4BXSA

Crystal structure of the prothrombinase complex from the venom of pseudonaja textilis
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
326
structure length
248
Chain Sequence
KSCRVDNGNCWHFCKHVQNDIQCSCAEGYLLGEDGHSCVAGGNFSCGRNIKMDCKLGECPWQAALVDEKEGVFCGGTILSPIYVLTAAHCINETETISGEIDKLSVDKIYVHKKFVPPQKAYKFDLAAYDYDIAIIQMKTPIQFVPACLPTADFANQVLMKQDFGIVSGFKSKTLKVLKVPYVDRHTCMVSSETPITPNMFCADSGGPHTTVYRDTHFITGIVSSGKYGNYTKLSKFIPWIKRIMRQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the Prothrombinase Complex from the Venom of Pseudonaja Textilis.
pubmed doi rcsb
source organism Pseudonaja textilis
molecule tags Blood clotting
molecule keywords FACTOR X-LIKE PROTEASE
total genus 37
structure length 248
sequence length 326
ec nomenclature
pdb deposition date 2013-07-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00008 EGF EGF-like domain
A PF00089 Trypsin Trypsin
A PF00594 Gla Vitamin K-dependent carboxylation/gamma-carboxyglutamic (GLA) domain
A PF14670 FXa_inhibition Coagulation Factor Xa inhibitory site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.25.10 Mainly Beta Ribbon Laminin Laminin 4bxsA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4bxsA02
2BQ7B 4JCNA 4AOQA 1APQA 3HGPA 5A09A 3MO6A 4KGAA 3SORA 1V2RT 4ZXXL 4BTTA 3ELAL 1TRYA 4LK4A 4CHAC 1TGSZ 1O2OA 3IITA 3GOVB 1UHBB 1QGFA 1ETSH 3UWJH 1RGQA 4NWKA 1C1QA 2VIPA 4B2BA 3D23A 3V12A 4TYDA 4FUDA 2WPKE 1TPGA 1CT4E 2GCTC 4BDXA 2HOBA 4X2XA 1SPJA 1T4VH 5LPRA 1GHAF 1EJAA 4NZLA 2Z94A 1S5SA 2OTVA 1ADXA 6LPRA 1BMMH 5IKRA 3M7UA 4X8SL 1Y5AT 2FS8A 2BOHA 3IITB 1VJ9U 1HDTH 1P04A 1UZKA 1NFXA 1CBWC 3QWCH 4MQAA 2A4GA 3T25A 2BY6X 4XDEA 1SOZA 1Z8JB 5KN5C 2HNTE 5AF9H 1ARCA 2BD2A 3LTFB 2BO2A 5DP9A 3NTBA 1LMJA 1XFEA 3UNQA 3POYA 2IN2A 2ZA5A 1Z6CA 3TPIZ 1EAWA 1MMJN 2W7UA 1W0YH 1P01A 3VB4A 4JYVH 3F6UH 1G1TA 4JZDH 2ZDNA 1TFXA 2FOFA 4CRCA 1FPCH 1BQYA 2PHBA 4AFSA 4X8TH 3FCSB 3RC5A 1DDJA 1GVZA 4AG2A 1FAKL 2GVFA 1B0EA 2WPMS 1O2NA 2KAIA 7GCHG 5C5NA 1O5BB 2FOMB 1JXPA 1PPBH 4FXGH 1YLDA 2A0QB 3ZVGA 3T26A 4YLUA 1L1GA 2AFQB 1AY6H 2W26A 3F1SB 3HS6A 2WPKS 3MHWU 3QTOH 4OS1A 1H4WA 3LOXA 4A6LA 3Q7DA 3OYPA 3DD2H 4FVBA 1URKA 2PKSB 3CS7L 3GCOA 5FPYA 1GJ7B 1P10A 4OS7A 1Z8IB 3B8JA 3BPSE 1AUTC 2UUFB 4B74A 2BVSH 1DXWA 1IQFA 1ATAA 4YLQH 3EAJA 3R05A 1AHTH 1UJ1A 2FI4E 1F0RA 1MU8B 3TH2H 2CHAB 3UREA 1HREA 5EXMA 1DANH 1FJSA 4JYUH 3NXPA 4FU7A 2BQ6A 3S69A 2Y81B 4MPVA 1FV9A 1UK2A 4CRGA 2ZEBA 5A0BA 2VH6A 1V2TT 1GBLA 1FF7A 3S7HB 3LC5B 1IQNA 2AMPA 2ALPA 1UTKA 3LIWA 2ZFPH 1UCYH 1SL3A 2VH0B 1ZTKA 3DFLA 1ZAQA 2NU3E 3ZVEA 2XBYA 1N6XA 2VIWA 1KXBA 3KK6A 3LPRA 5C67A 1O2ZA 2GV7A 4H42U 4ASHA 1C5QA 2XCFA 2BVRH 2Z6BD 3T62A 2Z3CA 1YPGH 4X1RU 1SQAA 1OB1C 3OX7U 1EAXA 3I29A 1EPIA 2M74A 1ZGIA 4WY3A 4AZ2B 2BMGB 2Q1JB 2H9HA 1ZSKA 2EI7A 4ISHH 2STAE 1EPTC 1XX9A 1O5DL 2D1JB 1DS2E 2W3KA 3DFJA 3RXIA 4ABJA 2EI6A 2J94A 2VWMK 3MH5A 1QL7A 4MNVA 4R0IA 3SI4H 5F6MA 2BY8X 2QGRA 1LHEH 2YGOA 3AAVA 4I8KA 1Z6EA 1F7ZA 5JYIA 2UWLB 1OXGA 1P0SH 3Q00A 1SGQE 3PTBA 3M7TA 4X2VA 1UVUH 3L3TA 4ZKSU 1C1MA 1O5EH 3KQDA 4Q7YA 3LN0A 2BHGA 3LAQA 3LTGD 5HYOA 4ABDA 2WPHS 4BAHB 2GCHF 5FBEA 1C5ZB 3R0FA 1JRSA 3UTUH 5EQQA 1SGDE 2ZGBH 4UFGH 1O3LA 5DP3A 1V2NT 3O8DA 1J17T 1P9UA 2M5TA 1W7XH 2VGCB 2ZU3A 6GCHG 3QUMP 2KV4A 2A1DB 3PWBA 2SGQE 5J4QA 3AW0A 4DJZB 5JB9S 2ZFSA 3RXCA 2THFB 4K1EA 4X8VL 1O3HA 1C1VH 4CRDA 5B6OA 1SGRE 4A1VA 1XXDA 2PKSC 2OBQA 3IJEB 1EPGA 1V2LT 2C93B 1HAYB 1QBVH 1BHXF 1QFKH 3ZZBA 3SOVA 5JBCS 4I8HA 5EXLA 1CO7E 1GJ4H 1BDAA 2VIDA 2QXHA 3SHAH 2R3UA 1OWEA 1P06A 1AKSA 1Q2WA 1CGHA 2FMJA 1MZAA 1ELTA 1BIOA 4NGAL 1E37B 1C5LH 3N8ZA 3TGJE 1EPJA 1TBRH 5LH8A 1L4ZA 4AB8A 1P12E 5C1XA 2P94A 3GCTG 1NS3A 1JV2B 2W2OE 1D3TB 1K36A 1FAXA 3VGCB 1H1BA 3BT2A 1GBAA 1CBWB 2BD3A 3SN8A 1WBGB 4KP0A 2SGEE 4NSVA 2Y5FL 1PPHE 3CA7A 5E8DA 1ZLRA 1O5GH 4UFFH 4ISOA 2P3FH 1GI3A 3P6ZB 1O3DA 4IGDA 4DCDA 4NFFA 4X6MA 3RMLH 3RXPA 2BQWA 2XBYL 2WYGA 8GCHG 1A46H 1HNEE 3GY4A 1IQIA 1AU8A 1NQLB 1GJ5H 2EC9H 3BTWE 2BDHA 3NWUA 4Y0YE 4ABBA 1SGYE 4DG4A 2PHBB 2Y38A 2TGAA 3SV8A 1EASA 3RM2H 1MBQA 2PKAB 4TPIZ 1TNJA 4ZHAA 2SGDE 5E8EH 1EJNA 1PPCE 2YNBA 3TU7H 3UQOA 3QGNB 4WH8A 3RC4A 3H5CB 3SU2A 5DP5A 1C2EA 1SG8B 3TBDA 1V2UT 1BT7A 3V7TA 2GCTB 1KXCA 3FP8E 5F1AA 1SGFA 2OC1A 3H7TA 2MGPA 1P02A 1S84A 1YPHE 3ZYJB 1KLTA 1AWHB 1ESTA 4ZMAH 2AGGX 3O8RA 4JZDL 1SHHB 3KGPA 3K9XA 3SJ8A 2OYUP 1K1NA 1AVGH 1D9IA 2AMDA 1K22H 4X2WA 2ZCLP 1C2KA 2A2QH 1IJQA 3A86A 4TWWA 6ESTA 1N1IA 1LHDH 4TY6A 4RRYA 1HAIH 4GHQA 3R3GB 3K2UA 1GGDB 4Y8XA 2SNWA 1SC8U 1XXFA 2GMTB 3RXRA 3Q77A 3P92A 4O03A 5AHGH 4D90A 4NIVA 4RS0A 2WPME 1O2YA 1VGCB 1A3EH 4FUHA 2QXGA 2P8OC 7KMEH 1HXFH 3Q3KA 3PLPA 2G81E 1FY8E 3BIVH 5DP4A 3SU1A 1ZYOA 2FLGA 3MH4A 1P2JA 1S6FA 1DXPA 2FTMA 3EA8A 1XUGA 1C4V2 1ORFA 1V2VT 1HJAC 1ZRKA 1KYNA 1V2KT 1TRNA 2VNTA 3M37A 1DIYA 3K6YA 2VWMA 1RS0A 2WYJA 4YOJA 5IYTA 1P9SA 1IQJL 1HJAB 3RXSA 3KN2A 4A92A 4ZKNU 3PGHA 3UIRA 1CA8B 2J34B 3FFGL 5JW1A 2TGDA 1IQHL 2ANYA 4DY7B 2BX3A 3UFAA 1FDPA 2BD5A 2B0FA 3LU9B 4FUFA 1MBMA 9LPRA 3KEEA 3SOBB 3TK6B 2UWLA 3SV9A 1TLEA 1D6RA 5HMAA 4MPUA 2HVXA 3A83A 1LKBA 3QN7A 5HM2A 1BHXB 3P8FA 2XC0L 1KLOA 1HX2A 4NZQA 4Y79A 