4BXIA

Crystal structure of atp binding domain of agrc from staphylococcus aureus
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
153
structure length
146
Chain Sequence
b'NAIKLNGIENLKVREIKGLITAKILRAQEMNIPISIEIPDEVSSINLNMIDLSRSIGIILDNAIEASTEIDDPIIRVAFIESENSVTFIVMNKCADDIPRIHELFQESFSLGLSTLKEIADNADNVLLDTIIENGFFIQKVEIINN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ACCESSORY GENE REGULATOR PROTEIN C
publication title Influence of the Agrc-Agra Complex in the Response Time of Staphylococcus Aureus Quorum Sensing
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Atp-binding protein
total genus 46
structure length 146
sequence length 153
ec nomenclature
pdb deposition date 2013-07-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14501 HATPase_c_5 GHKL domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 4bxiA00
4AWPA 3ZKBA 4HY6A 2YK9A 3RLQA 1NHIA 1UYFA 4LWGA 2E0AA 4EGHA 5BOCA 2IWXA 2UWDA 1H7SA 2YI5A 4FCQA 3WHAA 2BU7A 1AH6A 5J71A 3INXA 4WUCA 2GQPA 4MPNA 3SL2A 1OSFA 3TZ0A 5J6AA 3EHHA 5M4EA 3K99A 3VHDA 2O1VA 5D7DA 4H7QA 4JASA 1TH8A 4HZ0A 4XTJA 2XDLA 4XKOA 2XHXA 4L93A 4EEHA 4QPKA 2WI7A 4ZKIA 4EMVA 4CWRA 3IEDA 5F5RA 3OWDA 1H7UA 5M4PA 3HEKA 2BZ5A 1BKNA 3CGZA 1THNA 1Z5CA 1I5DA 1UY6A 4CWPA 4BAEA 2XJJA 1TIDA 1I5CA 3LPSA 2YKBA 2O1WA 4KP4A 3A0RA 1QY8A 2YE2A 2IWSA 4UROA 2CH4A 2XD6A 3TZ2A 3WQ9A 3TTZA 4E02A 4B7PA 2ZKJA 2HG1A 3OW6A 3HYZA 4V25A 2QG0A 4XCJA 4WUBA 4V26A 3U2DA 4O0BA 4GEEA 4JAUA 2FXSA 4BIUA 3ZXOA 1QYEA 3K98A 4EFUA 3A0WA 2YI0A 4H81A 2XCMA 4HYMA 4NH7A 4HY1A 1I59A 2H55A 1UY7A 5D7CA 4ASBA 3JZ3A 4YKXA 5CTXA 1Y8PA 4I5SA 1U2OA 1YT1A 3PEHA 4R3AA 2CG9A 2XDXA 3EHGA 2YK2A 1YT2A 4FMTA 5FWKA 1TILA 4YKZA 3Q5KA 1ID0A 2YGEA 4EGKA 2EXLA 4XD8A 3TZ4A 2VW5A 2VCIA 2YKIA 4PRXA 3VHAA 3B24A 4XIRA 2BU6A 2QFOA 5FNFA 4HXWA 2CCSA 3C11A 2BYIA 4BXIA 3FT5A 4MB9A 3QDDA 4AWOA 1UYIA 5M4HA 4L94A 2CGFA 4Q20A 1GKXA 1TBWA 3HZ1A 3CGYA 2BT0A 3K97A 4O09A 3FV5A 2YEAA 1AM1A 4U93A 3CRKA 2BU8A 3DGEA 2JJCA 1Y4UA 3T10A 3TZ5A 1AJ6A 4CWOA 1Z5AA 1EA6A 4GGLA 2YE9A 3MNRP 4MP2A 3GIEA 4XITA 3FT8A 4CWQA 4YKUA 2WI4A 3A0XA 3U2KA 1ZWHA 3B28A 2YJXA 2ZBKB 3D2RA 4ASFA 1YC3A 4MOTA 2XHTA 4NH8A 1Y8NA 2WEPA 1YT0A 1UYMA 3K60A 5D6QA 4PL9A 1MU5A 5L3JA 1KIJA 4O05A 5M4MA 5M4KA 4H85A 1BYQA 2WI6A 3R92A 3R4PA 4PRVA 4WUDA 3T2SA 3D0BA 3INWA 2QF6A 3EKOA 3R4MA 2XJXA 2YI6A 3H80A 5CF0A 4X9LA 4XIQA 3BM9A 4KQVA 3R91A 2YE8A 4ASAA 1I5BA 1YC1A 2VCJA 2CCTA 1ZXMA 1YSZA 3LNUA 2QG2A 4DUHA 1UYKA 4CE3A 1AMWA 1YC4A 4K4OA 4YKWA 2YGAA 3B26A 5GGZA 1Y4SA 3B27A 1YS3A 1NHHA 3GIGB 4XCLA 3O0IA 2XK2A 2BU2A 3ZXQA 3B25A 3HHUA 1L0OA 2PNRA 3R4OA 4GT8A 4CWFA 2Q2EB 3VADA 4KFGA 1BXDA 3PEJA 2YEFA 5BODA 4L90A 2YEDA 1ZXNA 2VWCA 2XX5A 5IN9A 1TC6A 1JM6A 2YJWA 2XX4A 1YESA 2FYPA 3T0ZA 4HYPA 4CE1A 4EGIA 2YE6A 5F3KA 3D36A 2YE5A 4GQTA 4KSHA 4URLA 5FNCA 1Y8OA 1A4HA 4FCRA 4CWSA 3CRLA 4LWHA 1S14A 4L8ZA 1UY9A 5D7RA 4KTNA 2HKJA 2YEJA 2YKJA 4LP0A 2IORA 5CTYA 4B6CA 1MX0A 2WI3A 4FCPA 1YSRA 4GFNA 3T1KA 4URNA 1Z59A 5D6PA 4YKQA 1S16A 2O1UA 3BMYA 4P7AA 1ZW9A 2WEQA 4LWIA 3EKRA 4XE2A 1I58A 4I3HA 3VHCA 4E01A 3GIGA 3HYYA 1R62A 2IWUA 4R1FA 2FWYA 4O07A 2IOPA 1UY8A 2Q8FA 3R4NA 4YKRA 5FNDA 3T0HA 4XKKA 4QPJA 2BREA 2WI1A 3G7EA 4U7NA 4DZYA 4MPEA 3RLPA 