4BXSA

Crystal structure of the prothrombinase complex from the venom of pseudonaja textilis
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
326
structure length
248
Chain Sequence
KSCRVDNGNCWHFCKHVQNDIQCSCAEGYLLGEDGHSCVAGGNFSCGRNIKMDCKLGECPWQAALVDEKEGVFCGGTILSPIYVLTAAHCINETETISGEIDKLSVDKIYVHKKFVPPQKAYKFDLAAYDYDIAIIQMKTPIQFVPACLPTADFANQVLMKQDFGIVSGFKSKTLKVLKVPYVDRHTCMVSSETPITPNMFCADSGGPHTTVYRDTHFITGIVSSGKYGNYTKLSKFIPWIKRIMRQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the Prothrombinase Complex from the Venom of Pseudonaja Textilis.
pubmed doi rcsb
source organism Pseudonaja textilis
molecule tags Blood clotting
molecule keywords FACTOR X-LIKE PROTEASE
total genus 37
structure length 248
sequence length 326
ec nomenclature
pdb deposition date 2013-07-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00008 EGF EGF-like domain
A PF00089 Trypsin Trypsin
A PF00594 Gla Vitamin K-dependent carboxylation/gamma-carboxyglutamic (GLA) domain
A PF14670 FXa_inhibition Coagulation Factor Xa inhibitory site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.25.10 Mainly Beta Ribbon Laminin Laminin 4bxsA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4bxsA02
5GIBA 1SOZA 4Y79A 2XTTB 4WMFA 1UTPA 2I6SA 1EP5A 3RC5A 1BTHH 1RIWC 3M3VA 2P93A 3TJVA 1DIYA 4M10A 2ZHQH 1ATAA 7KMEH 3WY8A 5ETXA 1TRMA 1S5SA 4IBLH 5ABWA 5JB9S 1IQGA 4WH6A 3EGFA 3BEFB 1MBQA 1PQAA 3NTGA 3Q3KB 1GVLA 1TNJA 3MNBA 1SVPA 3SNBA 1SGNE 1AFQB 1ESAA 2ZFFH 4I33A 1ESBA 1O3IA 1HUTH 1MTVA 1NPMA 1LQDB 2FPZA 5A8YA 3EQ0H 4CR5A 2PV9B 1E38B 1KLIL 1HB0B 1YC0A 2BOHA 1S83A 1UVOA 2P28B 1KLJH 1ZPCA 1UCYK 3TJNA 5E8EH 2Z9KA 1P9SA 1NFWB 1YYY1 1DLEA 2MGRA 5F8TA 4ZKSU 1NRNH 1T8OA 1L4ZA 1A4WH 1W14U 4ZXYL 1PYTD 3A88A 1GHZA 1LHGH 1LVOA 1BBRK 2GTBA 1DE7H 3CENL 1T8LA 3ZZCA 2XBVL 8ESTE 1QJ6B 1SI5H 2IPHA 4BTTB 2NU0E 1TA2A 3PO1B 1AB9C 3ELAH 1W2KH 1O34A 2FOCA 4X2WA 1SL3A 5EXNA 3N8YA 2ZNKH 3EGKH 2ZTYA 1SHYA 2OQ5A 1DDXA 1KXCA 2ZU1A 1C2GA 2O9QA 4ZKNU 1MAXA 2BOKL 1V3XA 2FXRA 3QZQA 5SGAE 2W26A 1A3EH 4NFFA 4Y0ZE 2BOXA 2OBQA 2WPKS 3MH4A 1VJAU 1JL9A 5DP8A 3QN7A 1O5AB 2ZDAH 1CU1A 2XBYL 1TQ7B 1V2MT 1HRFA 3SV9A 1IQHA 2F3CE 3F68H 3K65B 3TIUA 2OBOA 2P3UB 1ZLRA 3VB7A 1AQ7A 1O3JA 1C5VA 2FESH 2BDAA 2CJIB 2BD9A 2JKHA 1TMBH 4O97A 1NS3A 1THPB 3BG4B 4B76A 6CHAC 2ANKH 4GSOA 3H7TA 2AMQA 4BDXA 2HALA 1N6XA 2GCHF 1YPEH 1GI2A 3RUOA 4THNH 2XNIA 2PKSC 1K1LA 2PKAA 5CMXH 5F03A 5I46L 2Y5HA 4XBDA 1L4DA 4ISOA 4DURA 2TIOA 1XMNB 3U98H 1BOQA 1O3FA 3TNSA 1AD8H 4OS5A 4D7FA 4UEHH 5I46H 1QIXB 4CSYA 1CX2A 1J14A 1N6YA 1BTYA 3AW1A 1FN6A 4K1SA 1EB2A 2G8TA 1VGCC 1C5TA 1SFIA 2P26A 1HAOH 3R3GB 2VH0A 2UUJB 4X1QU 3SUGA 2ZQ2A 2I9BA 3N8XA 3O8CA 3GCHB 1GHYH 1ZRBA 2BD8A 2GDDA 3ENSA 5JBTA 1GI7B 1EZSC 3T25A 1BTXA 2FX4A 3RXMA 1YPLH 3HPTA 1Q3XA 1TOZA 4ABGA 3MU1A 1UK3A 2VGCB 1HCGB 3HKIB 3BG8A 1XUHA 2Y7ZB 3BTFE 1PPHE 3SV6A 4AX9H 4MNXA 3RMOH 4ZHMU 1V3XB 1ZR0A 1DX5M 2FLBL 1K1JA 4BXWA 1GBCA 4GHTA 3LJJA 3P8GA 4CHAC 2P3FH 5IKVA 1V2TT 2R9PA 2TPIZ 1GBJA 1YM0A 5L2YH 1SSXA 4O9VA 4JMYA 2Y5FA 1YPGH 3BIVH 1YUFA 2PUQL 2UWOB 2LPRA 3A7VA 1GI5A 2ZPQA 3LOXA 1ELFA 1KTSB 2W2ME 2FOHA 1AKSA 1XUJA 2CJIA 1G32B 2R3YA 4K60A 3M37A 3ASIA 1PQ7A 2TGDA 1YBWA 5FAHA 4A5TS 1DANH 1OXGA 1KXDA 2VGCC 3S0NA 2VWMK 