3SV2H 4LORA 3KQEA 2ZHEH 2UUJB 4Z0KA 3RM0H 1G37A 1GI5A 3DHKH 2P3TA 4UDWH 3E16B 1TA2A 1C4Y2 1QHRB 2OC8A 1CU1A 1QA7A 2AH4X 1O30A 3SJ9A 3CFWA 2EI7B 2RDLA 1GCDA 1O36A 5L30H 1XM1A 1CA0C 4UE7H 1EP6A 3E8LA 1XUHA 1THRH 3TZIA 2PTNA 4B2CA 1WU1B 2ZHFH 3BTFE 1OX1A 1S6HA 1DLEA 1QY6A 4ZUHA 8KME2 4JYUL 4Y8YA 4ABAA 4B76A 1DM4B 5L2YH 4Y7BA 3MFJA 3MNXA 1MQ6A 1NC6A 3A7TA 1W11U 4R8TB 1AE5A 2XCNA 4Y71A 1YUKB 1JMOH 1F0UA 1N1LA 1C2DA 3SV7A 5DP6A 1ELFA 4CH8B 1DE7H 2G55A 1O2QA 2F9NA 1A5IA 1ELGA 2ZC9H 1W8BL 1QR3E 2ZDVH 3LC3B 4CREA 1IQIL 2FLRH 2HWLB 2TGTA 4NA9L 5DGJA 3LONA 1TALA 1S82A 2BQ6B 3A84A 1BCUH 1F7EA 2Z3EA 1IOXA 2BDYA 1F0SB 5DK1A 3ZZ8A 1Y3UA 4H6SB 1GBBA 5JBAS 1INCA 3GISX 1GI6A 1GL1A 1KLJL 3EA7A 1H9LB 3GY2A 3BEIB 1MKXK 1DUEA 2C8WB 5F03A 2ZDAH 1SGTA 2W2ME 1O3BA 2Y6TA 2RG3A 3KRKA 2ULLA 4CBNA 3TH3L 4MNWA 1GDQA 3U1IB 3GDUA 1IQNL 2WPJE 1P2IA 2GTBA 1VZQH 3PM3A 2ZWLH 4LXBH 1P03A 3SNAA 4MMYB 1S81A 4ZROA 3NKKA 2BLWA 4IC6A 4JMYA 3KHVA 2G52A 2BOUA 1AE8H 1N7DA 1J16A 1O38A 3TIUA 1TB6H 3ZZCA 1CGJE 4HFPB 2FPZA 2VWNA 1KLIH 3GCXE 3A8CA 2KAIB 4ESTE 1THPB 4X6PA 4A7IB 4E05H 2H5CA 2OQUA 3UNSA 2AMQA 4WMEA 1VITG 1A0JA 1WAYB 1EZXC 4I8LA 2Z3DA 4X8SH 2BDGA 2A7CA 1G1SA 2QXIA 2Z9GA 5AVDA 1C2HA 2FOHA 1MKXH 1IAUA 1L4DA 1YPJH 2Z9KA 3ZVFA 1IQGA 1IP0A 1V2MT 1BTXA 2D2DA 4YZUA 1NRNH 2J4IB 4MMXB 4K3JA 3PLBA 4NIXA 3RMMH 3N7OA 3A87A 1F0TA 3GCWE 1F5RA 4FUIA 3RXOA 4JZEL 5C20A 1YPLH 5JBBE 2ZQ1A 3F9FA 1RD3B 2J95A 1HV7A 3SU3A 1HZ8A 4FUCA 2LNCA 1DITH 3KQCA 3HO4A 4BTUA 4FUGA 4UEHH 3HO3A 4AFUA 3ZYEA 1UTQA 3T28A 1IQHA 3KQEL 3H7OA 4DVAU 2BLQA 3NK8A 4ZH8B 1L1NA 3KIDU 1K2I1 2ZTZA 3E90B 4X2YA 1EPHA 1MQ5A 2ZGHA 1LKAA 1MQ5L 4F49A 4GAWA 4E7RG 1LQEA 2RA0L 1J8AA 3GDVA 1QA0A 1DWCH 5JB8E 1BBRK 1V2PT 2XC0A 1C5VA 2AIPA 3NUMA 1IQLL 1CEJA 2ZI2H 2AS9A 3U9AH 2J38B 3LJOA 2V3OH 1DQBA 2Q6GA 2PV9B 3VXFH 3M7QA 3TH3H 3S9AA 1L1JA 1G3CA 2C90B 1B0FA 2F9UA 4IW4E 4LOYH 1MD8A 1HT8A 4WVPE 3BTDE 3L6PA 1A61H 5I46L 1GJ9B 2XBWL 4YZUB 1D3QB 1LPZA 1PJPA 4YT6H 1O2SA 5EW2H 2PTCE 1C1WH 1YF4A 5CKMA 3TLOA 5IDKA 1UTNA 1H9IE 2FTLE 3ENSB 1J15A 3LKWA 4I33A 1V2ST 4Y10E 1GK5A 3BTQE 3ZZ3A 1S83A 4KTUA 2DE8A 3MU1A 1MOXC 1HPGA 3A7XA 1GVLA 1CQQA 1MCVA 3P17H 3VGCC 1W8BH 2V0BA 4ISHL 1L3YA 5FPTA 2ZU2A 1O2WA 1FUJA 1OP2A 3PYHA 3RXMA 3NPSA 1QB1A 1OYTH 1M9UA 3K9XB 2XYAA 2XBXL 3PO1C 2BXTH 2Y5GA 1T8MA 1HB0B 1LQDB 4TWYA 2ILNA 1H9HE 1IGZA 1GDNA 1G36A 3I78A 1QURH 1UTLM 1GBKA 3TK5B 1NN6A 4GHTA 1FPHH 1VR1H 3N8WB 3BTKE 2J9NA 4CUEA 1C5NH 1HJ8A 1MU6B 5FAHA 4H4FA 1G1RA 2GDEH 1NRSH 1E36B 3M5NA 4VGCB 1JL9A 4CR5A 2K2SB 3RXGA 3Q3XA 3T5FH 3V0XA 2WFTA 1PFXL 4RRZA 2QIQA 3DT0H 1IOEL 3FANA 1G1QA 3OSYA 1NROH 1CX2A 2KB9A 1JRTA 5IKTA 2P3UB 1ZR0A 1A1RA 3U73A 5CKQA 2VU8E 2VIQA 3RXLA 3OLUA 4ISIL 4BTIB 2ODQA 9ESTA 3M3SA 1E34B 3FP6E 1BMLA 2A4QA 1FZZA 1V2JT 1ANBA 2AERH 5CISA 1TMBH 2FYQA 1LMWB 2SFAA 3URCA 2QF0A 1HRTH 2WYGB 2BQWB 1ELAA 1G3BA 3LT3A 5GCHG 2H5DA 3U98H 4RSPA 1GBDA 5G4BA 2H6MA 1EAIA 3EA9A 2BDAA 1EMNA 3SO3A 3P95A 4Y76A 4BDWA 1X7AC 3EDXB 1AO5A 3SW2B 3KQDL 1V2OT 2V35A 5EOKA 3KCGL 1ZSLA 3N8YA 1P2QA 1GI8B 1YGCL 2WPHE 1EMOA 1DUAA 5K7RA 2SGAA 1QL8A 1ARBA 1DSTA 1G2MA 2GZ8A 1MTNC 4OS4A 3SV6A 3C9AC 1EQGA 1MAYA 3FFGA 4BAMB 1TX7A 1ELBA 1L0ZA 2FOCA 1G32B 1NRPH 1SBWA 4RKJB 2CN0H 3T29A 2ZCHP 3A85A 2WINI 4AGJA 1BB0B 1K1OA 1W10U 2YOLA 5TJXA 3HK3B 5A8XA 4JYTA 5IKQA 3A7ZA 3QCWA 4YO9A 1HYLA 2Z9IA 4U32A 2P3TB 2RA0A 5ESTE 4JYVL 4U2WA 1Z71A 1C9PA 1PGEA 4WMFA 2ODYB 1BMAA 2TBSA 5A8YA 4OTJA 3KQBA 4XLWA 2UWPB 4BXSA 1O2TA 2Z9JA 2FOEA 4GSOA 2GCHG 2BYAX 2WFXB 1YPMH 2H9EH 1V3XB 1BRAA 4Q80A 1OKXA 1OYQA 2D8WA 4MVNA 2VJ1A 3V65B 5JB8S 1C5MF 2DDUA 4NA9H 4ABHA 1LPKA 2G00L 1E38B 1SHYA 4MNYA 2FP7B 1FAKH 3RMOH 5JBAE 4D8NA 1U6QA 4SGAE 4GCHF 2GP9B 1AFQB 3RDZA 1DSUA 2PSXA 3QZRA 5I46H 1GHWH 1GCTC 3RU4D 1ANDA 3W94A 3HO5A 3VFEA 4WMDA 2NU2E 3F9EA 2FO9A 2A5IA 1TPSA 1UMAH 4B75A 3MQEA 2CJIB 1BTWA 2BD4A 2FX6A 1Q31A 5FX5A 2ZPSA 1HJ7A 1O33A 5L30L 1FONA 4X1NU 3B9FH 4BAOB 3GICB 1T8LA 4PROA 1WYKA 1F0RB 4K2YA 2TGPZ 1VITH 4K1SA 4IN2A 1A5HA 1V2WT 3BF6H 1C1TA 3HS7A 1GMDF 3BG4C 4ABGA 1ELCA 2ANKH 4WH6A 4Z0LA 1Y8TA 1UTPA 4IS5A 1SLUB 4K5ZA 4O3UA 3TK9A 1EXFA 1NFWB 4Y8ZA 5GXPA 4YOIA 1P9JA 1E0FD 3S0NA 1ZOMA 1S85A 5GIBA 2J34A 4UFDH 3A80A 2PUQH 1TGBA 3LN1A 4I8JA 2G4UA 1GGDC 1TYNA 2PGBB 4NCYA 5C3NA 2G51A 3JZ2B 5JBBS 1O37A 1F7MA 2P16L 1RFNA 2WG3C 2W26B 3OLTA 1O0DH 1CHGA 5FCRA 1O2RA 3HPTB 1EB2A 2VVUL 2VB0A 3E3TA 2HPPH 2SGPE 1AIXH 3GYMA 4ISNA 5GJ4B 1QFKL 5A8ZA 1UVOA 2JKHA 3U8TH 4WXIA 1A4WH 1FN8A 2Y81A 1FE2A 1DWEH 2A4RA 2OCVB 3BN9A 2XC4L 1Q3XA 1GBJA 6GCHF 1TPAE 3ODDA 2VWNL 1JOUB 5HM9A 4XBMA 2VWLL 1KXFA 3MYWA 4YM9A 1O2JA 3SHCH 3M5MA 1PQ8A 1G9IE 4DGJA 1AD8H 1SMFE 1QJ6B 2ZNKH 1SGEE 1SLXB 2BD8A 2VWLA 5EXNA 2ZIQH 5E2OA 1IQFL 1MTWA 1BTUA 4DIIH 1A0LA 2QN5T 3SUFA 4CBOA 2BZAA 1RTLA 4BXWA 2B9LA 3ATLA 1NU9A 2P28B 2EA3A 2EI8A 4JK5A 1P2NA 1NPMA 3RC6A 1P09A 3AASA 3TGKE 4YT6L 3ENSA 2GD4A 1YYY1 2BOHB 2R2MB 1SQOA 1LO6A 1YC0A 2Y7XB 1P05A 3URDA 1NY22 4CH2B 2ZCKP 2HALA 2XTTB 2PLXA 2P59A 1QRWA 1UCYK 3HK6B 1O3CA 4UD9H 5F8XA 4AYYB 2ZTXA 2HNTF 1NRRH 1EGFA 2OINA 3ZYGA 4Y6DA 4X8TL 1JBUL 3ASIA 7GCHF 2BD9A 1GJDB 4XOJA 5GWZA 4ZAEA 3AAUA 3D49H 1TQ7B 