4BIZA 1GKZA 4U7OA 1UYHA 3G7BA 1UYDA 5IDJA 5CTUA 2XHRA 4XDMA 2Q8HA 2BTZA 2WI2A 2YECA 4JQLA 3A0ZA 2HCHA 2YE3A 2XX2A 4W7TA 3A0YA 3RLRA 2YKCA 3OMUA 2YE4A 4CWNA 2ESAA 4URMA 3O6OA 1GJVA 1U0ZA 2JKIA 2WERA 3RKZA 2Q8GA 4YKTA 2GFDA 2BYHA 1I5AA 3U67A 2BRCA 4XIPA 1YERA 2ZDYA 3OWBA 3C0EA 3OPDA 3Q5LA 2FWZA 2WI5A 3KE6A 2XDSA 3ZKDA 1BGQA 3A0TA 2Q8IA 3GIFA 3EHJA 3EHFA 2YKEA 3H4LA 1PVGA 3ZM7A 4O04A 4E00A 4EFTA 2YEBA 2CCUA 2XABA 4GCZA 2YGFA 1Z5BA 3HZ5A 4PU9A 4XC0A 4KSGA 1KZNA 1TC0A 4BQGA 2AKPA 2YEHA 3CWVA 2YI7A 3TUHA 4JAVA 4LWEA 1B63A 1UYGA 2BU5A 2XDUA 2H8MA 5IDMA 4P8OA 2ZDXA 1YETA 4HXZA 2BSMA 1AH8A 3G75A 5CPHA 4MP7A 1B62A 4R3MA 2YEEA 2C2AA 1UYLA 4MBCA 1UYEA 2XDKA 4L91A 4ASGA 4LPBA 2K5BA 4MPCA 4ZVIA 4CWTA 3O2FA 2XJGA 1US7A 4AWQA 3QTFA 5CTWA 5M4NA 4BQJA 1EI1A 3NMQA 4AS9A 4EM7A 4FPPA 1QZRA 1NHJA 1UYCA 5C93A 2YE7A 1B3QA 4YKYA 2YEGA 4HZ5A 4CE2A 3Q5JA 2IOQA 4XKAA 2YEIA 4NH9A 4LWFA
chains in the Genus database with same CATH superfamily
4AWPA 3ZKBA 4HY6A 2HHIA 2YK9A 3RLQA 1NHIA 1UYFA 4LWGA 2E0AA 4EGHA 5BOCA 2IWXA 2UWDA 1H7SA 2YI5A 4FCQA 3WHAA 2BU7A 1AH6A 5J71A 3INXA 1F51A 4WUCA 2GQPA 4MPNA 3SL2A 1OSFA 3TZ0A 5J6AA 3EHHA 5M4EA 3K99A 3VHDA 2O1VA 5D7DA 4H7QA 4JASA 1TH8A 4HZ0A 4XTJA 2XDLA 4XKOA 2XHXA 4L93A 4EEHA 4QPKA 2WI7A 4ZKIA 4EMVA 4CWRA 3IEDA 5F5RA 3OWDA 1H7UA 5M4PA 3HEKA 2BZ5A 1BKNA 3CGZA 1THNA 1Z5CA 1I5DA 3S5TA 1UY6A 4CWPA 4BAEA 2XJJA 1TIDA 1I5CA 3LPSA 2YKBA 2O1WA 4KP4A 3A0RA 1QY8A 2YE2A 2IWSA 4UROA 2CH4A 2XD6A 3TZ2A 3WQ9A 3TTZA 4E02A 4B7PA 2ZKJA 2HG1A 3OW6A 3HYZA 4V25A 2QG0A 4XCJA 4WUBA 4V26A 3U2DA 4O0BA 4GEEA 4JAUA 2FXSA 4BIUA 3ZXOA 1QYEA 3K98A 4EFUA 3A0WA 2YI0A 4H81A 2XCMA 4HYMA 4NH7A 4HY1A 1I59A 2H55A 1UY7A 5D7CA 4ASBA 3JZ3A 4YKXA 5CTXA 1Y8PA 4I5SA 1U2OA 1YT1A 3PEHA 4R3AA 2CG9A 2XDXA 3EHGA 2YK2A 1YT2A 4FMTA 5FWKA 1TILA 4YKZA 3Q5KA 1ID0A 2YGEA 4EGKA 2EXLA 4XD8A 3TZ4A 2VW5A 2VCIA 2YKIA 4PRXA 3VHAA 3B24A 4XIRA 2BU6A 2QFOA 5FNFA 4HXWA 2CCSA 3C11A 2BYIA 4BXIA 3FT5A 4MB9A 3QDDA 4AWOA 1UYIA 5M4HA 4L94A 2CGFA 4Q20A 1GKXA 1TBWA 3HZ1A 3CGYA 2BT0A 3K97A 4O09A 3FV5A 2YEAA 1AM1A 4U93A 3CRKA 2BU8A 3DGEA 2JJCA 1Y4UA 3T10A 3TZ5A 1AJ6A 4CWOA 1IXMA 1Z5AA 1EA6A 4GGLA 2YE9A 3MNRP 4MP2A 3GIEA 4XITA 3FT8A 4CWQA 4YKUA 2WI4A 3A0XA 3U2KA 1ZWHA 3B28A 2YJXA 2ZBKB 3D2RA 4ASFA 1YC3A 4MOTA 2XHTA 4NH8A 1Y8NA 2C1GA 2WEPA 1YT0A 1UYMA 3K60A 5D6QA 4PL9A 1MU5A 5L3JA 1KIJA 4O05A 5M4MA 5M4KA 4H85A 1BYQA 2WI6A 3R92A 3R4PA 4PRVA 4WUDA 3T2SA 3D0BA 5JENA 3INWA 2QF6A 3EKOA 3R4MA 2XJXA 2YI6A 3H80A 5CF0A 4X9LA 4XIQA 3BM9A 4KQVA 3R91A 2YE8A 4ASAA 1I5BA 1YC1A 2VCJA 2CCTA 1ZXMA 1YSZA 3LNUA 2QG2A 4DUHA 1UYKA 3CYGA 4CE3A 1AMWA 1YC4A 4K4OA 4YKWA 2YGAA 3B26A 5GGZA 1Y4SA 3B27A 1YS3A 1NHHA 3GIGB 4XCLA 3O0IA 2XK2A 2BU2A 3ZXQA 3B25A 3HHUA 1L0OA 2PNRA 3R4OA 4GT8A 3LMMA 4CWFA 2Q2EB 3VADA 4KFGA 1BXDA 3PEJA 2YEFA 5BODA 4L90A 2YEDA 1ZXNA 2VWCA 2XX5A 5IN9A 1TC6A 1JM6A 2YJWA 2XX4A 1YESA 2FYPA 3T0ZA 4HYPA 4CE1A 4EGIA 2YE6A 5F3KA 3D36A 2YE5A 4GQTA 4KSHA 4URLA 5FNCA 1Y8OA 1A4HA 4FCRA 4CWSA 3CRLA 4LWHA 1S14A 4L8ZA 1UY9A 5D7RA 4KTNA 2HKJA 2YEJA 2YKJA 4LP0A 2IORA 5CTYA 4B6CA 1MX0A 2WI3A 4FCPA 1YSRA 4GFNA 3T1KA 4URNA 1Z59A 5D6PA 4YKQA 1S16A 2O1UA 3BMYA 4P7AA 1ZW9A 2WEQA 4LWIA 3EKRA 4XE2A 1I58A 4I3HA 3VHCA 4E01A 3GIGA 