4BXSA

Crystal structure of the prothrombinase complex from the venom of pseudonaja textilis
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
326
structure length
248
Chain Sequence
KSCRVDNGNCWHFCKHVQNDIQCSCAEGYLLGEDGHSCVAGGNFSCGRNIKMDCKLGECPWQAALVDEKEGVFCGGTILSPIYVLTAAHCINETETISGEIDKLSVDKIYVHKKFVPPQKAYKFDLAAYDYDIAIIQMKTPIQFVPACLPTADFANQVLMKQDFGIVSGFKSKTLKVLKVPYVDRHTCMVSSETPITPNMFCADSGGPHTTVYRDTHFITGIVSSGKYGNYTKLSKFIPWIKRIMRQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FACTOR X-LIKE PROTEASE
publication title Crystal Structure of the Prothrombinase Complex from the Venom of Pseudonaja Textilis.
pubmed doi rcsb
source organism Pseudonaja textilis
molecule tags Blood clotting
total genus 37
structure length 248
sequence length 326
ec nomenclature
pdb deposition date 2013-07-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00008 EGF EGF-like domain
A PF00089 Trypsin Trypsin
A PF00594 Gla Vitamin K-dependent carboxylation/gamma-carboxyglutamic (GLA) domain
A PF14670 FXa_inhibition Coagulation Factor Xa inhibitory site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.25.10 Mainly Beta Ribbon Laminin Laminin 4bxsA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4bxsA02
2P3UA 4GSOA 1P3EA 1GCTB 1QNJA 2ZU4A 5A8XA 5JBCE 5DGJA 4JZDH 1CX2A 2OC1A 1MTNB 3JZ2B 3N7OA 2ZGBH 3QWCH 4D9RA 1XMNB 4NFEA 5G4BA 1EASA 1TNGA 3ZYJB 5EODA 1P9SA 4ABBA 3ZZAA 1HRTH 2ZCHP 2TRMA 2A1DB 4AX9H 1APOA 1YUKB 2P94A 1C1MA 4HTCH 3NTGA 7KMEH 1NRPH 3IJEB 1QJ6B 1KLIH 1P9UA 4DVAU 1FJSA 1LTOA 4MNWA 4DURA 7GCHG 2F91A 2AIPA 1HLTH 4RN6A 1KLTA 2IJOB 2Y80A 2W86A 3BEUA 4WF8A 1LHGH 2HGTH 3NUMA 4DIIH 1D3TB 2R0KA 4ABDA 4B2AA 5DP5A 1QRWA 2C8WB 3PMBB 1W7XL 3QUMP 2ZI2H 4ZXYH 1SGFG 3M7QA 2ODQA 4KP0A 1KSNA 2ANMH 1A7SA 1IQGA 1QRZA 2P3UB 1E37B 3SU0A 3KK6A 1NU7B 1OYQA 9LPRA 3N8VA 1HAXB 1GVKB 1GBFA 2BOXA 3Q3XA 1F5LA 1BRBE 1K1PA 1NFWA 2VVCK 2H2ZA 5BRRE 1G1TA 1L5GB 1P09A 1C2HA 3AASA 5JB8S 4A1VA 1HT5A 1O3OA 2VVUA 4NA9L 3UNRA 2FLRL 1TA2A 4ISHH 4A92A 3SNBA 2RA0L 3G01A 1C2EA 2EI7A 3HGNA 2AIQA 3P5BL 2BDYA 3SU4A 2HWLB 3UNSA 8ESTE 2ZNKH 4A7IA 2D1JA 1Q4GA 3KL6B 2Z9IA 1GI7B 4IMZA 3STJA 1HX2A 4GLYA 4E7RG 1SVPA 5EPNA 5EQSA 1UTKA 2C90B 4K1EA 4XDEA 1HFDA 3ZZBA 1EQGA 1P2QA 1BJUA 5TCAA 4X8TL 1YKTA 1VCQA 3ZYEA 3RXPA 3K9XB 1KSNB 3V13A 3E0PB 2Y81B 2ZG0H 1YCPM 2QF3A 3R05A 5EOKA 3MNXA 4NIYA 1RTKA 3TBDA 3UPEA 3TH3L 4OTJA 3Q00A 2Q6GA 2WPIE 2FXRA 3TJVA 1GJ8B 1F0RB 1HXFH 5LH8A 5F8TA 3LGTA 3HK6B 1TPAE 2TBSA 1AN1E 2ZFRH 3MTYA 4MDSA 1TOMH 4XLWA 3E3TA 1O2YA 2BQ6B 2GD4B 1TONA 1OYTH 3PYHA 4OS4A 2O8WA 4TWWA 1O3GA 1LMJA 5F8XA 1DPOA 1WHFA 1MOXC 3U73A 2ODPA 1DVAL 2Y5FL 3SU2A 3SJ8A 4A7IB 3VXEH 1IHTH 3O8DA 1UZQA 1P05A 1XM1A 2VWLA 3GICB 2FEQH 4HI3A 3VB5A 1PYTC 2BOHA 4AFQA 1ELEE 3SW2A 4B73A 4BTUA 1VR1H 1TQ0B 1GI0A 1V2OT 1PRHA 3M5LA 2TGTA 4BTTA 1AFQC 1LHFH 2VJ1A 2BD3A 1EKBB 3ZZ5A 5CMXH 2UWPA 4BDWA 1YUFA 2BQWA 1O2RA 2XC5A 2Z94A 2AERH 2D26C 3BG8A 1QTFA 3IITA 1CVWH 1C1NA 1LVBA 3NK8A 3SJIA 7LPRA 1YO8A 1LMWB 1LVOA 2AEIH 3RXIA 3Q7DA 1QHRB 1P0SL 5JVYA 2A2QH 1ELFA 3CENL 5DK1A 1IGXA 2C4FH 1MQ6A 1XKAL 1MTVA 1DDXA 1XKAC 2RG3A 3P6ZB 2XNIA 4TY7A 4X6MA 1IOXA 1AY6H 1G1QA 1CBWB 3KQBA 1F5RA 4CHAC 5L30L 1DY8A 3RXCA 1SB1H 2YOLA 3D23A 4IGDA 1DIYA 1QQ4A 1HJ9A 3N8YA 2ZO3H 2ZDVH 4AZ2B 3EA9A 4MNXA 5DJ7A 3SW2B 1URKA 1L1JA 2PSYA 2XRCA 4TWYA 1TBRH 2Y5GA 1PXXA 1K1IA 1ELVA 1ELTA 1SGIB 2PUQH 1YP9A 3SUEA 1O5GH 1Z8IB 1SLVB 1AB9C 4ISOA 5ETXA 1Z8JB 1GCTC 2IPHA 4K3JA 1OWIA 4MVNA 4AG1A 4SGAE 5F6MA 1V3XA 3MOCA 1NRQH 3LJJA 1MTNC 3V65B 1WUNH 5LPFA 1EJNA 3BTFE 1GG6C 2PW8H 1EP6A 2GKVE 3TGFA 2NU1E 5K0HA 1L4ZA 1YLDA 3PB1E 2ODYB 1NU9A 3FP8E 2ZFTA 1D6RA 4Y7AA 1MCVA 4ZAEA 3S7HB 2Z9KA 4YT7H 1JOUB 2P16L 1GI6A 1C5YB 2RA3A 5E0HA 2ZGCA 3VGCB 3N8YB 1O3CA 1PPHE 4I8KA 3OYPA 3PO1B 3PTNA 2EI6B 3SI3H 1PQ8A 1W0ZU 3M5OA 6GCHF 4SGBE 3QDZB 1GVZA 2G81E 2FYQA 3QH0A 4X2VA 3KHVA 3SV6A 4CR5A 1FAKL 5FCKA 1IGZA 3NT1A 1SFQB 4FM5A 3SOQA 1TGTA 1QFKH 1ZR0A 3KQDA 1DX5I 1EPJA 3RXSA 1BF9A 1BTPA 2WPKE 4RRZA 1E36B 5L2YH 3CS7A 1ZSLA 3BG4B 2C8YB 4RKOB 3PMAB 1W12U 2J94B 2QY0B 1VITG 1GHAG 1NPMA 1C1VH 4RKJB 2TGFA 2GZ9A 1F0UA 3BTQE 1C4V2 1O3LA 3BTTE 1KXFA 3TH4H 1Z1JA 3EGFA 3CS0A 3FZDA 4Y7AB 1HNEE 2QAAA 3RXHA 4UFFH 5B6OA 3A7ZA 5F19A 4JCNA 5KIRA 2SNWA 2O9QA 4O3UA 1F2SE 2ALVA 4D9QA 4A5TS 1JBUH 1CHGA 3AAUA 2HLCA 1AUJA 1UVTH 2BZ6H 1GI9B 4FU9A 1IQEA 3MO3A 3SUFA 2TGPZ 4KKDA 2Y7XB 3L33A 3ZVEA 4NCYA 3TK5A 3ZZ8A 4YZUB 1GI4A 3SU3A 3LC5B 5LPEA 4WMEA 5PTPA 2BY7X 3N8XA 3OLTA 2P3TA 2P8OB 1Y59T 1CT0E 1BTYA 2FOBA 5EXNA 3FCSB 4IS5A 1OP8A 1F7ZA 1TX6A 1IQIA 2BDHA 3I78A 1ZHRA 4BNRA 3TJOA 3MH5A 1CCVA 2UUKB 3D62A 2XBVA 1ETSH 1UCYH 3S9BA 2XC0L 2BB4A 5AFYH 3LN0A 1THPB 1MZDA 3V12A 3E6PH 4UONA 1Q31A 2J4IA 2Z3CA 1FAXA 1AGJA 1MKXH 4AG2A 3KRKA 2SGFE 1AQ7A 3TLOA 1IQLA 1SLXB 3GCNA 1O2SA 4FUCA 1C5UA 2BOKL 3UREA 1C5XB 3UQOA 1CSOE 1DM4B 2KAIB 3F6UL 1QIXB 1GGDC 1HRFA 1NY22 1KLJL 1QQUA 5HGGA 2BLQA 1IQNA 1EX3A 5JBBS 3TGKE 5EW1H 2W26A 2QXJA 3E90B 3I77A 4AB8A 1SHHB 2R9PA 3A87A 4NA9H 1IQHL 1C4Y2 2FLRH 3RM2H 4D7GA 5GIBA 4X2YA 4X1SU 5C67A 4KGAA 4AYVB 4MPUA 1YCPH 2GZ7A 2CXVA 2GP9B 5GCHG 2ZGJA 1VJ9U 3KF2A 3L3TA 4FUIA 