4BX9A

Human vps33a in complex with a fragment of human vps16
Total Genus 223
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
223
sequence length
594
structure length
574
Chain Sequence
AAHLSYGRVNLNVLREAVRRELREFLDKCAGSKAIVWDEYLTGPFGLIAQYSLLKEHEVEKMFTLKGNRLPAADVKNIIFFVRPRLELMDIIAENVLSEDRRGPTRDFHILFVPRRSLLCEQRLKDLGVLGSFIHREEYSLDLIPFDGDLLSMESEGAFKECYLEGDQTSLYHAAKGLMTLQALYGTIPQIFGKGECARQVANMMIRMKREFTGSQNSIFPVFDNLLLLDRNVDLLTPLATQLTYEGLIDEIYGIQNSYVKLPPEKFAPKTEAKKLQLNSAEELYAEIRDKNFNAVGSVLSKKAKIISAAFEERHNAKTVGEIKQFVSQLPHMQAARGSLANHTSIAELIKDVTTSEDFFDKLTVEQEFMSGIDTDKVNNYIEDCIAQKHSLIKVLRLVCLQSVCNSGLKQKVLDYYKREILQTYGYEHILTLHNLEKAGLLKPQTGGRNNYPTIRKTLRLWMDDVNEQNPTDISYVYSGYAPLSVRLAQLLSRPGWRSIEEVLRILPGPHFEERQPLPTNRVTLIFFLGGVTFAEIAALRFLSQLEDGGTEYVIATTKLMNGTSWIEALMEKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords VACUOLAR PROTEIN SORTING-ASSOCIATED PROTEIN 33A
publication title Structural basis of Vps33A recruitment to the human HOPS complex by Vps16.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
total genus 223
structure length 574
sequence length 594
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00995 Sec1 Sec1 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.850 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4bx9A04
3.40.50.1910 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4bx9A02
3.40.50.2060 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4bx9A01
3.90.830.10 Alpha Beta Alpha-Beta Complex Syntaxin Binding Protein 1; Chain A, domain 2 Syntaxin Binding Protein 1; Chain A, domain 2 4bx9A03
1Y9JA 4BX8A 4JEHA 3PUJA 5BUZA 1EPUA 4JC8A 1FVHA 3C98A 2XHEA 1MQSA 4CCAA 3PUKA 5BV0A 5BV1A 4JEUA 4KMOA 1FVFA 4BX9A
chains in the Genus database with same CATH superfamily
1T9KA 2OZLB 1BDMA 2BI4A 4JA0A 4FZRA 1TAQA 5FI5A 4K5AB 3AO0B 2J6IA 4J0JA 1ESEA 4AUEA 4GMLA 3CEQA 2HWYA 3KAJA 2BGRA 3HDYA 4DLKA 4XLTA 1AMOA 1IBCA 3EIJA 1KKLA 4HQDA 3ZDEA 3BH0A 3GIDA 3B1JA 1H5UA 3G5LA 3DZCA 5A6CA 5BOSB 4L3VA 5FOXA 1ULSA 3MGCA 4LDAA 4OJTA 4EY5A 3FUTA 1M74A 2VP5A 3CUVA 5LDDC 4QE3A 3W2IA 2HA2A 4Z1MA 2H1HA 1EFPA 1MH1A 2IW3A 2BD0A 2ZSUA 1QCDA 4LC9A 4Y2GA 3AZOA 2JH9A 3GBPA 5IK2D 4ILHB 1KZGB 1N4AA 5AOAA 4Q4JB 3K4PA 3V00A 5JZOA 3KTAB 4Z49A 5JZMA 4IWNA 1V6AA 4OB8A 2L9BA 2XZTG 1WRBA 3ETEA 1KVSA 1UJCA 3UB4A 2AUTA 5DZSA 221PA 2OK8A 4UJ3A 2J9ZB 3DBRA 1GGVA 5J4HA 3I1IA 1K8KG 2CVOA 2Q6LA 4CLDA 3KVNA 1X14A 3GFFA 2WAXA 4MS1A 2WM9A 3FPSA 4DT1A 3HIZA 3VI4B 4G81A 1VG1A 2Y0PA 1FYFA 2R00C 1P19A 2WD7B 3AF2A 1ZZGA 4WK2B 5KDLA 1COWA 4QHYA 3W34A 2MTBA 2J0SA 3T7DA 3QMPA 3MKRA 1PK9A 4EHFA 2ZJ1A 3GQVA 4CHTA 2CL0X 5PGMA 5EFZA 4E4YA 1V11A 2IF4A 3I5PA 4WXPA 4DV3B 1S89A 4ANUA 2YUTA 1I3CA 2AG8A 2PQNA 1RWXA 3WGQA 4BP9A 2A5UA 1R4ZA 3VH4A 2AVDA 4KTTE 3HBNA 4U0KA 1EVIA 1YGYA 2V4UA 4PX9A 4IF6A 4CCYB 3U61B 3GJ5A 1YS2X 4MKHA 1IQPA 2QLJA 3ANTA 3GFGA 3JUEA 2EILE 3OCYA 4Q3NA 1RHJA 5LP0A 4C06A 3JRNA 2YHIB 5IXJA 2QROA 1BX0A 3PNYA 5CHYA 1IN7A 3T5TA 5K1ZA 4KWEA 5G40A 4C43A 1T5TA 3S7JA 2QY6A 3OQIA 3PZ1A 3VO8A 4MYSA 4N3AA 2VCEA 3INNA 4WGGA 1XAJA 1Q0TA 1VCHA 2VQ3A 3TUZC 2KZTB 2SKDA 1Y1RA 4L27A 3IYLW 2EP7A 3O93A 3NTLA 4TYPA 1N5OX 3KJNA 3ORSA 4QU0A 2XCBA 2QN1A 4TS9A 3AKEA 5LZ5A 4QT4A 4PC2A 5A6VA 3OWHA 3SVTA 2WF9A 3T7SA 3KVVA 1U1FA 3EIUA 3IPCA 4B9EA 3P0JA 1F8YA 2QUIA 3I34X 3A58B 1A2OA 2KW5A 2QLTA 3G1WA 2VUTA 3UATA 4D0GA 4BZPA 2YJGA 3O94A 5AW1A 2BEVB 2YY5A 1OCRE 2GM4A 3MOSA 4E5SA 1C3VA 2COEA 4EF6A 1XX6A 4DNQA 2QL6A 1PKEA 3KWMA 4KQEA 5DBIA 4UUCA 1DIOB 4AQYB 2B2XA 3V8MA 1YO6A 1UBUS 1NNEA 4J03A 4WI1A 4O63O 1M6VA 1U4OA 1KXZA 4TV3A 4OVKA 2PRYA 2H92A 2WWHA 2PXHA 2PKQO 4TTSA 1ADGA 4FULA 1E1RA 4MVJI 3UICA 3AHCA 4JYBA 4DI3A 2WWYA 5C5DA 1ZL0A 2XIJA 3I5AA 5IM4F 4EJSC 4LYGA 3Q5MA 1ADJA 4GZLA 1XN1A 3FH5A 2WTXA 3TJPA 3QYFA 4ILIA 4MGKR 4ARSA 4XWWA 3T9EA 4O2AB 2J1LA 5CVJA 5AJYA 1EKXA 2FMHA 1HG0A 4W7SA 1YBVA 2CXNA 3E18A 4W5WA 1E2GA 3BZBA 1TZKA 4FX2A 3T3NA 1WB4A 1Y8QB 1U7XA 2IZ7A 4P3NA 2M63A 5A71A 4A3VA 4DSAA 4S1OA 4CXMA 4HRVA 4HLDA 1EX9A 1V1RB 4F86A 2BUBA 5K0EA 3ZHZA 4BBPA 3GJ6A 4UTNA 3OTHA 4OQEA 5E4FA 1NI5A 1DRKA 3B3GA 1U7WA 2VHWA 1Q74A 1C3OB 2B1GA 4G8BA 4CEMA 2LDXA 4J1TA 5THQA 1VKHA 2D13A 1OPRA 1LLFA 3T3HA 1KQ3A 5BXOA 5HR5A 2VAMA 4R16A 5EAIA 4BMZA 2WTUA 3FUEA 1RKQA 3NEPX 1IE3A 1X77A 2ETCA 4X8HA 5TJ9A 4MQUA 4XEUA 4AYXA 3C6KA 4O0MA 3ZDQA 4WSOA 1IIBA 3V7YA 1ZHHA 2C5HA 3Q85A 4B8WA 3KEQA 5L51A 3QVGB 1NVTA 4QYIA 2WI8A 1LI4A 4DG5A 1MPTA 5BPPA 2X8BA 4EYEA 3JQ0A 3LNTA 2Z9BA 2WJ6A 3H2ZA 5AW9A 5L3SA 1HLDA 2VEDA 4YY3B 3DDSA 3PC6A 2DUNA 1Z0SA 5KNDA 1K2VN 3AVPA 1KAEA 2A9QA 4JIGA 3LYHA 3ZJ4A 4HUJA 3HMKA 3PDIB 1EK0A 1CY4A 3NAWA 3BXHA 4LQ4A 1LZKA 2C1XA 4HP8A 2WOJA 1E69A 1O97C 2GASA 5HDBB 1DNPA 1A27A 4U0SA 4LUNU 5JMWA 5JD6A 1VCOA 1JQAA 2YN2A 3WB9A 3PBKA 1C80A 4KZPA 1F7VA 1EXMA 4BNDB 2C8KA 2Y0BA 2WFLA 1C29B 5T7BA 2KLHA 4DLXA 3LHFA 4D3XA 3UF0A 3I4LA 4BP3A 1JHDA 2ZG6A 3D3WA 4AZSA 1EWVA 1IN1A 1TCUA 1ZJ5A 2WNSA 1HG2A 1S8FA 1P18A 3D3QA 1GARA 5H1YA 1F9EA 2YOFA 4U8HA 3BMOB 3R74A 2VBGA 1KJ9A 5LM3A 4IYRA 2PCJA 1VPLA 1CQPA 4Y1RB 1OHHA 2N3ZA 4Z9BA 1S64A 3DQQA 2CZQA 1U8CB 3B1XA 5KNGA 4MQFB 2Z2XA 4RIFA 4GPZA 4KNWA 3ESBA 2XDAA 3QKWA 4FGZA 5JIBA 1P9RA 