3TH2H 5C1YA 1O35A 1V2ST 2PLXA 3NXPA 1PXXA 1A5IA 1ZTLA 2OC0A 1F0SA 1Y3VA 2FM2A 1MKWH 1IGXA 1HAHH 1C4U2 1N7DA 1J9CH 3ZVEA 1J8AA 5JW1A 1EZXC 5JVZA 5GJ4B 1F0RB 2IOTA 1GMCF 5HM9A 2WPKE 1IVOC 2TGAA 2WYGB 1GGDB 4ZROA 3ATMA 1ELAA 1P9UA 1Y8TA 1V6DA 4ABDA 3A7WA 2ZCLP 3LGIA 4OTJA 2J95B 3F6UL 1MTNC 1O2PA 2Y80B 2A7HA 3VEQB 1BQYA 2G4UA 1MCVA 2Y82B 2CN0H 3E6PH 1H4WA 1ID5H 1G3DA 4ISIH 2BOUA 1V2JT 1HCGA 4RS0A 1F2SE 3SI4H 3K6YA 2QXGA 3QGNB 4YT7H 2A1DB 2HPQH 3KQDL 2BO2A 2OLGA 4OS6A 3MYWA 3ZVCA 5T3HA 4AYVB 3ZZ3A 1AFQC 1S0QA 1PPBH 3IJEB 1D4PB 4TWWA 1JBUH 1N1LA 1PPFE 3FANA 4FUEA 1RTKA 2HLCA 2VIOA 4YOJA 3A7YA 1YUGA 1DVAL 2BZ6H 1K1MA 1A3PA 1LVBA 1UVPA 4JZEL 1P04A 2FOAA 3CS0A 2O8UA 1THRH 1GI0A 4Y11E 1BHXB 2ILNA 2ZTZA 2ALVA 2P3TB 1MU6B 1LPKA 3E91A 2ZO3H 5BRRE 3A84A 2BDYA 2VIDA 1AGJA 1LTOA 1SLXB 4JZIA 2FDAA 3RU4E 2AEIH 1P2JA 4X8VL 4GVUA 1GBKA 4AB9A 1NFWA 1QBOA 1TPGA 1W3CA 4XBBA 2O8MA 2PR3A 4TPYA 3TZIA 1V2PT 4I32A 1GMDF 1SMFE 3A81A 3RU4D 3ZV8A 5DP9A 1G3CA 4WMDA 1XFEA 1IQLL 1P06A 3CA7A 2P3FL 2B7DH 1NFXB 2FO9A 2RA0A 5AF9H 3HS6A 3LIWB 3URDA 1Z1IA 3BSQA 5JBBE 4HZHA 1GHXH 3SJ9A 2AIQA 1LCYA 4ISNA 2BLVA 2G00A 3RXPA 2MHPA 1DS2E 3W95A 1IQML 2W2PE 4A7IB 1N8OC 3ZVGA 5KIRA 3OYPA 1EASA 1GJDB 1UTKA 3K9XA 1S82A 2KL7A 3A8AA 3ZVBA 1O2ZA 1VITG 1IP0A 2BDBA 3N8YB 1ABIH 1OPHB 3A8BA 3GY4A 5BPEA 3RXDA 2ODQA 1MAYA 3CS7A 1HFDA 2WPLS 3TH3H 1GHAF 4KELA 2TGPZ 3U8TH 1CT4E 1PJPA 1SGFG 2W3IB 3PV4A 3KHVA 4ZUHA 1QJ7B 3ITIA 3VB5A 3ZZAA 2Z3EA 5EODA 5DKMA 1TGTA 2Y5HL 1A61H 1TRNA 4IGDA 1EAIC 2A31A 2WPIS 2DDUA 1O5GH 1CGJE 2V6NA 3PMJA 2ZHDA 1AUTC 4G1MB 2RCEA 1Y3YA 4OS4A 4DOQA 4B73A 3KF2A 4UFGH 1CA0B 3UNSA 1TLDA 3UFAA 1CA8B 1SFQB 4J1YA 2GZ8A 2XYAA 1FY1A 3ZZ6A 5C2ZA 4JYVL 2UWLA 4IW4E 2QYIA 3E1XB 2AGGX 1WCZA 1JIRA 4X6NA 2H9HA 4Y6DA 1LKAA 1C5SA 4FUJA 3RMNH 4IS5A 1SG8B 3ZYJB 1LHEH 5EOKA 5T6GA 2HWLB 3MQEA 1EAUA 4D90A 3FAOA 2ZECA 3LIWA 4MQAA 4NA8A 2BDCA 2P95L 1BF9A 3NWUA 4Y7BA 2CV3A 2ZFTA 3A87A 5K7RA 2M5TA 4MMXB 1DVAH 4X1NU 1CHOF 1C2FA 1TMUH 7ESTE 2VIVA 1KIGH 1O2VA 5TJXA 1V2QT 3MU0A 2OCVB 3PLBA 3RM2H 4AQTA 1EZUC 1GI1A 4JZDL 2PWXA 3KGPA 3T28A 4KP0A 2BZ6L 4D0FA 1YO8A 3KL6A 3P8NA 2ZU4A 3HATH 1O3LA 4U01A 1UVTH 2XBWL 2Y7XA 1XXDA 2BTCE 1RGQA 1G1QA 1TOMH 1KXFA 4I8HA 3SOSA 1GDUA 4RN6A 1TGCA 1ZSKA 1QBVH 1EQGA 1X7AC 3MTYA 1A7SA 4BAMB 2UWOA 3D23A 5EGMA 2ZFRH 5F1AA 3SU0A 1Q4GA 4IC5A 3CP7A 3RMMH 1F92A 1AKSB 1EATA 4YLUA 1IOXA 2H9EH 4A1TA 3F9EA 1OKXA 1T8MA 3SGQE 1V2VT 2ZI2H 2GT7A 2A5KA 2HRVA 3Q76A 2D1JB 5LPRA 3ATKA 1HT5A 1S0RA 3RXRA 1EMOA 1EB1H 5JVYA 2FZZA 5HGGA 2J34B 3HO5A 4O02B 4Q7XA 2PTCE 1GBFA 4RRZA 3UPEA 5LPFA 3RXCA 4Y6DB 1NPEB 3B8JA 4FU7A 2O8WA 1E0FD 4CUDA 4MDSA 4Y0YE 5F6MA 1DWDH 2ZP0H 2BQ7A 1PPZA 4X8SL 4MNVA 4BAQB 1C5ZB 3KQCL 4MMZB 4FUDA 1RD3B 1YP9A 1P10A 3DEMA 1IQKA 3QTVH 1EOJA 4WY3A 4X8SH 2Z9GA 2QXJA 2XCNA 1J15A 1HAYB 2AMDA 4Q2KA 1BRCE 3UQVA 4Y7AB 2ZFQH 2ZGBH 1UTJA 2ANWA 5AVDA 1TAWA 1GI9B 3PWCA 2WPHS 2W7SA 1SZBA 4O3TA 3SQHE 4NCYA 4ZAEA 3KL6B 1EUFA 4CH8B 5C20A 1AY6H 4ABEA 1CVUA 2J4IB 2F9OA 2W26B 3RXJA 5I25A 1CA0C 2VVUA 1W12U 3BIUH 1MKWK 5JPMH 1Z8GA 3LDXH 3SNCA 2WPHE 1D6WA 1ATEA 1VJ9U 5AHGH 3HO4A 3BPSE 4BTIA 1K28D 1TOCB 1XKBC 2QV1A 4TPIZ 1HAFA 1YF4A 3RC4A 2QC2A 4IC6A 3SGBE 2H9EL 1IGZA 1W7XH 3UUZA 1GDQA 2ZHEH 2G00L 3RU4T 4CBNA 4C16A 2STAE 