3HYYA 1R62A 2IWUA 4R1FA 2FWYA 4O07A 2IOPA 1UY8A 2Q8FA 3R4NA 4YKRA 5FNDA 3T0HA 4XKKA 4QPJA 2BREA 2WI1A 3G7EA 4U7NA 4DZYA 4MPEA 3RLPA 4BIZA 1GKZA 4U7OA 1UYHA 3G7BA 1UYDA 5IDJA 5CTUA 2XHRA 4XDMA 2Q8HA 2BTZA 2WI2A 2YECA 4JQLA 3A0ZA 2HCHA 2YE3A 2XX2A 4W7TA 3A0YA 3RLRA 2YKCA 3OMUA 2YE4A 4CWNA 2ESAA 4URMA 3O6OA 1GJVA 2FTKA 1U0ZA 2JKIA 2WERA 3RKZA 2Q8GA 4YKTA 2GFDA 2BYHA 1I5AA 3U67A 2BRCA 4XIPA 1YERA 2ZDYA 3OWBA 3C0EA 3OPDA 3Q5LA 2FWZA 2WI5A 3KE6A 2XDSA 3ZKDA 1BGQA 3A0TA 2Q8IA 3GIFA 3EHJA 3EHFA 2YKEA 3H4LA 1PVGA 3ZM7A 4O04A 4E00A 4EFTA 2YEBA 2CCUA 2XABA 4GCZA 2YGFA 1Z5BA 3HZ5A 4PU9A 4XC0A 4KSGA 1KZNA 1TC0A 4BQGA 2AKPA 2YEHA 3CWVA 2YI7A 3TUHA 4JAVA 4LWEA 1B63A 1UYGA 2BU5A 2XDUA 2H8MA 5IDMA 4P8OA 2ZDXA 1YETA 4HXZA 2BSMA 1AH8A 3G75A 5CPHA 4MP7A 1B62A 4R3MA 2YEEA 2C2AA 1UYLA 4MBCA 1UYEA 2XDKA 4L91A 4ASGA 4LPBA 2K5BA 2C1IA 4MPCA 4ZVIA 4CWTA 3O2FA 2XJGA 1US7A 4AWQA 3QTFA 5CTWA 5M4NA 4BQJA 1EI1A 3NMQA 4AS9A 4EM7A 4FPPA 1QZRA 1NHJA 1UYCA 5C93A 2YE7A 1B3QA 4YKYA 2YEGA 4HZ5A 4CE2A 4E72A 3Q5JA 2IOQA 4XKAA 2YEIA 4NH9A 4LWFA
chains in the Genus database with same CATH topology
4AWPA 3ZKBA 4HY6A 2YK9A 3RLQA 1NHIA 1UYFA 4LWGA 2E0AA 4EGHA 5BOCA 2IWXA 2UWDA 1H7SA 2YI5A 4FCQA 3WHAA 2BU7A 1AH6A 5J71A 3INXA 4WUCA 2GQPA 4MPNA 3SL2A 1OSFA 3TZ0A 5J6AA 3EHHA 5M4EA 3K99A 3VHDA 2O1VA 5D7DA 4H7QA 4JASA 1TH8A 4HZ0A 4XTJA 2XDLA 4XKOA 2XHXA 4L93A 4EEHA 4QPKA 2WI7A 4ZKIA 4EMVA 4CWRA 3IEDA 5F5RA 3OWDA 1H7UA 5M4PA 3HEKA 2BZ5A 1BKNA 3CGZA 1THNA 1Z5CA 1I5DA 1UY6A 4CWPA 4BAEA 2XJJA 1TIDA 1I5CA 3LPSA 2YKBA 2O1WA 4KP4A 3A0RA 1QY8A 2YE2A 2IWSA 4UROA 2CH4A 2XD6A 3TZ2A 3WQ9A 3TTZA 4E02A 4B7PA 2ZKJA 2HG1A 3OW6A 3HYZA 4V25A 2QG0A 4XCJA 4WUBA 4V26A 3U2DA 4O0BA 4GEEA 4JAUA 2FXSA 4BIUA 3ZXOA 1QYEA 3K98A 4EFUA 3A0WA 2YI0A 4H81A 2XCMA 4HYMA 4NH7A 4HY1A 1I59A 2H55A 1UY7A 5D7CA 4ASBA 3JZ3A 4YKXA 5CTXA 1Y8PA 4I5SA 1U2OA 1YT1A 3PEHA 4R3AA 2CG9A 2XDXA 3EHGA 2YK2A 1YT2A 4FMTA 5FWKA 1TILA 4YKZA 3Q5KA 1ID0A 2YGEA 4EGKA 2EXLA 4XD8A 3TZ4A 2VW5A 2VCIA 2YKIA 4PRXA 3VHAA 3B24A 4XIRA 2BU6A 2QFOA 5FNFA 4HXWA 2CCSA 3C11A 2BYIA 4BXIA 3FT5A 4MB9A 3QDDA 4AWOA 1UYIA 5M4HA 4L94A 2CGFA 4Q20A 1GKXA 1TBWA 3HZ1A 3CGYA 2BT0A 3K97A 4O09A 3FV5A 2YEAA 1AM1A 4U93A 3CRKA 2BU8A 3DGEA 2JJCA 1Y4UA 3T10A 3TZ5A 1AJ6A 4CWOA 1Z5AA 1EA6A 4GGLA 2YE9A 3MNRP 4MP2A 3GIEA 4XITA 3FT8A 4CWQA 4YKUA 2WI4A 3A0XA 3U2KA 1ZWHA 3B28A 2YJXA 2ZBKB 3D2RA 4ASFA 1YC3A 4MOTA 2XHTA 4NH8A 1Y8NA 2WEPA 1YT0A 1UYMA 3K60A 5D6QA 4PL9A 1MU5A 5L3JA 1KIJA 4O05A 5M4MA 5M4KA 4H85A 1BYQA 2WI6A 3R92A 3R4PA 4PRVA 4WUDA 3T2SA 3D0BA 3INWA 2QF6A 3EKOA 3R4MA 2XJXA 2YI6A 3H80A 5CF0A 4X9LA 4XIQA 3BM9A 4KQVA 3R91A 2YE8A 4ASAA 1I5BA 1YC1A 2VCJA 2CCTA 1ZXMA 1YSZA 3LNUA 2QG2A 4DUHA 1UYKA 4CE3A 1AMWA 1YC4A 4K4OA 4YKWA 2YGAA 3B26A 5GGZA 1Y4SA 3B27A 1YS3A 1NHHA 3GIGB 4XCLA 3O0IA 2XK2A 2BU2A 3ZXQA 3B25A 3HHUA 1L0OA 2PNRA 3R4OA 4GT8A 4CWFA 2Q2EB 3VADA 4KFGA 1BXDA 3PEJA 2YEFA 5BODA 4L90A 2YEDA 1ZXNA 2VWCA 2XX5A 5IN9A 1TC6A 1JM6A 2YJWA 2XX4A 1YESA 2FYPA 3T0ZA 4HYPA 4CE1A 4EGIA 2YE6A 5F3KA 3D36A 2YE5A 4GQTA 4KSHA 4URLA 5FNCA 1Y8OA 1A4HA 4FCRA 4CWSA 3CRLA 4LWHA 1S14A 4L8ZA 1UY9A 5D7RA 4KTNA 2HKJA 2YEJA 2YKJA 4LP0A 2IORA 5CTYA 4B6CA 1MX0A 2WI3A 4FCPA 1YSRA 4GFNA 3T1KA 4URNA 