4BXDA

Crystal structure of ampdh3 from pseudomonas aeruginosa in complex with tetrasaccharide pentapeptide
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
255
structure length
255
Chain Sequence
MLTIDYNSYRTTTPYGKRVRFLVLHYTALDFAASVKALTTGAASAHYLIPAPHDPSYKAAGFKGQRIFNLVAEEDRAWHAGVSGWARRDNLNDTSIGIEIVNLARDDDGVFTFPDYERSQINALKQLAKNILQRYPDMTPKNVVGHSDIAVGRKSDPGPKLPWKELYEAGIGAWYDDATRDRYREGFERDGLPPRADLLEAFRLYGYALPATVDDAYFASLLRAFQMHFRPENYDGALDVETAAILYALNEKYPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AMPDH3
publication title Cell-Wall Remodeling by the Zinc-Protease Ampdh3 from Pseudomonas Aeruginosa.
pubmed doi rcsb
source organism Pseudomonas aeruginosa pao1
molecule tags Hydrolase/peptide
total genus 75
structure length 255
sequence length 255
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-07-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01510 Amidase_2 N-acetylmuramoyl-L-alanine amidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.101.10 Mainly Alpha Orthogonal Bundle Muramoyl-pentapeptide Carboxypeptidase; domain 1 PGBD-like superfamily/PGBD 4bxdA02
3.40.80.10 Alpha Beta 3-Layer(aba) Sandwich Lysozyme-like Peptidoglycan recognition protein-like 4bxdA01
3T2VA 1S2JA 1AROL 2Y2BA 1EAKA 2R2KA 1SK4A 4BXJA 2XZ8A 5CTVA 1TWQA 2R90A 2Y2CA 1YB0A 2WKXA 2Y2DA 3CG9A 3QJ1A 3LATA 3NG4A 3NNOA 3C2XA 2Y2EA 4BPAA 4BXEA 3EP1A 1SK3A 2L47A 3RT4A 4BOLA 4G54A 2F2LX 3QV4A 1L6JA 3UILA 4IVVA 3CXAA 5E0AA 4Q8SA 3UMQA 3D2YA 3CORA 2EAXA 4BXDA 3NW3A 4KNKA 4KNLA 3UMLA 4Z8IA 4GF9A 1J3GA 2CB3A 1OHTA 2Z9NA 4Q9EA 2F2LA 4OPPA 5E0BA 2XZ4A 3HMBA 5DWFA 4LPQA 3USXA 1YCKA 1Z6IA 2Y28A 3TRUA 1SXRA 4ORVA 4OUGA 1LBAA 4BJ4A 2AR3A 2APHA 3O4KA 2EAVA 3BKVA 3D2ZA 4OLSA 4ZXMA 4X36A 3RDRA 1LBUA 3QS0A 3T39A 3BKHA 4FNNA 2RKQA 3OGXA 2BH7A
chains in the Genus database with same CATH superfamily
3T2VA 1S2JA 1AROL 2Y2BA 1EAKA 2R2KA 1SK4A 4BXJA 2XZ8A 5CTVA 1TWQA 2R90A 2Y2CA 1YB0A 2WKXA 2Y2DA 3CG9A 3QJ1A 3LATA 3NG4A 3NNOA 3C2XA 2Y2EA 4BPAA 4BXEA 3EP1A 1SK3A 2L47A 3RT4A 4BOLA 4G54A 2F2LX 3QV4A 1L6JA 3UILA 4IVVA 3CXAA 5E0AA 4Q8SA 3UMQA 3D2YA 3CORA 2EAXA 4BXDA 3NW3A 4KNKA 4KNLA 3UMLA 4Z8IA 4GF9A 1J3GA 2CB3A 1OHTA 2Z9NA 4Q9EA 2F2LA 4OPPA 5E0BA 2XZ4A 3HMBA 5DWFA 4LPQA 3USXA 1YCKA 1Z6IA 2Y28A 3TRUA 1SXRA 4ORVA 4OUGA 1LBAA 4BJ4A 2AR3A 2APHA 3O4KA 2EAVA 3BKVA 3D2ZA 4OLSA 4ZXMA 4X36A 3RDRA 1LBUA 3QS0A 3T39A 3BKHA 4FNNA 2RKQA 3OGXA 2BH7A
chains in the Genus database with same CATH topology