3S7KB 1W7XL 2V3HH 4BANB 5FDQA 5K0HB 4WXVA 1LPZA 2Y5GA 4Z0LA 1QBNA 2J94B 3KNXA 1PQ5A 3O8BA 4ISHH 3QK1A 3TLOA 4GHQA 2GZ9A 1K22H 2WYJB 3KK6A 4Y10E 4D9QA 4JZDH 1C1WH 3HKJB 3KQDA 1GCTB 1UJ1A 3BTDE 2FODA 3LGTA 3M7QA 3VGCB 3LGYA 5F8ZA 5GCHF 3QZRA 1ANBA 2H1UA 4BAHB 2VVCK 2BQ7B 1ZGIA 1ELVA 3GDVA 1IQNA 3ELAL 3PO1C 1ADXA 2R2WU 4JZ1A 2XRCA 3D65E 4NFEA 4CRBA 1A5HA 1HJ7A 1CO7E 2ZF0H 1WOFA 1S6HA 1O5EH 4DW2U 3OLUA 2TBSA 1TPOA 4JZFH 4WJG2 3SJOA 3SU6A 4MVNA 1XKBA 3URCA 3GY8A 3A80A 1DWEH 1QRXA 1F7ZA 2BB4A 1KYNA 3Q7DA 2Z7FE 3HPTB 3GISB 4R8TB 3STIA 1IQJL 4XL1A 1ABJH 1QFKH 2QCYA 1DXPA 8KME2 4LORA 3GCXE 1HX2A 2BD3A 4BOHA 2EI6B 2W3KB 4MTBA 5A0CA 2D2DA 1O2HA 2Y7ZA 5EQRA 1BB0B 3DD2H 1V2WT 4RRWA 2A4GA 4X8TH 4XE4A 3RP2A 1UTOA 3TGFA 1GK5A 2J4IA 1WUNH 1EJAA 3TK9A 2W3IA 1SPJA 5C5NA 3MH6A 4YT6H 3TH4H 1EQHA 4AFQA 1O2UA 1O2KA 1LKBA 3EYDA 1NU7B 1ZTKA 2GT8A 2F83A 4HTCH 3L6PA 3M36L 3QLPH 3KCGH 5CHAC 1DSUA 1S81A 3Q3KA 3BTKE 2PSYA 5T6DA 4Y76B 3E8LA 4NZQA 3GCTF 1LQEA 1BA8B 4DJZB 2VWNA 3KN2A 1NRSH 2WPJS 1JRTA 4FVDA 2PFEA 2UWPB 1IQMA 2VINA 1KTTB 2AIPA 4BNRA 3OTJE 4FUGA 1EAWA 1ELEE 1IQEA 1UK2A 1D3PB 2XW9A 1P2QA 1XDTR 5FPYA 2Y81B 1LVYA 1QNJA 3R05A 1O3DA 3A8CA 2ZU5A 3NUMA 2C3SA 1JWTA 4NWLA 2KV4A 3W94A 1WYKA 1W11U 1MCTA 1GBBA 4GCHG 3Q3XA 1O3HA 3E16B 2XBWA 2ZPSA 3EA8A 2BVXH 1K1OA 3IWMA 5FHTA 1QB1A 2NU2E 3UREA 3PMHB 1FNIA 2A2XH 3QMOA 3B23B 4TY6A 1IOEA 4Y7BB 1O2IA 1XUGA 3H5CB 4BTTA 1O3AA 1W0ZU 4AG1A 1QURH 2BQ6B 3ODFA 3GYLB 1DITH 2GCHG 4A6LA 5FBIA 1GPZA 1UMAH 2XC5L 2BD7A 2PKSB 3QDZB 1GBMA 3VXEH 3N8ZA 1DWBH 1NRRH 4ABAA 1JMOH 1EZQB 3RXIA 1PRHA 2EI8A 1GL0E 1TNIA 2BQWA 4X8TL 4RSPA 5EQSA 1BBRH 1COUA 1U67A 1C5WB 1LHFH 2HPPH 1MQ5L 4A92A 1NRPH 1RXPA 2Y7XB 3I78A 4I8GA 1NU9A 1Z1JA 1O30A 2BOKA 4NGAH 2F9BH 4AB8A 3DUXH 1RTFB 2AMPA 2XWBI 2STBE 2AH4X 2ASUB 3A82A 2WUBA 2F9BL 4CUEA 5FPTA 1HZ8A 3AVZA 1NFYA 1V2UT 1Z71A 2XBYA 5IKQA 1BRUP 3MHWU 3UY9A 3M35A 3SUFA 2UWPA 3MI4A 4SGAE 1UHBA 1K36A 3BTHE 2BY8X 3OX7U 4NZLA 5A2MH 1O2RA 4Y71B 1SLWB 2F9NA 4OTYA 3MH5A 3DFJA 4MG3A 1HREA 2ZPRA 5GCHG 1NM6A 2Y81A 2IJOB 4UD9H 1DWCH 2ZDVH 2PKAB 3DA9B 1MMJN 1FJSA 5PTPA 5FPSA 2PR3B 4GUXA 1FAKH 3LU9B 3PLPA 3T62A 4AOQA 2G52A 4YZUA 4DIIH 1O3MA 3M5LA 2ZA5A 5J4SA 1W13U 3F6UH 1QL7A 2VWOL 1V2OT 1MTNB 1IHTH 1LPGB 5E0GA 1YGCH 4CRDA 1Y5BT 2NU3E 2FLRL 1LDTT 1W0YH 3F9GA 6GCHG 3UQOA 2VH0B 5EW2H 5FX5A 3PROA 3UNQA 1Z6EL 1CEJA 2ULLA 3FP8E 2ZGHA 1NESE 2VJ3A 3ZZ5A 3K9XB 1ANDA 4HI3A 3UOUA 3ZYEA 3SNEA 1EPJA 1FPCH 2OD3B 3O8DA 3EE0B 1BMAA 1DDJA 1GJCB 3HS5A 2D26C 3LH3A 4AFSA 3MO9A 1HJAC 3RXTA 1HAEA 3SQEE 4AORA 3VB4A 5JB8E 2F9UA 2GMTC 4MNWA 1G1TA 2HNTF 2Z3DA 4LZ1H 4YLQH 4DT7B 3T29A 2A45B 4U2WA 3I29A 1QL8A 3N8VA 2OC8A 3GDUA 3BG4C 6CHAB 1HYLA 3RXSA 3LJOA 4BTIB 1O36A 1HJAB 2RNLA 1IQIA 1SGTA 3FCSB 2GD4B 3QX5H 1CCFA 4JYUL 1O3NA 4OS2A 1TBQH 1PGEA 1C5PA 1NFYB 1AE5A 2ADXA 1G2MA 1KXBA 1IQKL 2C8ZB 2ZHWH 1MD8A 3PWBA 3ZVAA 2VIWA 3M3SA 1APOA 1F5KU 1GJBB 1K1IA 1ANEA 5IKTA 4Y71A 5K0HA 3ZYGA 3U73A 1PPEE 1T31A 1QR3E 2J94A 2A5IA 4D8NA 1WQSA 4GCHF 4BDWA 4B75A 2UWLB 4Z6AL 2A7CA 1P3CA 1PTHA 1CBWC 1UTMA 1H1BA 2GKVE 3PTNA 4ZXYH 7GCHF 1SLVB 3TGIE 4YZUB 1CSOE 1QHRB 2CMYA 4QT8C 2FOMB 4B74A 5LH8A 3ZZ9A 1WU1B 1GWAA 2J2UA 1F0UA 1C1SA 1N8OB 1LPGA 3LC3B 4U30A 3IG6B 1OSSA 1FY5A 3UNRA 2GP9B 1HXEH 2BD5A 