3GDSA 3LDXH 2AMQA 1WBGB 2PGBB 2J4IB 2ZU5A 3URCA 1LPKA 1ESAA 1GWAA 3POYA 2GX4A 1PYTD 1YPHC 1OXGA 3BF6H 4WMFA 4FUJA 1Z71A 2QN5T 1V2KT 4ZHMU 3U9AH 1V2UT 2H5DA 1NRSH 1H4WA 3MU1A 1BBRK 3TH3H 4NIWA 4ISIL 1IQKA 1EOLA 4INHA 1JL9A 5E0JA 5L6NH 1BHXB 5EQRA 3D65E 3RXKA 1F5KU 1BHXF 1SGQE 1GJ6A 4U32A 1GMDF 3ATKA 1Z7KA 3ZYGA 3HPTA 1NM6A 4OGXA 1Y3YA 4U30A 1JIRA 3W94A 3DD2H 2NU4E 3PROA 3VB4A 1N1LA 1O5EH 2GCTB 2CJIA 1DVAH 1C4U2 3SGAE 4BAKB 5IDKA 1BTUA 3BN9A 1LPGA 2WYGB 1K1LA 4X6PA 1P2OA 4X8SH 2BY6X 3LGVA 1F0SB 2BO2A 4ZH8B 2VVVL 1UCYE 1XVMA 2A4GA 3GCTG 1HV7A 3TK6A 1WHEA 3A8CA 2WFTA 2V6NA 5AHGH 1AI8H 1A3BH 2EI8B 1GJCB 2ZIQH 1TOCB 2YNBA 5JVZA 3I29A 5F8ZA 3A84A 1A0LA 3MYWA 1Q3XA 3ATMA 5L2ZL 4ABHA 5T6GA 3SHCH 4BAOB 1EPHA 2A4RA 1G3DA 1V2LT 1B9WA 4B71A 3LH3A 1MTSA 2BYAX 1Y5BT 3EYDA 1P0SH 4HZHA 4Y7BA 3AAVA 1SGEE 4ZKOU 8GCHG 1G1RA 2FP7B 4ABEA 3NKKA 1GJ7B 3RXTA 2QF0A 3SZNA 1UTLM 2RCEA 2ZFPH 5EU8A 1MKWK 4OS6A 1IAUA 2HVXA 3A86A 2Y7ZA 4DT7B 1EOJA 1DITH 4K8BA 3S0NA 2FX6A 3ESTA 1ZMJA 2W3KA 2XC4L 4O03A 1IQML 1S85A 2BZAA 6CHAB 2WV4A 2G00A 3TK6B 3MO6A 1RJXB 2OBQA 3RU4T 1QCPA 1A46H 3T62A 2IOTA 1G2MA 5DP4A 2QIQA 1HZ8A 1V2RT 1GJ5H 1H9HE 2C8XB 2HALA 3M37A 3ZZ3A 3GOVB 4OS2A 3P8NA 1GJDB 2BM2A 1FIWA 3ZV9A 2BDAA 2WV5A 3F9FA 5JBAE 2BY5X 2FI5E 1H9LB 1P10A 1T8NA 2Z9GA 4NSYA 3RLWH 3ODFA 1G3EA 1EPGA 1AD8H 4Y7BB 1O3FA 2ZKSA 2P8OC 4YLQH 1V2VT 2HNTC 1J14A 1N6XA 4UFEH 1XVOA 5GXPA 3SN8A 1OB1C 2R3UA 1VGCB 2PHBA 1ACBE 1LPZA 3TNTA 4X6OA 4ABFA 2XWBI 3DFLA 1B7XB 3SU1A 4A6LA 2FWWA 4R0IA 4WH6A 2DDUA 1HAZB 1T8MA 5CKMA 3ZVAA 2Y38A 1LHDH 1C5VA 1C2GA 3M35A 4XE4A 1G9IE 4RRYA 1RTFB 5HYOA 5E0GA 4FXGH 3RXOA 4NGAL 3MI4A 1FAKH 1GVLA 1GL0E 5FX5A 1TB6H 1V2ST 1MBMA 3U69H 1YM0A 5SGAE 2XBYA 1BIOA 3KN2A 2XBWA 1TLEA 3V64C 1TGSZ 1W10U 4I33A 2GCHG 1ZPBA 2CV3A 1EUFA 4AFZA 1EZUC 4CHAB 4FUEA 3M5MA 4UDWH 5I25A 2PHBB 3LC3A 2ZGHA 1OX1A 3Q3KA 4NZQA 2OQ5A 2VINA 2STAE 1O2IA 2VWOL 5T6FA 2WPLE 1IOEA 1H8IH 1P57B 2OLGA 2W2ME 2C8ZB 3GCOA 3MU5A 4I8LA 1NFUB 2F3CE 2FODA 3EE0B 1MCTA 2PUXB 2ILNA 4D0EA 1DWEH 3KQCL 3ATWA 2Q6DA 2ZA5A 4X8UH 4IMQA 3M36L 4X1NU 3E16B 1O2HA 1GG6B 2Y5HA 2V35A 5ABWA 1FSBA 1UK2A 1N6YA 4CH2B 5A8YA 1GBIA 3P8GA 3A8BA 1O5FH 4X2WA 3ZZ7A 2BQ7B 2H1UA 3GDUA 3IWMA 4LZ1H 5JYIA 1SGFA 3RXBA 3LC3B 3MO9A 1MAYA 3Q3KB 1RIWB 3KL6A 1S6HA 2GCTC 2KV4A 3HATH 3PWBA 4AN7A 1DXWA 1P2IA 3AW0A 3MH7A 1C5RA 5J4QA 3UQVA 1YC0A 2ZDAH 3RXAA 4UEHH 2BD2A 1DWCH 1EZSC 2Z3EA 5K7RA 2XCNA 1Z1IA 2CGAA 1AVWA 3K9XA 1ORFA 2B7DL 4X1QU 1ELCA 2Y81A 4FVDA 1J16A 1S6FA 1O3IA 1OWHA 4D76A 3F6UH 1PFXL 1ZMNA 1PFXC 4IC5A 1PTHA 1KLJH 1ZSJA 1F0RA 4INLA 1S0RA 7GCHF 3VB7A 1P12E 4NG9H 1PPZA 5E8EH 3U1IB 2BQ6A 2GD4A 1AWHB 1GI5A 5GWZA 1WSSH 1X7AL 1O35A 1TMBH 1G1SA 1X7AC 1NTPA 3RC4A 3ZZ4A 3M3VA 5BPEA 3RP2A 2GZ8A 5FDQA 1C1TA 3ITIA 4TPIZ 2WPHS 1J8AA 2A0QB 3NXPA 1APQA 1EMOA 3SOSA 3M7TA 1SMFE 3Q77A 1O5BB 2BD8A 1C5TA 1QB6A 1E38B 3SU5A 1O2NA 4FUHA 4J2YB 6CHAC 2FLBH 2BOKA 3U8RH 1W14U 3CP7A 2W2OE 5JDUB 1TPGA 1MH0A 4Q7YA 3SNDA 2G51A 4UE7H 1CHOG 1ADXA 1KIGL 3GCXE 1KXCA 2OP9A 3C1KA 3ZVBA 4JK6A 1G32B 1HGTH 1Y3VA 1G37A 2J95A 1V2TT 3DA9B 2CF9H 4D8NA 1FF7A 2HRVA 1CQEA 3SO3A 4BANB 1M1XB 1E35B 2AFQB 1O2MA 2H6MA 3RXRA 3UOPA 1VGCC 3RXEA 4JZFL 3M7UA 1IP0A 3F9HA 4Y6DB 2B0FA 3HKJB 1RRKA 2FOGA 2W3IB 1ESTA 1T8OA 2BD4A 4K8YA 1NQLB 1P9JA 1BZXE 3A81A 2ZTZA 2F9NA 2GMTB 4DY7B 1PJPA 1GK5A 3B23B 1EB1H 1EATA 1GGDB 2Y82B 2BXUH 3M3SA 4MTBA 3SUGA 3S9CA 5L2ZH 4CRFA 4K5ZA 1GCDA 5A0AE 2ESTE 3SORA 1SR5C 1SHYA 1ATBA 2SGAA 3ZVDA 1O5DL 3DEMA 1C5ZB 3FP7E 1AKSB 1UTOA 1QL8A 2FOHA 2J95B 5LGOA 5KN5C 1C5NH 1SGRE 4K1SA 1MTUA 3LGIA 1EPTB 1EQ9A 4XBDA 1RGQA 4Y76B 5EW2H 4B76A 2FS9A 2ZU2A 2ZFSA 4B2BA 4Y8XA 4NZLA 3U8OH 2VVVA 4G1MB 4H6TA 3U8TH 3TZIA 3SBKA 3MU4A 2FZZL 2A4QA 2C93B 4PH9A 2EI6A 1K2I1 2ZC9H 4X0WU 3V0XA 3KQEA 1O3MA 1CQQA 1GBTA 3UTUH 5FPSA 1YPHE 1SLWB 1CT2E 1L1GA 3E8LA 4ISNA 1VITH 2WUBA 4OS1A 4AYYB 3FBYA 1GL1A 1HAHH 3HS5A 5GPIB 2WG3C 2FLGA 1J9CL 3RXMA 5CE1A 1A2CH 3T2NA 3IG6B 1D3PB 2GDDA 3ASIA 6LPRA 3HS6A 1MBQA 2J94A 4UFDH 4AB9A 1SL3A 3U7UG 1A4WH 1LQDB 1WAYB 3TPIZ 1P3CA 5JBCS 1ANBA 3STIA 1QY6A 1TIOA 3L6PA 3SJOA 1S84A 3TJUA 3MU8A 1O33A 4LXBH 2VIDA 2XBXL 2XC4A 1O3AA 1NZIA 1G3CA 5JB9E 1GBCA 1KTTB 1IQMA 2SGPE 1RIWC 2KL7A 1KYNA 1GBBA 1FLEE 1KTSB 3KCGL 1SZBA 1O2QA 2B9LA 1U67A 1LO6A 1LKBA 1ZTLA 3KEEA 4BXWA 1UTMA 3MFJA 1GHWH 1PQ7A 4MG3A 5C1UA 1SOTA 2FOEA 3RXVA 4NGAH 1BTXA 2Y7XA 2P95A 4Y79B 1BCUH 4OTYA 1E34B 1GI1A 4YZUA 1EZQA 1XXFA 4O1ZA 1ZLRA 3LC5A 5H4IB 2H9TH 3BTHE 1T7CA 2IN2A 1CGJE 1Z6EL 2Z9LA 5CKQA 1BMNH 2P3FH 4Q7ZA 4X1PU 1WU1B 4GVUA 1O32A 4LZ4B 2J2UA 3T28A 1PPCE 4ZMAH 5FHTA 1YLCA 4C16A 2OQUA 1MD8A 1QL9A 1YYY1 1C2KA 1UVOA 1C1PA 1L2EA 2MGPA 3SOVA 2HPQH 1SBWA 1C1RA 3EA8A 4HFPB 1W8BL 1B5GH 3LGUA 4CSYA 1AUTL 1FE2A 2RNLA 1AUTC 2ZHDA 1XXDA 1UCYK 1F7MA 2ANWA 4VGCB 2OBOA 1DWDH 4IN1A 1ZMLA 5DPAA 3SNAA 3U98H 1T4UH 4GCHG 1ZHPA 2O8LA 1MKXK 1IQJA 1TYNA 2JKHL 1W3CA 2KAIA 2VWNA 1VITF 1GHAF 3E1XB 3BTWE 1C2DA 1IQFA 5LPRA 1GDQA 2P26A 1AO5A 3R3GB 1EZQB 1TLDA 1GDUA 2A7CA 1GBLA 2AS9A 1C1QA 1K37A 5J4SA 3GYMA 3RC5A 1ELBA 1FQ3A 1NFYB 1L3YA 3UR6A 1V2NT 1YPJH 1KY9A 2HNTF 5EXMA 3DT0H 1Z6JH 4ABAA 2J2UB 1XUHA 1LVYA 2HNTE 2VWOA 