2F9OA 2G5NA 3BG8A 1F92A 3VEQB 1HRFA 4KTCA 2ZFRH 7LPRA 3UR6A 1CQEA 2O8UA 2ALVA 2JH5D 1FY4A 1B7XB 1O3JA 3MNSA 2IJOB 3QLPH 4CUFA 1TX6A 2FIRH 5CHAB 1TMUH 1SVPA 1QCPA 2W3IA 1N8OC 1CGIE 3ZV9A 3C1KA 1PRHA 4KKDA 5DPAA 1COUA 1PPZA 4NIWA 2TRMA 2OYEP 3LGWA 3B23B 1YLCA 1EKBB 1O2KA 1P2OA 2XXLA 3ITIA 5FBIA 4NG9L 2OC7A 1EZQA 4DW2U 3SGBE 1HIAB 3P70B 3BTME 4D76A 2QV1A 1ZPZA 1C2JA 1B5GH 1HJ9A 2A2XH 3M5LA 1TRMA 1ZPCA 2P8OB 3SNBA 1SB1H 3KF2A 1PTHA 1C9TA 1TA6A 1P3EA 1FMGA 1KTTB 1SZBA 3PB1E 1GJ8B 5PTPA 2ANMH 2B7DL 1TAWA 1XKBA 1ESAA 6CHAC 4JZIA 4FU9A 1W2KH 2WPIE 2Y7ZA 3VPKA 1FQ3A 4XBDA 2ZQ2A 4E1GA 5F19A 1NESE 2OP9A 4X8UH 1H8IH 1ZTLA 1OWDA 3BSQA 5C1YA 4FUBA 2P3FL 3UOPA 1EQHA 2OUAA 2XC5A 1O31A 1GI1A 1MZDA 3SOQA 5JDUB 2FZZL 4E06H 1IQEA 2HRVA 1NZQH 4OGXA 1KIGH 1VITF 3SOSA 3GDSA 1O2LA 1P3CA 3M61U 1MQ6L 3MU0A 1GBCA 2TIOA 4UONA 4U01A 2VWOL 4YT7H 1GJCB 3U7UG 2J4IA 4DIHH 1T7CA 1QB9A 2RA3A 1W7XL 3RXDA 1Y3VA 1QRZA 3DA9B 1FXYA 3CS7A 3QK1A 5L2ZH 3RXEA 1SSXA 2PW8H 2O8TA 3LH1A 1JBUH 5JB9E 2Y5HA 2QF3A 1O3EA 5LPEA 1O3IA 2OC0A 1ID5H 1ACBE 1HAVB 2A5KA 3LIWB 3RXQA 1D3PB 1MTUA 2NPRA 1LVBA 1XKAC 1CVWH 1TNGA 2A32A 3WY8A 2PKAA 1NFWA 2WPLE 4ABIA 1FY5A 1F5KU 4O3TA 1WTGH 3DUXH 5FHTA 1A2CH 4JZ1A 1WV7H 2PFEA 2BD7A 1HAHH 3OTJE 3SNCA 2FI5E 2CHAC 3SU5A 1PPGE 5L6NH 1WTHD 1TNLA 4I32A 1EAUA 1RTKA 4Y7AA 2W2NE 3HS5A 1ZZZA 4XSKU 5J4SA 1ELVA 3C27B 1HAVA 2BY9X 1GJ6A 4BAKB 1DY9A 2ANWA 4VGCC 2G4TA 4ISLA 1UZJA 3FZZA 3STJA 2WPLS 1C1RA 4CRBA 1C2LA 2W7SA 1GBTA 1YPHC 2ZDKA 1PPEE 3A89A 1CVWL 4AGKA 4XE4A 3M36L 1O2UA 3GY8A 1OP8A 1BOQA 5A0CA 1Y5UT 1HGTH 2Y82A 4K8BA 5A2MH 2F91A 3SI3H 1HLTH 3SZNA 1GDUA 1DX5I 1F0SA 3TJUA 1OWHA 2O9QA 1YPKH 1A7SA 1CVUA 3PO1B 1SGIB 1TONA 2FOGA 1RXPA 3QZQA 2ZFTA 1YGCH 1MKWH 1LPKB 4YT7L 1KDQA 1ZSJA 4X6OA 3UNRA 1KTSB 5FDQA 1TGCA 1EAIC 2VGCC 2ZPRA 2AEIH 1JIRA 1TNKA 2PR3A 4IMZA 3SJKA 4BOHA 2ZDMA 1O3AA 3TGIE 2R0LA 4Q7ZA 1EBVA 1DT2A 3GY5A 4BTUB 3QDZB 1EP5A 1DFPA 1Z6JH 1O2MA 3PWCA 1SR5C 1DLKB 4JK6A 2K2TA 1C5SA 1GBFA 4Y71B 1XVMA 1LHFH 2I9AA 1SGPE 2FM2A 3HKJB 2TPIZ 1FN6A 1SLWB 1QRXA 1GMHG 4XBBA 3QGJA 1IQJA 4X1QU 1HXEH 5EQRA 4NSYA 1WQSA 4Q7XA 3SUGA 2IPHA 2BLVA 8LPRA 1ZMJA 2AGEX 1A5GH 3M37L 2C8ZB 3FP7E 5K0HB 3TITA 3KNXA 3BTTE 1C1PA 1HCGA 1GI4A 1WUNH 2HNTC 2XRCA 3A7YA 3ZZ6A 3RXKA 2W3IB 1O3NA 3MU5A 3IWMA 4O02B 4Q2KA 4BAQB 1GMDG 2BXUH 3A7VA 2VVVL 3RU4E 3MNCA 1CT0E 5EG4A 4A7IA 1OWJA 4SGBE 2G00A 5AFZH 5DO4H 4OGYA 1YKTA 3F6UL 3FBYA 1KSNA 3PMJA 1ESBA 1IQKA 1FLEE 4HTCH 2H9EL 2XBXA 5JPMH 3I77A 3RXVA 2SGFE 3BT1A 2ZU5A 4OTYA 2AGIX 3MU8A 4LZ4B 3CENL 2FI3E 2P3UA 2ZHDA 1U67A 1HAEA 5DJ7A 1SGCA 4OS5A 1ANCA 4AB9A 2ZECA 3FAOA 1IQEL 2Y5FA 2P93L 3ZVCA 1GMHF 1UVSH 2H9TH 4ZKRU 2BTCE 2FESH 1O5FH 5TCAA 2JETB 3EGKH 4MPXA 3P5BL 4B73A 1O5AB 1AUTL 3QX5H 2KL7A 4NWLA 1TLDA 4JZFL 4Y7AB 1WOFA 5HGGA 2RNLA 1GJAB 1IHSH 1LQDA 1S0QA 1TQ0B 1JWTA 2UUYA 4RN6A 3Q3KB 2J2UB 1C5PA 3M3TA 3TH4H 2Y5HL 1AFEH 3OU0A 1F2SE 6CHAB 3BTHE 3M35A 1DY8A 5C5OA 2JKHL 1AZZA 1GVKB 4BNRA 4D0EA 1NM6A 1PYTC 2W5EA 4WJG2 2FZZA 4X0WU 1GHXH 3FVFB 3P8OA 4ZHAB 2XC5L 1C1UH 2HGTH 1IQML 4I7YH 3SUEA 2JH6D 4M10A 3BEUA 3E0PB 1UK3A 4FUJA 3F9HA 1CE5A 2ZU1A 1O5CB 4D7GA 1C5XB 3Q76A 1VCQA 2VVCA 4NA7A 2GD4B 3O8CA 4C16A 1KIGL 1C2GA 1SFIA 1L2EA 4RRWA 4ABFA 5HXFA 3MDLA 4XBCA 1UTMA 2QAAA 1HAGE 1UVTH 1BJUA 1QBNA 3Q3YA 5CHAC 2VVUA 2FOBA 1O2XA 2CXVA 1EB1H 4WXVA 3GY3A 1CT2E 2WV4A 2A4OA 2QYIA 1RJXB 1OSSA 2XBVL 4PH9A 3ESTA 1A3PA 1O3GA 1ZHPA 3A82A 3SJOA 1KY9A 2ZFQH 1K1MA 5FXLA 4AFZA 4D9QA 1FJSL 3UQVA 3ZYDA 2ZHWH 4FU8A 1O3OA 3CS0A 1TOZA 2VIOA 5EPNA 2GDDA 1Z6EL 1AGJA 4INLA 3HATH 4NG9H 1CCFA 1J9CL 3F9GA 2JH0D 1OP0A 1LPZB 4ABEA 1IQGL 1RFNB 2FLBH 2OBOA 4CRFA 3EE0B 1QQ4A 3E1XB 1C5OH 4ZAEB 4I8GA 1AUJA 5E0JA 1HCGB 1GHBF 2CJIA 2WYJB 2RCEA 3UY9A 1B9WA 1GJBB 4RRXA 1EQ9A 3UOUA 3RXTA 3U8OH 4G1MB 3RMNH 1BRUP 3M3VA 3LGIA 3SJIA 3SGAE 1BBRH 1BZXE 1MH0A 1BF9A 1WHEA 3ZZ4A 1AVXA 1SGNE 4AG1A 1Z1IA 2VVCK 3MNBA 3NJPC 4MMZB 4HI3A 2ZO3H 2FYRA 2EI8B 4ZH8A 2BOKL 4ZXYL 4COXA 1FY1A 1XVOA 3PLKA 2ZPQA 2CV3A 4Y79B 2V3HH 1HAOH 4Y0ZE 3RUOA 1WQVH 5K0HA 2C8XB 3BTEE 3PMHB 3TVJB 1RIWB 1HT5A 2UWPA 1J14A 3ODFA 1IQKL 4YTAA 1SI5H 1BRBE 1O2PA 1LCYA 2C3SA 4Y6DB 2P93A 3TNSA 4QT8C 1UCYE 2FODA 1HFDA 2BVXH 4IC5A 3ATMA 4WWYA 3A81A 1G2MB 4TGFA 1GHBG 5JBTA 2CMYA 1FAXL 1QJ1B 5BRRE 5SGAE 1AB9C 2GV6A 1ATBA 3E91A 2ZGXH 3LDXH 1T31A 2ZKSA 4A1XA 1EUFA 1GPZA 2VH0A 3BTGE 3KL6A 2PR3B 2ADXA 1GCTB 2ZF0H 3TJVA 3VXEH 1ELDE 4RKOB 4JZEH 1NTPA 1IOEA 4I31A 5ETXA 3RXFA 1VJAU 1AFQC 1T8NA 1ZRBA 2XBWA 3AW1A 5ESBA 1G3DA 1Y3WA 5FPSA 2ZHQH 5A0AE 2OLGA 3PV4A 3SU6A 1HAXB 2F9PA 3LGYA 1D4PB 1XUFA 3GISB 1ETTH 1C1NA 2W86A 3GCNA 1LTOA 2H1UA 1NO9H 1QIXB 2XWBI 1O2GH 1A3BH 1PYTD 1PQ7A 5DP7A 3RXHA 5BPEA 5EQSA 2HLCA 2JETC 1GMCG 1OS8A 1DX5M 2TGFA 2F9VA 1I0UA 3MMGA 1TNHA 2FWWA 3FZDA 1KLIL 4LMFA 1FSBA 2STBE 1K21H 1ETRH 1HBTH 3A8AA 2LPRA 2A45B 2BDBA 4LZ1H 3UUZA 2R3YA 4CUDA 4GCHG 1ATEA 2XWAA 1QTFA 2RHPA 1TGNA 3BV9B 1TOCB 2AIQA 4Z6AL 3STIA 3RXBA 1MTNB 4AFQA 1ELEE 3HGNA 4NGAH 3RXJA 3N8XA 3GCHB 1PXXA 1WU1A 1DDXA 1YUGA 1OOKB 1Y3XA 1GBIA 1Q4GA 1T4UH 2BY7X 3SNEA 3ATIA 3ZZ9A 7ESTE 3UWIA 1HAPH 1ZJKA 3GCTF 4KELA 1NU7B 3A7WA 1C1SA 2BZ6H 1NFYA 1ZMNA 2GKVE 2O8MA 