2Q1JB 1TNLA 3V13A 1O2YA 4X6PA 1DPOA 2XBXL 2PUXB 3BEUA 3GICB 2HVXA 1XVOA 1UZJA 1HGTH 2ANMH 5L6NH 1FXYA 3POYA 1F5LA 1FIZA 4K69A 3RMLH 1YPMH 2OYEP 4CRAA 1DFPA 1HPGA 1L1NA 1TMTH 5TCCA 5EW1H 1FAXL 1T8NA 4RKJB 2VU8E 2ZCHP 2Y5GL 1BMMH 1IQEL 2ZKSA 5LPEA 4NIXA 1TNGA 3MNSA 2WPLE 4KGAA 1HAXB 3C27B 4ABJA 4DVAU 1EJNA 1SHHB 1IQFA 1HJ8A 2FLBH 4YTAA 1Q31A 4YO9A 2WPIE 1P01A 2QGRA 3P95A 5EGMB 1H9IE 1SGQE 4AGKA 1F7MA 2A0QB 1HAIH 2O8LA 1BT7A 2GD4A 5C5OA 3FFGA 5EXLA 2A5AA 1E36B 4X1SU 1TLEA 1HLTH 4ISLA 1TALA 2FOBA 1CQQA 1O2XA 1OWIA 2H6MA 3RXFA 2SGAA 2BVRH 2BX3A 3ZZ7A 1ESTA 1F0TA 1AZZA 2J9NA 2QF0A 2P3TA 5HM2A 2FOFA 1ZPBA 1O39A 4ZHLU 1UVSH 4Q80A 1TIOA 1A1RA 4YOGA 4O3UA 4NSYA 1O2OA 1BJUA 1J16A 3MFJA 3R0FA 5C1UA 1AO5A 2BYAX 1DY8A 4LOYH 3GY6A 1JIMA 1DX5I 1EJMA 2A7JA 3NKKA 4K8YA 1SC8U 4HFPB 1O5DH 1FY3A 2GVFA 1NFXA 1KXAA 4H4FA 1EPGA 4A7IA 2UUKB 1EX3A 1QGFA 3LPRA 3STJA 2BQ6A 1QCPA 2BY5X 3RXEA 1URKA 2FI3E 1WTGH 1Z7KA 4NA9H 4DY7B 1W10U 1SGPE 2QY0B 1EZQA 3ZVFA 2EI8B 4NA9L 1ETSH 2BQWB 1YPHE 1OYTH 1SLUB 1YPHC 1LVMA 1RJXB 3OY6U 3OU0A 1FDPA 1C5XB 3MOCA 2G81E 1KLTA 1OWJA 2J38B 4I7YH 2Z94A 1K21H 2WFXB 4I8JA 3LTGD 1A2CH 1BUIA 4E06H 5DPAA 2GMTB 2FI5E 1THSH 3M5NA 4BTUA 1O2TA 2EA3A 2PSXA 4RRXA 2BMGB 2FYRA 1M9UA 3S9BA 2VWOA 5E0HA 3OSYA 1CGIE 4D76A 2YNBA 1ZZZA 5DP6A 5GPIB 5DP7A 2BDHA 1ELBA 1C5OH 1WBGB 4DCDA 1ZAQA 1JOUB 4B2AA 1UHBB 3A7ZA 4NSVA 1BBRE 1TX8A 2UUFB 5JBAE 1Z8RA 3BTQE 2WFTA 1X7AL 3RXHA 2WYJA 1DUAA 2ZFPH 1SGRE 1MUEB 1FUJA 1NN6A 2GZ7A 4OGYA 1KY9A 1FLEE 1KDQB 3SU1A 1L1JA 4X8VH 9ESTA 1MH0A 2W2NE 1GBLA 1W7GH 3Q3YA 1ZOMA 1AZ8A 3MNXA 3RM0H 1INCA 2VJ1A 2VWLL 1QQ4A 1YPKH 3A85A 1LO6A 2P94L 1ARBA 1A0HB 3GY7A 4UFDH 3P70B 4NG9L 5GDSH 3A83A 5JYIA 2PHBB 1MBMA 1UZQA 2ZZUH 2C90B 4MLFB 1OOKB 5CHAB 5EQQA 1TGSZ 1T4UH 5F8XA 1VZQH 3Q77A 1GBTA 1T7CA 5GXPA 5L2YL 1A0LA 2WPME 1GDNA 2XWAA 4YT7L 1MZDA 1VITF 2PUQH 1T32A 2EI6A 2W3KA 1TNKA 4NIVA 1C9TA 1HAGE 2BZAA 1UK4A 1HAVB 4ISIL 1H9LB 1XUFA 1P11E 3LH1A 2KAIA 3P8OA 1PPGE 1QRZA 4CRCA 1H8DH 1FJSL 2H9TH 5EG4A 1C2JA 3RXUA 3SHCH 3P92A 1C4V2 4WMEA 5E8DA 3GY3A 1HDTH 3TPIZ 1ANCA 2TGFA 2BMGA 1V2KT 9LPRA 1P8VC 3BTGE 5B6OA 1ELGA 4Y76A 3UIRA 1G2MB 4NGAL 2BXTH 3MDLA 2R2MB 2XBXA 4F4OC 1ZHPA 1DXWA 3TJUA 1DQBA 2D1JA 1QB6A 4JYUH 1HIAA 4X8UL 4Q7YA 4UE7H 1GCDA 8GCHG 1D3TB 1C5MD 2EC9H 3UTUH 1OP2A 3ATWA 3O8RA 4JK6A 3S9AA 1A5GH 1CHOG 3MH7A 1BTPA 1UCYE 1UTLM 2JH0D 1BIOA 3LC3A 1CHGA 1EOLA 1UTQA 4INKA 2P3FN 2XC4A 2H2ZA 1KSNB 2PHBA 1C1VH 1TPAE 5EU8A 2Q1JA 1P2KA 2Z9IA 1IQIL 2SGDE 1OWKA 2WPMS 3BT1A 2FTLE 1O2JA 1OS8A 3FFGL 2XC0L 1V2LT 1C2IA 1C5UA 5CISA 1D9IA 1O2NA 1JV2B 2BVSH 4ZH8B 2JETC 3SZNA 4K8BA 3UWIA 2R0KA 1O32A 4A1VA 2SGFE 1XKAC 1DT2A 1L1GA 1GMHG 1EKBB 3BV9B 1WSSH 2SGQE 4K3JA 4D7GA 1MQ6A 1C1RA 3M5OA 1H8IH 1C5YB 3TK5A 3SNDA 1Y5AT 3ZYDA 3F9FA 2ZHFH 3NK8A 1D3DB 3SI3H 2OTVA 3GCNA 4U32A 2EI7A 3LN0A 3GY5A 1E34B 3LC5B 5HXFA 1Y59T 1Z8JB 2YOLA 4I8LA 4YESB 1O3EA 3C9AC 3M7TA 4IMQA 1EPHA 2C8WB 1QQUA 2G5NA 3RLYH 1C2MA 1J17T 1HBTH 1L2EA 2B7DL 2B5TB 1L0ZA 1G9IE 8LPRA 1LPZB 1RS0A 4WF8A 5EXMA 1HIAB 1GG6C 4NG9H 1ZHMA 5L2ZL 1BCUH 1GHWH 2Z9LA 1SGCA 1AU8A 1AFEH 1OX1A 1Y3WA 4X1RU 1YKTA 4KTUA 2B8OH 3B9FH 2JH6D 1OYQA 1AB9B 1TB6H 2A32A 5JBAS 1IQFL 3BEIB 2ZCKP 4XBCA 4GLYA 1KSNA 1NO9H 1IQNL 1Y5UT 4X2VA 2QXIA 6COXA 1AVXA 