RCZA 4L2LA 1QQ5A 2Y9PB 2FPIA 3FI0A 1T0UA 1WXGA 2GRJA 2WKPA 2XGSA 1F8UA 2AV6A 2IF0A 2MOKA 4HUQA 4OJMX 1IMJA 1SHZA 2O8EB 4QLOA 4U2EA 4BMCA 1DEAA 1OAAA 2IHUA 4F86A 1AUPA 3ZW9A 1Y98A 1SVIA 2F3SA 6GPBA 1KQFA 4BEPA 3ENKA 1N9GA 1YMVA 3HUEA 2PLFA 2OORA 1H3NA 3K0FA 2UZIR 4KK3A 3DYVA 3DXYA 1MJGA 3FWPA 3MMZA 3OAWA 4Q3CA 2VK8A 3A6EA 3ZPXA 5KWIA 1GKIA 5H7XA 5CNKA 1J8YF 2FE4A 4ZOCA 1CZHA 2P1DA 4CG2A 1I4EB 2WKSA 4M9SA 3FXAA 3HDXA 2ZVJA 1F9EA 4FGUA 4WJKB 2ZJ5A 4H2DA 1P77A 4TSRA 1YJ8A 2JFHA 3ROPA 2ZTSA 3GRUA 2BFPA 5IMBA 2PLRA 2PX3A 1ZNXA 2H2HA 4N0MA 6REQA 5ITVA 1DLIA 5A23A 4K6MA 4Z9FA 5M3BA 3UK6A 1NXSA 1IBRA 1CZOA 3PLNA 3UH0A 1ADCA 2A5YB 5ITZF 1WD7A 2F62A 2O2DA 1N11A 1NXPA 3IYLW 3URMA 1QKKA 2HZBA 3FNHA 4WL0A 5AD1A 1RYNA 2Q5EA 2J6BA 3IVCA 2GFQA 3NTVA 3OLCX 5C35A 4DEXA 3ES9A 3ZEFA 3OOHA 4YFVA 5BWLA 4Y6RA 2ZEJA 4DUZB 5A2QA 4J8PA 1XE3A 5DZSA 3Q5DA 3QNMA 4KXWA 3UFBA 3FNFA 3IPRA 1DV1A 4K6OA 1ZOSA 3IEGA 1ZVMA 4RDIA 5SZKB 2RMKA 2QP4A 1SWWA 3QFTA 2DM6A 2WVJA 4NE2A 4RPKA 4CQMD 3FUIA 1GOTA 3OX1A 4M55A 5EKXA 4UJ3A 1RCUA 1PAUA 4MVYA 4AJJA 2OGWA 2Z1NA 3I58A 3IJRA 3VNBA 1HE8B 5EIDA 2Q3JA 3WGKA 1OFHA 1LY1A 1YS6A 1Z0KA 3NGLA 4Y2PA 1UMCA 2WEKA 1N1GA 3AB3A 5TR9A 3PRHA 1MF7A 1NGSA 1R4NB 3R3VA 1CEXA 2E1PA 3TBHA 2CYBA 3TDKA 3DKRA 2NO1A 2Y99A 1TU0A 3LC1O 3COSA 2FCAA 1A9OA 1BC5A 1KKMA 1PZHA 2GERA 2H7CA 1G5PA 2HDWA 2WPVA 2QMUA 3I4CA 4RVNA 4W6QA 3MZ0A 1MPXA 3KD3A 4E5YA 1UBSB 2WLTA 2ZTHA 2J08A 1ZD2P 5FP0A 1FDOA 1H1TA 1QHYA 2FW1A 3KSZO 3L8FA 4UUAA 4J75A 1VCMA 3G0GA 4GLLA 3RADC 3MCVA 1OUVA 1L8OA 2XEEA 2ID4A 3QXGA 3VYSB 2P4HX 2OQIA 2VUHB 2PVCA 4KXNA 1C7ZA 1G38A 3PHCA 4IIHA 4BFYA 2FPKA 3NTUA 3SBDA 3G9XA 3B7RL 3QPCA 4L51A 1KKUA 4QXPA 1KLXA 4OI4A 3B1VA 1NBWB 3ASVA 4RMJA 5DN6A 4DTIA 2IV7A 1U2TA 4N5CA 1H9BA 2AJLI 2V4UA 4XB2A 4ZPXA 2X8LA 5DASA 3ENVA 1WO8A 5GGYA 3VJMA 2UUBB 1VG0B 4P0QB 5KJLA 1ECGA 2KMLA 4CM4B 2AFIB 1XLWA 4K6KA 1I7LA 3RWBA 3T3DA 3NNDA 2I2AA 1RD4A 1X80A 2ZOSA 3S55A 5BOSB 4YRMA 3IXLA 1NVWQ 1U0HC 1B2RA 7REQB 3GFPA 4BNGA 1ORHA 3E53A 5EG5A 2QEQA 5DK4A 2DZDA 2XHEA 3DAOA 1BE1A 4CM8B 5FWXB 2OT3B 4PVCA 1RZ4A 3ETEA 3ZJ4A 2F00A 2INGX 2E5LB 4GKKB 4V02A 2WFAA 1G4AE 2HYZA 1W581 1JKFA 4O8ZA 2KBEA 3L9WA 4EYSA 1NAIA 3ZHSA 3CVPA 1M2KA 1XZCA 3AW8A 3V2OA 1ZKDA 4I4NA 3GLGA 3A9WA 2W4IA 1E2HA 2JBAA 3WQSB 4NV0A 1WXDA 4F9FA 5ADWA 3H2BA 4NWIA 1F2UB 2DF8A 1DTSA 3LE8A 2PRKA 4ID3A 4AFNA 5IVPA 1BDBA 2QBYB 2XJ9A 2X76A 4OQNA 1C7RA 3L7IA 2BBWA 2IL1A 3RJVA 4MSUA 4IIFA 3I64A 2J41A <