1SGFG 5JVYA 1LHGH 4AX9H 3NT1A 3A88A 4HGCA 3DEMA 5LGOA 1QNJA 1BTYA 4GUXA 1ABIH 1AN1E 2HPQH 5TCCA 4XFQA 1O3KA 2BY5X 1O2IA 2ZGJA 1MKWK 1W0ZU 1OWIA 1GHVH 2ZFFH 1O5DH 3A8DA 3LGTA 1DWBH 1APOA 3PROA 2FX4A 4MPWA 5FCKA 2GZ9A 3ATKA 2VINA 3P8NA 3OY5U 5CE1A 2OQ5A 4X1SU 1C5WB 1GBEA 1XDTR 3UPEA 2O8LA 4B2AA 1D6WA 1ZPBA 1LHCH 4M7GA 1QL9A 4DOQA 2BX4A 1PPFE 2R2WU 3OY6U 1NZIA 3U8RH 2BZ6L 2ZU4A 2Y7ZB 1NFUB 1HUTH 3ELAH 4J2YB 1C5RA 4OS6A 1BTPA 2AYWA 1MD7A 3BEFB 2ZTYA 2WG4B 2W3KB 2D1JA 2F9BH 1CSOE 1OPHB 2NU1E 2B5TB 1XKBC 3HKIB 2FXRA 1C2MA 1EATA 2BQ7A 1SFQB 2PSYA 4A5TS 2Y80B 1KXEA 2C4FH 3N8VA 1P2KA 1BUIA 1GBHA 1XKAL 2BB4A 1NFUA 4MLFB 5IKVA 1LVMA 1C5TA 1Z1JA 2P95L 1QB6A 1YBWA 3GY6A 5DP8A 2VWOA 3L33A 1ATDA 1O35A 1LDTT 4O9VA 3SU4A 1ZMLA 2R9PA 1UO6A 1UTOA 4MTBA 4B1TA 5JVZA 2P94L 1GI2A 4AORA 1LPGB 4AQTA 4X8UL 1EZUC 2P95A 3MO9A 5EPYA 2F83A 1GL0E 2Q6FA 4K69A 1BITA 4ISIH 2PUXB 5DKMA 1DOJA 1Z8RA 2GX4A 1G2LA 2D26C 2F3CE 1TX8A 5EGMB 3U69H 1QQUA 4GVUA 2BM2A 4IN1A 2CF8H 3SU0A 1DPOA 1BJVA 4TPYA 1GHYH 3ATWA 2VVVA 3LJJA 3SNDA 1K1JA 1P2MA 1YCPK 1CHOG 2EI6B 2J94B 1XUJA 3LH3A 3RLWH 1PQ5A 1UZPA 3RP2A 3PMAB 1EPTB 4H6TA 2PWXA 1AVWA 4A1TA 5T3HA 1XUIA 3TJNA 1PQAA 4X6NA 4D0FA 2BDIA 1AWFH 2WPJS 1MAXA 2P16A 1AMHA 4Y11E 2UWOA 2ZDLA 4F4OC 2I6SA 2Y7XA 2Z9LA 4CHAB 3NCLA 1UZQA 1K28D 1IQMA 1GI9B 1EX3A 2Y82B 1C2FA 4OS2A 5CKNA 3E6PH 1KXDA 2GGVB 1O3FA 4X8VH 2VIVA 3MH7A 2UUKB 1GWAA 1FFMA 1XMNB 4AN7A 1W14U 2MHPA 1Y3YA 1MCTA 2FD6A 1Y59T 4D7FA 2XW9A 4U30A 5EODA 1AI8H 1A0HB 3GYLB 2BDCA 2H2ZA 5F8TA 3ZZ5A 1CCVA 2ASUB 5CMXH 5ABWA 3S7KB 2NWNA 1TBZH 1MTSA 2QCYA 4FUEA 2F9BL 3D62A 5C1UA 1AZ8A 1THSH 4MG3A 2QA9E 5F8ZA 3LGVA 1G30B 2DE9A 3NZIA 1O3PB 2R0KA 3TJOA 2V6NA 1CHOF 1PFXC 1BA8B 3RXAA 1G2LB 1C5UA 3EGFA 3GY7A 5FX6A 1TE0A 3LC3A 1ZHMA 1KXAA 2QXJA 2J2UA 5C2ZA 3V3MA 3O8BA 2SNVA 3QMOA 4JZFH 4INKA 1LPGA 2PGQB 1ABJH 1V2QT 1NFXB 2WUBA 1W13U 2ZGCA 2OD3B 5EW1H 2A5AA 1C4U2 1VCWA 8ESTE 4CRAA 1IHTH 4FVDA 2CGAA 5EU8A 1UTJA 3HPTA 2FLBL 5I25A 5T6GA 1TIOA 4Z6AH 3AVZA 4THNH 4XL1A 1X7AL 3QO6A 1J9CH 2XC4A 2A7HA 2J95B 3QH0A 1NRQH 2W2QE 1AB9B 2J38A 4INHA 4Y7BB 1AKSB 4X1PU 6COXA 1GG6B 1N8OB 3NTGA 1SOTA 1O2HA 1NT1A 3G01A 2YGPA 1DVAH 2XBVA 3UR9A 3RR3A 1IVOC 1RRKA 2C8YB 4ZHMU 3U1JB 5T6FA 2BOKA 1V3XA 3T2NA 4O1ZA 1YPEH 4UFEH 2NU0E 4BANB 2ZP0H 3VB3A 1Y5BT 2P3FN 1YO8A 5LPFA 5L2ZL 1E35B 3ZYIB 1JIMA 1KDQB 1QJ7B 1RIWC 2B7DH 1ZGVA 1LVOA 4Z0KB 1K37A 2BLOA 4FM5A 5DG6A 2WPIS 3ZZDA 4K1TA 1DVAL 5KIRA 1MTVA 5COXA 5GPIB 2W2PE 3CENA 1NPEB 2BMGA 5E0HA 2AYLA 1AQ7A 2WV5A 3ZZ7A 3K6ZA 3SUDA 2G8TA 1YUFA 3PMBB 2A31A 3LGUA 5E2PA 3S9CA 2O8WA 1WCZA 1OWKA 1WSSH 2DUCA 4K60A 1TMTH 1O3MA 1FIZA 3KQCL 3CP7A 5JBCE 2ODPA 2K1QA 2FEQH 1BMNH 2WUCA 3ZVBA 3SBKA 1EOLA 2VH6B 3PTNA 2A7JA 3QTVH 1YCPH 4TY7A 1YCPM 2Q6DA 4RUTA 1UVPA 1CA0B 3SGQE 1W3CA 3S9BA 1NFYB 5GCHF 3MU4A 3GCHC 4D9RA 4BTIA 1FY3A 3P8GA 2YNAA 2Q1JA 1P0SL 3IG6B 4K8YA 4MDSA 1TWXB 2Z7FE 2G5VA 2ZZUH 1BTZA 1L5GB 1IQLA 4ZXYH 1GMCF 1ZJDA 2ZG0H 3D65E 3E0NB 1W12U 3T27A 3V13A 3VB5A 1TGTA 4DURA 1H8DH 1FIWA 1P8VC 3BIUH 2FOAA 1K1IA 2QY0B 1G3EA 3SW2A 4GPGA 3RLYH 2Y5GL 1TPOA 4Y76B 4IBLH 1K9OE 5GDSH 1KLJH 3N8WA 3N8YB 5T6DA 3TNTA 3KL6B 3TK5A 3LC5A 1EZSC 2P26A 1M1XB 1QBOA 1C5MD 1RTFB 4NA8A 1Z7KA 1K1LA 3MO3A 4ZHLU 1N6YA 1P11E 1GI7B 2J92A 2XNIA 5H4IB 3SQEE 1BRCE 4CR9A 1GG6C 1TBQH 1O2VA 1ZTJA 3A8BA 2GT8A 3EQ0H 3MOCA 2FLRL 1DICA 3V64C 4CSYA 1XUKA 4KTSA 1Z8GA 1O34A 1NT0A 3M5OA 1C2IA 2UWOB 3W95A 1EPTA 3BG4B 4NFEA 3VB6A 1C1OA 3EYDA 1O32A 2GZ7A 1BTHH 1WHFA 3MTYA 1FI8A 1YP9A 2GT7A 5E0GA 4NIYA 2VJ3A 3KCGH 1W7GH 4O97A 1O39A 1GBMA 1EJMA 5L2YL 2EEKA 2I6QA 1SQTA 1VGCC 4IMQA 2ESTE 1TOMH 3JZ1B 1MUEB 2IOTA 4ZXXH 2B8OH 1TPPA 1P57B 1U8CB 3ZZAA 1VCPA 3K65B 4DT7B 1BBRE 1T32A 4ZKOU 1T8OA 1EOJA 3F68H 1V6DA 5EGMA 1S0RA 1GHZA 1SLVB 4B71A 2FS9A 4MNXA 3SQHE 2I9BA 3TGFA 2NU4E 1IGXA 1ZHRA 2FDAA 2QC2A 1HIAA 3M36A 1F5LA 3ZV8A 4AYVB 1ANEA 4E7NA 2OXSA 1FNIA 4WF8A 3MH6A 1HAZB 1D3DB 2PUQL 1EZQB 1TABE 1TNIA 2MGRA 3KQBL 2BOXA 2GMTC 1UK4A 1HAFA 1YM0A 4GLYA 1UHBA 3MI4A 8GCHF 2Y80A 3RU4T 3ZVDA 5AFYH 3VB7A 3MWIU 1KSNB 4M11A 1LVYA 4J1YA 4YESB 1K1PA 4YOGA 3ZVAA 1GHAG 1GI0A 3TK6A 3RXUA 1C5YB 4BTTB 2CF9H 1DWDH 4HZHA
chains in the Genus database with same CATH superfamily
3FOAA 2BQ7B 4JCNA 4AOQA 1APQA 3HGPA 4F48B 5A09A 3MO6A 4KGAA 3SORA 1V2RT 4ZXXL 4BTTA 3ELAL 1TRYA 4LK4A 5C17A 4CHAC 1TGSZ 1O2OA 3IITA 3GOVB 1UHBB 1QGFA 1ETSH 3UWJH 1RGQA 4NWKA 1C1QA 2VIPA 4B2BA 3D23A 3V12A 4TYDA 4FUDA 2WPKE 1OHHD 1TPGA 1CT4E 2GCTC 4BDXA 2HOBA 4X2XA 1SPJA 1T4VH 5LPRA 1GHAF 1EJAA 4NZLA 2Z94A 1S5SA 2OTVA 1ADXA 6LPRA 1BMMH 5IKRA 3M7UA 4X8SL 1Y5AT 2FS8A 2BOHA 3IITB 1VJ9U 1HDTH 4RT0A 1P04A 1UZKA 1NFXA 1CBWC 3QWCH 4MQAA 2A4GA 3T25A 2BY6X 4XDEA 1SOZA 1Z8JB 5KN5C 2HNTE 5AF9H 1ARCA 2BD2A 3LTFB 1H8HD 2BO2A 5DP9A 3NTBA 1LMJA 1XFEA 3UNQA 3POYA 5HKKD 2IN2A 2ZA5A 1Z6CA 3TPIZ 1EAWA 1MMJN 2W7UA 1W0YH 1P01A 2KM0A 3VB4A 4JYVH 3F6UH 1G1TA 4JZDH 3S6XA 2ZDNA 1TFXA 2FOFA 4CRCA 1E1QD 1FPCH 1BQYA 2PHBA 4AFSA 4X8TH 3FCSB 3RC5A 1DDJA 1GVZA 4AG2A 1SQRA 1FAKL 2GVFA 1B0EA 2WPMS 1O2NA 2KAIA 7GCHG 5C5NA 1O5BB 2FOMB 1JXPA 1PPBH 4FXGH 1YLDA 5HIZA 1S6LA 2A0QB 3ZVGA 5DSFA 3T26A 4YLUA 1L1GA 2AFQB 