1Z59A 5D6PA 4YKQA 1S16A 2O1UA 3BMYA 4P7AA 1ZW9A 2WEQA 4LWIA 3EKRA 4XE2A 1I58A 4I3HA 3VHCA 4E01A 3GIGA 3HYYA 1R62A 2IWUA 4R1FA 2FWYA 4O07A 2IOPA 1UY8A 2Q8FA 3R4NA 4YKRA 5FNDA 3T0HA 4XKKA 4QPJA 2BREA 2WI1A 3G7EA 4U7NA 4DZYA 4MPEA 3RLPA 4BIZA 1GKZA 4U7OA 1UYHA 3G7BA 1UYDA 5IDJA 5CTUA 2XHRA 4XDMA 2Q8HA 2BTZA 2WI2A 2YECA 4JQLA 3A0ZA 2HCHA 2YE3A 2XX2A 4W7TA 3A0YA 3RLRA 2YKCA 3OMUA 2YE4A 4CWNA 2ESAA 4URMA 3O6OA 1GJVA 1U0ZA 2JKIA 2WERA 3RKZA 2Q8GA 4YKTA 2GFDA 2BYHA 1I5AA 3U67A 2BRCA 4XIPA 1YERA 2ZDYA 3OWBA 3C0EA 3OPDA 3Q5LA 2FWZA 2WI5A 3KE6A 2XDSA 3ZKDA 1BGQA 3A0TA 2Q8IA 3GIFA 3EHJA 3EHFA 2YKEA 3H4LA 1PVGA 3ZM7A 4O04A 4E00A 4EFTA 2YEBA 2CCUA 2XABA 4GCZA 2YGFA 1Z5BA 3HZ5A 4PU9A 4XC0A 4KSGA 1KZNA 1TC0A 4BQGA 2AKPA 2YEHA 3CWVA 2YI7A 3TUHA 4JAVA 4LWEA 1B63A 1UYGA 2BU5A 2XDUA 2H8MA 5IDMA 4P8OA 2ZDXA 1YETA 4HXZA 2BSMA 1AH8A 3G75A 5CPHA 4MP7A 1B62A 4R3MA 2YEEA 2C2AA 1UYLA 4MBCA 1UYEA 2XDKA 4L91A 4ASGA 4LPBA 2K5BA 4MPCA 4ZVIA 4CWTA 3O2FA 2XJGA 1US7A 4AWQA 3QTFA 5CTWA 5M4NA 4BQJA 1EI1A 3NMQA 4AS9A 4EM7A 4FPPA 1QZRA 1NHJA 1UYCA 5C93A 2YE7A 1B3QA 4YKYA 2YEGA 4HZ5A 4CE2A 3Q5JA 2IOQA 4XKAA 2YEIA 4NH9A 4LWFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AWP A;  3ZKB A;  4HY6 A;  2YK9 A;  3RLQ A;  1NHI A;  1UYF A;  4LWG A;  2E0A A;  4EGH A;  5BOC A;  2IWX A;  2UWD A;  1H7S A;  2YI5 A;  4FCQ A;  3WHA A;  2BU7 A;  1AH6 A;  5J71 A;  3INX A;  4WUC A;  2GQP A;  4MPN A;  3SL2 A;  1OSF A;  3TZ0 A;  5J6A A;  3EHH A;  5M4E A;  3K99 A;  3VHD A;  2O1V A;  5D7D A;  4H7Q A;  4JAS A;  1TH8 A;  4HZ0 A;  4XTJ A;  2XDL A;  4XKO A;  2XHX A;  4L93 A;  4EEH A;  4QPK A;  2WI7 A;  4ZKI A;  4EMV A;  4CWR A;  3IED A;  5F5R A;  3OWD A;  1H7U A;  5M4P A;  3HEK A;  2BZ5 A;  1BKN A;  3CGZ A;  1THN A;  1Z5C A;  1I5D A;  1UY6 A;  4CWP A;  4BAE A;  2XJJ A;  1TID A;  1I5C A;  3LPS A;  2YKB A;  2O1W A;  4KP4 A;  3A0R A;  1QY8 A;  2YE2 A;  2IWS A;  4URO A;  2CH4 A;  2XD6 A;  3TZ2 A;  3WQ9 A;  3TTZ A;  4E02 A;  4B7P A;  2ZKJ A;  2HG1 A;  3OW6 A;  3HYZ A;  4V25 A;  2QG0 A;  4XCJ A;  4WUB A;  4V26 A;  3U2D A;  4O0B A;  4GEE A;  4JAU A;  2FXS A;  4BIU A;  3ZXO A;  1QYE A;  3K98 A;  4EFU A;  3A0W A;  2YI0 A;  4H81 A;  2XCM A;  4HYM A;  4NH7 A;  4HY1 A;  1I59 A;  2H55 A;  1UY7 A;  5D7C A;  4ASB A;  3JZ3 A;  4YKX A;  5CTX A;  1Y8P A;  4I5S A;  1U2O A;  1YT1 A;  3PEH A;  4R3A A;  2CG9 A;  2XDX A;  3EHG A;  2YK2 A;  1YT2 A;  4FMT A;  5FWK A;  1TIL A;  4YKZ A;  3Q5K A;  1ID0 A;  2YGE A;  4EGK A;  2EXL A;  4XD8 A;  3TZ4 A;  2VW5 A;  2VCI A;  2YKI A;  4PRX A;  3VHA A;  3B24 A;  4XIR A;  2BU6 A;  2QFO A;  5FNF A;  4HXW A;  2CCS A;  3C11 A;  2BYI A;  4BXI A;  3FT5 A;  4MB9 A;  3QDD A;  4AWO A;  1UYI A;  5M4H A;  4L94 A;  2CGF A;  4Q20 A;  1GKX A;  1TBW A;  3HZ1 A;  3CGY A;  2BT0 A;  3K97 A;  4O09 A;  3FV5 A;  2YEA A;  1AM1 A;  4U93 A;  3CRK A;  2BU8 A;  3DGE A;  2JJC A;  1Y4U A;  3T10 A;  3TZ5 A;  1AJ6 A;  4CWO A;  1Z5A A;  1EA6 A;  4GGL A;  2YE9 A;  3MNR P;  4MP2 A;  3GIE A;  4XIT A;  3FT8 A;  4CWQ A;  4YKU A;  2WI4 A;  3A0X A;  3U2K A;  1ZWH A;  3B28 A;  2YJX A;  2ZBK B;  3D2R A;  4ASF A;  1YC3 A;  4MOT A;  2XHT A;  4NH8 A;  1Y8N A;  2WEP A;  1YT0 A;  1UYM A;  3K60 A;  5D6Q A;  4PL9 A;  1MU5 