1O38A 2WPIS 3MHWU 4WMDA 3MNSA 1A0HB 4YOGA 4JZDL 2J34B 1TWXB 1YCPK 2P93A 1AE5A 1DX5M 4FUBA 2EA3A 1HJAC 1ZYOA 1W7XH 3P95A 1BOQA 1FNIA 1C1WH 3PTBA 2VVUL 5IKTA 1KXEA 5CHAC 1MD7A 1NRRH 1NS3A 2B7DH 1HAFA 1GHVH 4JZEL 1BQYA 1JRSA 2AMPA 3OX7U 1SLUB 3QK1A 4WWYA 2GMTC 3N8WB 4ZHAA 3A85A 1FDPA 4YO9A 4NA7A 1NT1A 4AQTA 1AE8H 3PV4A 3BSQA 4MPVA 4ZXYL 5EPYA 2A4OA 4M7GA 4ZKSU 4HGCA 2HPPH 1GI8B 4JYVL 1FIZA 1W13U 4XSKU 1MAXA 4X8VL 1DS2E 2BVXH 1W11U 4D7FA 1SQOA 2GT7A 1EPTC 2WPJE 1C2MA 1K22H 2WYGA 2B8OH 2KB9A 4Y11E 5T3HA 3TIUA 2UWOA 3ZYIB 2WPME 1F0SA 3AVZA 3ZVCA 2A7JA 4ZH8A 9ESTA 1V2MT 4IW4E 5I46L 1GHBG 2OC8A 1GMHG 2EI8A 1AZ8A 2XTTB 4X8TH 2ZTXA 4A1TA 5FPTA 3U1JB 5FPYA 2FTMA 2BXTH 1L1NA 2BVRH 1EJAA 1IVOC 4ZHAB 2TIOA 2EC9H 1EP5A 2GV7A 4BDXA 4YOJA 1KIGH 1P06A 3TITA 5GCHF 1BDAA 3LIWB 1HDTH 1F92A 2GT8A 1UO6A 2RA0A 1GMCG 1SQAA 2Z3DA 1H8DH 1SPJA 1PPFE 2ZQ2A 3A8DA 1GI3A 4I8GA 5E2PA 1QA0A 4FU8A 3RXLA 5JPMH 1O3PB 4B75A 3FAOA 2PGQB 1DE7H 3PLBA 1TBQH 1D4PB 2THFB 1P02A 1XUJA 4JZFH 2UWOB 3RUOA 3O8BA 3LKWA 4Y0ZE 1HBTH 4WXVA 3QGJA 2VWMA 1BTHH 1ZGIA 2VH6A 2F9BL 3LAQA 2ZPSA 1TABE 3UR9A 3SOBB 4CUFA 1FY5A 1TNLA 3RDZA 3ENSA 4CRGA 4MMYB 3F1SB 1N8OC 2WYJB 1OWJA 2F9OA 2ZHEH 1TRYA 1QA7A 1NZQH 3PWCA 3A7WA 1MUEB 1MQ6L 1EMNA 1VZQH 1P11E 1P2JA 2PTNA 3KQBL 2XWAA 1AWFH 1TBZH 1UZPA 1WCZA 1C1UH 3MH6A 4XFQA 4FUDA 2FS8A 1JIMA 1BB0B 3SHAH 2XYAA 1A5HA 5A0BA 3SGQE 1O5DH 4JK5A 5JB8E 4JZIA 2BTCE 1WYKA 3LGWA 1VJAU 2WG4B 3GCTF 2Y5FA 3OY5U 2CN0H 5CISA 1FN8A 3ODDA 4ZXXL 4BAHB 1A5IA 1DSUA 1LQEA 2G5VA 1QL7A 2WPKS 5L30H 4NWLA 1HREA 4O3TA 4GHQA 2ZECA 4B74A 1HCGB 2OUAA 2BVSH 2ADXA 5HMAA 2VH6B 1FPCH 3V3MA 1RD3B 1S0QA 1BITA 1AVXA 4VGCC 1CU1A 1CGHA 1DY9A 3ENSB 2Z6BD 1MQ5L 3OU0A 1SGPE 2BMGA 1BA8B 4CBOA 4Y8YA 3GY6A 3RMOH 2A2XH 2ULLA 1C5PA 1CA0C 4IBLH 2SGQE 1GJ4H 4BAMB 3OY6U 1ETTH 2BOUA 1U8CB 2ALPA 2WINI 1HAIH 3CENA 1BRAA 1SOZA 1KXDA 3LJOA 1GBJA 2TGAA 1TMUH 3NJPC 3RXGA 1DXPA 2W2NE 4ASHA 2ZP0H 4M10A 1SGYE 1GBKA 4I31A 4LORA 1A3PA 1C1OA 3KQDL 1IJQA 1EPIA 2FZZA 3BT2A 1U6QA 2EEKA 1O37A 3RMLH 4WJG2 3KCGH 1ID5H 4Q80A 2BDCA 6COXA 2YNAA 2K2TA 4BOHA 2PLXA 4DIHH 1BMLA 1T32A 1NFUA 3RXDA 1G3BA 4Y71A 4E06H 3URDA 1JV2B 1NRNH 3LH1A 4ISLA 2BMGB 2K2SB 1JWTA 4CRDA 2R2MB 3GCHB 1O0DH 4E1GA 1EGFA 4DJZB 2Q1JB 3E91A 1CE5A 1TGCA 1B0EA 1DLKB 2OYEP 3B8JA 4CUEA 2PKSC 2TGDA 3SQHE 1ELAA 3E0NB 2BQ7A 2NU3E 1XX9A 2QV1A 2ZDMA 3AW1A 3M61U 4THNH 1IQEL 1XKBC 2RDLA 1TAWA 1KDQB 4OGYA 1NO9H 2P16A 2V3HH 1DICA 5L2YL 1W8BH 5DG6A 5IKRA 1H1BA 1D3QB 1ANEA 1O5AB 3HO4A 2AH4X 2A5IA 1AMHA 3RR3A 1HAVB 3S9AA 3BIVH 1O2PA 2G8TA 3FFGL 4IN2A 4GUXA 3BTEE 4XBCA 3EAJA 4Y71B 1UJ1A 4F4OC 1XUFA 1UK3A 2SGDE 4M11A 4I32A 1THRH 2GCHF 4AGKA 4ZKNU 3TVJB 2VGCB 2WPMS 3PGHA 4ABGA 1DFPA 1V2WT 1MU8B 1XUGA 5EGMA 1ETRH 4OS7A 3UOUA 1ZJKA 2P59A 2F9PA 2GGVB 1INCA 1C9PA 2ZTYA 4E05H 1FI8A 1FAXL 1HXEH 2Y6TA 1TNKA 1QBOA 1BT7A 1IQLL 1NN6A 3BEIB 2FOMB 1S83A 5FBIA 3H5CB 1KXBA 1ARBA 1HJ8A 2FO9A 3PLKA 1J15A 4AFUA 3MMGA 3UIRA 2J9NA 2I6QA 5A0CA 3H7OA 3C9AC 3GYLB 5C3NA 1IQNL 1UVUH 5IKQA 1C5MD 2CHAB 3BTDE 1HAEA 1TE0A 1E0FD 1K9OE 1ZRBA 2FDAA 2JKHA 2PV9B 4XOJA 1UVPA 2WFXB 4JZEH 3QMOA 2ASUB 2ZU3A 5TCCA 1YPMH 4JMYA 2J92A 1NROH 3D49H 2LPRA 1O3EA 3RMNH 1P01A 3SV8A 3UUZA 5EGMB 4RS0A 2I6SA 1G2LB 3OTJE 1CCFA 1MMJN 1LHEH 2ZGXH 3RXFA 2STBE 2P28B 3NTBA 3HO3A 1P2KA 2A5AA 2ZEBA 1T4VH 3GISB 1NPEB 2BX3A 1K1OA 2UUJB 1DOJA 5AVDA 4JYVH 2FESH 3ZVGA 2VH0B 4X8VH 2ZHWH 1T31A 1EAIC 3T29A 1XDTR 1CVUA 2FD6A 3GY5A 2XC0A 1KXAA 2ANYA 5GJ4B 2SFAA 4AFSA 3RXUA 3BTKE 3NWUA 2A32A 8LPRA 4Y6DA 1IQKL 2SGEE 2ZDKA 4KELA 4ZUHA 2F83A 3T27A 1C2JA 1Y3XA 3ZZ6A 3GY3A 3LTGD 1QB1A 2W3IA 5I46H 2H5CA 5ESTE 1OOKB 1OWEA 1P2MA 2V0BA 1SGDE 2VJ3A 1LHCH 2J38A 2R2WU 1WV7H 1S82A 4YESB 2V3OH 1DWBH 2Y82A 5FCRA 1QRXA 3NCLA 4KTSA 2Y80B 4MPXA 4ISIH 4WY3A 4LMFA 1LVMA 1P2NA 3QX5H 2AMDA 5HM9A 3K65B 2ZQ1A 4BXSA 4ESTE 1IQHA 3QZRA 3P8FA 2ZU1A 1YBWA 2ZFFH 1AKSA 5E8DA 1O36A 1QB9A 1UTQA 4YOIA 3CA7A 4H6SB 1EPTA 1FMGA 1LDTT 1AZZA 2VU8E 3BEFB 4Y76A 5EQQA 1S5SA 3GY2A 1W2KH 3TK9A 1ELGA 4Y8ZA 3MQEA 4X1RU 3K6ZA 2BDBA 4ABJA 2AYLA 1C2IA 5HM2A 2HOBA 5JBAS 1ZAQA 1K36A 1HJAB 1NFWB 1AVGH 1O2WA 1QJ1B 3EDXB 1HAOH 1K28D 1M9UA 1ABIH 3HGPA 1O3DA 1OP2A 2ZWLH 1ANDA 2F9BH 3LGYA 4NIXA 5CHAB 3MU0A 2O8UA 2DE9A 1D6WA 1CEJA 1O2VA 3M5NA 1CHOF 4X2XA 2EI7B 2I9BA 2J38B 2W7SA 2I9AA 3QO6A 4B1TA 1XUIA 1GBHA 3BPSE 1OWDA 3UY9A 1NC6A 2D1JB 1V6DA 4YT6L 1OPHB 1EJMA 2PFEA 2FTLE 3R0FA 2A5KA 4X8SL 3BIUH 5IKVA 1G30B 3DUXH 3GCHC 1C9TA 1D9IA 4MPWA 5JBBE 2QXIA 2QYIA 3N8ZA 3A7VA 4DCDA 4Y0YE 3SJKA 2JH6D 1OSSA 2VIQA 1QBVH 2G00L 3RXQA 5FXLA 1LQDA 2VVCA 1ZOMA 2ZHFH 5FAHA 1PGEA 2DE8A 1O2UA 1ANCA 5CKNA 4ZXXH 2F9VA 3M37L 1C5MF 1H9IE 5C5NA 4AOQA 4TPYA 1EZXC 2FX4A 1YF4A 1OS8A 5ESBA 2YGPA 4CRCA 1EAWA 1V2JT 4R8TB 1HB0B 1XUKA 2FOAA 5EG4A 4CRAA 4O9VA 2G4TA 3QCWA 1NT0A 1SGTA 2ZDNA 1XFEA 2R0LA 4Y79A 1O39A 2NWNA 2OC7A 3UFAA 2WPLS 2CMYA 1TGNA 4ZHLU 2FMJA 1ZSKA 1K1NA 1EQHA 1Y5AT 2BOHB 2VGCC 2VIWA 4AORA 1DDJA 4BTUB 1ELDE 1WU1A 2OCVB 3F9GA 1YGCL 4BTTB 1G36A 1CGIE 4Z0KA 1RXPA 2UWPB 2VNTA 2BQWB 3RU4D 1Z8RA 3P17H 2DUCA 4H42U 3Q76A 3TJNA 3IITB 3KGPA 3A82A 3SI4H 4WVPE 1ZPZA 1EAXA 3PM3A 3K6YA 2BHGA 2PSXA 3KIDU 