1AY6H 2W26A 3F1SB 3HS6A 2WPKS 3MHWU 3QTOH 4OS1A 1H4WA 3LOXA 4A6LA 3Q7DA 3OYPA 3DD2H 4FVBA 3F2HA 1URKA 2WZPP 2PKSB 3CS7L 3GCOA 5FPYA 1GJ7B 1P10A 4OS7A 1Z8IB 3B8JA 3BPSE 2YMSD 1AUTC 2UUFB 4B74A 2BVSH 1DXWA 1IQFA 1ATAA 4YLQH 3EAJA 3R05A 1AHTH 1UJ1A 2FI4E 1F0RA 1MU8B 3TH2H 2CHAB 3UREA 1HREA 5EXMA 1DANH 1FJSA 4JYUH 3NXPA 4FU7A 2BQ6A 3S69A 2Y81B 4MPVA 1FV9A 1UK2A 4CRGA 2ZEBA 5A0BA 2VH6A 1V2TT 1GBLA 2EY4C 1FF7A 3S7HB 3LC5B 1IQNA 2AMPA 2ALPA 1UTKA 3LIWA 2ZFPH 1UCYH 1SL3A 2VH0B 1ZTKA 3DFLA 1ZAQA 2NU3E 2WZQA 3ZVEA 2XBYA 1N6XA 2VIWA 1KXBA 3KK6A 3LPRA 5C67A 1O2ZA 2GV7A 4H42U 4ASHA 1C5QA 2XCFA 2BVRH 2Z6BD 3T62A 2Z3CA 1YPGH 4X1RU 1SQAA 1OB1C 3OX7U 1EAXA 3I29A 1EPIA 2M74A 1ZGIA 4WY3A 4AZ2B 2BMGB 2Q1JB 2H9HA 1ZSKA 2EI7A 4ISHH 2STAE 1EPTC 1XX9A 1O5DL 2D1JB 1DS2E 2LP6A 2W3KA 3DFJA 3RXIA 4ABJA 2EI6A 2J94A 2VWMK 3MH5A 1QL7A 4MNVA 4R0IA 3SI4H 5F6MA 2BY8X 2QGRA 4GU3A 1LHEH 2YGOA 3AAVA 3VG8A 4I8KA 1Z6EA 1F7ZA 5JYIA 2UWLB 1OXGA 1P0SH 4B6EA 2M2AA 3Q00A 1SGQE 3PTBA 3M7TA 4X2VA 1UVUH 3L3TA 4ZKSU 1C1MA 1O5EH 4AC9A 4ACAA 3KQDA 4I86A 4Q7YA 4FOUC 3LN0A 2BHGA 3LAQA 3LTGD 2LELA 5HYOA 4ABDA 2WPHS 4BAHB 3KYGA 2GCHF 5FBEA 1C5ZB 3R0FA 1JRSA 3UTUH 5EQQA 1SGDE 2ZGBH 4UFGH 1O3LA 5DP3A 1V2NT 3O8DA 1J17T 1P9UA 2M5TA 1W7XH 2VGCB 2J5UA 2ZU3A 6GCHG 3QUMP 2KV4A 2A1DB 3PWBA 2SGQE 5J4QA 3AW0A 4DJZB 5JB9S 2ZFSA 2WHXA 3RXCA 2THFB 4K1EA 4X8VL 1O3HA 1C1VH 4CRDA 5B6OA 1SGRE 4A1VA 1XXDA 2PKSC 2OBQA 3IJEB 1EPGA 1YLNA 1V2LT 2KX4A 2C93B 1HAYB 1QBVH 1BHXF 1QFKH 3ZZBA 3SOVA 5JBCS 4I8HA 5EXLA 1CO7E 1GJ4H 1BDAA 5C0TA 2VIDA 2QXHA 3SHAH 2R3UA 1OWEA 3DCLA 1P06A 1AKSA 1Q2WA 1CGHA 2FMJA 2VBCA 1MZAA 1ELTA 1BIOA 4NGAL 1E37B 1C5LH 3N8ZA 3TGJE 1EPJA 1TBRH 5LH8A 1L4ZA 4AB8A 2KNIA 1P12E 5C1XA 2P94A 5C94A 3GCTG 1NS3A 1JV2B 2W2OE 1D3TB 1K36A 1FAXA 3VGCB 1H1BA 3BT2A 1GBAA 1CBWB 2BD3A 3SN8A 1WBGB 4KP0A 3ZIAD 2SGEE 4NSVA 2Y5FL 1PPHE 3CA7A 5E8DA 1ZLRA 1O5GH 4UFFH 4ISOA 2P3FH 1GI3A 3P6ZB 1O3DA 4IGDA 4DCDA 4Z1MD 4NFFA 4X6MA 3RMLH 3RXPA 2BQWA 2XBYL 2WYGA 3SZEA 8GCHG 1A46H 1HNEE 3GY4A 1IQIA 1AU8A 1NQLB 1GJ5H 2EC9H 3BTWE 2BDHA 3NWUA 4Y0YE 4ABBA 1SGYE 4DG4A 2PHBB 2Y38A 2TGAA 4ASUD 3SV8A 1EASA 3RM2H 1MBQA 2PKAB 4TPIZ 1TNJA 4ZHAA 2SGDE 5E8EH 1EJNA 1PPCE 2YNBA 3TU7H 3UQOA 3QGNB 4WH8A 3RC4A 3H5CB 3SU2A 5DP5A 1C2EA 1SG8B 3TBDA 1V2UT 1BT7A 3V7TA 2GCTB 1KXCA 3FP8E 5F1AA 1SGFA 2OC1A 3H7TA 2MGPA 1P02A 1S84A 1YPHE 3ZYJB 1KLTA 1AWHB 1ESTA 4ZMAH 2AGGX 3O8RA 4JZDL 1SHHB 3KGPA 2BSFA 3K9XA 3SJ8A 2KCPA 2BT8A 2OYUP 1K1NA 1AVGH 1D9IA 2AMDA 1K22H 4X2WA 2ZCLP 1C2KA 2A2QH 1IJQA 3A86A 4TWWA 6ESTA 1N1IA 1LHDH 2GJGA 2JIZD 4TY6A 4RRYA 1HAIH 4GHQA 3R3GB 3K2UA 1GGDB 3F2GA 4Y8XA 2SNWA 1SC8U 1XXFA 2GMTB 3RXRA 3Q77A 5T1VA 3P92A 4O03A 5AHGH 4D90A 4NIVA 4RS0A 2WPME 1O2YA 1VGCB 1A3EH 4FUHA 2QXGA 2P8OC 4M9FA 7KMEH 1HXFH 3Q3KA 3PLPA 2G81E 1FY8E 3BIVH 5DP4A 3SU1A 1ZYOA 2FLGA 3MH4A 1P2JA 1S6FA 1DXPA 2FTMA 3EA8A 1XUGA 3PV2A 1C4V2 4A94C 1ORFA 1V2VT 1HJAC 1ZRKA 3PRDA 1KYNA 1V2KT 1TRNA 2VNTA 3M37A 1DIYA 3K6YA 2VWMA 3F0PA 2W6JD 1RS0A 2WYJA 4YOJA 5IYTA 1P9SA 1IQJL 1HJAB 3RXSA 3KN2A 4A92A 4ZKNU 3PGHA 3UIRA 1CA8B 2J34B 3FFGL 5JW1A 2TGDA 1IQHL 2ANYA 4DY7B 2BX3A 3UFAA 1FDPA 2BD5A 2B0FA 1W0KD 3LU9B 4FUFA 1MBMA 9LPRA 3KEEA 3SOBB 3TK6B 2UWLA 3SV9A 1TLEA 3PRBA 1D6RA 5HMAA 4MPUA 2HVXA 3A83A 1LKBA 3QN7A 5HM2A 1BHXB 3P8FA 3EE7A 2XC0L 1KLOA 1HX2A 4NZQA 4Y79A 3SV2H 4LORA 1EFRD 3KQEA 2ZHEH 2UUJB 4Z0KA 3RM0H 1G37A 1GI5A 3DHKH 2P3TA 4UDWH 3E16B 1TA2A 1C4Y2 1QHRB 2OC8A 1CU1A 1QA7A 2AH4X 1O30A 3SJ9A 3CFWA 2EI7B 2RDLA 1GCDA 1O36A 5L30H 1XM1A 1CA0C 4UE7H 1EP6A 3E8LA 1XUHA 1THRH 3TZIA 2PTNA 4B2CA 1WU1B 2ZHFH 3BTFE 1OX1A 1S6HA 1DLEA 1QY6A 4ZUHA 8KME2 4JYUL 4Y8YA 4ABAA 4B76A 1DM4B 5L2YH 4Y7BA 3MFJA 3MNXA 1MQ6A 1NC6A 3A7TA 1W11U 4R8TB 1AE5A 2XCNA 3SYJA 4Y71A 1YUKB 1JMOH 1F0UA 1N1LA 1C2DA 3SV7A 5DP6A 1ELFA 4CH8B 1DE7H 2G55A 1O2QA 2F9NA 1A5IA 1ELGA 4Q4LA 2ZC9H 1W8BL 1QR3E 2ZDVH 3LC3B 4CREA 1IQIL 2FLRH 2HWLB 2TGTA 2OK5A 4NA9L 5DGJA 2XOKD 1TALA 3LONA 1S82A 2BQ6B 3A84A 1BCUH 1F7EA 2Z3EA 1IOXA 2BDYA 1F0SB 3OEED 5DK1A 3ZZ8A 1Y3UA 4H6SB 1GBBA 5JBAS 1INCA 3GISX 1GI6A 1GL1A 1KLJL 3EA7A 1H9LB 3GY2A 3BEIB 1MKXK 1DUEA 2C8WB 5F03A 2ZDAH 1SGTA 2W2ME 1O3BA 2Y6TA 2RG3A 3KRKA 2ULLA 4CBNA 3TH3L 4MNWA 1GDQA 3U1IB 3GDUA 1IQNL 2WPJE 1P2IA 2GTBA 1VZQH 3PM3A 2ZWLH 4LXBH 1P03A 3SNAA 4MMYB 1S81A 4ZROA 3NKKA 2BLWA 4IC6A 4JMYA 3KHVA 2G52A 3F0OA 4YXWD 2BOUA 2KCOA 1AE8H 1N7DA 1J16A 1O38A 3TIUA 1TB6H 3ZZCA 1CGJE 4HFPB 2FPZA 2VWNA 1KLIH 3GCXE 3A8CA 2KAIB 4ESTE 1THPB 4X6PA 4A7IB 4E05H 2H5CA 2OQUA 3UNSA 2HLDD 2AMQA 4WMEA 1VITG 1A0JA 1WAYB 1EZXC 4I8LA 2Z3DA 4X8SH 2BDGA 2A7CA 1G1SA 2RFKC 2QXIA 3H09A 2Z9GA 5AVDA 1C2HA 2FOHA 1MKXH 1IAUA 1L4DA 1YPJH 2Z9KA 3ZVFA 1IQGA 1IP0A 1V2MT 1BTXA 2D2DA 4YZUA 2L6OA 1NRNH 2J4IB 4MMXB 2HORA 3PLBA 4K3JA 4NIXA 3RMMH 3N7OA 3A87A 1F0TA 3GCWE 1F5RA 4FUIA 3RXOA 4JZEL 5C20A 1YPLH 5JBBE 2ZQ1A 3F9FA 1RD3B 2J95A 1HV7A 3SU3A 1HZ8A 4FUCA 2LNCA 1DITH 3KQCA 3HO4A 4BTUA 4FUGA 4UEHH 3HO3A 4AFUA 3ZYEA 1UTQA 3T28A 1IQHA 3KQEL 3H7OA 4DVAU 2BLQA 3NK8A 2IPQX 4ZH8B 1L1NA 3KIDU 1K2I1 2ZTZA 3E90B 4X2YA 1EPHA 1MQ5A 2ZGHA 1LKAA 1MQ5L 4F49A 4GAWA 4E7RG 1LQEA 2RA0L 1J8AA 3GDVA 1QA0A 