1H2XA 1L4FA 2RGWA 1RD4A 4UCWA 3BWCA 1JKMA 1T5LA 1FP1D 2FXIA 4DG9A 2NIPA 3VNUA 4RMNA 3F9RA 4Q0MA 3TIIA 1B4DA 3WE7A 2YHUA 3IUMA 2CDBA 3C6MA 1WJGA 2BI8A 2XKAA 3TR0A 2D2FA 4BN5A 1JIJA 3QLVA 3VDXA 1CC1S 2JARA 3SZLA 2A35A 1PF7E 1DKQA 1JAXA 1V48A 4FDAA 3K35A 1ICEA 3RO3A 4M0FA 1M2VB 2YTZA 1GRCA 5HILA 1ZBDA 2HCJB 1MX1A 4R2HA 1SXHA 1Z25A 4UMEA 4MVJH 4M8KA 2VTBA 1XTJA 3RKRA 1KYIA 4YP5A 3VR5H 4PSKA 5C3MA 3HO1A 1QFZA 4HEJA 3FCSB 5DYGA 2FQWA 1GLVA 1LX6A 1IZ7A 4DV2B 3ZGNA 4C76A 1SURA 4OI2A 3ML8A 4JROA 5E2AA 5JJ5A 4YQFA 1RABA 4M0UA 3DLTA 2OHFA 4G1CA 3SJAA 5CLLA 4JITA 1BVHA 3WLAA 2DWUA 3L07A 4JENA 2PEZA 5EFOA 3GLHE 4GPD1 4N41A 5CD1A 1UBCA 4Y2QA 1KAMA 4B79A 2PZLA 4S1NA 4QM6A 4Z0PA 4DLAA 5KWEA 4QBKA 4Q05A 4I1VA 4E5MA 4DMGA 4D98A 5B6IA 3RBZA 5FH9A 4C6SA 1UMCA 1IY8A 5FTMA 1CY2A 3ZK7A 2FSSA 3ULYA 3I58A 1J0XO 5AW8A 2XLBA 3TOCA 2XE7A 2PX2A 4WMLA 2H4ZA 3CEPB 3P0FA 1G66A 2BHLA 1NYTA 3D4PA 3H84A 2W8BA 5BW4A 4WZAA 3HUEA 1TK3A 4LJ4A 5EKQD 1ZN8A 3WGVA 2W2XA 3D1LA 4LHZA 1KQGA 4XQ0A 3RUPA 3AG1E 1XMVA 4AJNA 1RM0A 3NB0A 2UY1B 1LD3A 2EFJA 3MT7A 1LLQA 2OEPA 4CCWA 3T5MA 3D31A 5KTKA 4MV5A 1TVEA 4LK3A 3OFSA 5KDDA 3KYIB 4MUBA 3ZOZA 2CLIB 4D80A 2L0XA 4J4TA 4IS3A 1PS0A 3ROQA 2M9MA 4FC6A 4HGRA 5IAJA 4JBGA 2PL5A 4GTVA 2EZTA 2I4NA 4MWOA 4O2BB 3HJHA 5JJCA 2X0EA 4KR9A 4MKXA 1DVRA 5H83A 5JSZB 3SXJA 3GRUA 3P52A 1U99A 1YH3A 3G2VA 4DUPA 1KOJA 4C1NA 2BH2A 2FZCA 4CE6A 5HQTA 4KAAA 4WBNF 3CHRA 1N6HA 3HKCA 4ZI2A 1POWA 4KP7A 5LXTB 2MSWA 1NZNA 2AZTA 2H1RA 1L1FA 2QTRA 4EGAA 1F17A 2HA7A 1AF4A 2FH5B 1TM3E 2I6TA 1WP4A 4OQ4A 2I3BA 1HMYA 2ETBA 1Q22A 2EBFX 1V3QE 4PTLA 1OUMA 2NGRA 5K3SA 4D96A 4OBXA 5IVPA 1Z15A 1OD6A 1TUIA 3NWJA 2JANA 3S6JA 2J5XA 3IS3A 3PL5A 1IHDA 1OWNA 4F4FA 2ID7A 2DFLA 1YJQA 4WX2B 2QR3A 2J9FB 2B30A 2Q27A 3CUYA 2WMOB 3VR4D 3F0TA 4AWBA 1OCZE 4IV8A 5JBIA 4MCHA 3KOUA 3USZA 4HR7A 5DYNA 3VAZA 4HX5A 2GO1A 1YQUA 1EB9A 5JCOA 3ME5A 4ND3A 4Y2JA 4QUHA 5LDGA 1UT5A 4GH5A 3QVSA 3KOWA 4R2KA 5FWQA 4OG2A 2O8BB 1J5XA 3WOHA 1VB3A 4KACA 1MAAA 1BQ3A 3SPXA 2H51A 1UWVA 1WP9A 3U1VA 2ZXEA 4LY0A 5AKYA 5FCDA 3GDOA 4AZVA 4B2YA 1E59A 4F56A 3K8YA 1OX4A 2EJUA 4CKBA 3L0ZA 1R9GA 4NMMA 1SKBA 1R7RA 1L5JA 1XFAA 2XWSA 2DB3A 2SNIE 1QHSA 3IP1A 2VP2A 4AV7A 3WV4A 1XNFA 1PFGA 4F4CA 1LD7A 4I7EA 1YVRA 4KOAA 5JJ7A 4IR7A 1M6EX 1LPBB 1NE7A 3T3PB 4LMRA 2LVBA 2GFQA 4PCUA 4WLFA 1DAEA 4ZEWA 2ORIA 1YHNA 2VCYA 4AY5A 4K3UA 4AJ2A 1KY3A 1G5PA 3QYPA 2KQUA 2X1LA 3A1FA 5BN5B 3I1JA 2Z8ZA 2JH3A 3KHTA 4RLYA 1L7NA 1NF3A 2GDJA 3U3OA 2IELA 2QZ4A 4GOOD 5LJLA 3AL2A 1NA0A 1Z13A 1K98A 1SWVA 4PXSA 5L6LB 3SJ7A 4HLLA 4RGYA 1WXGA 2ZYSA 3COPA 3ZYLA 3FHEA 5D51S 1Z4PX 2YRXA 4EW2A 2RKOA 1WCXA 1P5JA 1L5RA 2NV0A 1GGKA 4OQFA 3UHAA 5EJ4A 3PEVB 2W2LD 2JB9A 2QL7A 3R9AB 1H23A 3IKJA 2OQ2A 4US0R 1QSGA 3S2FA 3FVTA 4F3RA 4WEQA 1YOBA 4V2IA 1QQEA 1HKHA 2JFHA 3CRMA 2R5FA 3TLGA 1XU4A 4BNUA 3VNBA 4JX9A 2DFPA 3RT9A 3JQ1A 5IW8A 1D2HA 1U8XX 1NNLA 4J7WA 3F1KA 4ED9A 1CXZA 3CPSA 4CMKA 3W4IA 5CA0F 4UEOA 1KY2A 2NZWA 2XBMA 1JG6A 4A73A 1J8DA 4PANA 2XZLA 1RXWA 2XV1A 2CBGA 3CEJA 3D7RA 3EX7C 3ZU6A 3RUFA 1KYQA 4RPIA 4KFRA 3N2ZB 4EATA 4AN0A 1ML4A 3DVAA 3MIIA 4TL6A 1W47A 3ZXXA 1P80A 1NR7A 1CPYA 3D64A 5K5EA 1TAUA 1ZOOA 1AO3A 2IP4A 4DR3B 2Z5LA 4CODB 4WERA 1P2GA 4QAQA 3CUUA 2JCGA 3PCTA 2YMPA 3BGOS 1AGNA 1E0DA 5HKLA 1JDVA 3O8NA 5D3MA 3ABKE 2H1VA 2P7IA 3DPSA 2PVSA 3GA7A 1JNYA 2FX2A 2C2LA 4GKJB 2CJYA 5JRZA 3CNLA 2XRYA 1P7CA 4RHUA 2VPTA 4ZEOA 2QKYA 3H0CA 3DAYA 1P0CA 4FXPA 1PQUA 3OOHA 3DMYA 3IERA 3COYA 4YJ2B 1P7PA 1AK9A 3HYCA 3OI7A 4G1UC 1AUQA 3QPCA 5JADA 2ZJ6A 4CMIA 4X3OA 4X63A 3GRYA 3TQRA 1SUBA 2EFCB 3OEHD 4LHSA 4RFSA 5HOQA 3PS9A 3P7MA 3DOHA 4UEQA 3TAUA 2QL5A 3NWEA 2E37A 3MZLB 1PGOA 2AI1A 1PYOA 3TFOA 3HWX1 1TFRA 4EDFA 5KX5A 2I2DA 3F6YA 5LYJA 2O6LA 3UWSA 4AF8A 3C16C 1JVBA 2GPNA 3L4BC 4G5QA 3FTSA 2JIRA 3KM0A 2H6IA 4I1OA 4NMWA 2TYSB 2GO7A 4WXYB 5FTPA 5ALZA 3IFSA 2PM6A 2YWCA 1M2KA 2GSWA 4RA6A 1A5ZA 5E6SB 1ID8A 4MA5A 3A32A 4RVBA 5A5GA 3SNXA 3M6IA 3HEBA 3SX0A 5J2UF 4AJ9A 2BJWA 2YVKA 3H75A 5F2KA 2OV1A 3HXPA 3ZJYA 1D03A 4MR7A 5TEVA 3I8OA 2WLTA 1WQ1R 3E48A 4GRIA 4K9LA 2HF9A 3U37A 2UZ0A 2YXDA 2H6GA 2FDRA 3ANLA 1TT5B 2G1AA 1GPAA 1ZLXA 4WACA 1FVHA 2JL1A 4CHGA 1XZ8A 1E1KA 2VTKA 1VIDA 1QPBA 4O4HB 1MX4A 1MO2A 4YMIA 1RAIA 1BXZA 2NAPA 3X2EA 1H0SA 5EYPF 4UFPA 4JC8A 4UU0A 4R2MA 4YMLA 1Z2DA 2UAGA 3HXQA 1B0AA 4MA0A 4GQBA 3MINB 4OI1A 1LWNA 4LMAA 2AFHB 5DCYA 1MC1A 1J7JA 1Z39A 4PFSA 3GQBA 3KTAA 1RRGA 4E22A 2C5AA 3LP5A 4R8RA 2WIDA 1FFSA 4X8QA 2HXSA 1NBMA 4UEWA 1VKRA 5L7WA 1MXFA 5F51A 5CBPB 1P29A 2IITA 3TXNA 4G4SO 5JH7F 4BESA 3U13A 3WGNA 5IY5E 3GLSA 1HT0A 3VGPA 1D8AA 1RXEA 2BEUB 4A1FA 2OMKA 4Q9NA 2XMRA 3HUTA 4U07A 1N8SA 4KN6A 1PZNA 1A9PA 4IRUB 1N34B 3K0AB 1WG0A 3NHUA 5HKAA 5KIAA 1QYXA 4KQCA 2QG9A 2FWRA 3TGLA 3JQ8B 4MS4B 1W8DA 3WDSA 1JVSA 3IV0A 2NSHA 4L3OA 3O3OB 3MM4A 3FM9A 3LLMA 3LPCA 2JW5A 1R27A 4ZANA 3QM1A 2A30A 3VU3A 4X95A 4HTAA 2ZJFA 3RI3A 3K9FC 5IKOA 3QV2A 2BGWA 3R7LA 4DSUA 2YOGA 4O8CA 3AEKB 3QDNA 1HO3A 3TB4A 1IBRA 1YRLA 3D2CA 5J1TB 4FCVA 5P21A 2V97A 1DAKA 3O4GA 2ZT6A 3SEAA 1LY1A 2O2EA 1U7OA 2YMLA 1M2OA 4LWPA 3WO1A 1HWYA 4H17A 1ZXLA 4YAEA 5C4IA 1T9GR 2H0RA 3U17A 5ARBA 1MB2A 4YDQA 4JYZA 5AVZA 3H5NA 3PS6A 3NWBA 3ROKA 4IGEA 4QBTA 2JLBA 