2VB0A 2NU4E 1YCPH 1EAXA 1ORFA 3MU4A 5DO4H 1JRSA 1PQ8A 1RRKA 3LGVA 3AAUA 4FUBA 1NTPA 1GI3A 1ETTH 2XXLA 3K6ZA 4MPUA 2SNWA 1IQJA 3HK6B 3SJKA 3NTBA 3TK6A 1UTNA 2A4QA 3EA9A 4YOIA 3RXKA 2P8OC 1DSTA 1P2NA 2J38A 2PTNA 1SQAA 3S7HB 1C9PA 1C1UH 1K9OE 4UFEH 3A8DA 3QH0A 2BM2A 1O5BB 1GMCG 3SW2B 2HOBA 3TK5B 2ZFSA 3D62A 3E0NB 2C4FH 4BTUB 3TBDA 1C2EA 7LPRA 1GG6B 1QL9A 4JK5A 1N1IA 2AFQB 1BMLA 4FM5A 1TGNA 3LGUA 2NU1E 1B0FA 2OUAA 1G30B 1FSBA 6LPRA 5CE1A 3FP6E 4I31A 1NT1A 2WV5A 4Y79B 3PM3A 2ZEBA 3KQEA 4CBOA 1FPHH 5DGJA 1ELTA 2AYLA 3AW0A 3MO3A 1TPPA 1SQTA 3V12A 2VWNL 4X6MA 3ZYIB 4ZHAB 1HJ9A 4H6SB 3BN9A 4CH2B 2OP9A 3SJ8A 1TBZH 3SV2H 1NC6A 4XDEA 3NJPC 1XM1A 2HNTC 3QO6A 1UCYH 1O0DH 2JKHL 3ATLA 2FOEA 1UVUH 3EAJA 2FS8A 3L33A 1MD7A 5COXA 2ZDMA 2ZG0H 3N8WA 4AN7A 2P16L 1MTWA 4PH9A 2LNCA 5C1XA 3V7TA 4K2YA 1AVWA 1CGHA 1JBUL 2JETB 1ZSJA 4ABIA 3RXVA 1O3PB 2I6QA 1G3EA 4J2YB 4B2BA 3M7UA 3HS7A 1C1OA 4TGFA 3GYMA 2O8TA 1M1XB 2MGPA 4JZFL 1ELCA 1SR5C 3SUEA 2XCFA 4X0WU 3P6ZB 2XC5A 5FXLA 1B9WA 1OB1C 4K5ZA 1QFKL 2BD2A 3G01A 3U1JB 5A09A 1DUEA 1ZHRA 3TK6B 1AIXH 1HAVA 1MZAA 1EMNA 1PFXC 1GJ7B 3KEEA 3LTFB 2GX4A 2BLQA 1EPIA 3DFLA 1XUIA 1CE5A 4ABHA 2ZC9H 3TVJB 1K37A 1XXFA 1CBWB 1BMNH 3HGPA 4Q7ZA 1GBDA 4E05H 1FIWA 5CKNA 3PMAB 2VWLA 2CHAC 3JZ1B 2P94A 2FX6A 3BTTE 1P2OA 4E7RG 1FMGA 1KLJL 1P2MA 1E37B 4ASHA 5IDKA 2VIPA 2BX4A 2SFAA 4X1PU 4NA7A 1O5DL 1P09A 1KIGL 3U9AH 4KKDA 3C1KA 1BRAA 1FF7A 2GGVB 3U69H 5F19A 3TGJE 3SHAH 2Q6GA 5DP4A 2ZDNA 3PGHA 1P03A 2BDIA 2AYWA 3SU4A 1Q2WA 3PYHA 3NT1A 1WAYB 1G37A 1MKXK 3N8WB 1NRQH 4BAKB 4COXA 3E3TA 3A89A 3VFEA 3F9HA 3SORA 3RXQA 2C8XB 4D0EA 5C67A 1SGEE 3IITB 1WV7H 3ZV9A 2V0BA 3FZDA 5FCRA 3E90B 4K1TA 5FCKA 1V2NT 1O3GA 4H42U 1TBRH 1C5RA 3T5FH 1ZGVA 1SB1H 2F9VA 2Q6DA 4FU8A 1DY9A 3LAQA 3AASA 2FMJA 1CT0E 1NZQH 1GBIA 1AUJA 1MU8B 1P02A 2PW8H 1B5GH 3TJOA 1K1NA 2QA9E 3BF6H 1DOJA 3VXFH 5JB8S 3ZVDA 4B71A 4BAOB 2ODYB 4XOJA 2EI7B 4ZKOU 1FE2A 4ZKRU 1AVGH 3GCHC 4DG4A 1TWXB 1QTFA 3K2UA 3M5MA 4O1ZA 1EPTB 5JDUB 2YNAA 3QCWA 2G5VA 5JB9E 3F1SB 2XC4L 3SUDA 1BDAA 4AYYB 2VVVL 1GGDC 5FX6A 1JXPA 5E0JA 1S85A 1TQ0B 1PFXL 2QIQA 2VWMA 5AFZH 2FIRH 1A46H 4GAWA 2XC0A 5FBEA 2Y5FL 5DP3A 4AFUA 2GDEH 3ESTA 2H5DA 4K1EA 2V35A 5DK1A 1A0JA 4O03A 6GCHF 4NWKA 1C1PA 1G1SA 2VH6B 1HAZB 1O5FH 3SOQA 3U7UG 1C2KA 1HT8A 1BTWA 3RXBA 1AMHA 1BHXF 1ZJKA 2RHPA 3M37L 3D49H 4FVBA 3VB3A 1IHSH 4LMFA 1HAPH 2UUYA 3M61U 4XFQA 1ETRH 2J2UB 1WU1A 3T26A 3TITA 1GI8B 4GPGA 1LQDA 1TPSA 1TX7A 4JYVH 3Q00A 1AN1E 5HYOA 1O2MA 2THFB 2BOHB 1SGDE 1XUKA 3IITA 2P8OB 4UDWH 3P8FA 1YCPM 4HGCA 4WWYA 1S84A 3FBYA 1LMJA 2ANYA 1RFNA 5L30H 3PB1E 5EPNA 2ZGCA 1ARCA 4FUFA 1Z6EA 4DIHH 1Y3UA 2NPRA 3PLKA 3SN8A 2RA0L 3SBKA 4E7NA 2ESTE 1SQOA 4R0IA 1F0RA 1GBHA 2CXVA 1CVWH 1O31A 3LONA 1OP0A 5EPYA 1C2HA 4Z0KB 2AERH 1B0EA 2FTMA 4AGJA 1FAXA 2KAIB 3KQBL 4OS7A 2FD6A 1UO6A 2SGPE 1EXFA 4ZXXH 1C5QA 3HO3A 3E0PB 3S9CA 2Y80A 1O2SA 1QB9A 2SGEE 4ABFA 1P3EA 1ZPZA 1FY4A 1ELDE 1K1PA 2VIQA 4UONA 2Z3CA 4IN2A 3U8RH 1SBWA 1D6RA 3CS7L 2P16A 1C5LH 5DP5A 3PMBB 1C1TA 1TRYA 4IMZA 1QA0A 1MKXH 1KXEA 3S69A 2FEQH 2RDLA 3ZZBA 4BXSA 3GCOA 4FUIA 4LXBH 2I9AA 3CFWA 3TGKE 4ZHAA 3A7TA 1MTSA 2YGPA 2IN2A 1O2QA 4H6TA 1ZRKA 3V64C 4INLA 1KLIH 5T6FA 1VR1H 1MOXC 1TA6A 1PPCE 1FQ3A 4X2XA 4MPXA 3QWCH 1FFMA 4WH8A 3HGNA 2P3UA 