6GCHG 2PWXA 1GDNA 4RRXA 4Z6AL 4I7YH 1HT8A 2XBYL 3MNBA 1D3DB 3F9EA 3HKIB 5F03A 2GVFA 2XBWL 2BY8X 2FI3E 3GY4A 1N8OB 5A09A 2XXLA 1MQ5A 2W2QE 1RS0A 2CHAC 1JXPA 3Q3YA 4I8JA 3QZQA 5AF9H 4K2YA 1O31A 2UUYA 4E7NA 1C2FA 1A61H 1HAGE 4DW2U 4ZKRU 5JBTA 4I8HA 1BMAA 4UFGH 1IOEL 3BV9B 2BX4A 1NFYA 4CRBA 1TRMA 3P70B 1ZRKA 3RM0H 2ZF0H 3S69A 4XBBA 2YGOA 3HK3B 2NPRA 4Z0KB 1FN6A 1HAYB 1A5GH 2JH5D 4H4FA 3F68H 2MHPA 1O2JA 1SI5H 3K2UA 4JYUL 1FY1A 1TNHA 3BT1A 1DLEA 2J34A 4YTAA 3ZZDA 1QGFA 4CUDA 2FOCA 4AGJA 1V3XB 3ELAL 2R3YA 5DO4H 1WOFA 3UWJH 1BJVA 1SQTA 1ARCA 4JYTA 2Y5HL 3FP6E 3SNEA 1UTNA 2W5EA 5FX6A 5C1XA 5K0HB 4QT8C 2SNVA 1A0JA 1C5WB 3ZYDA 4O02B 2P94L 4LOYH 1CA0B 4Q7XA 1FPHH 1W0YH 4DG4A 3B9FH 4CR9A 1Z6CA 4ZAEB 3N8WA 1CA8B 1FJSL 2H9EL 1TALA 3QTOH 2BD9A 3GISX 4TYDA 1N7DA 3DFJA 3EGKH 2UUFB 5A8ZA 1TX7A 5T6DA 1O2TA 3A7TA 1ZPCA 3SNCA 1HPGA 1V2QT 3QN7A 4NFFA 1ZHMA 4K60A 1XKBA 1K1MA 3A8AA 2PTCE 3SU6A 1MTWA 1O2KA 1FFMA 1I0UA 1YPLH 1TX8A 1IQGL 2FM2A 4GCHF 1COUA 3SUDA 5HXFA 1TA6A 4X8UL 1K21H 2AGGX 4WXIA 1C5OH 1C5LH 1UVSH 1ATEA 1CO7E 1OKXA 1DUEA 3FFGA 2G4UA 4F49A 1TMTH 3VB3A 1O3BA 1QBNA 1NFXA 1HJ7A 1NESE 5AFZH 1TQ7B 3ATIA 3SV7A 3SGBE 2VWMK 3KQCA 3VFEA 4TY6A 2A45B 1KLIL 3FZZA 1RFNA 1WQVH 2GV6A 5DP3A 3M36A 1ABJH 2ZHQH 3VEQB 1ZTJA 1SG8B 2ANKH 2BD7A 3PMJA 2G5NA 3RMMH 1PPEE 3NZIA 1VCWA 1ZGVA 3T26A 1SGCA 2PKSB 4BTIA 1YPKH 3LIWA 5JW1A 3KNXA 4NIVA 1UTPA 2BD5A 3S7KB 2BY9X 1Z8GA 2XCFA 4U01A 2GTBA 2PKAA 5A2MH 3FANA 3RU4E 2A7HA 3MH4A 1GPZA 4RSPA 1ATDA 2RHPA 1UZKA 3TK5B 2FI4E 4RRWA 3PMHB 4MMXB 1WQSA 2K1QA 3UWIA 1Y3UA 1DANH 1RTLA 4ZROA 1PPBH 5DP9A 3SV2H 1Y8TA 4D0FA 4Q2KA 2P3TB 4NG9L 1IHSH 2O8MA 1DSTA 1C5SA 3A88A 3A89A 2JETB 5DP8A 1Q2WA 4ISHL 1NFXB 1UTJA 1FV9A 1GHXH 3A7XA 2BDGA 1THSH 2OINA 1EXFA 2WYJA 2CF8H 1RFNB 1TOZA 1GJAB 3SV9A 4YLUA 3HO5A 4Z0LA 1GI2A 1CBWC 1GMDG 3W95A 2VWLL 3P92A 2MGRA 1C2LA 1ZTKA 1AIXH 1FXYA 2M74A 1VCPA 2M5TA 4FUFA 2D2DA 2JH0D 4Y10E 4BTIB 4ABIA 1LKAA 3DHKH 2FLBL 5FBEA 1TRNA 5F1AA 1EAIA 1GBAA 5DKMA 7ESTE 2BDIA 2BLVA 4D90A 2PKAB 1FONA 1WTGH 2QXHA 1BTZA 3QLPH 2FOFA 1GHBF 1GMHF 1A3EH 2XC5L 3LN1A 4X6NA 1UHBA 2O8TA 3ZZ9A 2Z9JA 3RLYH 3UNQA 3TGJE 3A80A 4KTUA 4DOQA 1F0TA 5TJXA 2W2PE 1HCGA 5GDSH 2W26B 1PQAA 1BTWA 1O2ZA 3SQEE 1S81A 3OLUA 2QA9E 1P04A 2OD3B 1HYLA 4IC6A 1YPGH 4MNYA 4K1TA 1PPGE 3C27B 3O8CA 3CFWA 3LPRA 4XL1A 1GMCF 1SGNE 3MNCA 4MMZB 5JB9S 2LNCA 2OXSA 4YT6H 1GHYH 1L4DA 2ZPRA 2VIOA 1TNJA 1DT2A 1GHZA 1K1JA 1TPSA 3TU7H 8KME2 2NU2E 1HUTH 3A83A 1LPKB 1Y5UT 4PROA 1O3HA 2ZCKP 3VGCC 1JRTA 1O2OA 1CT4E 1HAPH 3PO1C 3ZV8A 1O3JA 4GAWA 1C1SA 1BBRH 2ZDLA 1A1RA 2ZFQH 2Y5GL 1Y3WA 4CH8B 3KQEL 4KTCA 3LU9B 1YPEH 2BLWA 3GCWE 1CVWL 2FIRH 1UHBB 2WPHE 1F7EA 1UK4A 1C5QA 2AGEX 3JZ1B 1BRUP 2D8WA 3GY7A 4FUGA 2H9HA 4INKA 3ZVFA 3BG4C 1BMMH 3LONA 3HPTB 3LOXA 1O5CB 2CJIB 3OSYA 1UZJA 1DUAA 3WY8A 4NWKA 1LPGB 3BTME 8GCHF 1EB2A 1QJ7B 4WH8A 4FU7A 1BUIA 2GDEH 3MWIU 4GHTA 1QR3E 2Q1JA 4LK4A 1J9CH 3TGIE 1AFEH 1HIAA 1PQ5A 2G55A 1YGCH 1GJ9B 2ZPQA 5C1YA 1N1IA 1DQBA 3RXJA 1ATAA 2QGRA 4FVBA 4U2WA 2PUQL 5C20A 3PLPA 2AYWA 2OTVA 1FZZA 2Q6FA 1AU8A 3GY8A 3QGNB 1TGBA 1KDQA 3VPKA 2P95L 4RUTA 1O2GH 2Z7FE 1O3KA 2FPZA 4MLFB 2PR3A 2P3FN 1V2PT 4DGJA 4Z6AH 1AHTH 1FY3A 1TNIA 4MNVA 3CS7L 1L0ZA 1SC8U 1MKWH 1ZJDA 1HAVA 3HS7A 1FUJA 1MU6B 1SSXA 2VB0A 2UWLA 1TPPA 3ZZCA 2OC0A 1P8VC 5DP7A 4UD9H 2ZCLP 2TPIZ 1T8LA 3A7YA 3NPSA 5C5OA 3TH2H 2Y7ZB 2A31A 3VXFH 2VIPA 3RC6A 1W7GH 4O97A 2W3KB 4YT7L 2BLOA 4MQAA 2G52A 5DP6A 5C2ZA 1ZZZA 1KLOA 2F9UA 4TGFA 2QCYA 1AFQB 1O34A 3GDVA 3MDLA 1HIAB 6ESTA 1GBMA 1O2LA 5IYTA 1TFXA 4NSVA 1G2MB 3P8OA 3VB6A 4JZ1A 2C3SA 3BTGE 2WUCA 1LCYA 2XBXA 2XW9A 3SJ9A 1ESBA 1JMOH 1EBVA 4CREA 1BBRE 4CBNA 1IQJL 1QFKL 4JYUH 2NU0E 2VWNL 1EAUA 1FY8E 1IQFL 1UMAH 4K69A 2PR3B 3ELAH 1GBEA 4A1XA 2FYRA 3H7TA 3O8RA 4XBMA 4YM9A 1OWKA 1J17T 2P3FL 1MZAA 1P03A 3ATLA 1GBDA 1O3NA 4COXA 3M3TA 5E2OA 2UWLB 5COXA 2AGIX 5EXLA 2JETC 3V7TA 1WTHD 2QC2A 2WPJS 1QURH 3FVFB 4BAQB 1IQIL 1LPZB 1BRCE 1GJBB 2VIVA 1O2XA 3T5FH 4GPGA 2ZZUH 3LTFB 2H9EH 3QTVH 1Z6EA 2XBVL 1FY4A 2W7UA 2B5TB 3LT3A 4NA8A 4B2CA 1G2LA 1B0FA 2P93L 3T25A 1YUGA 1TPOA 3EQ0H 1JBUL 1SFIA 1OP0A 4J1YA 2BZ6L 3EA7A 3TNSA 4OS5A 1O30A 2OYUP 2VH0A 2QXGA 1AB9B
chains in the Genus database with same CATH superfamily
2P3UA 4GSOA 1P3EA 1GCTB 1QNJA 2ZU4A 5A8XA 5JBCE 5DGJA 5IK2D 4JZDH 1CX2A 2OC1A 1MTNB 3JZ2B 3N7OA 2ZGBH 3QWCH 4D9RA 1XMNB 4NFEA 5G4BA 1EASA 1TNGA 3ZYJB 5EODA 1P9SA 4ABBA 3ZZAA 1HRTH 2ZCHP 2TRMA 2A1DB 4AX9H 1APOA 1YUKB 2P94A 1C1MA 4HTCH 3NTGA 7KMEH 1NRPH 3IJEB 1QJ6B 4I86A 1KLIH 1P9UA 2KCPA 1FJSA 4DVAU 1LTOA 3FOAA 4MNWA 4DURA 7GCHG 2F91A 2AIPA 1HLTH 4RN6A 1KLTA 2IJOB 2Y80A 2W86A 3BEUA 2F43B 4WF8A 1LHGH 2HGTH 3NUMA 4DIIH 1D3TB 2R0KA 2JJLA 4ABDA 4B2AA 5DP5A 1QRWA 2C8WB 2HLDD 3PMBB 1W7XL 4ZCNA 3QUMP 2ZI2H 4ZXYH 1SGFG 2JJ2D 3M7QA 2ODQA 4KP0A 1KSNA 2ANMH 1A7SA 1IQGA 1QRZA 2P3UB 1E37B 3SU0A 3KK6A 1NU7B 2WPDD 1OYQA 9LPRA 3N8VA 1HAXB 1GVKB 1GBFA 2BOXA 3Q3XA 1F5LA 2CK3D 1BRBE 1K1PA 1NFWA 2VVCK 2H2ZA 5BRRE 1G1TA 1L5GB 1P09A 1C2HA 3AASA 5JB8S 4A1VA 1HT5A 1O3OA 2VVUA 5CHBA 4NA9L 2L74A 3UNRA 2FLRL 1TA2A 4ISHH 4A92A 3SNBA 2RA0L 3G01A 1C2EA 2EI7A 3HGNA 2AIQA 3P5BL 2BDYA 3SU4A 2HWLB 