A;  5L3J A;  1KIJ A;  4O05 A;  5M4M A;  5M4K A;  4H85 A;  1BYQ A;  2WI6 A;  3R92 A;  3R4P A;  4PRV A;  4WUD A;  3T2S A;  3D0B A;  3INW A;  2QF6 A;  3EKO A;  3R4M A;  2XJX A;  2YI6 A;  3H80 A;  5CF0 A;  4X9L A;  4XIQ A;  3BM9 A;  4KQV A;  3R91 A;  2YE8 A;  4ASA A;  1I5B A;  1YC1 A;  2VCJ A;  2CCT A;  1ZXM A;  1YSZ A;  3LNU A;  2QG2 A;  4DUH A;  1UYK A;  4CE3 A;  1AMW A;  1YC4 A;  4K4O A;  4YKW A;  2YGA A;  3B26 A;  5GGZ A;  1Y4S A;  3B27 A;  1YS3 A;  1NHH A;  3GIG B;  4XCL A;  3O0I A;  2XK2 A;  2BU2 A;  3ZXQ A;  3B25 A;  3HHU A;  1L0O A;  2PNR A;  3R4O A;  4GT8 A;  4CWF A;  2Q2E B;  3VAD A;  4KFG A;  1BXD A;  3PEJ A;  2YEF A;  5BOD A;  4L90 A;  2YED A;  1ZXN A;  2VWC A;  2XX5 A;  5IN9 A;  1TC6 A;  1JM6 A;  2YJW A;  2XX4 A;  1YES A;  2FYP A;  3T0Z A;  4HYP A;  4CE1 A;  4EGI A;  2YE6 A;  5F3K A;  3D36 A;  2YE5 A;  4GQT A;  4KSH A;  4URL A;  5FNC A;  1Y8O A;  1A4H A;  4FCR A;  4CWS A;  3CRL A;  4LWH A;  1S14 A;  4L8Z A;  1UY9 A;  5D7R A;  4KTN A;  2HKJ A;  2YEJ A;  2YKJ A;  4LP0 A;  2IOR A;  5CTY A;  4B6C A;  1MX0 A;  2WI3 A;  4FCP A;  1YSR A;  4GFN A;  3T1K A;  4URN A;  1Z59 A;  5D6P A;  4YKQ A;  1S16 A;  2O1U A;  3BMY A;  4P7A A;  1ZW9 A;  2WEQ A;  4LWI A;  3EKR A;  4XE2 A;  1I58 A;  4I3H A;  3VHC A;  4E01 A;  3GIG A;  3HYY A;  1R62 A;  2IWU A;  4R1F A;  2FWY A;  4O07 A;  2IOP A;  1UY8 A;  2Q8F A;  3R4N A;  4YKR A;  5FND A;  3T0H A;  4XKK A;  4QPJ A;  2BRE A;  2WI1 A;  3G7E A;  4U7N A;  4DZY A;  4MPE A;  3RLP A;  4BIZ A;  1GKZ A;  4U7O A;  1UYH A;  3G7B A;  1UYD A;  5IDJ A;  5CTU A;  2XHR A;  4XDM A;  2Q8H A;  2BTZ A;  2WI2 A;  2YEC A;  4JQL A;  3A0Z A;  2HCH A;  2YE3 A;  2XX2 A;  4W7T A;  3A0Y A;  3RLR A;  2YKC A;  3OMU A;  2YE4 A;  4CWN A;  2ESA A;  4URM A;  3O6O A;  1GJV A;  1U0Z A;  2JKI A;  2WER A;  3RKZ A;  2Q8G A;  4YKT A;  2GFD A;  2BYH A;  1I5A A;  3U67 A;  2BRC A;  4XIP A;  1YER A;  2ZDY A;  3OWB A;  3C0E A;  3OPD A;  3Q5L A;  2FWZ A;  2WI5 A;  3KE6 A;  2XDS A;  3ZKD A;  1BGQ A;  3A0T A;  2Q8I A;  3GIF A;  3EHJ A;  3EHF A;  2YKE A;  3H4L A;  1PVG A;  3ZM7 A;  4O04 A;  4E00 A;  4EFT A;  2YEB A;  2CCU A;  2XAB A;  4GCZ A;  2YGF A;  1Z5B A;  3HZ5 A;  4PU9 A;  4XC0 A;  4KSG A;  1KZN A;  1TC0 A;  4BQG A;  2AKP A;  2YEH A;  3CWV A;  2YI7 A;  3TUH A;  4JAV A;  4LWE A;  1B63 A;  1UYG A;  2BU5 A;  2XDU A;  2H8M A;  5IDM A;  4P8O A;  2ZDX A;  1YET A;  4HXZ A;  2BSM A;  1AH8 A;  3G75 A;  5CPH A;  4MP7 A;  1B62 A;  4R3M A;  2YEE A;  2C2A A;  1UYL A;  4MBC A;  1UYE A;  2XDK A;  4L91 A;  4ASG A;  4LPB A;  2K5B A;  4MPC A;  4ZVI A;  4CWT A;  3O2F A;  2XJG A;  1US7 A;  4AWQ A;  3QTF A;  5CTW A;  5M4N A;  4BQJ A;  1EI1 A;  3NMQ A;  4AS9 A;  4EM7 A;  4FPP A;  1QZR A;  1NHJ A;  1UYC A;  5C93 A;  2YE7 A;  1B3Q A;  4YKY A;  2YEG A;  4HZ5 A;  4CE2 A;  3Q5J A;  2IOQ A;  4XKA A;  2YEI A;  4NH9 A;  4LWF A; 
#chains in the Genus database with same CATH topology