3O8OA 3EGXB 3KK0A 1LDYA 2OD2A 3TW8B 1L1QA 1Z28A 3P9ZA 3C3OA 2KZTA 2I3DA 5ALJA 1QIKA 2P5UA 5JI3E 1G5RA 1DO8A 1AT1A 3KT8A 4WHMA 2FWAA 2GBFA 4BRWA 1NRXA 5IJXA 3K7EA 1LW6E 2O7RA 3KWFA 3CYFA 4L7QA 3UH0A 4DGSA 1LB1B 2ZJ7A 3WWCA 3D0OA 2NC9A 4U7GA 5EMHA 4EFNA 1OF1A 4M9QA 4L74A 4IDBA 1XOIA 1GGFA 2OFFA 3GGOA 2GBLA 4UXJA 3QXSA 4HNAB 5KYKA 3IOCA 2J3DA 3WICA 3TD9A 2J6BA 5G1NA 1VHTA 3CLVA 2VJBA 2JLSA 3KZ1E 3R3JA 2NUPA 4V03A 2J4CA 1SPBS 2HMTA 3A36A 3C6BA 1U0BB 2NU6B 4YJ3A 3GG9A 1KIAA 4OO3A 5ENSD 2Q1UA 2H2DA 3LOUA 2Q41A 2OV2A 3UMCA 2HXYA 3AERA 2DVMA 5J4LA 4GNKA 2O8VA 1P45A 1MC5A 1QQTA 3KR1A 1XIVA 2HSZA 2CHVA 2NT3A 2X1MA 1VG0B 2IX3A 1DC7A 2AG5A 5JVDF 2YJ4A 3IC5A 1Z74A 2PPVA 2ANBA 1JGTA 4UUOA 4JC0A 5FF9A 2PS0A 2VL7A 1TI7A 3LPAA 4Y6QA 3AY6A 2BZ0A 1IHOA 2WYVA 4CDRA 4RGQA 4ZHBA 3WLOA 4C0QC 2X1VA 1P3DA 1MT0A 1T1RA 1SIBE 4QQ8A 5DLYA 4C2BA 3WXMA 3QRWA 4U9IS 2KCKA 4EZBA 1XTKA 2WHPA 1JZTA 4A3SA 3M4XA 3VU9B 3WL6A 4F5WA 3F5MA 1I1OA 3X1YA 1EBUA 1N11A 1RM4A 2NU9A 3KZMA 3OEED 4DPKA 2X58A 4J16A 4MVJA 2IHJA 1TW3A 1MH9A 1OAKA 2GAAA 1L9KA 3ILXA 3TM4A 1RLMA 3HHPA 2VJ8A 3VTZA 1G3MA 3ETLA 3V1UA 1W49A 1ZL2A 4E6HA 3FVVA 4TRQA 2XUAA 4EB3A 1JMKC 1L9XA 1IB0A 2IPLA 3A3OA 4AP6A 1C4KA 5HJ5A 5TVGA 4M7OA 3WNQA 2P6MA 4L07A 3V42A 1WCV1 4KXNA 4ZJPA 4PICA 3UB2A 5AXBA 4M87A 3LZCA 3IAM1 4MV6A 4W5JA 4URWR 3OKFA 3WTBA 2X7JA 4L95C 4YDOA 5AUQA 3B1ZA 3T6KA 3OLCX 5KOJA 3QVGA 5JDIC 3CZAA 5JAOA 2P75A 1Z6AA 3OTNA 2B8TA 2VZ8A 2FWNA 5LQUA 1K89A 4NC9A 3B60A 1E7SA 2BTQB 2PXCA 1I2ZA 3I3NA 3I4FA 3TB6A 3ENEA 1TM7E 4HWRA 1CBUA 4H7DA 3SYRA 4JOQA 1E3IA 3CHYA 2H4JA 4YGXB 1DBQA 2VHTA 1GPYA 1G9TA 1XO1A 1IN5A 2HQ1A 3VPBA 3EBLA 3O9VA 5K8TA 2CUZA 3WGTA 2BHSA 1M2FA 4AZ0A 4ODIA 2AK2A 3Q9UC 4JGIA 5K09A 2AOVA 2JIZA 4IDPA 3PLAE 3LNCA 1DXYA 2DRIA 3DBHA 2G9UA 5JZSA 2KMLA 4PCLA 4K3VA 1N57A 3DBLA 1SBCA 1OZHA 3BMOA 3FU5A 5JS1A 4D99A 3GOHA 4MUHA 2J4DA 4NNPA 3AIOA 4OIMA 4OK5A 4Y1RA 1QLWA 3Q7EA 5KNBD 1UMBB 2Y4OA 5GIOE 2R86A 2AL7A 3GJZA 3MAAC 1R0YA 1F38A 2Z30A 3MRSA 2ODWA 4MQFA 2JEOA 4NG4A 2GBPA 3AG4E 3VJRA 2BEWA 1M76A 1K8YB 4RQUA 3A1CA 4IF4A 2CBZA 3SLRA 1NAIA 3N59A 3KAEA 1D0IA 1ODIA 1PEAA 4P5PA 4CRWA 1LPPA 3OECA 3A6HA 3U4MA 1VSQA 5AESA 2Y4TA 1PKXA 1MX2A 3S2ZA 2GH1A 3ZCQA 2CMHA 1Y42X 3SC2B 3CVLA 2B99A 3T4UA 5G0VA 1Y8RB 3WWOA 1FMCA 1MX9A 4FWIB 2QLNA 4ZRDA 4AMZA 5JAUA 5LP6F 2I78A 3L7AA 1USKA 1Y7TA 4MGEA 3GDHA 3FDJA 2PMCA 4OFXA 4KDEA 4BO4A 3BM5A 2I54A 4HS2A 1ZEJA 3I3SR 1DQPA 4WVFA 1RU3A 1K7YA 3SWWA 3PUKA 1TLLA 3PQ5A 4B34A 1SBZA 2J09A 1DIHA 1LJ8A 3M6MD 2V7QD 4JT9A 3WG7E 3KDPA 1M5UA 2AEMA 2YS7A 2ECOA 2C0PA 2XA9A 3PUWA 1WUTA 1NONA 2C7QA 1IBSA 2XE8A 4WWHA 4PPFA 2X8JA 4YRGA 1QH9A 4EKGA 2JJMA 3DNFA 3EA4A 5LZ9A 1JHAA 3U3ZA 4DC0A 16PKA 3IXMA 2BM9A 4D45A 1E20A 4D4GA 4RZ3A 3HVHA 1F12A 4NFSA 1DAIA 1M75A 2FQXA 3LDGA 4A1OA 5KTPA 621PA 2PGNA 1F8UA 2EATA 7REQB 1JAYA 2P2LA 3BG5A 1KSGA 3UZUA 1SIOA 4AX4A 1QYRA 3SF4A 3LV8A 4G8CA 2IE0A 1JRLA 4RZSA 1B2LA 5FNZA 3SBTB 2JBAB 5B1SA 4JP2A 4FT2A 4OEHA 4RVNA 2VZ9A 1WSBA 5BORA 3TX2A 4RKQA 3BMXA 3VSEA 4YDHB 1ZUD1 2VNSA 3NATA 3TI9A 1JILA 1T43A 2M6LA 1LCIA 1O5MA 5K3FA 1U28C 4TTIA 3GRFA 1C1XB 1Q0HA 1ADCA 1KP2A 2UY1A 4Y9UA 3PPWA 4A6DA 1CY0A 3OIFA 3NHWA 5FJYA 4BO0A 1T9DA 1V54E 2BIFA 4JK3A 1AHNA 2H8KA 3M3DA 4EA7A 4QGBA 4TRNA 1WO8A 2BUGA 3O4JA 3DEZA 2KYRA 1SXQA 3KJFA 1PFWA 2M98A 1BN7A 2RD0A 4GOLD 4QXMA 1I80A 4IINA 3WBJA 2X6JA 4LF8B 4GX1A 2QK4A 3ILSA 1MEJA 2EHJA 1ZWKA 1UBTS 3Q73A 1XE3A 3C3DA 3STYA 1K4YA 4LHXA 3T7KA 4CMCA 1D1SA 1X6VA 5DM1A 4O2BA 4PZZA 1TQ8A 4BVKA 1RHKA 4E2ZA 2OE2A 4DSNA 2Q4DA 2RFLA 4LE1A 1K1AA 5B2FA 3GW4A 4BO6A 1M8PA 3IMCA 2Y71A 4OHFA 1VP9A 1H9AA 2BHNA 3PQ4A 2RFAA 1XTUA 1BDJA 3BXFA 1Z8HA 5I9MA 2IDJA 1P7WA 4NY1A 2TRSB 2B4QA 1H0AA 3ISVA 1NMYA 2QD4A 4ANWA 1T91A 1BU5A 1ZIYA 5TY0A 2P9SG 1N1MA 3FOBA 2P62A 2JJYA 5EZSA 2F1OA 3EGWA 3AUXA 1AN0A 5E9JA 4DDVA 2G40A 1MX3A 3GJ8A 4U6QA 2Q5IA 5D8DA 3IBYA 3MJRA 4NZMA 4D82A 3UHFA 4Y6CA 3SFYA 1TU3A 3GZJA 1BJTA 2DECA 5ABPA 2HQRA 1B74A 1XCOA 5AHOA 5A02A 4E4RA 4MNTA 2EJTA 3MCAA 4KN9S 3TQHA 2AC2A 4CZ2D 3DE0X 3A1TA 3NHJA 2AFIB 3LPDA 3LWBA 1W5AA 1J8YF 3FZEA 2OHIA 4FFPA 3FPGA 3CVJA 2MCFA 1RI1A 1HOTA 3GPLA 1P74A 1GFWA 1SCUB 1D5WA 3D6FA 2PT7A 1AUOA 4C2UA 2O8BA 4UVGA 4DIUA 4WOBA 3IELA 5CXUA 4XJVA 1AM4D 3MT0A 2WICA 1Z26A 1NZJA 3ZU3A 3KS9A 3CCFA 1VDZA 3LA8A 2D4HA 4P1ZA 5C46F 2XSZA 4QDJA 3KKPA 4HB0A 4IUYA 2PZGA 2YJ3A 4FGLA 2JCVA 2WXHA 1X74A 3RU7A 3FMPB 4OPMA 1C41A 3AAAC 1IOWA 3Q5EA 1OIWA 3WIDA 1FB5A 3BUSA 3UJ8A 2PL1A 5G0UA 4IL5A 3K16A 1PWYE 4IIUA 2GD0A 1XV5A 3CRW1 3R7RA 1R10A 3PZBA 1YZYA 3FU0A 1QCCA 3OCZA 1SXGA 1UBNA 2YBDA 5BN5A 4OL0A 4QVGA 3CZMA 4WBNB 3Q49B 4E5PA 3FBWA 4RTQA 3ZH2A 4EARA 5JJIA 4NCKA 1Q1BA 4J3FA 3SQWA 5KYTA 2RKKA 3R77A 3HA3A 2O20A 3GAFA 1V37A 4J0IA 2I7TA 3AXTA 4H18A 2YN4A 2CHXA 2NO7A 5KJKA 3PEVA 5AM2A 1Y3AA 1JTEA 1P4RA 3ZDXB 3W8NA 1MORA 4RYDA 3VTXA 4ARVA 1VLVA 1JQBA 4FIZA 1E6LA 3TBHA 5KU1A 1QLJA 1V1MB 3A11A 4LC1A 1QX3A 1TXGA 4NE7A 4O5OA 1EJ2A 2IEIA 1T15A 1HF8A 3EGCA 3PB3A 2FW1A 4Y2VA 6GPBA 2IS4A 3IESA 4GYWA 4LFCB 1QF7A 4BC0A 4AKHA 2W0SA 1R6VA 4YMSA 3A1EA 3KS2A 3PZRA 4D0LB 1DBWA 1R2QA 4DB4A 1J0AA 2LCQA 1Y6ZA 5BW8A 4DCJA 1GQ2A 2XQ0A 4MR8B 4H1HA 2EEPA 3KETA 1KEZA 1Z75A 1SGWA 4B4VA 5CVEA 4BS9A 