3UNSA 8ESTE 2ZNKH 2PP6A 4A7IA 2D1JA 1Q4GA 3KL6B 2Z9IA 1GI7B 4IMZA 3STJA 2QE7D 1HX2A 4GLYA 1E1QD 1SVPA 5EPNA 4E7RG 5EQSA 1UTKA 2C90B 4K1EA 4XDEA 1HFDA 3ZZBA 1EQGA 1P2QA 1BJUA 3FO8D 5TCAA 4X8TL 1YKTA 1VCQA 3ZYEA 3RXPA 3K9XB 1KSNB 3V13A 3E0PB 2Y81B 1KMHB 1YCPM 2QF3A 3R05A 2ZG0H 3MNXA 5EOKA 4NIYA 4Q4LA 1RTKA 3TBDA 3UPEA 3TH3L 4OTJA 3Q00A 2Q6GA 2WPIE 2FXRA 2YMSD 3TJVA 1GJ8B 1F0RB 1HXFH 5LH8A 3N7DA 5F8TA 3LGTA 3HK6B 1TPAE 2TBSA 1AN1E 2ZFRH 3MTYA 4MDSA 1TOMH 4XLWA 3E3TA 1O2YA 2BQ6B 2GD4B 1TONA 5HIYA 1OYTH 3PYHA 4OS4A 2O8WA 4TWWA 1O3GA 1LMJA 5F8XA 1DPOA 1WHFA 1MOXC 3U73A 2ODPA 2YGQA 1DVAL 2Y5FL 3SU2A 3SJ8A 4A7IB 3VXEH 1IHTH 3O8DA 1UZQA 1P05A 1XM1A 2VWLA 3GICB 2FEQH 4HI3A 3VB5A 1PYTC 2BOHA 4AFQA 1ELEE 3SW2A 4B73A 4BTUA 1VR1H 1TQ0B 1GI0A 1V2OT 1PRHA 3M5LA 2EQNA 2TGTA 4BTTA 1AFQC 1LHFH 2VJ1A 2BD3A 1EKBB 3ZZ5A 5CMXH 2UWPA 4BDWA 1YUFA 2BQWA 1O2RA 2XC5A 2Z94A 2AERH 2D26C 3BG8A 1QTFA 3IITA 1CVWH 1C1NA 1LVBA 2IPQX 3NK8A 3SJIA 7LPRA 1YO8A 1LMWB 1LVOA 2AEIH 3RXIA 3Q7DA 1QHRB 1P0SL 5JVYA 2A2QH 1ELFA 3CENL 5DK1A 1IGXA 2M2AA 2C4FH 1MQ6A 1XKAL 1MTVA 1DDXA 1XKAC 2RG3A 3P6ZB 2XNIA 3PRBA 4TY7A 4X6MA 1IOXA 1AY6H 1G1QA 1CBWB 3KQBA 1F5RA 4CHAC 5L30L 1DY8A 1COWD 3RXCA 1SB1H 2YOLA 1H8ED 3D23A 4IGDA 1DIYA 1QQ4A 1HJ9A 3N8YA 2ZO3H 2ZDVH 4AZ2B 3EA9A 4MNXA 5DJ7A 3SW2B 1URKA 1L1JA 2PSYA 2XRCA 4TWYA 1TBRH 2Y5GA 1PXXA 1K1IA 1ELVA 1ELTA 1SGIB 2PUQH 1YP9A 3SUEA 1O5GH 1Z8IB 1SLVB 1AB9C 4ISOA 5ETXA 1Z8JB 1GCTC 2IPHA 4K3JA 1OWIA 4MVNA 4AG1A 4SGAE 5F6MA 1V3XA 3MOCA 1NRQH 3LJJA 1MTNC 3V65B 1WUNH 2W6JD 5LPFA 1EJNA 3BTFE 1GG6C 2PW8H 1EP6A 2GKVE 2J97A 3TGFA 2NU1E 5K0HA 1L4ZA 1YLDA 3PB1E 2ODYB 1NU9A 3FP8E 2ZFTA 1D6RA 4Y7AA 1MCVA 4ZAEA 3S7HB 2Z9KA 4YT7H 1JOUB 2P16L 1GI6A 2J98A 1C5YB 2RA3A 2VBCA 5E0HA 2ZGCA 3VGCB 3N8YB 1O3CA 1PPHE 4I8KA 3OYPA 3PO1B 3PTNA 2EI6B 3SI3H 1PQ8A 3PV2A 1W0ZU 3M5OA 6GCHF 4SGBE 3QDZB 1GVZA 2G81E 2FYQA 3QH0A 4X2VA 3KHVA 3SV6A 4CR5A 1FAKL 3DSPA 5FCKA 1IGZA 3NT1A 1SFQB 4FM5A 3SOQA 4GU4A 1TGTA 1QFKH 1ZR0A 3KQDA 1DX5I 5C0UA 1EPJA 3RXSA 1BF9A 1BTPA 2WPKE 4RRZA 1E36B 5L2YH 3CS7A 1ZSLA 3BG4B 2C8YB 4RKOB 3PMAB 1W12U 2J94B 2QY0B 1VITG 1GHAG 4B6EA 1NPMA 1C1VH 4RKJB 2TGFA 2GZ9A 1F0UA 3BTQE 1C4V2 1O3LA 3BTTE 1KXFA 3TH4H 1Z1JA 3EGFA 3CS0A 3FZDA 4Y7AB 1HNEE 2QAAA 3RXHA 4UFFH 5B6OA 3A7ZA 4TT3D 5F19A 4JCNA 5KIRA 2SNWA 2O9QA 4O3UA 1F2SE 2ALVA 4D9QA 4A5TS 1JBUH 1CHGA 2V3MA 3AAUA 2HLCA 1AUJA 1UVTH 2BZ6H 1GI9B 4FU9A 1IQEA 3MO3A 3SUFA 2TGPZ 4KKDA 2Y7XB 3L33A 3ZVEA 4NCYA 3TK5A 3ZZ8A 4YZUB 1GI4A 3SU3A 3LC5B 5LPEA 4WMEA 5PTPA 2EY4C 2BY7X 3N8XA 3OLTA 2P3TA 2P8OB 1Y59T 1CT0E 1BTYA 2FOBA 5EXNA 3FCSB 4IS5A 1OP8A 1F7ZA 1TX6A 1IQIA 2BDHA 3I78A 2IJD1 1ZHRA 4F48B 4BNRA 4XRNA 3TJOA 3MH5A 1CCVA 2UUKB 3D62A 2XBVA 1ETSH 1UCYH 3S9BA 2XC0L 2BB4A 5AFYH 3LN0A 1THPB 1MZDA 3V12A 3E6PH 4UONA 1Q31A 2J4IA 2Z3CA 3NRLA 1FAXA 5F53A 1AGJA 1MKXH 4AG2A 3KRKA 2SGFE 1AQ7A 3TLOA 1IQLA 1SLXB 3GCNA 1E1RD 1O2SA 4FUCA 1C5UA 2BOKL 3UREA 1C5XB 3UQOA 3W1EA 1CSOE 1DM4B 2KAIB 3F6UL 1QIXB 1GGDC 1HRFA 1NY22 1KLJL 1QQUA 5HGGA 2BLQA 1IQNA 1EX3A 5JBBS 3TGKE 5EW1H 2W26A 2QXJA 3E90B 3I77A 4AB8A 1SHHB 2R9PA 3A87A 4NA9H 1IQHL 1C4Y2 2FLRH 3RM2H 4D7GA 5GIBA 4X2YA 4X1SU 5C67A 4KGAA 4AYVB 4MPUA 1YCPH 2GZ7A 2CXVA 2GP9B 5GCHG 2ZGJA 1VJ9U 3KF2A 3L3TA 4FUIA 3GDSA 3LDXH 2AMQA 1WBGB 2PGBB 2J4IB 2ZU5A 3URCA 1LPKA 1ESAA 1GWAA 3POYA 2GX4A 1PYTD 1YPHC 1OXGA 3BF6H 4WMFA 4FUJA 1Z71A 2QN5T 1V2KT 4FOUC 4ZHMU 3U9AH 1V2UT 2H5DA 2HORA 1NRSH 1H4WA 3MU1A 1BBRK 3TH3H 4NIWA 4ISIL 1IQKA 1EOLA 4INHA 1JL9A 5E0JA 5L6NH 1BHXB 5EQRA 3D65E 3RXKA 1F5KU 1BHXF 1SGQE 1GJ6A 4U32A 1GMDF 3ATKA 1Z7KA 3ZYGA 3HPTA 1NM6A 4OGXA 1Y3YA 4U30A 1JIRA 3W94A 3DD2H 2NU4E 3PROA 3VB4A 1N1LA 1O5EH 2GCTB 2CJIA 1DVAH 1C4U2 3SGAE 4BAKB 5IDKA 1BTUA 3BN9A 1LPGA 2WYGB 1K1LA 4X6PA 1NBMD 1P2OA 4X8SH 4AC9A 2BY6X 3LGVA 1F0SB 2BO2A 4ZH8B 2VVVL 1UCYE 1XVMA 2A4GA 3GCTG 1HV7A 3TK6A 1WHEA 3A8CA 2WFTA 2V6NA 5AHGH 2V7QD 1AI8H 1A3BH 2EI8B 1GJCB 2ZIQH 1TOCB 2YNBA 5JVZA 3I29A 5F8ZA 3A84A 1A0LA 3MYWA 1Q3XA 3ATMA 5L2ZL 4ABHA 5T6GA 3SHCH 4BAOB 1EPHA 2A4RA 1G3DA 1V2LT 1B9WA 4B71A 3LH3A 1MTSA 2BYAX 1Y5BT 3EYDA 1P0SH 4HZHA 4Y7BA 3AAVA 1SGEE 2LP6A 4ZKOU 8GCHG 1G1RA 2FP7B 4ABEA 3NKKA 1GJ7B 3RXTA 2QF0A 3SZNA 1UTLM 2RCEA 2ZFPH 5EU8A 1MKWK 4OS6A 1IAUA 2HVXA 3A86A 2Y7ZA 4DT7B 1EOJA 1DITH 4K8BA 3S0NA 2FX6A 3ESTA 1ZMJA 2W3KA 2XC4L 4O03A 1IQML 1S85A 2BZAA 6CHAB 2WV4A 2G00A 3TK6B 3MO6A 1RJXB 2OBQA 3RU4T 1QCPA 1A46H 3T62A 2IOTA 1G2MA 5DP4A 2QIQA 1HZ8A 5FL7D 1V2RT 1GJ5H 1H9HE 2C8XB 2HALA 5DN6D 3M37A 3ZZ3A 3GOVB 4OS2A 3P8NA 1GJDB 2BM2A 1FIWA 1QZ8A 1OHHD 3ZV9A 2BDAA 2WV5A 3F9FA 5JBAE 2BY5X 2FI5E 1H9LB 4RT1A 1P10A 1T8NA 2Z9GA 3OTPA 4NSYA 3RLWH 3ODFA 5EIYA 1G3EA 1EPGA 1AD8H 4Y7BB 1O3FA 2ZKSA 2P8OC 4YLQH 2AHME 1V2VT 2HNTC 1J14A 1N6XA 4UFEH 1XVOA 5GXPA 3SN8A 1OB1C 2R3UA 1VGCB 2PHBA 1ACBE 1LPZA 3TNTA 4X6OA 4ABFA 2XWBI 3DFLA 1B7XB 3SU1A 4A6LA 2FWWA 4R0IA 4WH6A 2DDUA 1HAZB 1YY3A 1T8MA 5CKMA 3ZVAA 2Y38A 1LHDH 1C5VA 1C2GA 3M35A 4XE4A 1G9IE 4RRYA 3EE7A 1RTFB 5HYOA 5E0GA 4FXGH 3RXOA 4NGAL 3MI4A 1FAKH 1GVLA 4B6FA 1GL0E 5FX5A 1TB6H 1V2ST 1MBMA 3U69H 1YM0A 5SGAE 2XBYA 3N99A 1BIOA 3KN2A 2XBWA 1LK9A 1TLEA 3V64C 1TGSZ 