 4AWP A;  3ZKB A;  4HY6 A;  2HHI A;  2YK9 A;  3RLQ A;  1NHI A;  1UYF A;  4LWG A;  2E0A A;  4EGH A;  5BOC A;  2IWX A;  2UWD A;  1H7S A;  2YI5 A;  4FCQ A;  3WHA A;  2BU7 A;  1AH6 A;  5J71 A;  3INX A;  1F51 A;  4WUC A;  2GQP A;  4MPN A;  3SL2 A;  1OSF A;  3TZ0 A;  5J6A A;  3EHH A;  5M4E A;  3K99 A;  3VHD A;  2O1V A;  5D7D A;  4H7Q A;  4JAS A;  1TH8 A;  4HZ0 A;  4XTJ A;  2XDL A;  4XKO A;  2XHX A;  4L93 A;  4EEH A;  4QPK A;  2WI7 A;  4ZKI A;  4EMV A;  4CWR A;  3IED A;  5F5R A;  3OWD A;  1H7U A;  5M4P A;  3HEK A;  2BZ5 A;  1BKN A;  3CGZ A;  1THN A;  1Z5C A;  1I5D A;  3S5T A;  1UY6 A;  4CWP A;  4BAE A;  2XJJ A;  1TID A;  1I5C A;  3LPS A;  2YKB A;  2O1W A;  4KP4 A;  3A0R A;  1QY8 A;  2YE2 A;  2IWS A;  4URO A;  2CH4 A;  2XD6 A;  3TZ2 A;  3WQ9 A;  3TTZ A;  4E02 A;  4B7P A;  2ZKJ A;  2HG1 A;  3OW6 A;  3HYZ A;  4V25 A;  2QG0 A;  4XCJ A;  4WUB A;  4V26 A;  3U2D A;  4O0B A;  4GEE A;  4JAU A;  2FXS A;  4BIU A;  3ZXO A;  1QYE A;  3K98 A;  4EFU A;  3A0W A;  2YI0 A;  4H81 A;  2XCM A;  4HYM A;  4NH7 A;  4HY1 A;  1I59 A;  2H55 A;  1UY7 A;  5D7C A;  4ASB A;  3JZ3 A;  4YKX A;  5CTX A;  1Y8P A;  4I5S A;  1U2O A;  1YT1 A;  3PEH A;  4R3A A;  2CG9 A;  2XDX A;  3EHG A;  2YK2 A;  1YT2 A;  4FMT A;  5FWK A;  1TIL A;  4YKZ A;  3Q5K A;  1ID0 A;  2YGE A;  4EGK A;  2EXL A;  4XD8 A;  3TZ4 A;  2VW5 A;  2VCI A;  2YKI A;  4PRX A;  3VHA A;  3B24 A;  4XIR A;  2BU6 A;  2QFO A;  5FNF A;  4HXW A;  2CCS A;  3C11 A;  2BYI A;  4BXI A;  3FT5 A;  4MB9 A;  3QDD A;  4AWO A;  1UYI A;  5M4H A;  4L94 A;  2CGF A;  4Q20 A;  1GKX A;  1TBW A;  3HZ1 A;  3CGY A;  2BT0 A;  3K97 A;  4O09 A;  3FV5 A;  2YEA A;  1AM1 A;  4U93 A;  3CRK A;  2BU8 A;  3DGE A;  2JJC A;  1Y4U A;  3T10 A;  3TZ5 A;  1AJ6 A;  4CWO A;  1IXM A;  1Z5A A;  1EA6 A;  4GGL A;  2YE9 A;  3MNR P;  4MP2 A;  3GIE A;  4XIT A;  3FT8 A;  4CWQ A;  4YKU A;  2WI4 A;  3A0X A;  3U2K A;  1ZWH A;  3B28 A;  2YJX A;  2ZBK B;  3D2R A;  4ASF A;  1YC3 A;  4MOT A;  2XHT A;  4NH8 A;  1Y8N A;  2C1G A;  2WEP A;  1YT0 A;  1UYM A;  3K60 A;  5D6Q A;  4PL9 A;  1MU5 A;  5L3J A;  1KIJ A;  4O05 A;  5M4M A;  5M4K A;  4H85 A;  1BYQ A;  2WI6 A;  3R92 A;  3R4P A;  4PRV A;  4WUD A;  3T2S A;  3D0B A;  5JEN A;  3INW A;  2QF6 A;  3EKO A;  3R4M A;  2XJX A;  2YI6 A;  3H80 A;  5CF0 A;  4X9L A;  4XIQ A;  3BM9 A;  4KQV A;  3R91 A;  2YE8 A;  4ASA A;  1I5B A;  1YC1 A;  2VCJ A;  2CCT A;  1ZXM A;  1YSZ A;  3LNU A;  2QG2 A;  4DUH A;  1UYK A;  3CYG A;  4CE3 A;  1AMW A;  1YC4 A;  4K4O A;  4YKW A;  2YGA A;  3B26 A;  5GGZ A;  1Y4S A;  3B27 A;  1YS3 A;  1NHH A;  3GIG B;  4XCL A;  3O0I A;  2XK2 A;  2BU2 A;  3ZXQ A;  3B25 A;  3HHU A;  1L0O A;  2PNR A;  3R4O A;  4GT8 A;  3LMM A;  4CWF A;  2Q2E B;  3VAD A;  4KFG A;  1BXD A;  3PEJ A;  2YEF A;  5BOD A;  4L90 A;  2YED A;  1ZXN A;  2VWC A;  2XX5 A;  5IN9 A;  1TC6 A;  1JM6 A;  2YJW A;  2XX4 A;  1YES A;  2FYP A;  3T0Z A;  4HYP A;  4CE1 A;  4EGI A;  2YE6 A;  5F3K A;  3D36 A;  2YE5 A;  4GQT A;  4KSH A;  4URL A;  5FNC A;  1Y8O A;  1A4H A;  4FCR A;  4CWS A;  3CRL A;  4LWH A;  1S14 A;  4L8Z A;  1UY9 A;  5D7R A;  4KTN A;  2HKJ A;  2YEJ A;  2YKJ A;  4LP0 A;  2IOR A;  5CTY A;  4B6C A;  1MX0 A;  2WI3 A;  4FCP A;  1YSR A;  4GFN A;  3T1K A;  4URN A;  1Z59 A;  5D6P A;  4YKQ A;  1S16 A;  2O1U A;  3BMY A;  4P7A A;  1ZW9 A;  2WEQ A;  4LWI A;  3EKR A;  4XE2 A;  1I58 A;  4I3H A;  3VHC A;  4E01 A;  3GIG A;  3HYY A;  1R62 A;  2IWU A;  4R1F A;  2FWY A;  4O07 A;  2IOP A;  1UY8 A;  2Q8F A;  3R4N A;  4YKR A;  5FND A;  3T0H A;  4XKK A;  4QPJ A;  