4GYYA 2Q1WA 4NATA 3N6XA 4KWTA 1P1RA 4JVNA 1OW3B 4R9RA 1CJBA 2V5FA 3DC2A 4PFQA 2OT3B 3W6PA 3MA5A 3GLVA 2IIBA 1UL1X 4BX9A 1BD4A 4EABA 1SBIA 2L2QA 2DPGA 3CB4A 4BBAA 1EEHA 4HO1X 5LLSA 2J5QA 1E1QD 4D74A 3PRHA 3RC2A 1E6UA 1KAGA 1UJMA 1T6YA 4BUJA 3AG2E 1ZD2P 2BMDA 4MUEA 3TK1A 4N5LA 4AS2A 1TJPB 4YAWA 5BVGA 3B85A 1TIKA 3HBFA 1YI0A 3IAEA 3TLBA 2PT9A 4IDGA 4X7RA 1QDLB 1DMSA 4XPZA 3DEOA 3PRJA 1NAHA 2C97A 5FBWB 3ED5A 3NYQA 4YJGB 2XJ9A 4KO4S 4D6PA 3QNMA 2QAJA 1AUPA 2EGGA 2PV7A 1KEUA 3WO0A 3MHTA 3TTTA 4CPDA 1PTKA 3FGNA 5JXJA 1L5KA 2P0EA 3ZLUA 4AF7A 5CXSA 3JU3A 1X8KA 4DLYA 1NXQA 3CHOA 2Y76A 2XY4A 3UH1A 4F3KA 1B1CA 1G1AA 1H5NA 2JF0A 4YRPA 4QPCA 3B12A 3SCZA 4K6FA 5HFAA 2C0LA 5JQGF 4AY4A 1YKGA 1HO8A 4YVQC 5E6SA 3KX2A 4UHHA 2I2AA 4U6SA 4H7KA 3S5UA 4JJ8A 1JQLB 2Q2OA 3MCUA 1RYFA 3H3FA 2FZKA 1VIAA 4L8LA 5CA0B 3TAHA 4HI8A 1G6OA 4GI3A 1REQB 1DWQA 2OC4A 4R40A 3DKKA 5F64A 3AM3A 3WK6A 4MYDA 2GCIA 5BSEA 1J39A 5CLQA 3WLNA 3QVOA 3OA0A 5I8ZA 1TT5A 1LNZA 2AEEA 4DR6B 1QRTA 3ANNA 2R25B 4OH7A 3WLJA 3C7DB 4B4OA 1ZBPA 5AHWA 3OZXA 5BP7A 4ZFNA 5E8RA 2H4HA 3PR3A 1TRKA 3MLEA 5GV8A 5AICA 4QXOA 3S1AA 5ENNA 2C0CA 2A0FA 4IG9A 3KCQA 3LXUX 3MINA 4RH1A 4KQ1A 1F0PA 2AFHA 1FY2A 4N7MA 3KQWA 5C5IA 4CM4A 4MZDA 1QQBA 4BMPB 4F3NA 2YXPX 4YCAA 3FN4A 4O3FA 1P4AA 4FWTA 1CVIA 1Y7HA 4HF7A 2ATVA 3B1WA 4CL3A 2WP8J 4KVZA 3PSHA 3SBXA 1ISIA 1M2HA 4PPGA 3DLHA 3BG0B 1WDMA 2H2AA 1BEUB 1QIIA 3GA5A 5KHOC 3GPBA 3LCMA 1IHYA 1RKVA 4BV3A 4UTXA 2BEUA 3HFRA 3GC6A 1KIMA 1MGPA 3EIEA 3A0UA 1L8LA 5CYGA 3E7XA 3E9MA 1UBMS 3FKSD 4ZO6A 3LQYA 4IRUA 4JB8P 1P2BA 3K0AA 3BSWA 5K0SA 4Q1VA 4H08A 3U7QA 1Y1KE 5T4FA 3JQ8A 2H7CA 1Y5IA 1YNOA 4OOEA 2X6IA 3D43A 2B83A 5EKXA 4PWYA 1GUYA 3K8OE 1R4NB 5J2TA 2FHSA 1PZGA 3Q0TA 5A9SB 4FGJA 3I53A 1EFAA 1EDDA 2QUBA 4N01A 4LOIA 3FHCB 3BRCA 4ZJUA 1EFHA 1T8UA 1OPXA 3WLFA 1II8B 4RHFA 5J2UB 1UJJA 1KBZA 4DF3A 3KYDB 3Q9NC 2CCJA 4FCTA 5BUQA 4TVKA 4WOKA 3L08A 2ZRMA 4BEPA 3V3KA 2WJGA 5M7EA 3C3YA 1DDGA 5DSTA 5K8JB 3W3ZB 2M6RA 2M32A 1YVDA 1XZPA 5BO5A 2XYVA 3W7BA 4W9MC 3LTEA 1TCVA 5F3WB 3ILYA 3CM0A 4KK4A 3TLJA 2F59A 1FXSA 4XARA 3INTA 4TT3D 4BZQA 2HA0A 3PNPA 5EYPB 4DPLA 4XEIG 4LI3X 1ZU2A 4IPTA 5FTNA 4QFCA 1KZYC 2HZBA 4A5OA 4IIGA 4U7PB 2QJOA 4C87A 3H5OA 5ALDA 1RXYA 2ZUSA 1YFJA 4DLWA 3OZVA 4J07A 1P72A 2GMWA 3LSTA 1LNQA 3WL4A 2NNWB 4AXXA 5EE1A 2I29A 2RGAA 1DKNA 2V8OA 1HFAA 4FYKA 4AOFA 1TCAA 2OV4A 1R6UA 2QB5A 3HC7A 1J00A 1T2NA 5GP1A 3KKEA 1I3LA 1JEEA 5JH7B 1PR1A 2AJLI 1Q1GA 3NPMA 2FW9A 2WKRA 2HMWA 2W5UA 4M9XA 4NXNB 4M49A 1DEHA 2D1QA 2WF5A 3TWWA 1CP3A 3G82C 1EMDA 2PGXA 3NB2A 3SOZA 4CV1A 2YINA 5J5AA 4WBXC 5J5CA 2NU6A 4NBTA 4WQMA 3GCXA 2CSUA 1TK2A 5B7PA 4KZKA 1ODLA 2YIDA 1Q44A 2AMJA 1GRQA 4PIMA 4NU6A 1OR8A 1DAHA 2C5LA 3RUHA 2NX2A 4HWGA 1XRJA 1HT1E 3JALB 3R9XB 5ENOD 3KLBA 4O33A 4O4JF 2GEUA 4PHTA 3SZOA 1N5DA 3UUEA 5H8WA 1IWPB 4E03A 2B0JA 3LCUA 3EK2A 5ECYA 1N54A 1CRLA 1GQOA 4X66B 5L3RA 2OZPA 5ADHA 7ADHA 1AGYA 5B1HA 1NMZA 5EP1A 5TS3A 2QWXA 4QBFA 2X6HA 1XTRA 1TNDA 1E8ZA 3ISTA 2REBA 1W0JA 4TWRA 1RMYA 2EJVA 3B6MA 3PDNA 1GNSA 2OL4A 4HEA6 2Z9DA 3O8RA 3Q7QA 3T7CA 3GVXA 2H5EA 2BISA 3WKEA 1MU0A 1VE5A 2D5CA 5DNYB 3KJQA 3VU9A 2Z2KA 2ZS8A 2GNOA 3U80A 4IY1A 3APCA 4B3BA 1DTSA 2C4VA 2AIRA 2GA8A 4RXMA 5BSKA 4CL2A 4EZEA 4ZVLA 4EW3A 3HK2A 3SDSA 2H0QA 5C1IA 1P33A 2GARA 3R8CA 1Y89A 2B82A 4TXPA 3EU9A 2HT6A 3E9ZA 3V1YA 4B6JA 4DADA 4BVEA 4GFDA 5ALHA 2L69A 4QYTA 2Q9UA 1TZJA 1VE3A 2WKSA 2CV1A 1GKUB 4XD2A 3WFJA 1SQGA 4UZFA 4WE3A 1ZJJA 1Z6GA 2QXUA 3W6OA 2Y69E 1LBQA 5I51A 4QJ3A 4POAA 1XGKA 2CLSA 2VKQA 1T3ZA 2ZYUX 3JZMA 3BAFA 1DKOA 2I2OA 2FSHA 3WLPA 3LPNA 3MWDA 4I17A 2G0NA 1ZI6A 4G56A 4DUZB 1MF7A 1WSWA 1I30A 1VZ3A 5B3AA 1XEXB 2BTQA 5ANRB 4LOHA 2V6FA 2OCXA 4YTEA 1Y33E 3WGUA 1W9MA 4ZA2A 4C7BA 1VLLA 2C7PA 5FHRA 3CUKA 1K5DA 3UAZA 4R2XA 1GUZA 3PJRA 5IS2A 4J8FA 5IBPA 4IHJA 5AFSA 1JXQA 1ULUA 4ENUA 1TB4A 2P68A 2IZ1A 2EKZA 1PJAA 3REQA 4DS3A 5JVDB 4AQDA 5IM4A 3DSWA 2MYPA 4O08A 4AECA 1IEVA 2ISSD 5DWQA 1G21A 3TOSA 1XNHA 5I7EA 3TSZA 3TW6A 3BRWA 4F3CA 3QWWA 2FSPA 1GTG1 2IZ6A 3OFKA 4DW8A 3NU1A 5DSXA 3CSTA 4PYNA 2G06A 3IA2A 3NJ8A 3N8GA 1NF9A 4DIKA 2DT8A 4RPKA 1HEUA 4KOEC 2EW1A 3WMRA 1NSYA 1EXVA 1FUEA 5DGHA 4KMRA 1ZOLA 4IKEA 3CK7A 1QQ7A 3F47A 1QUFA 2OCKA 3AF0A 1O8BA 3B13B 4BLSA 4MPTA 1L3IA 3HCEA 4CMJA 1BDIA 4RDXA 2F3PA 2R79A 2ZFUA 3QSYA 3D02A 2BBWA 3TZEA 1P5RA 5TRTA 1BOFA 4XWGA 3FEXA 2X9LA 4LPKA 4KO2S 3ZI0A 4CTMA 2J7KA 1I4EB 1DIRA 2DWCA 2IDZA 4DRXB 3GRCA 4JVMA 4M1YA 3RK4A 4EAAA 5F77A 2XVXA 3PTAA 1XP8A 4J1SA 4TRRA 3UJDA 3H9BA 2ADOA 3LQ2A 5LB2A 2FEOA 1P1JA 2QXTA 2UU9B 3UGKA 1OBFO 4B48A 1SMKA 4AMVA 5I01A 4R5HA 2A4KA 3SIXA 3WZLA 3WJ2A 4PGHA 4BFXA 3D3MA 3FYHA 3GLGB 5EN5D 3O82A 2AMYA 1NLFA 2RAUA 3SQOA 4P4GA 2CE2X 3KQOA 3EMKA 5EVJA 1JEQA 5DM60 2I8CA 2QRQA 4ZQBA 3GZTB 3U4CA 1NASA 4M7RA 5KVCA 1N2HA 4AUNA 5BURA 3VBCA 1PGNA 3L7CA 2HM7A 1NJFA 4JT2A 4WESA 4RMHA 1I9GA 4OJKA 2APJA 4U3JB 4XGNA 1Z68A 3JAWA 4H3KB 3V34A 3PGJA 3DKVA 3IVXA 4C88A 3L1JA 3U62A 3GNLA 3CV0A 5JNVA 4CFSA 4H0CA 3PUVA 7REQA 2VAVA 4LA4A 1Q0QA 1F4VA 3WXXA 3AF6A 3LS2A 3Q15A 3A4LA 5H70A 4F5YA 3K9GA 1B76A 1XWWA 3MLBA 4DWOA 2ZB3A 1WM1A 2FRDC 2D0PB 4HQLA 2DCUA 1R9JA 4PLFA 1X3SA 2ENWA 2HREA 2ORED 1N4RA 1NVGA 4AWXA 2I7XA 5K03A 2L0IA 