1O3BA 2DE8A 4YT6L 2QXHA 3SV7A 2AGEX 1O5CB 4SGBE 1LHDH 2C8YB 1LPKB 1C2DA 8GCHF 2WPJE 1NQLB 1C1MA 4DGJA 1YPJH 2BXUH 3AAVA 3OY5U 1GHBG 1EAIA 2DE9A 4CRGA 1IQLA 2PGQB 1W8BH 2Y38A 3KQEL 1P05A 2ZGJA 3BTWE 2BLWA 1PYTC 1V2RT 5LGOA 1G2LB 4RUTA 1FY8E 1QA7A 4KTSA 4TYDA 3TU7H 1GHBF 1J9CL 4F49A 3PTBA 3MNCA 3GCWE 3TNTA 3MO6A 4E1GA 1OWDA 3A86A 2FWWA 1G3BA 2CF8H 5C3NA 1GI4A 3SOBB 1CQEA 2BHGA 2HNTE 3UR9A 3BTEE 1P9JA 5H4IB 4AFZA 1O2LA 2EEKA 3V65B 1EQ9A 1VCWA 1TFXA 1GVKB 1NT0A 1ATDA 2AGIX 3ODDA 3LGWA 1OWEA 1BZXE 3EA7A 3SNAA 2OC1A 4PROA 1FZZA 4VGCB 2K1QA 1EBVA 1HRTH 3GISX 1FI8A 4CREA 1AWHB 2RA3A 2A2QH 4MMYB 2YGOA 1BITA 1DM4B 5A8XA 1GJ6A 2FLRH 1F7EA 2OINA 1Z6JH 2XBVA 2H5CA 1TONA 1CCVA 4MNYA 3SU2A 4RRYA 1O38A 5DJ7A 2ZU3A 1C1NA 1L5GB 2F9PA 2WV4A 4TY7A 2W5EA 3QGJA 2A4OA 1L3YA 1FONA 1RTLA 5CKMA 1KDQA 1GCTC 2VNTA 3QUMP 3VGCC 3H7OA 1C1QA 2FP7B 1GI6A 1TX6A 3UR6A 3VB6A 1BJVA 5JBCE 4NIYA 1S6FA 4Y8YA 3MU5A 5TCAA 4AG2A 1H9HE 4RKOB 1CVWL 2FZZL 1G36A 2TRMA 1LMWB 1SGIB 1C4Y2 1XKAL 1O37A 1U6QA 2WG3C 1ZMJA 1P57B 5E2PA 3DHKH 1ATBA 4ISHL 2JH5D 2P93L 1W8BL 5HMAA 3BTME 1QRWA 4X8UH 3T2NA 1D3QB 4MPWA 1IQGL 2W2OE 4XSKU 1SGYE 3KQCA 4Y8XA 2B0FA 2BY9X 2P95A 4JCNA 3EDXB 2RG3A 3T27A 1OP8A 1EGFA 1HNEE 4CUFA 1IAUA 1NFUA 1HV7A 3N7OA 3RC6A 2WYGA 4KTCA 1RIWB 1FN8A 2R0LA 3SU5A 1MTUA 1P12E 1ZJDA 3SW2A 4LZ4B 1IJQA 1HXFH 2BLOA 1APQA 5A0BA 5JBCS 1DICA 1XVMA 2M74A 2ZTXA 4XLWA 2Y82A 2B9LA 3M3TA 4LK4A 4Z6AH 5GWZA 5A0AE 3SOVA 2A4RA 4WXIA 2G51A 1YGCL 1UZKA 1BTZA 2WUCA 3UOPA 2SNVA 4OS1A 4Y8ZA 2VVUL 5ESBA 1P0SL 4AZ2B 5L2ZH 2W2QE 3V0XA 4IN1A 3ZZDA 6ESTA 2VVCA 4I8KA 5G4BA 1ZSLA 2Q6FA 1GMHF 1VGCB 2W86A 3KCGL 4ABBA 3ZZ4A 7GCHG 5L30L 3CENA 1GJAB 2GCTC 1GL1A 2TGTA 2R3UA 4B2CA 2G55A 1G1RA 1WTHD 2C93B 4X6OA 2QAAA 2VH6A 4YM9A 2PGBB 2BY7X 1GJ5H 1O3OA 1P2IA 1VCPA 1GBEA 1UZPA 3U1IB 2ALPA 1LHCH 1O3KA 1GMDG 3KQBA 1Y3XA 2ZGXH 3L3TA 1O2GH 4ZXXL 5DG6A 5E2OA 2WINI 1TGBA 3BT2A 1A3BH 3FVFB 3ZZ8A 3RR3A 2FLGA 3RXLA 3VPKA 1C5MF 2J34A 1GBAA 3RXGA 1RFNB 1GVZA 5IYTA 2KB9A 3ATIA 2VVVA 1ACBE 4ZH8A 1TYNA 1T4VH 2D8WA 3JZ2B 3NCLA 4INHA 3SJIA 4TWYA 2W7UA 1OWHA 2GV7A 2ZU2A 1YLDA 4FU9A 1NFUB 1IQHL 4VGCC 2BY6X 4Z0KA 4CHAB 1XX9A 3SGAE 4NIWA 2K2SB 1GHAG 1ZMNA 1O3CA 2GV6A 1DLKB 2CGAA 2Z9JA 2HGTH 2CHAB 1O2WA 1QY6A 3SV8A 1AWFH 2FYQA 4ZMAH 1K2I1 2BD4A 2ZDLA 2ODPA 3ENSB 1FAKL 1O33A 2OXSA 1MQ6L 3FP7E 1GJ4H 4FUCA 1NROH 4Y7AA 5AFYH 3LC5A 3GDSA 2OYUP 1YLCA 1Z6CA 1WQVH 5ESTE 5CKQA 5A8ZA 2FI4E 1B7XB 3MWIU 2G4TA 1KLOA 3A7XA 4ZAEB 3MMGA 1QJ1B 1CT2E 4WVPE 3QTOH 2OQUA 4B1TA 1GJ9B 1BRBE 2QF3A 2P59A 3GY2A 1I0UA 4JZEH 1AI8H 1E35B 1F5RA 1TNHA 2ZIQH 2ZQ1A 4M7GA 3M36A 3RXAA 1AHTH 3UWJH 1SOTA 2F91A 3RDZA 2DUCA 3LN1A 3TH3L 2ZWLH 3OLTA 4A1XA 4UFFH 1AE8H 2AS9A 4M11A 1WHFA 1BTUA 2NWNA 1VITH 4OGXA 3MU8A 3KRKA 4X2YA 1NY22 2CF9H 1Z8IB 4MPVA 1ZYOA 3LT3A 4XBMA 3P5BL 3DT0H 3LKWA 3FZZA 3SU3A 3NPSA 2FOGA 2FS9A 1C5NH 2WG4B 1VCQA 3V3MA 2V3OH 1F0SB 2ZDKA 3GCTG 1P0SH 3I77A 4D9RA 3U8OH 1WHEA 1AUTL 1SGFA 4ESTE 3NZIA 1YCPK 1EP6A 5JBBS 1IOEL 1G2LA 3KIDU 2GCTB 2K2TA 4JYTA 3SO3A 1FV9A 2BDGA 5KN5C 2Z6BD 1EPTC 1ZTJA 3GOVB 1NZIA 2J95A 2J92A 2Y6TA 1C2LA 1TABE 5IKRA 4FUHA 3RLWH 4CRFA 3HK3B 3P17H 5J4QA 1TE0A 4FXGH 1MQ5A 1U8CB 1EPTA 1GJ8B 2QN5T 1ZMLA 1YUKB 1GHVH 4CR9A 2OC7A 3RXOA