2K8IA 1DWCH 5JB8E 1BBRK 1V2PT 2XC0A 1C5VA 2AIPA 3FKSD 3NUMA 1IQLL 1CEJA 2ZI2H 2AS9A 3U9AH 2J38B 3LJOA 2V3OH 1DQBA 2Q6GA 2PV9B 3VXFH 3M7QA 3TH3H 3S9AA 1L1JA 1G3CA 2C90B 1B0FA 2F9UA 4IW4E 4LOYH 1MD8A 1HT8A 4WVPE 3BTDE 3L6PA 1A61H 5I46L 1GJ9B 2XBWL 4YZUB 1D3QB 1LPZA 1PJPA 4YT6H 1O2SA 5EW2H 2PTCE 1C1WH 1YF4A 5CKMA 3TLOA 5IDKA 1UTNA 1H9IE 2FTLE 3ENSB 1J15A 3LKWA 4I33A 1V2ST 4Y10E 1GK5A 3BTQE 3ZZ3A 1S83A 4KTUA 2DE8A 3MU1A 1MOXC 1HPGA 3A7XA 1GVLA 1CQQA 1MCVA 3P17H 3VGCC 1W8BH 2V0BA 4ISHL 1L3YA 5FPTA 2ZU2A 1O2WA 1FUJA 1OP2A 3PYHA 3RXMA 3NPSA 1QB1A 1OYTH 1M9UA 3K9XB 2XYAA 2XBXL 3PO1C 2BXTH 2Y5GA 3DSPA 1T8MA 1HB0B 5IK2D 1LQDB 4TWYA 2ILNA 1H9HE 1IGZA 1GDNA 1G36A 3I78A 1QURH 1UTLM 1GBKA 3TK5B 1NN6A 4GHTA 1FPHH 1VR1H 3N8WB 3BTKE 2J9NA 4CUEA 1C5NH 1HJ8A 1LMMA 1MU6B 4H4FA 5FAHA 1G1RA 2GDEH 1NRSH 1E36B 3M5NA 4VGCB 1JL9A 4CR5A 2K2SB 3RXGA 3Q3XA 3T5FH 3V0XA 2WFTA 1PFXL 4RRZA 2QIQA 3DT0H 1IOEL 1LK9A 3FANA 1G1QA 3OSYA 1NROH 1CX2A 2KB9A 1JRTA 5IKTA 2P3UB 1ZR0A 1A1RA 3U73A 5CKQA 2VU8E 2VIQA 3RXLA 3OLUA 4ISIL 4BTIB 2ODQA 9ESTA 3M3SA 1E34B 3WWBA 3FP6E 1BMLA 2A4QA 1FZZA 1V2JT 1ANBA 2AERH 5CISA 1TMBH 2FYQA 1LMWB 2SFAA 3URCA 2QF0A 1HRTH 2WYGB 2BQWB 1ELAA 1G3BA 3LT3A 5GCHG 2H5DA 3U98H 4RSPA 1GBDA 5G4BA 2H6MA 1EAIA 3EA9A 2BDAA 1EMNA 3SO3A 3P95A 4Y76A 4BDWA 1X7AC 3EDXB 1AO5A 3SW2B 3KQDL 1V2OT 2V35A 5EOKA 3KCGL 1ZSLA 3N8YA 1P2QA 1GI8B 1YGCL 2WPHE 1EMOA 1DUAA 5K7RA 2SGAA 1QL8A 2F43B 1ARBA 1DSTA 1G2MA 2GZ8A 1MTNC 4OS4A 3SV6A 3C9AC 1EQGA 1MAYA 3FFGA 4BAMB 1TX7A 1ELBA 1L0ZA 2FOCA 1G32B 1NRPH 1SBWA 4RKJB 2CN0H 3T29A 2ZCHP 3A85A 2WINI 4AGJA 1BB0B 1K1OA 1W10U 2YOLA 5TJXA 3HK3B 5A8XA 4JYTA 5IKQA 3A7ZA 1K0HA 3QCWA 4YO9A 1HYLA 2Z9IA 4U32A 2P3TB 2RA0A 5ESTE 4JYVL 4U2WA 1Z71A 1C9PA 1PGEA 4WMFA 2ODYB 1BMAA 2TBSA 5A8YA 3W1EA 4OTJA 3KQBA 4XLWA 2UWPB 4BXSA 1O2TA 2Z9JA 2FOEA 4GSOA 2GCHG 2BYAX 2WFXB 1YPMH 2H9EH 1V3XB 1BRAA 4Q80A 1V1IA 1OKXA 1OYQA 2D8WA 4MVNA 2VJ1A 3V65B 5JB8S 1C5MF 2DDUA 4NA9H 4ABHA 2KFWA 1LPKA 2G00L 1E38B 1SHYA 4MNYA 2FP7B 1FAKH 3RMOH 5JBAE 4D8NA 1U6QA 4SGAE 4GCHF 1BMFD 1E79D 2GP9B 1AFQB 3RDZA 1DSUA 2PSXA 3QZRA 5I46H 1GHWH 1GCTC 3RU4D 1ANDA 3W94A 3HO5A 3VFEA 4WMDA 2NU2E 4GU4A 3F9EA 2FO9A 2A5IA 1TPSA 1UMAH 4B75A 3MQEA 1WDIA 2CJIB 1BTWA 2BD4A 2FX6A 1Q31A 1NBMD 5FX5A 2ZPSA 1HJ7A 1O33A 5L30L 1FONA 4X1NU 3B9FH 4BAOB 2KCAA 3GICB 1T8LA 4PROA 1WYKA 1F0RB 4K2YA 2TGPZ 1VITH 4K1SA 4IN2A 1A5HA 1V2WT 3BF6H 3F3BA 1C1TA 3HS7A 1GMDF 3BG4C 3U28C 1ELCA 2ANKH 4WH6A 4Z0LA 4FETA 1Y8TA 1UTPA 4IS5A 1SLUB 4K5ZA 4O3UA 3TK9A 1EXFA 1NFWB 1YY3A 4Y8ZA 5GXPA 4YOIA 1P9JA 1E0FD 3S0NA 1ZOMA 1S85A 5GIBA 2J34A 4UFDH 3A80A 2PUQH 1TGBA 3LN1A 4I8JA 2G4UA 1GGDC 1TYNA 2PGBB 4NCYA 5C3NA 2G51A 3JZ2B 5JBBS 1O37A 1F7MA 2P16L 4F55A 1RFNA 2WG3C 4ZCNA 2W26B 3OLTA 1O0DH 1CHGA 5FCRA 1O2RA 3HPTB 1EB2A 2VVUL 2VB0A 3E3TA 3CNRA 2HPPH 2SGPE 1AIXH 3GYMA 4ISNA 5HIYA 5F53A 5GJ4B 1QFKL 5A8ZA 1UVOA 5FL7D 2JKHA 3U8TH 4WXIA 1A4WH 1FN8A 2Y81A 1FE2A 1DWEH 2A4RA 2OCVB 3BN9A 2XC4L 1Q3XA 1GBJA 6GCHF 1TPAE 3ODDA 2VWNL 1JOUB 5HM9A 4XBMA 2VWLL 1KXFA 3MYWA 4YM9A 1O2JA 3SHCH 3M5MA 1PQ8A 1G9IE 4DGJA 1AD8H 1SMFE 1QJ6B 2ZNKH 1SGEE 1SLXB 2BD8A 2VWLA 5EXNA 2ZIQH 5E2OA 1IQFL 1MTWA 1BTUA 4DIIH 1A0LA 2QN5T 3SUFA 4CBOA 2BZAA 3AK5A 1RTLA 4BXWA 2B9LA 3ATLA 1NU9A 2P28B 2EA3A 4ABGA 2EI8A 4JK5A 1P2NA 1NPMA 3RC6A 2J97A 1P09A 3AASA 3TGKE 4YT6L 3ENSA 2GD4A 1YYY1 2BOHB 2R2MB 1SQOA 2WSSD 1LO6A 1YC0A 2Y7XB 1P05A 3OTPA 3URDA 1NY22 4CH2B 2ZCKP 2HALA 2XTTB 2PLXA 2P59A 1QRWA 1UCYK 3HK6B 1O3CA 4UD9H 5F8XA 4AYYB 2ZTXA 2HNTF 1NRRH 1EGFA 2OINA 3ZYGA 4Y6DA 4X8TL 1JBUL 3ASIA 7GCHF 2BD9A 1GJDB 4XOJA 5GWZA 4ZAEA 3AAUA 3D49H 1TQ7B 2F9OA 2G5NA 3BG8A 1F92A 3VEQB 4P00A 1HRFA 4KTCA 2ZFRH 1FX0B 7LPRA 3UR6A 1CQEA 2O8UA 2ALVA 1YWUA 2JH5D 1FY4A 1B7XB 1O3JA 3MNSA 2IJOB 3QLPH 4CUFA 1TX6A 2FIRH 5CHAB 1TMUH 1SVPA 1QCPA 2W3IA 1N8OC 1CGIE 3ZV9A 3C1KA 1PRHA 4KKDA 5DPAA 1COUA 1PPZA 4NIWA 2TRMA 2OYEP 3LGWA 3B23B 1YLCA 1EKBB 1O2KA 1P2OA 2XXLA 3ITIA 5FBIA 4NG9L 2OC7A 1EZQA 4DW2U 3SGBE 1HIAB 3P70B 3BTME 4D76A 2QV1A 1ZPZA 1C2JA 1B5GH 1HJ9A 2A2XH 3M5LA 1TRMA 1ZPCA 2J98B 2P8OB 3SNBA 1SB1H 3KF2A 1PTHA 1C9TA 1TA6A 1P3EA 1FMGA 1KTTB 1SZBA 3PB1E 1GJ8B 5PTPA 2ANMH 2B7DL 1TAWA 1XKBA 1ESAA 6CHAC 4JZIA 4FU9A 1W2KH 2WPIE 2Y7ZA 3VPKA 1FQ3A 4XBDA 2ZQ2A 4E1GA 5F19A 1NESE 2OP9A 4X8UH 1H8IH 1ZTLA 1OWDA 3BSQA 5C1YA 4FUBA 2P3FL 3UOPA 1EQHA 2OUAA 2XC5A 1O31A 1GI1A 1MZDA 4P02A 3SOQA 5JDUB 2FZZL 4E06H 1IQEA 2HRVA 1NZQH 4OGXA 1KIGH 1VITF 3SOSA 3GDSA 1O2LA 1P3CA 3M61U 1MQ6L 3MU0A 1GBCA 2TIOA 2XNDD 4UONA 2JJLA 2VWOL 4U01A 1GJCB 3U7UG 2J4IA 4YT7H 4DIHH 1T7CA 1QB9A 2RA3A 1W7XL 3RXDA 1Y3VA 1QRZA 3DA9B 1FXYA 3CS7A 3QK1A 5L2ZH 3RXEA 1SSXA 2PW8H 2O8TA 3LH1A 1JBUH 5JB9E 2Y5HA 2QF3A 1O3EA 5LPEA 1O3IA 2OC0A 1ID5H 1ACBE 1HAVB 2A5KA 3LIWB 3RXQA 1D3PB 1MTUA 2NPRA 1LVBA 1XKAC 3PV5A 1CVWH 1TNGA 2A32A 4B6FA 3WY8A 2PKAA 1NFWA 2VRSA 2WPLE 4ABIA 1FY5A 1F5KU 4O3TA 1WTGH 3DUXH 3F2FA 1A2CH 4JZ1A 5FHTA 1WV7H 2PFEA 2BD7A 1HAHH 3OTJE 3SNCA 2FI5E 2CHAC 3SU5A 1PPGE 5L6NH 1WTHD 1TNLA 4I32A 1EAUA 1RTKA 4Y7AA 2W2NE 3HS5A 1ZZZA 4XSKU 5J4SA 1ELVA 3C27B 1HAVA 2BY9X 1GJ6A 4BAKB 1DY9A 2ANWA 4VGCC 2G4TA 4ISLA 1UZJA 3FZZA 