4LKRA 1JFTA 2BH9A 3WB2A 2C78A 3TWXA 2XCIA 1WXWA 5HCUA 4U6NA 4ZCMA 3VSCA 1PV1A 1TE2A 3I2FA 3PUYA 4DREA 1SQ6A 3FYTA 4DCCA 2CNWD 2VQ6A 1Z2CA 5BVHB 4KGZA 2CCKA 2C8JA 4JSTA 2EBHX 4G63A 4A0FA 1GIAA 1I14A 3TS1A 4P2BA 3FOZA 1C1XA 1E2PA 3HYRA 2WUGA 2E4UA 3MJDA 2BKVA 5EHNA 4BVBA 1F5NA 5BSWA 1HLGA 5EJAA 1UQTA 3ABQB 2IUUA 3AYXB 2R1TB 2X6FA 2Z95A 2ECFA 2IOLA 1E3SA 4M9UA 1G8AA 2YASA 1WW3A 3H1PA 4GPIB 1YT5A 2F62A 1F3OA 3O95A 4ONEA 4G07A 2B4KA 5LP6B 3I9V1 4D56A 5TDHA 3ZNQA 1G4UR 3FYCA 1C4WA 1RHMA 4DA7A 4HDSB 1IXZA 5K0CA 1GL9B 1LNSA 3U3KA 3TMKA 1UODA 1VA5A 1ZJ4A 5IJZA 4N7RA 1GPJA 2HF2A 1JWGA 5ALMA 2ZI6A 3IDQA 2Z6UA 2IVFA 3E37A 4Q9DA 3FDFA 1GILA 1F8GA 1QTIA 2CN1A 2X5KO 4DXDA 4NDZA 3GEMA 4II7A 4ZQEA 1PTJA 2V9CA 1MOZA 3I2YX 2Q45A 3HUDA 3YASA 1GN8A 3HCCA 1PK7A 5LMZA 4XOIA 4HQFA 4ZYYA 3K4HA 2ZUFA 5JWRA 2IEAA 1QG0A 1ZM7A 1K6IA 4IX9A 5DGIA 3IEKA 1EFUA 2IIQA 1MENA 4JHKA 4ML3A 1P8JA 2QVYX 2ON6A 2OENG 2WKQA 1DUIA 3WGOA 1WZUA 1UFQA 1O0BA 2I4RA 3TG2A 2P67A 2KXPC 2CNOA 2QLLA 2R6GA 3B3AA 1EGMB 4FW9A 4I3GA 3VSDA 1F4LA 1XZGA 4AM8A 3U26A 5LZ8A 1B41A 1EG7A 4AZ3B 3MWJA 1Y9JA 2O1XA 4Y9SA 4AS3A 5JLJA 4IJMA 4DJEC 1JPVA 2IO3C 2FB9A 3ESCA 4CEHB 4BZWA 4IUBS 3EDMA 3PITA 1YS1X 3LDAA 1Q3KA 5HM6A 3DXFA 1R50A 1HDEA 4U5QA 1NVAA 4Q9HA 4QUBA 1LS6A 1ORWA 2OQRA 1EFKA 3RC8A 1RBMA 2ETXA 1V5IA 2PH5A 2ZUDA 1PZHA 3OZTA 2OFXA 4F6RA 3KBOA 1BI7B 4F92B 2CFUA 2GVZC 4JI2B 3FR8A 4GEGA 1KS9A 4U2CA 3T8YA 4TPKA 3ANMA 1GSAA 1UM8A 3F6RA 4EVQA 1XK7A 5F98A 2ZYVX 3CVWA 3RSOA 5LMNB 4BFTA 3GZ4A 3S29A 1PR4A 2QX4A 3HZRA 8ATCA 2ZIUB 3NFRA 3JW8A 2QAIA 5B4UA 3WHPA 4EMUA 5KHAA 3VHXB 3UCFA 1N5IA 5TPWB 4QRIA 1MG5A 3GV0A 4U39A 3IQEA 3DSRA 4RLSA 3PXXA 3C15C 4HS4A 4M99A 3I4GA 3EASA 4PIPA 4O25A 4UE2A 5D5HA 2D7DA 4WZBE 4NYIQ 3GPCA 4FU0A 3R9MA 2ZIZA 1W19A 4YAFA 5KREA 2OZLA 3CU5A 3OY7A 3KVOA 5K01A 3ZWYA 2O4CA 3FUIA 2LV8A 2ZBDA 4B1FA 2IO2C 5JUWA 5LYYA 4FBGA 1C3XA 5JANA 4C89A 1FQOA 3CUEF 1JJVA 3TWRA 1T25A 2XDYA 1HK7A 1JFVA 3NZEA 1O97D 5BOSA 4EGCB 2QVBA 4DJAA 2R66A 5B7NA 4GZ3A 2ZSFA 2WSSD 1AMUA 4D8XA 3MQ2A 2JGKA 3U7RA 4MTLA 3I9V6 3JARB 1V1MA 1YRYE 4MQMA 4R98A 2AI3A 2X1HA 5CECB 2CLFB 4NBLA 1ZXXA 3TN7A 1E2HA 4FOOA 5AM5A 4Q4JA 3X1JA 1ZY2A 4LSZA 4HPXB 2WF6A 1BMFD 2FSVA 1XF1A 3PXGA 1FS6A 3HCDA 3W4JA 2G70A 2K6GA 4F2WA 4OM7A 4ZI3A 3GP5A 3INYA 3KSMA 4NABA 1CDOA 1RP1A 3C8DA 3ONWA 3N7UA 5JYEA 3B53X 3PEUB 1KH2A 5TB5A 4FC7A 2NZ2A 3SMVA 1CX9B 1H5QA 1FZQA 3GGPA 2D5LA 1I32A 4IFEA 2BGIA 2OUKA 2G28A 1RRMA 3NR2A 2WD7A 3K0EA 1YI1A 4HLCA 3KC2A 3CX3A 1QMGA 1KTIA 2ZJAA 4E0BA 1ZJ6A 4R9SA 1E7RA 4MRVA 3L40A 3UK7A 1C0LA 4R2IA 5LWQA 3IBEA 1M1YE 1C9DB 1W4CA 3HXDA 4JGGA 1E3WB 1YDGA 3F4KA 4PG7A 1QMPA 1PX2A 3PXUA 1KE2A 3Q8LA 1I13A 1P2SA 4CGZA 2IPXA 4OQMA 1SXJB 1UXJA 4DA9A 5TF4A 4J29A 4CCYA 1K5GA 4ATZD 3HH8A 4K9OA 5PNTA 4ER6A 3BQNB 5K0ZA 1ZIXA 4E1AA 2YHIA 3ASNE 2YHBA 4G1FA 2YXEA 3S70A 2RC6A 1ZUNB 5CIWA 2GN9A 2WYUA 3MERA 3WK4A 1NSFA 3LLVA 4LWZA 3TQQA 3L82B 1E5TA 3I23A 4HDCA 2XNHA 2C2HA 2SCUB 3MWGA 1S96A 3EH2A 4PX2A 2IXBA 3IR5A 3D54D 3Q3HA 4NRDA 1P1IA 3LH5A 3DHVA 1L7MA 3B3JA 1CJVC 1D3AA 3O74A 3REOA 2QE6A 4M38A 2DYKA 3E1KA 1A96A 4JVLA 1U9CA 4AJPA 1JHQA 1HURA 4UKDA 2HPAA 1XD2B 1YGPA 2R6FA 4FX5A 2I6FA 4RSYA 1XPJA 4N5HX 1Q11A 3CKMA 2OP1A 1XXHE 3RFXA 4C4RA 5AVUA 2BEVA 3VTYA 5EIBE 2PMDA 4OKSA 5FL7D 4LRUA 2O2IA 3AL0C 3PVSA 3I1YA 3TZKA 3DKRA 4WEOA 5ED0A 1QG6A 3FGPA 5F76A 4ALKA 4U0JA 5HCNA 2RHJA 3E32A 3R0XA 1UWKA 1EVYA 3VC3A 3VKFA 3AR5A 1Y5NA 3KZCA 4BO2A 1AKWA 2D2EA 1UPXA 1VJ0A 4GOKA 1JF8A 3IE2A 1BDBA 1TEZA 5EUMA 1LPSA 1VL2A 3DLBA 2HA5A 2OAGA 2G08A 2BFFB 3N2IA 3QJYA 1Y3BE 4L23A 5EVCA 5CCBA 3I61A 2AGVA 3V2IA 1X9GA 1HV8A 2JFQA 6AT1A 3ZDCA 1JLRA 4Z0HO 1RMTA 4EHKA 4B74A 1CIPA 4CM9A 2AEJA 2C5BA 1Z9BA 1FFGA 2VJOA 1QH0A 2ZSEA 4O2AA 1QAMA 2JGAA 4KQKA 3KTDA 2A9FA 3FZYA 2VSFA 3P2JA 2OYCA 4ALJA 3ASUA 2VBIA 2Z6AA 2GN4A 3P0EA 1Y8QA 1GO2A 4G0XA 3CHQA 2HOQA 4H1WA 1SRQA 1Q2ZA 2YWRA 2KPOA 1V1RA 4NCIA 1Y7IA 2Y68A 3BFVA 1R5JA 1PR3A 2BE7A 4MW2A 4G3XA 1OXSC 1LWOA 4WY8A 5JQGB 1YJBA 4ZREA 1NVXQ 2P5SA 3U1TA 1SUIA 1TQ4A 1F0KA 4LRSB 3HXTA 5DNVA 5D2CA 4B3TB 4RSHA 5BQXA 1C3OA 1A71A 1KEEB 2YW2A 3UG6A 1YB5A 4JLSA 4HWSA 3RU3A 5J2UA 1EEXB 3KYDA 4RSGA 1VGVA 5JZVA 4NJMB 1I3MA 3LUDA 3ZPJA 2JVIA 4D9MA 3EG5A 2WE8A 2ATXA 1YR9A 1UFKA 2FJPA 4A6PA 3VPCA 2OGWA 1CUFA 5IKPA 4M8NE 3OVMA 4A5SA 3UEOA 4YPFA 2JIQA 2AXVA 3R5FA 3EZLA 4QQRA 2PHZA 1TJ5A 3E22B 1P0MA 5JD4A 1UOQA 1NJ6A 2HK8A 3KXLA 1O9GA 2HCFA 1TM4E 2XUIA 4RCYA 3PDIA 5AW5A 3TZHA 3D8SA 5C7YA 3QITA 4RPHA 5HCIA 4JWTA 3N28A 3KJXA 4HZIA 1RNLA 3NTUA 5BT8A 2FCRA 3KSQA 4D4MA 5CJJA 2GZDA 1O7JA 3B2NA 5D1HA 3QYAA 2JJ2A 1MC8A 1UAAA 3NM6B 4WN9B 2NXJA 4HFGA 4RPLA 2F1IA 4BNDA 4JJAA 3PR1A 1LRJA 4LV5B 4GBGA 2O1WA 3O03A 5EN4A 2XEDA 4CWAA 5BWBA 1BOOA 3IUPA 1H66A 1PJ3A 2YQZA 1E3DA 4UM9D 1VSTA 1DCKA 3GDGA 2HM8A 1P2TA 2XMQA 1L7PA 5DRYA 2UYHA 4KLCA 4ZJYA 3BX1A 1B93A 1TMOA 3LKVA 4IMJB 4FGUA 3ZIAA 2AXNA 3O75A 1MAUA 3JALA 2RK6A 4PQRA 1Z0DA 4TLBA 1RDFA 1TTPB 5KOYA 2X41A 3GU3A 1JSRA 2BGUA 2HW8A 3LUGA 4Z5XA 3KQTA 4ID3A 1S1CA 3USCS 2UVDA 1E1DA 3RYIB 2RK3A 3BK1A 3LRXA 1JSXA 4R1QA 5CYFA 4IH1A 4MW0A 2H57A 4YUVA 3LVFO 3RT7A 2Z08A 1VPTA 4M1WA 2HHAA 2FLWA 3THRA 5K0NA 4CCAA 3K20A 1D2CA 5HFNA 1W44A 2IS2A 3QX7A 