3OAAD 1W10U 5B6LA 4I33A 3H09A 2GCHG 1ZPBA 2CV3A 1EUFA 4AFZA 1EZUC 4CHAB 4FUEA 3M5MA 4UDWH 5I25A 2PHBB 3LC3A 2ZGHA 1OX1A 3Q3KA 4NZQA 2OQ5A 2VINA 2STAE 1O2IA 2VWOL 1NBME 2WZQA 1SQRA 5T6FA 2WPLE 1IOEA 1H8IH 5KECA 1P57B 2OLGA 2W2ME 2C8ZB 3GCOA 3MU5A 4I8LA 1NFUB 1WDIA 2F3CE 2FODA 3EE0B 1MCTA 2PUXB 2ILNA 4D0EA 1DWEH 3KQCL 3ATWA 2Q6DA 2ZA5A 4X8UH 4IMQA 3M36L 4X1NU 3E16B 1O2HA 1GG6B 2Y5HA 2V35A 5ABWA 1FSBA 1UK2A 1N6YA 4CH2B 5HKKD 5A8YA 1GBIA 3P8GA 3A8BA 1O5FH 4X2WA 3ZZ7A 2BQ7B 2H1UA 3GDUA 3IWMA 4LZ1H 5JYIA 1SGFA 3RXBA 3LC3B 3MO9A 1MAYA 3Q3KB 1RIWB 1V1HA 1S6HA 2GCTC 2KV4A 3HATH 3KL6A 3PWBA 4AN7A 1DXWA 5CDFE 1P2IA 3AW0A 2WHXA 3MH7A 1C5RA 5J4QA 3UQVA 1YC0A 2ZDAH 3RXAA 4UEHH 2BD2A 1DWCH 1EZSC 2Z3EA 5K7RA 2XCNA 1Z1IA 2CGAA 1AVWA 3K9XA 1ORFA 2B7DL 4GU3A 1ELCA 2Y81A 4X1QU 4FVDA 1J16A 1S6FA 1O3IA 1OWHA 1V1IA 4D76A 3F6UH 1PFXL 1ZMNA 1PFXC 4IC5A 1PTHA 1KLJH 1ZSJA 3SZEA 1F0RA 4INLA 1S0RA 7GCHF 3VB7A 1P12E 4NG9H 1PPZA 3KYFA 5E8EH 3U1IB 2BQ6A 2GD4A 1AWHB 1GI5A 5GWZA 1WSSH 1X7AL 1O35A 1G1SA 1TMBH 1X7AC 1NTPA 3RC4A 3ZZ4A 3M3VA 5BPEA 3RP2A 2GZ8A 5FDQA 1C1TA 3ITIA 4TPIZ 1FX0B 2WPHS 1J8AA 2A0QB 3NXPA 1APQA 2RFKC 1EMOA 3SOSA 3M7TA 3DSGA 1SMFE 3Q77A 1O5BB 2BD8A 1C5TA 1QB6A 1E38B 3SU5A 1O2NA 4FUHA 4J2YB 6CHAC 2FLBH 2BOKA 3U8RH 1W14U 3CP7A 2W2OE 5JDUB 1TPGA 1MH0A 4Q7YA 3SNDA 2G51A 4UE7H 1CHOG 1ADXA 1KIGL 3GCXE 1KXCA 2OP9A 3C1KA 3ZVBA 4JK6A 1G32B 1HGTH 1Y3VA 1G37A 2J95A 1V2TT 3DA9B 2CF9H 4D8NA 1FF7A 2HRVA 1CQEA 3SO3A 4BANB 1M1XB 1E35B 2AFQB 1O2MA 2H6MA 3RXRA 3UOPA 2XNDD 1VGCC 3RXEA 4JZFL 3M7UA 1IP0A 3F9HA 4Y6DB 2B0FA 3HKJB 1RRKA 2HOXA 2FOGA 2W3IB 1ESTA 1T8OA 2BD4A 4K8YA 1NQLB 1P9JA 4Q63A 1BZXE 3A81A 2ZTZA 2F9NA 2GMTB 4DY7B 1PJPA 1GK5A 3B23B 1EB1H 1EATA 1GGDB 2Y82B 2BXUH 3M3SA 4MTBA 3SUGA 3S9CA 5L2ZH 4CRFA 4K5ZA 1GCDA 5A0AE 3MQKC 2ESTE 3SORA 1SR5C 1SHYA 1ATBA 2SGAA 3ZVDA 1O5DL 3DEMA 1C5ZB 3FP7E 1AKSB 1UTOA 1QL8A 2FOHA 2J95B 5LGOA 5KN5C 1C5NH 1SGRE 2J5UA 4K1SA 1MTUA 3LGIA 1EPTB 1EQ9A 4XBDA 1RGQA 4Y76B 5EW2H 4B76A 2FS9A 2ZU2A 2ZFSA 4B2BA 4Y8XA 4P00A 4NZLA 3U8OH 2VVVA 4G1MB 4H6TA 3GS9A 3U8TH 3TZIA 3SBKA 3MU4A 2FZZL 2A4QA 2C93B 4PH9A 2EI6A 1K2I1 2ZC9H 4X0WU 3V0XA 5KGOA 3KQEA 3F2HA 1O3MA 1CQQA 5EJLA 1GBTA 3UTUH 5FPSA 1YPHE 3F0OA 1SLWB 1CT2E 1L1GA 3E8LA 4ISNA 1VITH 2WUBA 4OS1A 4AYYB 3FBYA 1GL1A 1HAHH 3HS5A 1MABB 5GPIB 2WG3C 2FLGA 1J9CL 3RXMA 5CE1A 1A2CH 3T2NA 3IG6B 1D3PB 2GDDA 3ASIA 1EFRD 3HS6A 1MBQA 2J94A 4UFDH 4AB9A 1SL3A 6LPRA 3U7UG 1A4WH 1LQDB 1WAYB 3TPIZ 1P3CA 5JBCS 4XD7D 1ANBA 3STIA 1QY6A 1TIOA 3L6PA 3SJOA 1S84A 3TJUA 3MU8A 1O33A 4LXBH 2VIDA 2XBXL 2XC4A 1O3AA 1NZIA 1G3CA 5JB9E 1GBCA 1KTTB 1IQMA 2SGPE 1RIWC 2KL7A 1KYNA 1GBBA 1FLEE 1KTSB 3KCGL 1SZBA 1O2QA 2B9LA 1U67A 1LO6A 1LKBA 1ZTLA 3KEEA 4BXWA 1UTMA 3MFJA 1GHWH 1PQ7A 4MG3A 5C1UA 1SOTA 2FOEA 3RXVA 4NGAH 1BTXA 2Y7XA 2P95A 4Y79B 1BCUH 4OTYA 1E34B 1GI1A 4YZUA 1EZQA 1XXFA 4O1ZA 1ZLRA 3LC5A 5H4IB 2H9TH 3BTHE 1T7CA 2IN2A 1CGJE 1Z6EL 2Z9LA 2W6ID 5CKQA 1BMNH 2P3FH 4Q7ZA 4X1PU 1WU1B 4GVUA 1O32A 4LZ4B 2J2UA 3T28A 1PPCE 4ZMAH 5FHTA 1YLCA 4C16A 2OQUA 1MD8A 1QL9A 1YYY1 1C2KA 1UVOA 1C1PA 1L2EA 2MGPA 3SOVA 2HPQH 1SBWA 1C1RA 3EA8A 4HFPB 1W8BL 1B5GH 3LGUA 4CSYA 1AUTL 1FE2A 2RNLA 1AUTC 2ZHDA 1XXDA 2VRSA 1UCYK 1F7MA 2ANWA 4VGCB 3UB0A 2OBOA 1DWDH 3FKSD 4IN1A 1ZMLA 5DPAA 2QF4A 3SNAA 3U98H 1T4UH 4GCHG 2GJGA 1ZHPA 3WWFA 2O8LA 1MKXK 1YWUA 1IQJA 1TYNA 2JKHL 2RDEA 1W3CA 2KAIA 2VWNA 1VITF 1GHAF 3E1XB 4F55A 3BTWE 1C2DA 1IQFA 5LPRA 1GDQA 2P26A 1AO5A 3R3GB 1EZQB 1TLDA 1GDUA 2A7CA 1GBLA 2AS9A 1C1QA 1K37A 5J4SA 3GYMA 3RC5A 1ELBA 1FQ3A 1NFYB 1L3YA 3UR6A 1V2NT 3OFND 1YPJH 1KY9A 2HNTF 5EXMA 3DT0H 1Z6JH 4ABAA 2J2UB 1XUHA 1LVYA 2HNTE 2VWOA 1O38A 2WPIS 3MHWU 4WMDA 3MNSA 1A0HB 4YOGA 4JZDL 2J34B 1TWXB 1YCPK 2P93A 1AE5A 1DX5M 4FUBA 3N7EA 2EA3A 1HJAC 1ZYOA 1W7XH 3P95A 1BOQA 1FNIA 1C1WH 3PTBA 2VVUL 5IKTA 1KXEA 5CHAC 1MD7A 1NRRH 1NS3A 2B7DH 1HAFA 1GHVH 4JZEL 1BQYA 1JRSA 2AMPA 3OX7U 1SLUB 3QK1A 4WWYA 5HIZA 4YXWD 2GMTC 3N8WB 4ZHAA 3A85A 1FDPA 4YO9A 4NA7A 1NT1A 4AQTA 1AE8H 3PV4A 3BSQA 4MPVA 4ZXYL 5EPYA 2A4OA 4M7GA 4ZKSU 4HGCA 2HPPH 5EJ1A 1GI8B 4JYVL 1FIZA 1W13U 4XSKU 1MAXA 4X8VL 1DS2E 2BVXH 1W11U 4D7FA 1SQOA 2GT7A 1EPTC 2WPJE 1C2MA 1W0JD 1K22H 2WYGA 2B8OH 2KB9A 4Y11E 5T3HA 3TIUA 2UWOA 3ZYIB 2WPME 1F0SA 3AVZA 3ZVCA 2A7JA 4ZH8A 9ESTA 1V2MT 4IW4E 5I46L 1GHBG 2OC8A 1GMHG 2EI8A 1AZ8A 2XTTB 4X8TH 2ZTXA 4A1TA 5FPTA 3U1JB 5FPYA 2FTMA 2BXTH 1L1NA 2BVRH 1EJAA 1IVOC 4ZHAB 2TIOA 2EC9H 1EP5A 2GV7A 4BDXA 4YOJA 1KIGH 2KCOA 1P06A 3TITA 5GCHF 4ACAA 1BDAA 3LIWB 1HDTH 1F92A 2GT8A 1UO6A 2RA0A 1GMCG 1SQAA 2Z3DA 4ACBA 1H8DH 1SPJA 1PPFE 2ZQ2A 3A8DA 1GI3A 4I8GA 5E2PA 1QA0A 4FU8A 3RXLA 5JPMH 1O3PB 4B75A 3FAOA 2PGQB 1DE7H 3PLBA 1TBQH 1D4PB 2THFB 1P02A 1XUJA 4JZFH 2UWOB 3RUOA 5C94A 3O8BA 3LKWA 4Y0ZE 1HBTH 4WXVA 3QGJA 2VWMA 1BTHH 1ZGIA 2VH6A 2F9BL 3LAQA 2ZPSA 1TABE 3UR9A 3SOBB 4CUFA 1FY5A 3DSOA 1TNLA 3RDZA 3ENSA 4CRGA 4MMYB 3F1SB 1N8OC 2WYJB 1OWJA 2F9OA 2ZHEH 1TRYA 1QA7A 1NZQH 3PWCA 3A7WA 1MUEB 1EMNA 1MQ6L 1VZQH 1P11E 1P2JA 2PTNA 3KQBL 2XWAA 1AWFH 4A94C 3F3BA 1TBZH 1UZPA 1WCZA 1C1UH 3MH6A 4XFQA 4FUDA 2FS8A 1JIMA 1BB0B 3SHAH 2XYAA 1A5HA 1W0KD 5A0BA 3SGQE 1O5DH 4JK5A 