2BRE A;  2WI1 A;  3G7E A;  4U7N A;  4DZY A;  4MPE A;  3RLP A;  4BIZ A;  1GKZ A;  4U7O A;  1UYH A;  3G7B A;  1UYD A;  5IDJ A;  5CTU A;  2XHR A;  4XDM A;  2Q8H A;  2BTZ A;  2WI2 A;  2YEC A;  4JQL A;  3A0Z A;  2HCH A;  2YE3 A;  2XX2 A;  4W7T A;  3A0Y A;  3RLR A;  2YKC A;  3OMU A;  2YE4 A;  4CWN A;  2ESA A;  4URM A;  3O6O A;  1GJV A;  2FTK A;  1U0Z A;  2JKI A;  2WER A;  3RKZ A;  2Q8G A;  4YKT A;  2GFD A;  2BYH A;  1I5A A;  3U67 A;  2BRC A;  4XIP A;  1YER A;  2ZDY A;  3OWB A;  3C0E A;  3OPD A;  3Q5L A;  2FWZ A;  2WI5 A;  3KE6 A;  2XDS A;  3ZKD A;  1BGQ A;  3A0T A;  2Q8I A;  3GIF A;  3EHJ A;  3EHF A;  2YKE A;  3H4L A;  1PVG A;  3ZM7 A;  4O04 A;  4E00 A;  4EFT A;  2YEB A;  2CCU A;  2XAB A;  4GCZ A;  2YGF A;  1Z5B A;  3HZ5 A;  4PU9 A;  4XC0 A;  4KSG A;  1KZN A;  1TC0 A;  4BQG A;  2AKP A;  2YEH A;  3CWV A;  2YI7 A;  3TUH A;  4JAV A;  4LWE A;  1B63 A;  1UYG A;  2BU5 A;  2XDU A;  2H8M A;  5IDM A;  4P8O A;  2ZDX A;  1YET A;  4HXZ A;  2BSM A;  1AH8 A;  3G75 A;  5CPH A;  4MP7 A;  1B62 A;  4R3M A;  2YEE A;  2C2A A;  1UYL A;  4MBC A;  1UYE A;  2XDK A;  4L91 A;  4ASG A;  4LPB A;  2K5B A;  2C1I A;  4MPC A;  4ZVI A;  4CWT A;  3O2F A;  2XJG A;  1US7 A;  4AWQ A;  3QTF A;  5CTW A;  5M4N A;  4BQJ A;  1EI1 A;  3NMQ A;  4AS9 A;  4EM7 A;  4FPP A;  1QZR A;  1NHJ A;  1UYC A;  5C93 A;  2YE7 A;  1B3Q A;  4YKY A;  2YEG A;  4HZ5 A;  4CE2 A;  4E72 A;  3Q5J A;  2IOQ A;  4XKA A;  2YEI A;  4NH9 A;  4LWF A; 
#chains in the Genus database with same CATH homology
 4AWP A;  3ZKB A;  4HY6 A;  2YK9 A;  3RLQ A;  1NHI A;  1UYF A;  4LWG A;  2E0A A;  4EGH A;  5BOC A;  2IWX A;  2UWD A;  1H7S A;  2YI5 A;  4FCQ A;  3WHA A;  2BU7 A;  1AH6 A;  5J71 A;  3INX A;  4WUC A;  2GQP A;  4MPN A;  3SL2 A;  1OSF A;  3TZ0 A;  5J6A A;  3EHH A;  5M4E A;  3K99 A;  3VHD A;  2O1V A;  5D7D A;  4H7Q A;  4JAS A;  1TH8 A;  4HZ0 A;  4XTJ A;  2XDL A;  4XKO A;  2XHX A;  4L93 A;  4EEH A;  4QPK A;  2WI7 A;  4ZKI A;  4EMV A;  4CWR A;  3IED A;  5F5R A;  3OWD A;  1H7U A;  5M4P A;  3HEK A;  2BZ5 A;  1BKN A;  3CGZ A;  1THN A;  1Z5C A;  1I5D A;  1UY6 A;  4CWP A;  4BAE A;  2XJJ A;  1TID A;  1I5C A;  3LPS A;  2YKB A;  2O1W A;  4KP4 A;  3A0R A;  1QY8 A;  2YE2 A;  2IWS A;  4URO A;  2CH4 A;  2XD6 A;  3TZ2 A;  3WQ9 A;  3TTZ A;  4E02 A;  4B7P A;  2ZKJ A;  2HG1 A;  3OW6 A;  3HYZ A;  4V25 A;  2QG0 A;  4XCJ A;  4WUB A;  4V26 A;  3U2D A;  4O0B A;  4GEE A;  4JAU A;  2FXS A;  4BIU A;  3ZXO A;  1QYE A;  3K98 A;  4EFU A;  3A0W A;  2YI0 A;  4H81 A;  2XCM A;  4HYM A;  4NH7 A;  4HY1 A;  1I59 A;  2H55 A;  1UY7 A;  5D7C A;  4ASB A;  3JZ3 A;  4YKX A;  5CTX A;  1Y8P A;  4I5S A;  1U2O A;  1YT1 A;  3PEH A;  4R3A A;  2CG9 A;  2XDX A;  3EHG A;  2YK2 A;  1YT2 A;  4FMT A;  5FWK A;  1TIL A;  4YKZ A;  3Q5K A;  1ID0 A;  2YGE A;  4EGK A;  2EXL A;  4XD8 A;  3TZ4 A;  2VW5 A;  2VCI A;  2YKI A;  4PRX A;  3VHA A;  3B24 A;  4XIR A;  2BU6 A;  2QFO A;  5FNF A;  4HXW A;  2CCS A;  3C11 A;  2BYI A;  4BXI A;  3FT5 A;  4MB9 A;  3QDD A;  4AWO A;  1UYI A;  5M4H A;  4L94 A;  2CGF A;  4Q20 A;  1GKX A;  1TBW A;  3HZ1 A;  3CGY A;  2BT0 A;  3K97 A;  4O09 A;  3FV5 A;  2YEA A;  1AM1 A;  4U93 A;  3CRK A;  2BU8 A;  3DGE A;  2JJC A;  1Y4U A;  3T10 A;  3TZ5 A;  1AJ6 A;  