2EFYA 1IXSB 8OHMA 1YFLA 4ILGA 3HDJA 2JI8A 2B37A 3QP9A 3W05A 1WZEA 2LNIA 5J59A 2QRKA 1T0PA 2Z09A 1RPAA 1J9ZA 2O59A 3GN2A 2PUDA 5HVNA 3UY4A 1M2VA 4JOSA 4GG1A 4GWLA 3GY0A 2O2SA 1XLUA 3H6HA 3UKDA 2NO5A 2C3UA 4RORA 3V7NA 4HVBA 2AXPA 5I9IA 1Q57A 3GROA 3HA5A 4JXJA 3EMVA 1BWSA 4KSBA 1PGQA 3IJRA 3CKBA 1FNBA 2NP6A 4B3MB 1I8TA 2QDXA 1N2CE 3KB6A 4LJYA 1WSDA 2YDYA 2NTNA 1NJSA 1YUBA 5BPFA 4PNEA 4Z4FA 2D3WA 5A7GA 1RWVA 1PR9A 4EZIA 1GXSB 2Y1KA 4YMUA 5CLFA 3QXCA 1P60A 3VVMA 4NMLA 1ZD1A 3VTAA 3FTXA 4GEKA 3R7WB 3KG2A 3PFBA 4ADSG 4BKPA 4JKIA 4CMEC 4FC8A 1WUYA 1PT8A 3SX2A 2HJRA 3TDKA 1ISJA 5HYVA 4NEGA 3T4PA 4TVSA 4FOTA 2UUPA 1E4OA 3ZKWB 5ANRA 3HDGA 5EPEA 4TXNA 1GKIA 2HO1A 3RYTC 1PT5A 1KK3A 3PIDA 3DDZX 5IZ4A 1TKRA 1LRKA 4M60A 4O4JB 3QPVA 1H0RA 3B36A 3LWZA 1J49A 3W90A 2AKAB 2Q49A 3OLZA 2P6NA 1UKZA 3TI7A 3KKLA 2FEWB 1I6MA 4X7BA 4HH3C 1U3FA 1YU9A 4BY6A 1G8KA 1M34B 1O94A 3PKIA 1G3QA 4I9GA 4UI9C 1UINA 2RHGB 5E7MA 3R7BA 3O73A 2V7UA 1DWUA 2DF8A 1V7QA 2Q2NA 2YRWA 4O59O 3VOTA 2P6RA 1UANA 4TLLB 2PWPA 1WDLA 2PGAA 5H5JA 1U2SA 1OFGA 2Y0CA 3QLVC 4YHBA 1JDBB 1Z3XA 2B3DA 3LC0A 2VDMB 4C4YA 3L13A 1R6TA 2HE0A 3AR9A 1C1HA 1HZZA 2O52A 1FQWA 2VZLA 5ILQA 5IDXA 2RI1A 4PNPA 1OCCE 5T4BA 3PFKA 3VA7A 1YQXA 5HKKA 2OMEA 4DKJA 3HG0D 4NE2A 4KE7A 4ZTZB 4IJWA 4DQVA 1BHSA 4JHLA 5JSZA 1BWRA 1NUPA 1FJXA 1Z0FA 5JTTA 3LP8A 1YZGA 3A6KA 4HH4A 3PVLA 4FMBB 3BQOA 4PHCA 3TWTA 4P7FA 5LXTA 2V9ZA 2R59A 5BYKA 1A5BB 2EWVA 4Q24A 1N5MA 3EQ2A 5DRTA 1AXEA 3WWDA 4ZVVA 1Q21A 4XM1A 2P3LA 3WAKA 2FUKA 3OF5A 1JAHA 3A26A 4REOA 5AWFC 2BWJA 4FSHA 1E7QA 2OFWA 4FGKA 3UN1A 1W93A 4UM5A 1GZHB 4KBQA 1KMNA 2XE4A 3UFXB 1L5YA 3BEOA 1XQVA 3RUCA 1DZ3A 3A6DA 2IWRA 5IAKA 1W1UA 2E1PA 4JLJA 4HXIA 1H93A 2R17C 1SXIA 1LLCA 1XEAA 2J9FA 2QTLA 1R8YA 2WMOA 3W2EA 3TWUA 3IIKA 3FWVA 4X9XA 2DPHA 1MW8X 4BMXA 3QPUA 4DXAA 3RKVA 2GAIA 4BSXA 1KBOA 3VUFA 1IY1A 2W4MA 3EHEA 2HWUA 4LDRA 2VDWB 3OZBA 1Y81A 1DX6A 5KVVA 1NBIA 3ZJUA 3ISMC 2ISQA 4HDAA 1YHYA 1QP0A 1P81A 3ZRHA 4BFSA 2H4FA 5AVXA 4H4CA 3N9IA 2TSYB 4Q9KA 3SSAA 1CR4A 4GF5A 1XQ9A 4KLRA 4D9JA 3ITNA 2XVYA 5REQB 3LA6A 2C0QA 4EI7A 1G3UA 3IUEA 4FFMA 4EUNA 3PXBA 3PRZA 2GN0A 3T54A 2UYOA 1KH3A 3G2PA 1DCEA 1NV8A 5EIAA 1WHTB 4JW1A 2UZAA 3TUJC 4TQUS 4DOMA 2BM0A 1J2RA 2ZI5A 4MLZA 3RH0A 3C87A 3KKMA 4M7PA 4DDKA 5KINB 4N03A 4IOMA 1JAIA 5BVHA 1BHO1 4INAA 4WY2A 1MDBA 3ICEA 2Z1DA 5JATA 2AOTB 5CB4B 4A8JB 2YZMA 1PLLA 1RJGA 3WL5A 3AKYA 1AUXA 3B8EA 2HTFA 4KAFA 4M22A 3KOOA 1KZ4A 4WJZA 1VSBA 2KSQA 4QRDA 4YXWD 2Y1LA 5LP6A 1OH7A 1V5WA 2AVNA 2HLDA 3W78A 1RAHA 3H87A 4D81A 5KSPA 1PW7A 5FA6A 1MX6A 2XEXA 3ROMA 1A2QA 3OMLA 3IP9A 3P9NA 4ZOAA 2QGFA 5SYMA 1WCIB 4ALNA 3ZU5A 4ZEXA 2GJ9A 3EE6A 2OZKA 4PLWA 4OHZA 3ZWKA 3AU8A 1BSVA 2GF2A 3O1HB 4QBHA 2WXMA 2NQ8A 2NQ2C 1FU8A 3AVOA 2PN1A 2ZWIA 5DXAA 3ZHOA 2OOKA 4FN5A 2Y1WA 1AE1A 4MW5A 4ZAZA 1E1MA 2KM4A 3K6SB 2JFUA 2OLJA 1V25A 3RC3A 3ESRA 5AKJA 5ES3A 5FUMA 2XOKD 3P9RA 1K8RA 1LD8A 1SB9A 5EIOA 4LIPD 1VGRA 2IXEA 3LFTA 3WP1B 3GA0A 4D26A 1O5OA 2Z8YA 3PA6A 1WTCA 1PHPA 3QX9A 5CEDB 1Z73A 3BXEA 1DFIA 4ITVA 3HU5A 3QGMA 4BTEA 3CNEA 2R1UA 3LC7O 4S0XA 4PDXA 1E8DA 1FVFA 2QJTA 4NZYA 2CHGA 4NDAA 2JCSA 1XLTA 1UKYA 4BJ5A 4J3JA 4Q6WA 4RQIA 1PCXA 2OCIA 4OAPA 1QFSA 5D0OD 4R1TA 2DMRA 1F5SA 3ZN3A 1Y8AA 4IIYA 4XGRA 5H9VA 2WFAA 1U8AA 2O2YA 1CUEA 4ZCRA 4YJ2A 4I08A 2XMDA 3NXKA 4MQBA 4L75A 3OY2A 2DR0A 4P3XA 4LF4B 3M3HA 4WBSA 1JU9A 1IK4A 2QS9A 4L5CA 4JI4B 4TXJA 1ELOA 4ZO9A 3D4LA 2BUAA 4C0HA 3KTOA 4RGVA 1R4MB 4X0EA 1B89A 1NTOA 1H8HD 2H1FA 3ZKAA 2JASA 3GHHA 3N5CA 3ZE6A 5IJ0B 1GPMA 3DTYA 1N6LA 2V8BA 4PAOA 3BSYA 3X44A 3UPUA 1CD5A 2DFNA 2PFSA 5CFNA 2AVPA 5HE9A 1DJQA 3VHXA 2G77B 3FBTA 2JBHA 1T4BA 3CW9A 4FI3C 3F4LA 1JA9A 1LPNA 1QCZA 4WAUA 2ZGGA 2CE7A 3GVCA 1JHYA 3GFQA 3OOWA 2XQFA 5HEKA 2XBLA 1SKYB 2VJDA 5C35A 2AKYA 2WFZA 4K0KB 4X8OA 4KXQA 3AUAA 3B3FA 1UDWA 3U3MA 4OLBA 5HBRA 3HJCA 1ONOA 2AYXA 4ZXPA 1JLLB 1NP7A 1K4KA 3H8VA 2O19A 1USUA 4OM8A 3B9RA 3AS8A 3C3QA 1IK6A 2XGMA 2AQKA 2QJRA 1FPQA 5E7QA 2OXTA 4O4HA 2O48X 4YO8A 3EGIA 2V0NA 2I66A 3L6OO 3BWDD 2GHRA 3H17A 4CQLB 5DBHX 3CRNA 1WB5A 3HP4A 4MV0A 3E2PA 2FGKA 2NVWA 3OT5A 1FSPA 3BE4A 5HF9A 4DC1A 4B3FX 2FPIB 3JQ7B 5IJ9B 3M4NA 2ZJ2A 3SIWA 4CQNA 4FDVA 3ZWQA 5J3JA 2Q3CA 1G41A 2PGJA 2PUCA 2RB4A 1XVVA 2N1MA 3UMGA 4KGDA 4B87A 3E4CA 2ALJA 4MH0R 5CBPA 4C0MA 1IEXA 2W0MA 1T6XA 4HEA1 4GECA 2I9PA 2YHCA 1RCTE 1NC1A 4KQXA 4FMPA 4HYEA 3G89A 3SBDA 2E18A 2GPWA 2Y4NA 1CFZA 1FDTA 4RNCA 4OQQA 3UPTA 3CR8A 4ZKEA 3L0CA 4MS4A 3RFCA 1QIDA 3UHPA 4Q4DA 4QYMA 2B2NA 1MQ8B 2C5FA 1MIOB 2GFHA 1M2EA 3IDSA 4NCNA 2AXZA 2VCHA 4JB8A 2FW7A 4BFCA 2YWXA 4A27A 3AEKA 4L5YA 1LK7A 1SXJA 2Z4SA 2VUIB 3KB1A 1S8NA 3M7IA 3OJXA 1FXWA 2VP4A 3KE9A 3EPHA 4RFVA 1YDEA 3BSSA 4NZ9A 1G6Q1 5CP8A 5JSFA 2O2CA 1JR2A 1U7DA 1N7IA 4UEJA 3PHLA 2WJZB 3EF3A 3MLAA 1T2UA 1A98A 4PVDA 2QQEA 2CV2A 1VYTA 3JYQA 2R4UA 1OU0A 1P44A 1GTZA 4F3VA 1LK0A 1ZNWA 3NNSA 2JGRA 3EGXA 1GPNA 3L82A 3LSYA 3VKVA 4G86A 3VC1A 5CRIA 3TW8A 4CV3A 1G2PA 4YWHA 3T0GA 3PC2A 3DW1X 2RGUA 3FSGD 1KGDA 5T41A 2IU4A 1E2UA 5CM8B 1XVLA 2JGFA 1JPJA 3NDPA 1MHPA 5A04A 3TW0A 1GL3A 2VTDA 3CONA 1EVKA 5DP2A 2PK3A 3PC8C 5CW2A 3FCXA 2VHXA 3MTGA 4PINA 4QL3A 1RIFA 3DZKA 3WLQA 3A70A 5ALRA 4QFMA 2BSAA 4LZOA 3Q2IA 5FUYA 2VGXB 