3T2VA 1S2JA 1AROL 2Y2BA 1EAKA 2R2KA 1SK4A 4BXJA 2XZ8A 5CTVA 1TWQA 2R90A 2Y2CA 1YB0A 2WKXA 2Y2DA 3CG9A 3QJ1A 3LATA 3NG4A 3NNOA 3C2XA 2Y2EA 4BPAA 4BXEA 3EP1A 1SK3A 2L47A 3RT4A 4BOLA 4G54A 2F2LX 3QV4A 1L6JA 3UILA 4IVVA 3CXAA 5E0AA 4Q8SA 3UMQA 3D2YA 3CORA 2EAXA 4BXDA 3NW3A 4KNKA 4KNLA 3UMLA 4Z8IA 4GF9A 1J3GA 2CB3A 1OHTA 2Z9NA 4Q9EA 2F2LA 4OPPA 5E0BA 2XZ4A 3HMBA 5DWFA 4LPQA 3USXA 1YCKA 1Z6IA 2Y28A 3TRUA 1SXRA 4ORVA 4OUGA 1LBAA 4BJ4A 2AR3A 2APHA 3O4KA 2EAVA 3BKVA 3D2ZA 4OLSA 4ZXMA 4X36A 3RDRA 1LBUA 3QS0A 3T39A 3BKHA 4FNNA 2RKQA 3OGXA 2BH7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3T2V A;  1S2J A;  1ARO L;  2Y2B A;  1EAK A;  2R2K A;  1SK4 A;  4BXJ A;  2XZ8 A;  5CTV A;  1TWQ A;  2R90 A;  2Y2C A;  1YB0 A;  2WKX A;  2Y2D A;  3CG9 A;  3QJ1 A;  3LAT A;  3NG4 A;  3NNO A;  3C2X A;  2Y2E A;  4BPA A;  4BXE A;  3EP1 A;  1SK3 A;  2L47 A;  3RT4 A;  4BOL A;  4G54 A;  2F2L X;  3QV4 A;  1L6J A;  3UIL A;  4IVV A;  3CXA A;  5E0A A;  4Q8S A;  3UMQ A;  3D2Y A;  3COR A;  2EAX A;  4BXD A;  3NW3 A;  4KNK A;  4KNL A;  3UML A;  4Z8I A;  4GF9 A;  1J3G A;  2CB3 A;  1OHT A;  2Z9N A;  4Q9E A;  2F2L A;  4OPP A;  5E0B A;  2XZ4 A;  3HMB A;  5DWF A;  4LPQ A;  3USX A;  1YCK A;  1Z6I A;  2Y28 A;  3TRU A;  1SXR A;  4ORV A;  4OUG A;  1LBA A;  4BJ4 A;  2AR3 A;  2APH A;  3O4K A;  2EAV A;  3BKV A;  3D2Z A;  4OLS A;  4ZXM A;  4X36 A;  3RDR A;  1LBU A;  3QS0 A;  3T39 A;  3BKH A;  4FNN A;  2RKQ A;  3OGX A;  2BH7 A; 
#chains in the Genus database with same CATH topology
 3T2V A;  1S2J A;  1ARO L;  2Y2B A;  1EAK A;  2R2K A;  1SK4 A;  4BXJ A;  2XZ8 A;  5CTV A;  1TWQ A;  2R90 A;  2Y2C A;  1YB0 A;  2WKX A;  2Y2D A;  3CG9 A;  3QJ1 A;  3LAT A;  3NG4 A;  3NNO A;  3C2X A;  2Y2E A;  4BPA A;  4BXE A;  3EP1 A;  1SK3 A;  2L47 A;  3RT4 A;  4BOL A;  4G54 A;  2F2L X;  3QV4 A;  1L6J A;  3UIL A;  4IVV A;  3CXA A;  5E0A A;  4Q8S A;  3UMQ A;  3D2Y A;  3COR A;  2EAX A;  4BXD A;  3NW3 A;  4KNK A;  4KNL A;  3UML A;  4Z8I A;  4GF9 A;  1J3G A;  2CB3 A;  1OHT A;  2Z9N A;  4Q9E A;  2F2L A;  4OPP A;  5E0B A;  2XZ4 A;  3HMB A;  5DWF A;  4LPQ A;  3USX A;  1YCK A;  1Z6I A;  2Y28 A;  3TRU A;  1SXR A;  4ORV A;  4OUG A;  1LBA A;  4BJ4 A;  2AR3 A;  2APH A;  3O4K A;  2EAV A;  3BKV A;  3D2Z A;  4OLS A;  4ZXM A;  4X36 A;  3RDR A;  1LBU A;  3QS0 A;  3T39 A;  3BKH A;  4FNN A;  2RKQ A;  3OGX A;  2BH7 A; 
#chains in the Genus database with same CATH homology
 3T2V A;  1S2J A;  1ARO L;  2Y2B A;  1EAK A;  2R2K A;  1SK4 A;  4BXJ A;  2XZ8 A;  5CTV A;  1TWQ A;  2R90 A;  2Y2C A;  1YB0 A;  2WKX A;  2Y2D A;  3CG9 A;  3QJ1 A;  3LAT A;  3NG4 A;  3NNO A;  3C2X A;  2Y2E A;  4BPA A;  4BXE A;  3EP1 A;  1SK3 A;  2L47 A;  3RT4 A;  4BOL A;  4G54 A;  2F2L X;  3QV4 A;  1L6J A;  3UIL A;  4IVV A;  3CXA A;  5E0A A;  4Q8S A;  3UMQ A;  3D2Y A;  3COR A;  2EAX A;  4BXD A;  3NW3 A;  4KNK A;  4KNL A;  3UML A;  4Z8I A;  4GF9 A;  1J3G A;  2CB3 A;  1OHT A;  2Z9N A;  4Q9E A;  2F2L A;  4OPP A;  5E0B A;  2XZ4 A;  3HMB A;  5DWF A;  4LPQ A;  3USX A;  1YCK A;  1Z6I A;  2Y28 A;  3TRU A;  1SXR A;  4ORV A;  4OUG A;  1LBA A;  4BJ4 A;  2AR3 A;  2APH A;  3O4K A;  2EAV A;  3BKV A;  3D2Z A;  4OLS A;  4ZXM A;  4X36 A;  3RDR A;  1LBU A;  3QS0 A;  3T39 A;  3BKH A;  4FNN A;  2RKQ A;  3OGX A;  2BH7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...