4CWO A;  1Z5A A;  1EA6 A;  4GGL A;  2YE9 A;  3MNR P;  4MP2 A;  3GIE A;  4XIT A;  3FT8 A;  4CWQ A;  4YKU A;  2WI4 A;  3A0X A;  3U2K A;  1ZWH A;  3B28 A;  2YJX A;  2ZBK B;  3D2R A;  4ASF A;  1YC3 A;  4MOT A;  2XHT A;  4NH8 A;  1Y8N A;  2WEP A;  1YT0 A;  1UYM A;  3K60 A;  5D6Q A;  4PL9 A;  1MU5 A;  5L3J A;  1KIJ A;  4O05 A;  5M4M A;  5M4K A;  4H85 A;  1BYQ A;  2WI6 A;  3R92 A;  3R4P A;  4PRV A;  4WUD A;  3T2S A;  3D0B A;  3INW A;  2QF6 A;  3EKO A;  3R4M A;  2XJX A;  2YI6 A;  3H80 A;  5CF0 A;  4X9L A;  4XIQ A;  3BM9 A;  4KQV A;  3R91 A;  2YE8 A;  4ASA A;  1I5B A;  1YC1 A;  2VCJ A;  2CCT A;  1ZXM A;  1YSZ A;  3LNU A;  2QG2 A;  4DUH A;  1UYK A;  4CE3 A;  1AMW A;  1YC4 A;  4K4O A;  4YKW A;  2YGA A;  3B26 A;  5GGZ A;  1Y4S A;  3B27 A;  1YS3 A;  1NHH A;  3GIG B;  4XCL A;  3O0I A;  2XK2 A;  2BU2 A;  3ZXQ A;  3B25 A;  3HHU A;  1L0O A;  2PNR A;  3R4O A;  4GT8 A;  4CWF A;  2Q2E B;  3VAD A;  4KFG A;  1BXD A;  3PEJ A;  2YEF A;  5BOD A;  4L90 A;  2YED A;  1ZXN A;  2VWC A;  2XX5 A;  5IN9 A;  1TC6 A;  1JM6 A;  2YJW A;  2XX4 A;  1YES A;  2FYP A;  3T0Z A;  4HYP A;  4CE1 A;  4EGI A;  2YE6 A;  5F3K A;  3D36 A;  2YE5 A;  4GQT A;  4KSH A;  4URL A;  5FNC A;  1Y8O A;  1A4H A;  4FCR A;  4CWS A;  3CRL A;  4LWH A;  1S14 A;  4L8Z A;  1UY9 A;  5D7R A;  4KTN A;  2HKJ A;  2YEJ A;  2YKJ A;  4LP0 A;  2IOR A;  5CTY A;  4B6C A;  1MX0 A;  2WI3 A;  4FCP A;  1YSR A;  4GFN A;  3T1K A;  4URN A;  1Z59 A;  5D6P A;  4YKQ A;  1S16 A;  2O1U A;  3BMY A;  4P7A A;  1ZW9 A;  2WEQ A;  4LWI A;  3EKR A;  4XE2 A;  1I58 A;  4I3H A;  3VHC A;  4E01 A;  3GIG A;  3HYY A;  1R62 A;  2IWU A;  4R1F A;  2FWY A;  4O07 A;  2IOP A;  1UY8 A;  2Q8F A;  3R4N A;  4YKR A;  5FND A;  3T0H A;  4XKK A;  4QPJ A;  2BRE A;  2WI1 A;  3G7E A;  4U7N A;  4DZY A;  4MPE A;  3RLP A;  4BIZ A;  1GKZ A;  4U7O A;  1UYH A;  3G7B A;  1UYD A;  5IDJ A;  5CTU A;  2XHR A;  4XDM A;  2Q8H A;  2BTZ A;  2WI2 A;  2YEC A;  4JQL A;  3A0Z A;  2HCH A;  2YE3 A;  2XX2 A;  4W7T A;  3A0Y A;  3RLR A;  2YKC A;  3OMU A;  2YE4 A;  4CWN A;  2ESA A;  4URM A;  3O6O A;  1GJV A;  1U0Z A;  2JKI A;  2WER A;  3RKZ A;  2Q8G A;  4YKT A;  2GFD A;  2BYH A;  1I5A A;  3U67 A;  2BRC A;  4XIP A;  1YER A;  2ZDY A;  3OWB A;  3C0E A;  3OPD A;  3Q5L A;  2FWZ A;  2WI5 A;  3KE6 A;  2XDS A;  3ZKD A;  1BGQ A;  3A0T A;  2Q8I A;  3GIF A;  3EHJ A;  3EHF A;  2YKE A;  3H4L A;  1PVG A;  3ZM7 A;  4O04 A;  4E00 A;  4EFT A;  2YEB A;  2CCU A;  2XAB A;  4GCZ A;  2YGF A;  1Z5B A;  3HZ5 A;  4PU9 A;  4XC0 A;  4KSG A;  1KZN A;  1TC0 A;  4BQG A;  2AKP A;  2YEH A;  3CWV A;  2YI7 A;  3TUH A;  4JAV A;  4LWE A;  1B63 A;  1UYG A;  2BU5 A;  2XDU A;  2H8M A;  5IDM A;  4P8O A;  2ZDX A;  1YET A;  4HXZ A;  2BSM A;  1AH8 A;  3G75 A;  5CPH A;  4MP7 A;  1B62 A;  4R3M A;  2YEE A;  2C2A A;  1UYL A;  4MBC A;  1UYE A;  2XDK A;  4L91 A;  4ASG A;  4LPB A;  2K5B A;  4MPC A;  4ZVI A;  4CWT A;  3O2F A;  2XJG A;  1US7 A;  4AWQ A;  3QTF A;  5CTW A;  5M4N A;  4BQJ A;  1EI1 A;  3NMQ A;  4AS9 A;  4EM7 A;  4FPP A;  1QZR A;  1NHJ A;  1UYC A;  5C93 A;  2YE7 A;  1B3Q A;  4YKY A;  2YEG A;  4HZ5 A;  4CE2 A;  3Q5J A;  2IOQ A;  4XKA A;  2YEI A;  4NH9 A;  4LWF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...