1W59A 4HNAA 4QGAA 4E12A 1BG6A 1UMDB 1IUPA 1IEQA 1T9CA 3WA6A 3G6KA 5T64A 3U9TA 3TXMA 4N76A 1D4ZA 5IXYA 4UJ5A 1G63A 3T8KA 4E2YA 1CQJB 2R6CA 2PJUA 4FTWA 4FDMA 1XQWA 1Z2OX 4GLJA 5KSZA 2CFZA 2QD2A 3BWXA 2F67A 1BQ4A 4FILA 1GRRA 4BEBA 3RJ9A 4JJIA 2WU4A 2RAVA 3C5CA 2PLNA 3BG1B 3PD0A 5EMMA 4MK4A 2BFFA 3B38A 3E70C 4OHUA 4CCSA 4D3YA 4W6QA 4ZQFA 2DUMA 2BAGA 2CYCA 3SIRA 4KGXA 2HA4A 2WJ3A 2F1KA 1FC0A 3GVPA 4Q3OA 3I9NA 1VJRA 5FXMA 3OU6A 5CMLA 3U31A 4B9AA 1O0SA 1FMJA 2FSIA 3N2NA 1XZFA 2B69A 3OZIA 4HEQA 1QJ4A 3SJCA 1R3DA 4MB2A 2PUGA 3NBNB 1E6EA 4FIDA 1O6GA 2O6HA 3OM8A 5H59A 1OFIA 2QPOA 3D7SA 1SA4A 3M4YA 1UT6A 2DM6A 3SHTA 1O4VA 1FFDA 1W1WA 2O54A 4JJZA 1VCMA 1OH6A 4GP7A 2OCDA 3COVA 5F4ZA 3PSAA 4N3BA 5JISA 5LQKA 3DXKG 1HL3A 1JL3A 3ZK8A 4LNUD 1P5FA 5F5XA 1GZVA 1LLUA 3A3KA 2VSXE 4GGPA 4INJA 1KDPA 3VR3D 3G2WA 4NJMA 3A28A 5DLPA 4HLNA 3O4FA 4FUTA 2OQIA 1D6SA 3M6VA 2GBLC 1YUNA 4UWLA 4GT1A 3WRYC 3IGFA 2RD2A 1NHGA 2CHFA 2GRNB 1JPUA 3K73O 1MNAA 2ZYAA 5HMLA 4DUGD 4FYHA 1E2IA 1U9JA 4OBEA 4BATA 4L1KA 4GS5A 2UUBB 3APDA 4PZ9A 1C8KA 4P2GA 1BMTA 3EXHC 2G3YA 4RHCA 2VZEA 5HHTA 4NCXA 4F97A 2VT7A 4BX3A 5K3BA 4BIIA 5FORA 2IW1A 2EG5A 3ZEFA 1KZHA 4WASA 1R0ZA 1C7QA 2C03A 2PJDA 1I2DA 2ZRKA 1DXOA 1ZU4A 4QGSA 2PAFA 1EESA 5IT9A 2P2NA 1ATIA 2PL3A 4RXTA 2R0QC 1Z4NA 1FYEA 4GYKA 1XC7A 2LWIA 3HTXA 2I87A 4BU1A 4MEAA 3KD3A 1PJRA 9GPBA 1IZ0A 4F93B 2YJ5A 5GM1A 1GAEO 2C9YA 4LNHA 3WYGA 3LD9A 4GBJA 3DUWA 3CEMA 3F6PA 2H6EA 3PEEA 4B2IA 1D6MA 4HNGA 2ZYTX 4JY7A 4IIBA 3T99A 3D9JA 4ISBA 4TSFA 3ADCA 2C2ZA 1CUXA 4FR5A 2OLKA 4HYQA 5EIXA 5LDHA 3ZE2B 4M9CA 1W6RA 4M0CA 3QH4A 3W3AD 3LC2O 1K08A 4QPJC 1UMBA 2DETA 2VC2B 1QHYA 5EA2A 1Q0RA 5AOCA 3AYZB 3L79A 5J5VA 2FYTA 1X80B 2Q9CA 3HWWA 3RYIA 1V8BA 4UREA 4CM3A 2FFJA 4ETNA 1UDCA 3HNOA 1HGXA 1GNQA 2V4MA 4J7XA 1MRZA 1U31A 2YW9A 1N9ZA 4K9SA 1E79A 3BD6A 1BKDR 3GAMA 5CB4F 1H0HA 5CVDA 3LBAA 2OHOA 4XWTA 1QK4A 3FLMA 1AQIA 3IHLA 4D42A 1RM3A 4L57A 3SC2A 1Y8RA 4PE5B 1ZW6A 5EE3A 2E55A 4RK1A 4WRRA 3L54A 4MVYA 3TTWA 2GTPA 1MRNA 3BF8A 1KOLA 1ZQ9A 2BTOA 4UULA 4BQQA 2PIAA 4Q18A 1V16B 3U7GA 4YN3A 3C39A 3RAJA 4JBLA 2VF7A 1VL0A 5BSHA 3D9PA 2JRCA 4YDSA 1WDWB 2WJVA 1K7CA 3M5PA 4NIMA 4IWYA 2X4DA 1E9SA 1YIDA 4DKXA 1RAAA 2Q6VA 1X7XB 3LO8A 5G3YA 3CCBA 2CCGA 1YOVB 3UMJA 1TC1A 1Q3HA 3FDIA 1KI1A 3GLUA 1NMXA 4PONA 2XVAA 2YXLA 3NQ41 4M0KA 4CMAA 2IUSA 2ZAYA 3AESB 2ZIEA 2H18A 3NTOA 1XWIA 1S6YA 3TG8A 3P2IA 5JXWA 1WCWA 3HVRA 4IVNA 4EMTA 3K1AB 3UANA 3BQMB 3VHLB 2Q6TA 5EIBC 5KYXB 3CZQA 4I3HA 4XQ9A 1HTBA 5AJVB 4MW7A 1RADA 3KALA 3QWHA 4KWCA 4LBWA 4PIVA 4EB6B 3A9UA 3A06A 3LCCA 3Q3IA 2XMSA 1MCZA 1QB8A 3F5FA 4H4DA 4U7DA 4X60A 3HGMA 1XTTA 5IKEA 2RCNA 2SICE 1UP6A 2JBAA 3N6RA 3K5IA 4E94A 3LYLA 4O4JA 3OOJA 5AIJA 4IIFA 3K0HA 1BCSB 1UWLA 3D6HA 3NFYA 1GTL1 3TZCA 1YB7A 1X7GA 4A36A 3NGLA 3PENA 1Q1NA 2CV0A 3FNFA 1EE9A 1XJQA 4LZJA 3JQBA 2X6KA 1M34A 1HC7A 1W29A 4I9NA 4QFBA 3GNTA 4GR4A 3UK1A 3CO0S 3K72B 3A9VA 3KIPA 3OQVA 3EZNA 1W87A 5AKLA 2PWAA 3S28A 5E9WA 4QX6A 3MYRA 3RG2A 3NM4A 1T26A 4B80A 1DWOA 5T3RA 1N6IA 1C9EA 7MHTA 2IFTA 4H4EA 4MYTA 1PNTA 3CT4A 1Q1ZA 4QTUB 4MIYA 4EAQA 4IXDA 3CVVA 2YYSA 2F8XK 3UCEA 1RPZA 4ME6A 4P7BA 3ZYKA 4L16A 5AK3A 1F8FA 4KSYA 2EKBA 1G0NA 1OXMA 2BCGY 4F1JA 1SUAA 3UAWA 5ITWA 4R7GA 5LN1A 5FYDA 4DX2A 2ZI7A 2R44A 3TIXB 2BHRA 4JWKA 2UYGA 4DARA 2FPPB 5IBCA 3NDJA 5IVIA 1WPXA 1X2EA 3H13A 4DL9A 5CMYA 1GPLA 3R0JA 3GRKA 3IUSA 4YGYA 3ZHRA 4Q82A 2YZNA 2VYVD 2QE7A 3BB3A 3FHLA 3MQFA 4URYR 2EBWA 3LCJA 2NZVG 2W6NA 1YMVA 3HKBB 4PG8A 2Q3EA 3AI3A 1X1TA 5H82A 1I51A 1WABA 3W79A 4EEXA 5IANA 5TQJA 4QA9A 1E3EA 3LW8A 4O4IF 2WJYA 2UUAB 2DR3A 1Q3TA 1J5PA 2WXOA 1GNTA 1K92A 2AFIA 721PA 2VHEA 3IEUA 5EPUA 4EO7A 4MO2A 1SCUA 3BGWA 3MF4A 2F90A 4HDOB 2XKBA 1PFYA 2V0GA 1HQYE 3TGPA 4LXUA 3TXYA 5FA5A 2YR0A 4NV3A 5AI5A 4RH3A 4OOFA 3DKIA 4DQXA 4I5GA 4OXYA 4X3PA 5REQA 4I1PA 3PVCA 1AQYA 2VXYA 4HAXA 3ONVA 4FOLA 1HZ4A 1AQLA 4BVFA 4Y0NA 4UWHA 3U5ZB 5K7SA 2F4VB 1GDHA 2PSSA 3EJWA 4ZZIA 5ICEA 4DPMA 4X00A 4XZ3A 2ZSJA 4D25A 3FY4A 4LMBA 4V24A 5FAKA 4G36A 4OI0A 4LRQA 1UOOA 2P9JA 1Q15A 1TKBA 4U2BA 3IQIX 3VPDA 2OB1A 2AWIA 2FPSA 1YA8A 4B3SB 4B83A 3L8CA 4WBNA 1RAGA 4L9RA 3SS9X 5KJFA 2IKQA 2JIMA 1R16A 2H4YA 3EZ9A 1PSWA 4FZVA 4I9CA 4I1MA 3TMYA 5CDFE 1CK4A 2HHHB 4ER0A 1OT3A 3RARA 1Z45A 2ZGVA 1EGHA 3B1VA 4O5AA 5G41A 1SCAA 2IQIA 4RIGA 3J81A 2W6PA 2OO7A 1G19A 4PLGA 2VN8A 2A1IA 4ARIA 3PZDA 5MFPA 1DAMA 1CUYA 4M8IA 4GTSA 1D0SA 8ADHA 3PU6A 1WCIA 1D07A 4QD3A 1RWWA 1JDZA 2RGCA 3N58A 4LZNA 4UBIA 5EX3A 1LV8A 4GKBA 3O38A 4Q4HB 2HBZA 4KQFA 3WDKA 1O0CA 1TMYA 3TQSA 2CVPA 4DCSA 3L5KA 1JTVA 1A8IA 4QBIA 1IN4A 4I4TF 3K6SA 4OA5A 1A9XB 1NVBA 1U80A 1U11A 4DGQA 2ZI4A 2HFJA 4MR8A 3VPAA 1CUUA 1RQNA 4HTFB 2J3QA 5A4KA 5EESA 1PZXA 3KR9A 4KYOB 3D4OA 2ZJBA 1I6LA 4TZ6A 1OB5A 4G2NA 2YNQA 1UWCA 1JQJC 5BQOA 2QN3A 1UJ6A 3MWFA 5JFTA 4PLYA 3PL1A 2OZVA 4B33A 4TUYF 5K3DA 4CQMB 3X0DA 5KQMA 2GXSA 4CIDA 4MVJE 5FKJA 1NY5A 4R0VA 4I9UA 2GXQA 3ZLBA 1FPPA 3I3OA 1S2IA 2FE4A 1DKMA 2VYCA 3F2IA 3JZIA 4UVIA 3H1AA 3IV6A 3TINA 3EOAI 2HSDA 4KQMA 5LIRA 3JVEA 3PHJA 3A3NA 1TO2E 2GZMA 1KI2A 1T8SA 4ZYXA 2DHEA 2W6OA 4Y9DA 3AJRA 1L4NA 5SYAA 4G25A 5H02A 4YJGA 1CJSA 1PQ4A 4RJJA 3ICWA 4F9GA 2JLAA 4QLBA 3N8KA 2R8PA 3G2NA 4E14A 5JS2A 1OKKD 