chains in the Genus database with same CATH superfamily
5GIBA 1SOZA 4Y79A 1LMMA 2XTTB 4WMFA 1UTPA 1UW7A 2I6SA 1EP5A 3RC5A 1BTHH 1RIWC 3M3VA 2P93A 3TJVA 1DIYA 4M10A 2ZHQH 1ATAA 7KMEH 3WY8A 5ETXA 1TRMA 1S5SA 2YGQA 4IBLH 5ABWA 1IQGA 5JB9S 4WH6A 3EGFA 3BEFB 1MBQA 1PQAA 3NTGA 3Q3KB 1GVLA 1TNJA 3MNBA 1SVPA 2XOKD 3SNBA 1SGNE 1AFQB 1ESAA 2ZFFH 4I33A 1ESBA 1O3IA 1HUTH 1MTVA 1NPMA 1LQDB 2FPZA 3DSGA 5A8YA 3EQ0H 4CR5A 2PV9B 1E38B 1KLIL 1HB0B 1YC0A 2BOHA 1S83A 1UVOA 2P28B 1KLJH 1ZPCA 1UCYK 3TJNA 5E8EH 2Z9KA 1P9SA 1NFWB 1YYY1 1DLEA 2MGRA 5F8TA 4ZKSU 1NRNH 1T8OA 1L4ZA 1A4WH 1W14U 4ZXYL 1PYTD 3A88A 1GHZA 1SKYE 2KCYA 1LHGH 1LVOA 1BBRK 2GTBA 1DE7H 3CENL 1T8LA 3ZZCA 2XBVL 2KCOA 8ESTE 1QJ6B 1SI5H 2IPHA 4BTTB 2NU0E 1TA2A 3PO1B 1AB9C 3ELAH 1W2KH 1O34A 2FOCA 2F4LA 4X2WA 1SL3A 5EXNA 3N8YA 1YWUA 2ZNKH 3EGKH 2ZTYA 1SHYA 2OQ5A 1DDXA 1KXCA 2ZU1A 1C2GA 2O9QA 4ZKNU 1MAXA 2BOKL 1V3XA 2FXRA 3QZQA 5SGAE 2W26A 1A3EH 4NFFA 4Y0ZE 2BOXA 2OBQA 2WPKS 3MH4A 1VJAU 1JL9A 1V1HA 5DP8A 3QN7A 1O5AB 2ZDAH 1CU1A 2XBYL 1TQ7B 1V2MT 1HRFA 3SV9A 2J98A 1IQHA 2F3CE 3F68H 3K65B 3TIUA 2OBOA 2P3UB 1ZLRA 3VB7A 1AQ7A 1O3JA 1C5VA 2FESH 2BDAA 2CJIB 2BD9A 2JKHA 2JJ2D 1TMBH 4O97A 1NS3A 1THPB 3BG4B 4B76A 6CHAC 2ANKH 4GSOA 3H7TA 2AMQA 4BDXA 2HALA 1N6XA 2GCHF 1YPEH 1GI2A 3RUOA 4THNH 2XNIA 2PKSC 1K1LA 2PKAA 5CMXH 5F03A 5I46L 2Y5HA 4XBDA 1L4DA 4ISOA 4DURA 2TIOA 1XMNB 3U98H 1BOQA 1O3FA 3TNSA 1AD8H 4OS5A 4D7FA 4UEHH 5I46H 1QIXB 4CSYA 1CX2A 1J14A 1N6YA 1BTYA 3AW1A 1FN6A 4K1SA 2KCAA 3MQKC 1EB2A 2G8TA 1VGCC 1C5TA 1SFIA 2P26A 1HAOH 3R3GB 2VH0A 2UUJB 4X1QU 3SUGA 2ZQ2A 2I9BA 3N8XA 3O8CA 3GCHB 1GHYH 1ZRBA 2BD8A 2GDDA 3ENSA 5JBTA 1GI7B 1EZSC 3T25A 1BTXA 2FX4A 3RXMA 1YPLH 3HPTA 1Q3XA 1TOZA 4ABGA 3MU1A 1UK3A 2VGCB 1HCGB 3HKIB 2YMSB 3BG8A 1XUHA 2Y7ZB 3KYGA 3BTFE 4TT3D 1PPHE 3SV6A 4AX9H 4MNXA 3RMOH 4ZHMU 1V3XB 1ZR0A 1DX5M 2FLBL 1K1JA 4BXWA 1GBCA 4GHTA 3LJJA 4Z1MD 3P8GA 4CHAC 2P3FH 5IKVA 2HORA 1V2TT 2R9PA 2TPIZ 1GBJA 1YM0A 5L2YH 1SSXA 5EIYA 4O9VA 4JMYA 2CK3D 2Y5FA 1YPGH 3BIVH 1YUFA 2QF4A 2PUQL 2UWOB 2LPRA 3A7VA 1GI5A 2ZPQA 3LOXA 1ELFA 1KTSB 2W2ME 2FOHA 1AKSA 1XUJA 2CJIA 1G32B 2R3YA 4K60A 3M37A 3ASIA 2KR7A 1PQ7A 2TGDA 1YBWA 5FAHA 4A5TS 4HG6A 1OXGA 1DANH 1KXDA 2VGCC 3S0NA 2VWMK 3TH2H 5C1YA 1O35A 1V2ST 2PLXA 3NXPA 1PXXA 1A5IA 1ZTLA 2OC0A 1F0SA 1Y3VA 2FM2A 1MKWH 1IGXA 1HAHH 1C4U2 1N7DA 1J9CH 3ZVEA 1J8AA 5JW1A 1EZXC 5JVZA 5GJ4B 1F0RB 2IOTA 1GMCF 5HM9A 2WPKE 1IVOC 2TGAA 2WYGB 1GGDB 4ZROA 3ATMA 1ELAA 5KGOA 1P9UA 1Y8TA 1V6DA 4ABDA 3A7WA 2ZCLP 3LGIA 4OTJA 2J95B 3F6UL 1MTNC 1O2PA 2Y80B 2A7HA 3CNRA 3VEQB 1BQYA 2G4UA 1MCVA 2Y82B 3PV5A 2CN0H 3E6PH 1H4WA 1ID5H 1G3DA 4ISIH 2BOUA 1V2JT 1HCGA 4RS0A 1F2SE 3SI4H 3K6YA 4AC9A 2QXGA 3QGNB 4YT7H 2A1DB 2HPQH 3KQDL 2BO2A 2OLGA 4OS6A 3MYWA 3ZVCA 5T3HA 4AYVB 3ZZ3A 1AFQC 1S0QA 1PPBH 4P00A 3IJEB 1D4PB 4TWWA 1JBUH 1N1LA 1PPFE 3FANA 4FUEA 1RTKA 2HLCA 2VIOA 4YOJA 3A7YA 1K0HA 1YUGA 1DVAL 2BZ6H 1K1MA 1A3PA 1LVBA 1UVPA 5KECA 4JZEL 1P04A 2FOAA 2W6ID 2O8UA 3CS0A 1THRH 1GI0A 4Y11E 1BHXB 2ILNA 2ZTZA 2ALVA 2P3TB 1MU6B 1LPKA 3E91A 2ZO3H 5BRRE 3A84A 2BDYA 2VIDA 1AGJA 1LTOA 1SLXB 4JZIA 2FDAA 3RU4E 2AEIH 1P2JA 4X8VL 4GVUA 1GBKA 4AB9A 1NFWA 1QBOA 1TPGA 1W3CA 4XBBA 2O8MA 2PR3A 4TPYA 3TZIA 1V2PT 4I32A 1GMDF 1SMFE 3A81A 3RU4D 3ZV8A 2RFKC 5DP9A 1G3CA 4WMDA 1XFEA 