3STJA 2WPLS 1C1RA 1QIUA 4CRBA 1C2LA 2W7SA 1GBTA 1YPHC 2ZDKA 1PPEE 3A89A 1CVWL 4AGKA 4XE4A 3M36L 1O2UA 3GY8A 1OP8A 1BOQA 5A0CA 1Y5UT 1HGTH 2Y82A 4K8BA 5A2MH 2F91A 3SI3H 1HLTH 3SZNA 1GDUA 1DX5I 1F0SA 3TJUA 1OWHA 2O9QA 1YPKH 1A7SA 1CVUA 3PO1B 1SGIB 1TONA 2FOGA 1RXPA 3QZQA 3OFND 2ZFTA 1YGCH 1MKWH 1LPKB 4YT7L 1KDQA 1ZSJA 4X6OA 2IJD1 3UNRA 1KTSB 5FDQA 1TGCA 1EAIC 2VGCC 2ZPRA 2WV9A 2AEIH 1JIRA 1TNKA 2PR3A 4IMZA 3SJKA 4BOHA 2ZDMA 1O3AA 3TGIE 2R0LA 4Q7ZA 1EBVA 1DT2A 3GY5A 4BTUB 3QDZB 3N7EA 1EP5A 1DFPA 1Z6JH 1O2MA 3PWCA 1SR5C 1DLKB 4JK6A 2K2TA 1C5SA 1GBFA 4Y71B 5KEDA 1XVMA 1LHFH 2I9AA 2BT7A 1SGPE 2FM2A 3HKJB 2TPIZ 1FN6A 1SLWB 1QRXA 1GMHG 4XBBA 3QGJA 1IQJA 4X1QU 1HXEH 5EQRA 4NSYA 1WQSA 4Q7XA 3SUGA 2IPHA 2BLVA 8LPRA 1ZMJA 2AGEX 1A5GH 3M37L 2C8ZB 3FP7E 5K0HB 3TITA 3KNXA 3BTTE 1C1PA 1HCGA 1GI4A 1WUNH 2HNTC 2XRCA 3A7YA 3ZZ6A 3RXKA 2W3IB 1O3NA 3MU5A 3IWMA 4O02B 4Q2KA 4BAQB 1GMDG 2BXUH 3A7VA 2VVVL 3RU4E 3MNCA 1CT0E 5EG4A 4A7IA 1OWJA 3WW7A 4SGBE 2G00A 5AFZH 5DO4H 4OGYA 1YKTA 3F6UL 3FBYA 1KSNA 2HVYB 3PMJA 1ESBA 1IQKA 1FLEE 4HTCH 2H9EL 2XBXA 5JPMH 3I77A 3RXVA 2SGFE 3BT1A 2ZU5A 4OTYA 2AGIX 3MU8A 4LZ4B 3CENL 2FI3E 2P3UA 2ZHDA 1U67A 1HAEA 5DJ7A 1SGCA 4OS5A 1ANCA 4AB9A 2ZECA 3FAOA 1IQEL 2Y5FA 2P93L 3ZVCA 1GMHF 1UVSH 2H9TH 1QZ8A 4ZKRU 2BTCE 2FESH 2HOXA 1O5FH 2YMSC 2JETB 3EGKH 5TCAA 4HG6A 2F4LA 4MPXA 3P5BL 4B73A 1O5AB 1AUTL 3QX5H 2KL7A 4NWLA 1TLDA 4JZFL 4Y7AB 1WOFA 5HGGA 2RNLA 1GJAB 1IHSH 1LQDA 1S0QA 1TQ0B 1JWTA 2UUYA 4RN6A 3Q3KB 2J2UB 1C5PA 1SKYE 3M3TA 3TH4H 2Y5HL 1AFEH 3OU0A 1F2SE 6CHAB 3BTHE 3M35A 1DY8A 5C5OA 2JKHL 1AZZA 1GVKB 4XRNA 4BNRA 4D0EA 1NM6A 1PYTC 2W5EA 4WJG2 2FZZA 1MABB 4X0WU 1GHXH 3FVFB 3P8OA 4ZHAB 2XC5L 1C1UH 2HGTH 1IQML 4I7YH 3SUEA 2JH6D 4M10A 3BEUA 3E0PB 1UK3A 4FUJA 3F9HA 1CE5A 2ZU1A 1O5CB 4D7GA 1C5XB 3Q76A 1VCQA 2VVCA 4NA7A 2GD4B 3O8CA 4C16A 1KIGL 1C2GA 1SFIA 2YGQA 1L2EA 4RRWA 4ABFA 5HXFA 3MDLA 4XBCA 1UTMA 2QAAA 1HAGE 1UVTH 2PP6A 1BJUA 1QBNA 3Q3YA 2JJ1D 5CHAC 2VVUA 2FOBA 2JJ2D 1O2XA 2CXVA 3WWFA 1EB1H 4WXVA 3GY3A 1CT2E 2WV4A 2A4OA 2QYIA 1RJXB 1OSSA 2XBVL 4PH9A 3ESTA 1A3PA 1O3GA 1ZHPA 3A82A 2KCYA 3SJOA 1KY9A 2ZFQH 2H9EC 1K1MA 5FXLA 4AFZA 4D9QA 1FJSL 3UQVA 3ZYDA 2ZHWH 4FU8A 2EQNA 3DSOA 1O3OA 3CS0A 1TOZA 1E1RD 2VIOA 5EPNA 2GDDA 2J98A 1Z6EL 1AGJA 4INLA 3HATH 4NG9H 1CCFA 1J9CL 3F9GA 2JH0D 1OP0A 1LPZB 4ABEA 1IQGL 1RFNB 5CDFE 2FLBH 2OBOA 4CRFA 3EE0B 1QQ4A 3E1XB 1C5OH 2JDID 4ZAEB 4I8GA 1AUJA 5E0JA 1HCGB 1GHBF 2CJIA 2WYJB 2RCEA 3UY9A 1B9WA 1GJBB 4RRXA 1EQ9A 3UOUA 3RXTA 3U8OH 4G1MB 3RMNH 1BRUP 3M3VA 3LGIA 3SJIA 3SGAE 1BBRH 2QF5A 1BZXE 1MH0A 1BF9A 1WHEA 3ZZ4A 1AVXA 1SGNE 4AG1A 1Z1IA 2VVCK 3MNBA 3NJPC 4MMZB 4HI3A 2ZO3H 3OEHD 2FYRA 2EI8B 4ZH8A 2BOKL 4ZXYL 4COXA 1FY1A 1XVOA 3PLKA 2ZPQA 2CV3A 4Y79B 2V3HH 1HAOH 4Y0ZE 3RUOA 1WQVH 5K0HA 2C8XB 3BTEE 3PMHB 3TVJB 1RIWB 1HT5A 2UWPA 1J14A 3ODFA 1IQKL 4YTAA 1SI5H 1BRBE 1O2PA 1LCYA 2C3SA 4Y6DB 2P93A 3TNSA 4QT8C 1UCYE 2FODA 5DN6D 1HFDA 2BVXH 4IC5A 3ATMA 4WWYA 3A81A 1KMHB 1G2MB 5KECA 4TGFA 1GHBG 5JBTA 2CMYA 1FAXL 1QJ1B 5BRRE 5SGAE 1AB9C 2GV6A 1ATBA 3E91A 2ZGXH 3LDXH 1T31A 2ZKSA 4A1XA 1EUFA 1GPZA 2VH0A 3BTGE 4ACBA 3KL6A 2PR3B 2ADXA 1GCTB 2ZF0H 3TJVA 5EIYA 3VXEH 1ELDE 4RKOB 4JZEH 1NTPA 1IOEA 4I31A 5ETXA 3RXFA 1VJAU 1AFQC 1T8NA 1ZRBA 2XBWA 3AW1A 5ESBA 1G3DA 1Y3WA 5FPSA 2ZHQH 5A0AE 2OLGA 3PV4A 3SU6A 1HAXB 2F9PA 3LGYA 1D4PB 1XUFA 3GISB 3MQKC 1ETTH 1C1NA 5EJLA 2W86A 3GCNA 1LTOA 2H1UA 1NO9H 1QIXB 2XWBI 1O2GH 1A3BH 1PYTD 1PQ7A 5DP7A 3RXHA 5BPEA 5EQSA 2HLCA 2JETC 1GMCG 1OS8A 1DX5M 2TGFA 2F9VA 1I0UA 3MMGA 1TNHA 2FWWA 3FZDA 1KLIL 4LMFA 1FSBA 2STBE 1K21H 1KKEA 1ETRH 4TT3D 1HBTH 3KYFA 3A8AA 2LPRA 2A45B 2BDBA 4LZ1H 3UUZA 2R3YA 4CUDA 4GCHG 1ATEA 2XWAA 1QTFA 2RHPA 1TGNA 3BV9B 1TOCB 2AIQA 4Z6AL 3STIA 3RXBA 1MTNB 4AFQA 1ELEE 3HGNA 4NGAH 2QF4A 3RXJA 3N8XA 3GCHB 1PXXA 1WU1A 1DDXA 1YUGA 5CHBA 1OOKB 1Y3XA 1GBIA 1Q4GA 1T4UH 2BY7X 3SNEA 3ATIA 3ZZ9A 7ESTE 3UWIA 1HAPH 1ZJKA 3GCTF 4KELA 1NU7B 3A7WA 1C1SA 2BZ6H 1NFYA 1ZMNA 2GKVE 2O8MA 1SGFG 5JVYA 1LHGH 4AX9H 3NT1A 3A88A 4HGCA 3DEMA 5LGOA 1QNJA 1BTYA 4GUXA 1ABIH 3OE7D 1AN1E 2HPQH 2WPDD 4XFQA 5TCCA 1O3KA 2BY5X 1O2IA 2ZGJA 1MKWK 1W0ZU 1OWIA 1GHVH 2ZFFH 1O5DH 2V3MA 3A8DA 3LGTA 1DWBH 1APOA 3PROA 2FX4A 4MPWA 5FCKA 2GZ9A 3ATKA 2VINA 3P8NA 3OY5U 5CE1A 2KR7A 2OQ5A 4X1SU 1C5WB 1GBEA 1XDTR 3UPEA 2O8LA 4B2AA 1D6WA 1ZPBA 1LHCH 4M7GA 2AHME 1QL9A 4DOQA 2BX4A 1PPFE 2R2WU 3OY6U 1NZIA 3U8RH 2BZ6L 2ZU4A 2Y7ZB 1NFUB 1HUTH 3ELAH 4J2YB 1C5RA 3UAIC 4OS6A 1BTPA 2AYWA 1MD7A 3BEFB 2ZTYA 2WG4B 2W3KB 2D1JA 3NRLA 2F9BH 1CSOE 1OPHB 2NU1E 2B5TB 1XKBC 3HKIB 2FXRA 3N7DA 1C2MA 1EATA 2BQ7A 1SFQB 2PSYA 4A5TS 2Y80B 1KXEA 2C4FH 2W6ID 3N8VA 1P2KA 1BUIA 1GBHA 1WXRA 1XKAL 2BB4A 1NFUA 4MLFB 5IKVA 1LVMA 1C5TA 1Z1JA 2P95L 1QB6A 1YBWA 1VKYA 3GY6A 5DP8A 2VWOA 3L33A 1ATDA 1O35A 1LDTT 4O9VA 3SU4A 1ZMLA 2R9PA 1UO6A 1UTOA 4MTBA 4B1TA 5JVZA 2P94L 1GI2A 4AORA 1LPGB 4AQTA 4X8UL 1EZUC 2P95A 3MO9A 5EPYA 2F83A 1GL0E 4RT1A 2Q6FA 4K69A 1BITA 4ISIH 2PUXB 5DKMA 1DOJA 1Z8RA 2GX4A 1G2LA 2D26C 2F3CE 1TX8A 5EGMB 3U69H 1QQUA 4GVUA 2BM2A 4IN1A 4TSFD 2CF8H 3SU0A 1DPOA 1BJVA 4TPYA 1GHYH 2YMSB 3ATWA 5EJ1A 2VVVA 3LJJA 3OAAD 3SNDA 1K1JA 