1B14A 1GDDA 1J99A 2PYDA 1SB8A 3IUBA 3V33A 2XB4A 5D66A 3V9PA 2GGFA 2EINE 5H68A 5EIDA 3OAAD 3SHVA 5LSAA 5LLTA 1U4SA 1FDSA 4DCMA 4PCVA 4BVGA 2WTEA 4LHWA 1BHJA 4KUGA 1B6RA 3UENA 1NU8A 1YL6A 2WFMA 3V8EA 4W5NA 2CHWA 4YUAA 1W5EA 3WIVA 1CQWA 5JJLA 4UVDA 4G5FA 1RRVA 4UTRA 1CHDA 3GLIB 4S35A 3PQ8A 4E5DA 2K2WA 3SSNA 4D3ZA 1X7YB 2R8OA 3KT3A 1ACMA 4A1SA 3ZY5A 1XRNA 1VMDA 3MB5A 3NKFA 3I9MA 1ILEA 1QYDA 2NZYA 4II2A 1FFBA 2Q21A 3HFSA 4YRFA 2J0VA 4CLRB 1Q2UA 5FOTA 5AH0A 3AHHA 5CA0A 1R0KA 4IOJA 4X91A 1REQA 5DM0A 3VHRA 1L5MA 1JLLA 1N2IA 4BBJA 1T4DA 4HWPA 4M0LA 2VP6A 1TT7A 5BNZA 3HDTA 1EPUA 3IMKA 3LVQE 4J0EA 1YK1A 3MELA 1LDMA 4XE0A 4KQJA 2O2JA 3RC7A 1VE6A 3S8MA 4JSYA 1EDUA 2JFGA 1UXKA 4OATA 3BB1A 3TL2A 4PS0A 2DKFA 2J6CA 4CQLA 5HZKA 3COSA 1YS4A 2WTMA 5IJWA 3FWPA 1C9MA 2VHVA 1XZAA 5AK4A 2P9NG 4GQAA 3JZDA 5FI0B 2Y8EA 5EGNA 4GIBA 3JQ7A 5IJ9A 2XDQB 4D0SA 4OHXA 1S4QA 3QTLA 2HL6A 2CLHB 1TEVA 4KXWA 2AF4C 3AHGA 1Z36A 1U7HA 1S0PA 3NKLA 5IVDA 3IKMB 3ZUVB 3IPRA 3UAYA 2OBYA 5CGQB 3KOXA 1GL7A 1Y4SA 3RYHB 4XEHA 5E6RB 3LY9A 1ELKA 4X97A 3BIJA 2JJ8A 2WM8A 4KR2A 2AW3A 5J90A 4MINA 4V3BA 1K7FB 3GUUA 2ZJ8A 1NJ5A 2L0TB 4PC3A 5TJHA 3W1VA 1G8YA 1YIAA 1FP4B 4JUBA 3ZBTA 1Z37A 3UYKA 3AF3A 4AVYA 3UKJA 3GGSA 1MIOA 2CUNA 3VC7A 4BJ1A 1E18A 1ZGJA 5TE9A 1HG5A 1R4NA 2GPTA 4GKAA 4B7CA 3D2BA 5A9SA 4JJKA 2CK3D 4EOGA 2AN5A 1E8NA 1OY1A 4ZO8A 2C31A 2P3QA 5FLEX 3L6DA 2WHRA 2I03A 4PQFA 4J2OA 3G68A 3TG5A 3AUJB 3S55A 2EBUA 1II8A 4LYYA 5A62A 4F3TA 5T8KA 2ZATA 3ZGQA 4EFKA 3R5JA 3T9KA 1ECFA 3R3ZA 3RAEC 1MZVA 1IUOA 1ETHA 1E9AA 1QBKC 4AP5A 1P75A 1KQPA 3I2IA 4LQCA 2IWHA 1ZR4A 3RRNB 1MB3A 3MB8A 4B3CA 1EDEA 4L9PA 3PA8A 3A4IA 4Q1FA 2OHXA 3V4RA 1WWKA 4YRBA 1IRIA 1IYGA 2DEUA 1KI6B 4UM8B 2XZDG 4KFCA 3ORFA 4DCPA 2R5NA 5EYPA 2ZT5A 2VDQB 1HX8A 1JI3A 1WKBA 5IVHA 4WZ6A 1EHYA 2C82A 1YVPA 3MD0A 3U9LA 3E3LA 4MDHA 4GLOA 1FBNA 1I1HA 2C20A 3EVBA 3W5UA 4BO9A 4K87A 3T1YB 2GN1A 1I4LD 1NUHA 4BMDA 3O4IA 4BRSA 2HJHA 4C7OB 2JLCA 3I04M 3MC1A 5CERB 2H59A 5DK4A 4X1IB 1UOPA 2EW2A 3KL4A 3DNMA 4D9BA 3GEBA 2V74B 4OGKA 1UN9A 3ZV4A 5KJLA 2Q50A 5JH7A 4JA2A 4P3YA 1N9GB 4DWVA 2HPZA 5DVZA 1P2UA 5HKBA 2WU3A 4YB8A 4K81B 4MI1A 3INRA 5EWLB 2HT1A 4XSVA 3WX0A 4NBUA 3W2HA 3NAZA 1I4TD 2F4NA 1PHRA 5LU8A 5A3SA 4KQ6A 3B7SA 1YCHA 4D97A 1CNFA 5E1BA 3TKYA 3HJBA 4D0NA 4C6TB 1GA4A 1EB8A 3A27A 1S9HA 2ZPTX 1GGNA 2BM8A 4DYVA 1ZRHA 1L5NA 3R9XA 3PJDA 1AU9A 3VJLA 3G1UA 1J70A 4L0QA 5F2NA 4F46A 1Q7RA 1P6XA 4I1SA 2EIXA 1RXUA 4CKXA 1X7WB 2UUOA 4LS3A 5CRUA 1OC4A 3VZCA 4Q1EA 5C9ZA 2H4WA 1SUDA 4JI0B 1NTRA 2IODA 4OGFA 3MUFA 1ORIA 1SD5A 4H16A 4EGFA 4J1TC 2BBTA 1QZUA 4PSAA 3BA6A 2EXXA 2OVFA 5DBKA 3WYAA 5DKFA 1KDTA 3HCNA 5AVQA 1NVWQ 1DEAA 3TMAA 5C3UA 1VYHA 1MLDA 1WY5A 3L8YA 4CG3A 3PR2B 2VDOB 3O48A 1JEYB 1WKVA 4PBRA 4IH9A 4M89A 1Z08A 3UINC 3PHBE 4P29A 3U7HB 3CX7A 2W6ZA 1U9ZA 3N2LA 2VYIA 2DT5A 1U04A 3B6KA 3T1HB 2C2YA 4UTVA 2X0DA 3DLPX 2ZEJA 1B0PA 1Y8CA 3MUNA 3DZFA 2Z6QA 2QG4A 5EERA 3MAJA 2JDIA 4Y1EA 5A3RA 2IIVA 4UTZA 1OUVA 1UJ4A 2IYYA 1XZEA 2OM6A 5EHGA 2BKLA 4YRSA 3W0LB 4JYCA 1XVIA 3H9UA 2XUQA 5IFLA 1LF5A 1L1RA 2PEYA 3ZHYA 3UAOA 3GNQA 4X94A 3AP3A 2HSWA 2FCAA 2HCBA 2VJQA 5DBOA 3DAPA 4DNFA 3DEPA 1V5EA 3GUHA 1DC5A 1NOKA 5JAMA 3PLNA 3R1IA 3TD6A 1RRKA 1K9VF 1IHBA 1CJTC 1NSTA 5CIYA 2IEYA 1NVFA 2R6R1 5AVRA 1N1EA 4CDNA 2G80A 1EX1A 4YI3A 3LG2A 1FYXA 1J5EB 1N4DA 4KRYA 1ZMBA 1PVDA 1XEXA 1NFRA 2XADA 3O1LA 1KRXA 4ZP1A 1N9KA 2W98A 4WDQA 5AVWA 3LCVB 2EQ5A 2OKGA 1ISGA 2JA1A 2ZUTA 1FDRA 4JH0A 3K70C 1HNWB 4FMCF 4E21A 2SKEA 2YNMA 3C6XA 1FLDA 4YQEA 5CD9A 5JVDA 3E9DA 2HJWA 4K9NA 3VU8A 4RELA 2GNAA 4XSGA 2EFDB 2W2PA 5G05C 4PYJA 2FVYA 1PWZA 1MABB 3CH5A 3WYBA 1MFZA 1JQEA 3O4RA 2EKQA 2R6ZA 3CVOA 4RIIA 5AIAA 1MB9A 5EJMA 1IUNA 4KNYA 4RUKA 2IZZA 1CETA 2QVLA 3DEJA 3GJ0A 5ULLA 4UWFA 2A9OA 4YCLA 4JB2A 5AUNB 5DJ5A 4ZZ0A 2XS1A 1Z8FA 3AKCA 4R1MA 4HQOA 1Y48E 4L76A 1D1PA 4IIJF 1JV2B 2O2HA 3ZDDA 4D9FA 1XR3A 1T0IA 3NHMA 4Y2SA 2JHAA 1JFFB 3WK7A 3SHWA 4B3HA 4I6GA 3B13A 3GD5A 3G79A 3QWAA 4LE2A 3I6MA 1O8CA 3FNEA 3R6GA 5E2BA 4RJTA 4M6WB 1W5TA 4RD0A 4ZFHA 5JC8A 1TJCA 4EF4A 1FRZA 3OESA 3WB1A 5TMPA 4L9AA 2ZZKA 4YJKA 3E15A 3Q6MA 4DRXA 1E3LA 1UJBA 4ESOA 3IHTA 4UMDA 2PWZA 2A1TS 1CZKA 3RSFA 2ILRA 1WAMA 1JHOA 1LTXA 4U7JA 3EVTA 3CLUC 2J9QA 2RI0A 3P20A 3GFBA 3P45A 4FUQA 2VOEA 4CQJA 1RWOA 3GI1A 2ZE8A 3QFCA 4AJWA 10MHA 3LUJA 2HSGA 3O3MB 1QO0D 1QG2A 3GXBA 1XZNA 5F33A 3GLGA 3ZR4B 3IDOA 3DSXA 3IXQA 1AKUA 1VKJA 3ESLA 5BUZA 1VLMA 4JKYA 2C7VA 3F8TA 4Y98A 1H2AS 1L6IA 3ZCVA 5FUQA 2F55A 4CU5A 4ENWA 3IUQA 4ABYA 1XI2A 2QTMA 5BQFA 1E94E 2B5WA 1YOVA 1YQ9A 3GYGA 2PRZA 4ETIA 2E85A 4L8WB 4OLFA 5CVVA 1Z4MA 2DKNA 4N82A 1HLFA 1W3BA 3VMMA 2YC4C 4U3JA 2G7ZA 4B09A 4BETA 4HSEA 4UPVA 3UPVA 1HF3A 5C31A 4IVPA 4II3A 1A7JA 1RI3A 3K1AA 3CF4A 3WNVA 2I65A 4B76A 1WZIA 2P27A 4QG7A 4GXQA 5KYXA 4NPAA 5JQWA 4XCVA 7AT1A 4OV6B 3DP9A 4JQCA 3RIBA 8ABPA 2NQTA 2VO1A 2IZ0A 4E3ZA 1EFVB 3FWHA 5ALSA 1G5TA 1R6XA 2MWMA 4QVIA 1ZVJA 4N9WA 3AR6A 1HNZB 3F5SA 4D02A 1N8NA 3R7FA 3IRUA 1SHZA 1Y9ZA 4P84A 2E89A 3MRTA 3JCKC 3P9XA 4KREA 1OTHA 3EWSA 3V4SA 1SVUA 3W6NA 1A5TA 4I1AA 1FMFA 3PUXA 4BP8A 2XCUA 4HX2A 1W36C 4Q9AA 2XF8A 3Q72A 1HQCA 3T5GA 4B6SA 1V5FA 1VLQA 1KZ1A 5CNJA 4B47A 3D9HA 3R23A 4DY6A 1RI4A 4BXOB