2QF5A 5JB8E 4JZIA 2BTCE 1WYKA 3LGWA 1VJAU 2BSFA 2WG4B 3GCTF 2Y5FA 3OY5U 2CN0H 5CISA 1FN8A 3ODDA 4ZXXL 4BAHB 1A5IA 1DSUA 1LQEA 2G5VA 1QL7A 2WPKS 5L30H 4NWLA 1HREA 4O3TA 4GHQA 2ZECA 4B74A 1HCGB 2OUAA 2BVSH 2ADXA 5HMAA 2VH6B 1FPCH 3V3MA 1S6LA 1RD3B 1S0QA 1BITA 1AVXA 4VGCC 1CU1A 1CGHA 1DY9A 3ENSB 2Z6BD 1MQ5L 3OU0A 1SGPE 5EJZA 2BMGA 1BA8B 4CBOA 4Y8YA 3GY6A 3RMOH 2A2XH 2ULLA 1C5PA 1CA0C 4IBLH 2SGQE 1GJ4H 1BMFD 4BAMB 3OY6U 1ETTH 2BOUA 1U8CB 2ALPA 2WINI 1HAIH 3CENA 1BRAA 1SOZA 1KXDA 3LJOA 1GBJA 2TGAA 1TMUH 3NJPC 3RXGA 1DXPA 2W2NE 4ASHA 2ZP0H 4M10A 1SGYE 1GBKA 4I31A 4LORA 1A3PA 1C1OA 3KQDL 1IJQA 1EPIA 2FZZA 1YLNA 3BT2A 1U6QA 2EEKA 1O37A 3RMLH 4WJG2 3KCGH 1ID5H 4Q80A 2BDCA 6COXA 2YNAA 2K2TA 4BOHA 2PLXA 4DIHH 1BMLA 1T32A 1NFUA 3RXDA 1G3BA 4Y71A 4E06H 3URDA 1JV2B 1NRNH 3LH1A 3OEED 4ISLA 2BMGB 2K2SB 1JWTA 4CRDA 2R2MB 3GCHB 1O0DH 4E1GA 2LELA 1EGFA 4DJZB 2Q1JB 3E91A 1CE5A 1TGCA 1B0EA 1DLKB 2OYEP 3B8JA 4CUEA 2PKSC 2TGDA 3SQHE 1ELAA 3E0NB 2BQ7A 2NU3E 1XX9A 2QV1A 2ZDMA 3AW1A 3M61U 4THNH 1IQEL 1XKBC 2RDLA 2KZ4A 1TAWA 1KDQB 4OGYA 1NO9H 2P16A 2V3HH 1DICA 5L2YL 1W8BH 5DG6A 5IKRA 1H1BA 1D3QB 1ANEA 1O5AB 3HO4A 2KCAA 2AH4X 2A5IA 1AMHA 3UAIC 3RR3A 1HAVB 2JIZD 3S9AA 3BIVH 1O2PA 2G8TA 3FFGL 4IN2A 4GUXA 3BTEE 4XBCA 3EAJA 4Y71B 1UJ1A 4F4OC 1XUFA 1UK3A 2SGDE 4M11A 4I32A 1THRH 2GCHF 4AGKA 4ZKNU 3TVJB 2VGCB 2WPMS 3PGHA 4ABGA 1DFPA 1V2WT 1MU8B 1XUGA 5EGMA 4RI0A 1ETRH 4OS7A 3UOUA 1ZJKA 2P59A 2F9PA 2GGVB 1INCA 1C9PA 2ZTYA 4E05H 1FI8A 1FAXL 1HXEH 2Y6TA 1TNKA 1QBOA 1BT7A 1IQLL 1NN6A 3BEIB 2FOMB 1S83A 5FBIA 3H5CB 1KXBA 1ARBA 1HJ8A 2FO9A 3PLKA 1J15A 4AFUA 3MMGA 3UIRA 5C0TA 2J9NA 2I6QA 5A0CA 3H7OA 3C9AC 3GYLB 5C3NA 1IQNL 1UVUH 5IKQA 1C5MD 2CHAB 3BTDE 1HAEA 2BT7A 1TE0A 1E0FD 1K9OE 1ZRBA 2FDAA 2JKHA 2PV9B 4XOJA 1UVPA 5GNDA 2WFXB 4JZEH 3QMOA 2ASUB 2ZU3A 5TCCA 1YPMH 4JMYA 2J92A 1NROH 3D49H 2LPRA 1O3EA 3RMNH 1P01A 3SV8A 3UUZA 5EGMB 4RS0A 2I6SA 1G2LB 3OTJE 1CCFA 1MMJN 1LHEH 2ZGXH 3RXFA 2STBE 2P28B 3NTBA 3HO3A 1P2KA 2A5AA 2ZEBA 1T4VH 3GISB 3U28C 1NPEB 2WV9A 2BX3A 1K1OA 2UUJB 1DOJA 5AVDA 4JYVH 2FESH 3ZVGA 2VH0B 4X8VH 2ZHWH 1T31A 1EAIC 3T29A 1XDTR 1CVUA 2FD6A 3GY5A 2XC0A 1KXAA 2ANYA 5GJ4B 2SFAA 4AFSA 3RXUA 3BTKE 3NWUA 2A32A 8LPRA 4Y6DA 1IQKL 2SGEE 2ZDKA 4KELA 4ZUHA 2F83A 3T27A 4Z1MD 1C2JA 1Y3XA 3ZZ6A 3GY3A 3LTGD 1QB1A 2W3IA 5I46H 2H5CA 5ESTE 1OOKB 1OWEA 4FETA 2KX4A 1P2MA 2V0BA 1SGDE 2VJ3A 1LHCH 2J38A 2R2WU 1WV7H 1S82A 4YESB 2V3OH 1DWBH 2Y82A 5FCRA 1QRXA 3NCLA 4KTSA 2Y80B 4MPXA 4ISIH 4WY3A 4LMFA 1LVMA 1P2NA 3QX5H 2AMDA 5HM9A 3K65B 2ZQ1A 4BXSA 4ESTE 1IQHA 3QZRA 3P8FA 2ZU1A 1YBWA 2ZFFH 1AKSA 5E8DA 1O36A 1QB9A 1UTQA 4YOIA 5C17A 3CA7A 4H6SB 4M9FA 1EPTA 1FMGA 1LDTT 1AZZA 2VU8E 3BEFB 4Y76A 5EQQA 1S5SA 3GY2A 1W2KH 3TK9A 1ELGA 4Y8ZA 3MQEA 4X1RU 3K6ZA 2BDBA 4ABJA 2AYLA 1C2IA 5HM2A 2HOBA 5JBAS 1ZAQA 1K36A 1HJAB 1NFWB 1AVGH 1O2WA 1QJ1B 3EDXB 1HAOH 1K28D 1M9UA 1ABIH 3HGPA 1O3DA 1OP2A 2ZWLH 1ANDA 2F9BH 3LGYA 4NIXA 5CHAB 3MU0A 2O8UA 2DE9A 1D6WA 1CEJA 1O2VA 3M5NA 1CHOF 4X2XA 2EI7B 2I9BA 2J38B 2W7SA 2I9AA 3QO6A 4B1TA 1XUIA 1GBHA 3BPSE 1OWDA 3UY9A 1NC6A 2D1JB 1V6DA 4YT6L 1OPHB 1EJMA 2PFEA 2FTLE 3R0FA 1H8HD 2A5KA 4X8SL 3BIUH 5IKVA 1G30B 3DUXH 3GCHC 1C9TA 1D9IA 4MPWA 5JBBE 2QXIA 2QYIA 3N8ZA 3A7VA 4DCDA 4Y0YE 3SJKA 2JH6D 1OSSA 2VIQA 1QBVH 2G00L 3RXQA 5FXLA 1LQDA 2VVCA 1ZOMA 2ZHFH 5FAHA 1PGEA 2JDID 2DE8A 1O2UA 1ANCA 5CKNA 1VKYA 4ZXXH 2F9VA 3M37L 1C5MF 1H9IE 5C5NA 4AOQA 4TPYA 1EZXC 2FX4A 1YF4A 1OS8A 5ESBA 2YGPA 4CRCA 3FN8A 1EAWA 1V2JT 4R8TB 1HB0B 1XUKA 2FOAA 5EG4A 4CRAA 4O9VA 2G4TA 3QCWA 1NT0A 1SGTA 2ZDNA 1XFEA 5T1VA 2R0LA 4Y79A 1O39A 2NWNA 2OC7A 3UFAA 2WPLS 2CMYA 1TGNA 4ZHLU 2FMJA 1ZSKA 1K1NA 1EQHA 1Y5AT 2BOHB 2VGCC 2VIWA 4AORA 1DDJA 4BTUB 1ELDE 1WU1A 2OCVB 3F9GA 1YGCL 4BTTB 1G36A 1CGIE 4Z0KA 1RXPA 2UWPB 2VNTA 2BQWB 3RU4D 1Z8RA 4ASUD 3P17H 2DUCA 4H42U 3Q76A 3TJNA 3IITB 3KGPA 2WZPP 3A82A 3SI4H 4WVPE 1ZPZA 1EAXA 3PM3A 3K6YA 2BHGA 2PSXA 3KIDU 6GCHG 2PWXA 1GDNA 4RRXA 3AK5A 4Z6AL 1K0HA 4I7YH 1HT8A 2XBYL 3MNBA 1D3DB 3F9EA 3HKIB 5F03A 2GVFA 2XBWL 2F4LA 2BY8X 2FI3E 3GY4A 1N8OB 5A09A 2XXLA 3F2FA 1MQ5A 2W2QE 1RS0A 2CHAC 4RT0A 3VG8A 1JXPA 3Q3YA 4I8JA 3QZQA 5AF9H 3WW7A 4K2YA 1O31A 2UUYA 4E7NA 1C2FA 1A61H 1HAGE 4DW2U 4ZKRU 5JBTA 4I8HA 1BMAA 4UFGH 1IOEL 3WWBA 3BV9B 2BX4A 1NFYA 4CRBA 1TRMA 3P70B 1ZRKA 3RM0H 2ZF0H 3S69A 2YMSB 2YGOA 4XBBA 3HK3B 2NPRA 4Z0KB 1FN6A 1HAYB 1A5GH 2JH5D 4H4FA 3F68H 2MHPA 1O2JA 1SI5H 3K2UA 4JYUL 1FY1A 1TNHA 3BT1A 1DLEA 2J34A 4YTAA 3ZZDA 1QGFA 4CUDA 2FOCA 4AGJA 1V3XB 3ELAL 3OE7D 2R3YA 5DO4H 1WOFA 3UWJH 1BJVA 1SQTA 1ARCA 4JYTA 2Y5HL 3FP6E 3SNEA 4OM9A 1UTNA 2W5EA 5FX6A 5C1XA 5K0HB 4QT8C 2SNVA 1A0JA 1C5WB 3ZYDA 4O02B 2P94L 4LOYH 1CA0B 4Q7XA 1FPHH 1W0YH 4DG4A 3B9FH 4CR9A 1Z6CA 4ZAEB 3N8WA 1CA8B 1FJSL 1KKEA 2H9EL 1TALA 2H9EC 3QTOH 2BD9A 3GISX 2J98B 1N7DA 4TYDA 3DFJA 3EGKH 2UUFB 5A8ZA 1TX7A 5T6DA 1O2TA 3A7TA 1ZPCA 3SNCA 1HPGA 1V2QT 3QN7A 4NFFA 1ZHMA 4K60A 1XKBA 1K1MA 3CNRA 3A8AA 2PTCE 3SU6A 1MTWA 3OEHD 1O2KA 1FFMA 1I0UA 1YPLH 1TX8A 1IQGL 2FM2A 4GCHF 1COUA 3SUDA 5HXFA 1TA6A 4X8UL 4P02A 1K21H 2AGGX 4WXIA 1C5OH 1C5LH 1UVSH 1ATEA 1CO7E 1OKXA 4DT4A 1DUEA 3FFGA 2G4UA 4F49A 1TMTH 3VB3A 