1P2MA 1YCPK 5C0UA 1CHOG 2EI6B 2J94B 1XUJA 3LH3A 3RLWH 1PQ5A 2KZ4A 1UZPA 3RP2A 3PMAB 1EPTB 4H6TA 2PWXA 1AVWA 4A1TA 5T3HA 1XUIA 3TJNA 1PQAA 4X6NA 4D0FA 2BDIA 1AWFH 2WPJS 1MAXA 2P16A 1AMHA 2V7QD 4Y11E 2UWOA 2ZDLA 4F4OC 2I6SA 2Y7XA 2Z9LA 4CHAB 3NCLA 1UZQA 1K28D 1IQMA 1GI9B 1EX3A 2Y82B 1C2FA 4OS2A 5CKNA 5EJZA 3E6PH 1KXDA 2GGVB 1O3FA 4X8VH 2VIVA 3MH7A 2UUKB 1GWAA 1FFMA 1XMNB 4AN7A 1W14U 2MHPA 1Y3YA 1MCTA 2FD6A 1Y59T 4D7FA 2XW9A 4U30A 5EODA 1AI8H 1A0HB 3GYLB 2BDCA 2H2ZA 5F8TA 3ZZ5A 1CCVA 2ASUB 5CMXH 5ABWA 3S7KB 2NWNA 1TBZH 1MTSA 2QCYA 4FUEA 2F9BL 3D62A 4RI0A 1AZ8A 1UW7A 1THSH 5C1UA 4MG3A 2QA9E 2RDEA 5F8ZA 3LGVA 1G30B 2DE9A 3NZIA 1O3PB 2R0KA 3TJOA 2V6NA 1CHOF 1PFXC 1BA8B 3RXAA 1G2LB 1C5UA 3EGFA 3GY7A 5FX6A 1TE0A 3LC3A 1ZHMA 1KXAA 2QXJA 2J2UA 5C2ZA 3V3MA 4DT4A 3O8BA 2SNVA 3QMOA 4JZFH 4INKA 1LPGA 2PGQB 1ABJH 1V2QT 1NFXB 1COWD 2WUBA 1W13U 2ZGCA 2OD3B 5EW1H 2A5AA 1C4U2 1VCWA 8ESTE 4CRAA 1IHTH 4FVDA 2CGAA 5EU8A 1UTJA 3HPTA 2FLBL 5I25A 5T6GA 1TIOA 4Z6AH 3AVZA 4THNH 4XL1A 1W0JD 1X7AL 3QO6A 1J9CH 2XC4A 2A7HA 2J95B 3QH0A 1NRQH 3KQ5A 2W2QE 1AB9B 2J38A 4INHA 4Y7BB 1AKSB 4X1PU 6COXA 1GG6B 1N8OB 3NTGA 1SOTA 1O2HA 1NT1A 3G01A 2YGPA 1DVAH 2XBVA 3UR9A 3RR3A 1IVOC 1RRKA 2C8YB 4ZHMU 3U1JB 5T6FA 2BOKA 1V3XA 3T2NA 4O1ZA 1NBME 1YPEH 4UFEH 2NU0E 4BANB 2ZP0H 3VB3A 1Y5BT 2P3FN 1YO8A 5LPFA 5L2ZL 1E35B 3ZYIB 1JIMA 1KDQB 1QJ7B 1RIWC 2B7DH 1ZGVA 1LVOA 2K0QA 4Z0KB 1K37A 2BLOA 4FM5A 5GNDA 5DG6A 2WPIS 3ZZDA 4K1TA 1DVAL 5KIRA 1MTVA 5COXA 5GPIB 2W2PE 3CENA 1NPEB 2BMGA 5E0HA 2AYLA 1AQ7A 2WV5A 3ZZ7A 3K6ZA 3SUDA 2G8TA 1YUFA 3PMBB 2A31A 3LGUA 5E2PA 3S9CA 2O8WA 1WCZA 1OWKA 1WSSH 2DUCA 4K60A 1TMTH 1O3MA 1FIZA 1H8ED 3KQCL 3CP7A 5JBCE 2ODPA 4OM9A 2K1QA 2FEQH 1BMNH 2WUCA 3ZVBA 3SBKA 1EOLA 2VH6B 3PTNA 2A7JA 3QTVH 1YCPH 4TY7A 1YCPM 2Q6DA 4RUTA 1UVPA 1CA0B 3SGQE 1W3CA 3S9BA 1NFYB 5GCHF 3MU4A 3GCHC 4D9RA 4BTIA 1FY3A 3P8GA 2YNAA 2Q1JA 1P0SL 3IG6B 4K8YA 4MDSA 1TWXB 2Z7FE 2G5VA 2ZZUH 1BTZA 1L5GB 1IQLA 4ZXYH 1GMCF 1ZJDA 2ZG0H 3D65E 3E0NB 1W12U 3T27A 3V13A 3VB5A 1TGTA 4DURA 1H8DH 1FIWA 1P8VC 3BIUH 2FOAA 1K1IA 2QY0B 1G3EA 3SW2A 4GPGA 3RLYH 2Y5GL 1TPOA 4Y76B 4IBLH 1K9OE 5GDSH 1KLJH 3N8WA 3N8YB 5T6DA 3TNTA 3KL6B 3TK5A 3LC5A 1EZSC 2P26A 1M1XB 1QBOA 1C5MD 1RTFB 2CK3D 3FO8D 4NA8A 1Z7KA 1K1LA 3MO3A 3UB0A 4ZHLU 1N6YA 1P11E 5KGOA 1GI7B 2J92A 2XNIA 5H4IB 3SQEE 1BRCE 3GS9A 4CR9A 1GG6C 1TBQH 1O2VA 1ZTJA 3A8BA 2GT8A 3EQ0H 3MOCA 2FLRL 1DICA 3V64C 4CSYA 1XUKA 4KTSA 1Z8GA 1O34A 1NT0A 3M5OA 1C2IA 2UWOB 3W95A 1EPTA 3BG4B 3N99A 4NFEA 3VB6A 1C1OA 3EYDA 1O32A 2GZ7A 1BTHH 1WHFA 3MTYA 1FI8A 1YP9A 2GT7A 5E0GA 4NIYA 2VJ3A 3KCGH 1W7GH 4O97A 1O39A 1GBMA 1EJMA 5L2YL 2EEKA 2I6QA 1SQTA 1VGCC 4IMQA 2ESTE 1TOMH 3JZ1B 1MUEB 2IOTA 4ZXXH 2B8OH 1TPPA 1P57B 1U8CB 3ZZAA 1VCPA 3K65B 4DT7B 1BBRE 1T32A 4ZKOU 1T8OA 1EOJA 3F68H 1V6DA 5EGMA 1S0RA 4XD7D 1GHZA 1SLVB 4B71A 3DSGA 2FS9A 2L74A 4MNXA 3SQHE 2I9BA 3TGFA 2NU4E 1IGXA 1ZHRA 2FDAA 2QC2A 1HIAA 3M36A 1F5LA 3ZV8A 4AYVB 1ANEA 3FN8A 2OXSA 4E7NA 1FNIA 4WF8A 3MH6A 1HAZB 1D3DB 2PUQL 2QE7D 1EZQB 1TABE 1TNIA 2MGRA 3KQBL 2BOXA 2GMTC 1UK4A 1HAFA 1YM0A 4GLYA 1UHBA 3MI4A 8GCHF 1V1HA 2Y80A 4Q63A 3RU4T 3ZVDA 5AFYH 3VB7A 3MWIU 1KSNB 4M11A 1LVYA 4J1YA 4YESB 1K1PA 5B6LA 4YOGA 3ZVAA 1GHAG 1GI0A 3TK6A 3RXUA 1C5YB 4BTTB 2CF9H 1DWDH 4HZHA
chains in the Genus database with same CATH topology
2BQ7B 4JCNA 4AOQA 1APQA 3HGPA 5A09A 3MO6A 4KGAA 3SORA 1V2RT 4ZXXL 4BTTA 3ELAL 1TRYA 4LK4A 4CHAC 1TGSZ 1O2OA 3IITA 3GOVB 1UHBB 1QGFA 1ETSH 3UWJH 1RGQA 4NWKA 1C1QA 2VIPA 4B2BA 3D23A 3V12A 4TYDA 4FUDA 2WPKE 1TPGA 1CT4E 2GCTC 4BDXA 2HOBA 4X2XA 1SPJA 1T4VH 5LPRA 1GHAF 1EJAA 4NZLA 2Z94A 1S5SA 2OTVA 1ADXA 6LPRA 1BMMH 5IKRA 3M7UA 4X8SL 1Y5AT 2FS8A 2BOHA 3IITB 1VJ9U 1HDTH 1P04A 1UZKA 1NFXA 1CBWC 3QWCH 4MQAA 2A4GA 3T25A 2BY6X 4XDEA 1SOZA 1Z8JB 5KN5C 2HNTE 5AF9H 1ARCA 2BD2A 3LTFB 2BO2A 5DP9A 3NTBA 1LMJA 1XFEA 3UNQA 3POYA 2IN2A 2ZA5A 1Z6CA 3TPIZ 1EAWA 1MMJN 2W7UA 1W0YH 1P01A 3VB4A 4JYVH 3F6UH 1G1TA 4JZDH 3S6XA 2ZDNA 1TFXA 2FOFA 4CRCA 1FPCH 1BQYA 2PHBA 4AFSA 4X8TH 3FCSB 3RC5A 1DDJA 1GVZA 4AG2A 1FAKL 2GVFA 1B0EA 2WPMS 1O2NA 2KAIA 7GCHG 5C5NA 1O5BB 2FOMB 1JXPA 1PPBH 4FXGH 1YLDA 2A0QB 3ZVGA 3T26A 4YLUA 1L1GA 2AFQB 1AY6H 2W26A 3F1SB 3HS6A 2WPKS 3MHWU 3QTOH 4OS1A 1H4WA 3LOXA 4A6LA 3Q7DA 3OYPA 3DD2H 4FVBA 1URKA 2WZPP 2PKSB 3CS7L 3GCOA 5FPYA 1GJ7B 1P10A 4OS7A 1Z8IB 3B8JA 3BPSE 1AUTC 2UUFB 4B74A 2BVSH 1DXWA 1IQFA 1ATAA 4YLQH 3EAJA 3R05A 1AHTH 1UJ1A 2FI4E 1F0RA 1MU8B 3TH2H 2CHAB 3UREA 1HREA 5EXMA 1DANH 1FJSA 4JYUH 3NXPA 4FU7A 2BQ6A 3S69A 2Y81B 4MPVA 1FV9A 1UK2A 4CRGA 2ZEBA 5A0BA 2VH6A 1V2TT 1GBLA 1FF7A 3S7HB 3LC5B 1IQNA 2AMPA 2ALPA 1UTKA 3LIWA 2ZFPH 1UCYH 1SL3A 2VH0B 1ZTKA 3DFLA 1ZAQA 2NU3E 3ZVEA 2XBYA 1N6XA 2VIWA 1KXBA 3KK6A 3LPRA 5C67A 1O2ZA 2GV7A 4H42U 4ASHA 1C5QA 2XCFA 2BVRH 2Z6BD 3T62A 2Z3CA 1YPGH 4X1RU 1SQAA 1OB1C 3OX7U 1EAXA 3I29A 1EPIA 2M74A 1ZGIA 4WY3A 4AZ2B 2BMGB 2Q1JB 2H9HA 1ZSKA 2EI7A 4ISHH 2STAE 1EPTC 1XX9A 1O5DL 2D1JB 1DS2E 2W3KA 3DFJA 3RXIA 4ABJA 2EI6A 2J94A 2VWMK 3MH5A 1QL7A 4MNVA 4R0IA 3SI4H 5F6MA 2BY8X 2QGRA 1LHEH 2YGOA 3AAVA 4I8KA 1Z6EA 1F7ZA 5JYIA 2UWLB 1OXGA 1P0SH 3Q00A 1SGQE 3PTBA 3M7TA 4X2VA