1O3BA 1QBNA 1NFXA 1HJ7A 1NESE 5AFZH 1TQ7B 3ATIA 3SV7A 3SGBE 2VWMK 3KQCA 3VFEA 4TY6A 2A45B 1KLIL 3FZZA 1RFNA 1WQVH 2GV6A 5DP3A 3M36A 1ABJH 2ZHQH 3VEQB 1ZTJA 1SG8B 2ANKH 2BD7A 3PMJA 2G5NA 3RMMH 1PPEE 3NZIA 1VCWA 1ZGVA 3T26A 1SGCA 2PKSB 4BTIA 1YPKH 3LIWA 5JW1A 3KNXA 4NIVA 1UTPA 2BD5A 3S7KB 2BY9X 1Z8GA 2XCFA 4U01A 2GTBA 2XOKD 2PKAA 5A2MH 3FANA 3RU4E 2A7HA 3MH4A 1GPZA 4RSPA 1ATDA 2RHPA 1UZKA 3TK5B 2FI4E 4RRWA 3PMHB 4MMXB 1WQSA 2K1QA 3UWIA 1SKYE 1Y3UA 1DANH 1RTLA 4ZROA 1PPBH 5DP9A 3SV2H 1Y8TA 2WSSD 4D0FA 4Q2KA 2P3TB 4NG9L 1IHSH 2O8MA 1DSTA 1C5SA 3A88A 3A89A 2JETB 5DP8A 1Q2WA 4ISHL 1NFXB 1UTJA 3KQ5A 1FV9A 1GHXH 3A7XA 2BDGA 1THSH 2OINA 3F0PA 1EXFA 2WYJA 2CF8H 1RFNB 1TOZA 1GJAB 3SV9A 4YLUA 3HO5A 4Z0LA 1GI2A 1CBWC 1GMDG 3W95A 2VWLL 3P92A 2MGRA 1C2LA 1ZTKA 1AIXH 1FXYA 2M74A 1VCPA 2M5TA 4FUFA 2D2DA 2JH0D 4Y10E 4BTIB 4ABIA 1LKAA 3DHKH 2FLBL 5FBEA 1TRNA 5F1AA 1EAIA 1GBAA 5DKMA 7ESTE 2BDIA 2BLVA 4D90A 2PKAB 3S6XA 1FONA 1WTGH 1BTZA 2QXHA 3QLPH 2FOFA 1GHBF 1GMHF 1A3EH 2XC5L 3LN1A 4X6NA 1UHBA 2O8TA 3ZZ9A 2Z9JA 3RLYH 3UNQA 3TGJE 3A80A 4KTUA 4DOQA 1F0TA 5TJXA 2W2PE 1HCGA 5GDSH 2W26B 1PQAA 1BTWA 1O2ZA 3KYGA 3SQEE 1S81A 3OLUA 2QA9E 1P04A 2OD3B 1HYLA 4IC6A 1YPGH 4MNYA 4K1TA 1PPGE 3C27B 3O8CA 3CFWA 3LPRA 4XL1A 1GMCF 1SGNE 3MNCA 4MMZB 2L6OA 5JB9S 2LNCA 2OXSA 4YT6H 1GHYH 1L4DA 2ZPRA 4TSFD 2VIOA 3ZIAD 1TNJA 2JJ1D 1DT2A 2OK5A 1GHZA 1K1JA 1TPSA 3TU7H 8KME2 2NU2E 1HUTH 3A83A 1LPKB 1Y5UT 4PROA 1O3HA 2ZCKP 3VGCC 1JRTA 1O2OA 1CT4E 1HAPH 3PO1C 3ZV8A 1O3JA 3PV5A 4GAWA 1C1SA 1BBRH 2ZDLA 1A1RA 2ZFQH 2Y5GL 1Y3WA 2YMSC 3KQEL 4KTCA 5DSFA 3LU9B 1YPEH 2BLWA 4CH8B 3GCWE 1CVWL 2FIRH 3PRDA 1UHBB 2WPHE 1F7EA 1UK4A 1C5QA 2AGEX 3JZ1B 1BRUP 2D8WA 3GY7A 2BT8A 4FUGA 2H9HA 4INKA 3ZVFA 3BG4C 1BMMH 3LONA 3HPTB 2K8IA 3LOXA 1O5CB 2CJIB 3OSYA 1UZJA 1DUAA 3WY8A 4NWKA 1LPGB 3BTME 8GCHF 1EB2A 5KEDA 1QJ7B 3F2GA 4FU7A 1BUIA 4WH8A 2GDEH 3MWIU 1UW7A 4GHTA 1QR3E 2Q1JA 4LK4A 1J9CH 3TGIE 1AFEH 1HIAA 1PQ5A 1LMMA 2G55A 2KR7A 2KFWA 1YGCH 1GJ9B 2ZPQA 5C1YA 1N1IA 1DQBA 3RXJA 1ATAA 2QGRA 4FVBA 4U2WA 2PUQL 5C20A 3PLPA 2AYWA 2OTVA 1FZZA 2Q6FA 1AU8A 3GY8A 3QGNB 1TGBA 1KDQA 3VPKA 2KM0A 2P95L 4RUTA 1O2GH 2Z7FE 1O3KA 2FPZA 4MLFB 2PR3A 2P3FN 1V2PT 4DGJA 4Z6AH 1AHTH 1FY3A 2KNIA 1TNIA 4MNVA 3CS7L 1L0ZA 1SC8U 1MKWH 1ZJDA 1HAVA 2KCYA 3HS7A 1FUJA 1MU6B 1SSXA 2VB0A 2UWLA 1TPPA 3ZZCA 2OC0A 1P8VC 5DP7A 4UD9H 2ZCLP 2TPIZ 1T8LA 3A7YA 3NPSA 5C5OA 3TH2H 2Y7ZB 2A31A 3VXFH 2VIPA 3RC6A 2HVYB 1W7GH 4O97A 2W3KB 4YT7L 2BLOA 4MQAA 2G52A 5DP6A 5C2ZA 1ZZZA 1KLOA 2F9UA 4TGFA 2QCYA 2K0QA 1AFQB 1O34A 3GDVA 3MDLA 1HIAB 6ESTA 1GBMA 1O2LA 5IYTA 1QIUA 1TFXA 1G2MB 4NSVA 3P8OA 1WXRA 3VB6A 4JZ1A 2C3SA 3BTGE 2WUCA 1LCYA 2XBXA 2XW9A 3SJ9A 1ESBA 1JMOH 1EBVA 4CREA 1BBRE 4CBNA 1IQJL 1QFKL 4JYUH 2NU0E 2VWNL 1EAUA 1FY8E 1IQFL 1UMAH 4K69A 2PR3B 3ELAH 1GBEA 4A1XA 2FYRA 3H7TA 3O8RA 4XBMA 4YM9A 1OWKA 1J17T 2P3FL 1MZAA 1P03A 3ATLA 1GBDA 1O3NA 4COXA 3M3TA 5E2OA 2UWLB 5COXA 2AGIX 5EXLA 2JETC 3V7TA 1WTHD 2QC2A 2WPJS 1QURH 3DCLA 3FVFB 4BAQB 1IQIL 1LPZB 1BRCE 1GJBB 2VIVA 1O2XA 3T5FH 4GPGA 2ZZUH 3LTFB 2H9EH 3QTVH 1Z6EA 2XBVL 1FY4A 2W7UA 2B5TB 3LT3A 4NA8A 3SYJA 4B2CA 1G2LA 1B0FA 2P93L 3T25A 1YUGA 1TPOA 3EQ0H 1JBUL 1E79D 1SFIA 1OP0A 4J1YA 2BZ6L 3EA7A 3TNSA 4OS5A 1O30A 2OYUP 2VH0A 2QXGA 4HG6A 1AB9B
chains in the Genus database with same CATH topology
2P3UA 4GSOA 1P3EA 1GCTB 1QNJA 2ZU4A 5A8XA 5JBCE 5DGJA 4JZDH 1CX2A 2OC1A 1MTNB 3JZ2B 3N7OA 2ZGBH 3QWCH 4D9RA 1XMNB 4NFEA 5G4BA 1EASA 1TNGA 3ZYJB 5EODA 1P9SA 4ABBA 3ZZAA 1HRTH 2ZCHP 2TRMA 2A1DB 4AX9H 1APOA 1YUKB 2P94A 1C1MA 4HTCH 3NTGA 7KMEH 1NRPH 3IJEB 1QJ6B 1KLIH 1P9UA 4DVAU 1FJSA 1LTOA 4MNWA 4DURA 7GCHG 2F91A 2AIPA 1HLTH 4RN6A 1KLTA 2IJOB 2Y80A 2W86A 3BEUA 4WF8A 1LHGH 2HGTH 3NUMA 4DIIH 1D3TB 2R0KA 4ABDA 4B2AA 5DP5A 1QRWA 2C8WB 3PMBB 1W7XL 3QUMP 2ZI2H 4ZXYH 1SGFG 3M7QA 2ODQA 4KP0A 1KSNA 2ANMH 1A7SA 1IQGA 1QRZA 2P3UB 1E37B 3SU0A 3KK6A 1NU7B 1OYQA 9LPRA 3N8VA 1HAXB 1GVKB 1GBFA 2BOXA 3Q3XA 1F5LA 1BRBE 1K1PA 1NFWA 2VVCK 2H2ZA 5BRRE 1G1TA 1L5GB 1P09A 1C2HA 3AASA 5JB8S 4A1VA 1HT5A 1O3OA 2VVUA 4NA9L 3UNRA 2FLRL 1TA2A 4ISHH 4A92A 3SNBA 2RA0L 3G01A 1C2EA 2EI7A 3HGNA 2AIQA 3P5BL 2BDYA 3SU4A 2HWLB 3UNSA 8ESTE 2ZNKH 4A7IA 2D1JA 1Q4GA 3KL6B 2Z9IA 1GI7B 4IMZA 3STJA 1HX2A 4GLYA 4E7RG 1SVPA 5EPNA 5EQSA 1UTKA 2C90B 4K1EA 4XDEA 1HFDA 3ZZBA 1EQGA 1P2QA 1BJUA 5TCAA 4X8TL 1YKTA 1VCQA 3ZYEA 3RXPA 3K9XB 1KSNB 3V13A 3E0PB 2Y81B 2ZG0H 1YCPM 2QF3A 3R05A 5EOKA 3MNXA 4NIYA 1RTKA 3TBDA 3UPEA 3TH3L 4OTJA 3Q00A 2Q6GA 2WPIE 2FXRA 3TJVA 1GJ8B 1F0RB 1HXFH 5LH8A 5F8TA 3LGTA 3HK6B 1TPAE 2TBSA 1AN1E 2ZFRH 3MTYA 4MDSA 1TOMH 4XLWA 3E3TA 1O2YA 2BQ6B 2GD4B 1TONA 1OYTH 3PYHA 4OS4A 2O8WA 4TWWA 1O3GA 1LMJA 5F8XA 1DPOA 1WHFA 1MOXC 3U73A 2ODPA 2YGQA 1DVAL 2Y5FL 3SU2A 3SJ8A 4A7IB 3VXEH 1IHTH 3O8DA 1UZQA 1P05A 1XM1A 2VWLA 3GICB 2FEQH 4HI3A 3VB5A 1PYTC 2BOHA 4AFQA 1ELEE 3SW2A 4B73A 4BTUA 1VR1H 1TQ0B 1GI0A 1V2OT 1PRHA 3M5LA 2TGTA 4BTTA 1AFQC 1LHFH 2VJ1A 2BD3A 1EKBB 3ZZ5A 5CMXH 2UWPA 4BDWA 1YUFA 2BQWA 1O2RA 2XC5A 2Z94A 2AERH 2D26C 3BG8A 1QTFA 3IITA 1CVWH 1C1NA 1LVBA 3NK8A 3SJIA 7LPRA 1YO8A 1LMWB 1LVOA 2AEIH 3RXIA 3Q7DA 1QHRB 1P0SL 5JVYA 2A2Q