2BSFA 1IQLL 1P06A 3CA7A 2P3FL 2B7DH 1NFXB 2FO9A 2RA0A 5AF9H 3HS6A 3LIWB 3URDA 1Z1IA 3BSQA 5JBBE 4HZHA 4DT4A 1GHXH 3SJ9A 2AIQA 1LCYA 4ISNA 2BLVA 2G00A 3RXPA 2MHPA 1DS2E 3W95A 1IQML 2W2PE 4A7IB 1N8OC 3ZVGA 5KIRA 3OYPA 1EASA 5EJLA 1GJDB 1UTKA 3K9XA 1S82A 2KL7A 3A8AA 3ZVBA 1O2ZA 1VITG 1IP0A 2BDBA 3N8YB 1ABIH 1OPHB 3A8BA 3GY4A 4OM9A 5BPEA 3RXDA 2ODQA 1MAYA 3CS7A 3OEED 1HFDA 2WPLS 3EE7A 1NBME 3TH3H 1GHAF 4KELA 2TGPZ 3U8TH 1CT4E 1PJPA 1SGFG 2W3IB 3N99A 3KHVA 3PV4A 1QJ7B 4ZUHA 3ITIA 3VB5A 3ZZAA 2Z3EA 5EODA 1E1QD 5DKMA 2OK5A 1TGTA 2Y5HL 1A61H 2VRSA 1TRNA 4IGDA 1EAIC 4RT1A 3F0PA 2A31A 2WPIS 2DDUA 1O5GH 1CGJE 1W0KD 2V6NA 2ZHDA 3PMJA 1AUTC 4G1MB 2RCEA 1Y3YA 4OS4A 4DOQA 4B73A 3KF2A 4UFGH 1CA0B 3UNSA 1TLDA 3UFAA 1CA8B 1SFQB 4J1YA 2GZ8A 2XYAA 1FY1A 3ZZ6A 5C2ZA 4JYVL 2UWLA 4IW4E 2QYIA 3E1XB 2AGGX 1WCZA 1JIRA 4X6NA 2H9HA 4Y6DA 1LKAA 1C5SA 4FUJA 3RMNH 4IS5A 1SG8B 5C17A 3ZYJB 1LHEH 5EOKA 1COWD 5T6GA 2HWLB 3MQEA 1EAUA 4D90A 3FAOA 2ZECA 3LIWA 2WPDD 4MQAA 2BDCA 4NA8A 2P95L 1BF9A 3NWUA 4Y7BA 2CV3A 2ZFTA 3A87A 5K7RA 2M5TA 4MMXB 1DVAH 4X1NU 1CHOF 1C2FA 1TMUH 7ESTE 2VIVA 1KIGH 1O2VA 1FX0B 5TJXA 1V2QT 3MU0A 2OCVB 3PLBA 3RM2H 4AQTA 1EZUC 1GI1A 4JZDL 2PWXA 3KGPA 3T28A 4KP0A 2BZ6L 4D0FA 1YO8A 3KL6A 3P8NA 3SYJA 2ZU4A 3HATH 1E79D 1O3LA 3OE7D 4U01A 1UVTH 2XBWL 2Y7XA 1XXDA 2BTCE 3VG8A 1RGQA 3WWBA 1G1QA 1TOMH 4I86A 1KXFA 4I8HA 3SOSA 1GDUA 4RN6A 1TGCA 1ZSKA 1QBVH 1EQGA 1X7AC 3MTYA 1A7SA 4BAMB 3WWFA 2UWOA 3D23A 5EGMA 2ZFRH 5F1AA 3SU0A 1Q4GA 4IC5A 3CP7A 3RMMH 1F92A 1AKSB 1EATA 2XNDD 4YLUA 1IOXA 2H9EH 4A1TA 3F9EA 1OKXA 1T8MA 3SGQE 1V2VT 2ZI2H 2GT7A 2A5KA 2HRVA 3Q76A 2D1JB 5LPRA 3ATKA 2QE7D 1HT5A 1S0RA 3RXRA 1EMOA 1EB1H 5JVYA 2FZZA 5HGGA 2J34B 3HO5A 4O02B 4Q7XA 2PTCE 1GBFA 4RRZA 3UPEA 5LPFA 3RXCA 4Y6DB 1NPEB 3B8JA 4FU7A 2O8WA 1E0FD 4CUDA 4MDSA 4Y0YE 5F6MA 1DWDH 2ZP0H 2BQ7A 1PPZA 2JJ1D 4X8SL 4MNVA 4BAQB 1C5ZB 3KQCL 4MMZB 4FUDA 1RD3B 1YP9A 1P10A 1BMFD 3DEMA 1IQKA 3QTVH 1EOJA 4WY3A 4X8SH 2Z9GA 2QXJA 2XCNA 1J15A 1HAYB 2AMDA 4Q2KA 1BRCE 3UQVA 4Y7AB 2ZFQH 2ZGBH 1UTJA 2ANWA 5AVDA 1TAWA 1GI9B 3PWCA 2WPHS 2W7SA 1SZBA 4O3TA 3SQHE 4NCYA 4ZAEA 3KL6B 1EUFA 4CH8B 5C20A 1AY6H 4ABEA 1CVUA 2J4IB 2F9OA 2W26B 3RXJA 5DN6D 5I25A 1CA0C 2VVUA 1W12U 3BIUH 1MKWK 4ZCNA 5JPMH 1Z8GA 3LDXH 3SNCA 2WPHE 1D6WA 1ATEA 1VJ9U 5AHGH 3HO4A 3BPSE 4BTIA 1K28D 1TOCB 1XKBC 2QV1A 4TPIZ 1HAFA 1YF4A 3RC4A 2QC2A 2KX4A 4IC6A 3SGBE 2L74A 2H9EL 1IGZA 1W7XH 3UUZA 1GDQA 2ZHEH 2G00L 3RU4T 4CBNA 4C16A 2STAE 3S7KB 1W7XL 2V3HH 4BANB 5FDQA 5K0HB 4WXVA 1LPZA 2Y5GA 4Z0LA 1QBNA 2J94B 3KNXA 1PQ5A 3O8BA 4ISHH 3QK1A 3TLOA 4GHQA 2GZ9A 1K22H 2WYJB 3KK6A 4Y10E 5EJZA 4D9QA 4JZDH 1C1WH 3HKJB 3KQDA 1GCTB 1UJ1A 3BTDE 2FODA 3LGTA 3M7QA 3VGCB 3LGYA 5F8ZA 5GCHF 3QZRA 1ANBA 2H1UA 4BAHB 2VVCK 2BQ7B 1ZGIA 1ELVA 3GDVA 1IQNA 3ELAL 3PO1C 1ADXA 2R2WU 4JZ1A 2XRCA 3D65E 4NFEA 4CRBA 1A5HA 1HJ7A 1CO7E 2ZF0H 1WOFA 1S6HA 1O5EH 4Q4LA 4DW2U 3OLUA 2TBSA 1TPOA 4JZFH 4WJG2 3SJOA 3SU6A 4MVNA 1XKBA 3URCA 3GY8A 3A80A 1DWEH 1QRXA 1F7ZA 2BB4A 1KYNA 3Q7DA 2Z7FE 3HPTB 3GISB 4R8TB 3STIA 1IQJL 4XL1A 1ABJH 1QFKH 2QCYA 1DXPA 8KME2 4LORA 3GCXE 1HX2A 2BD3A 4BOHA 2EI6B 2W3KB 4MTBA 5A0CA 2D2DA 1O2HA 2Y7ZA 5EQRA 1BB0B 3DD2H 1V2WT 4RRWA 2A4GA 4X8TH 4XE4A 3RP2A 1UTOA 3TGFA 1GK5A 2J4IA 1WUNH 1EJAA 3TK9A 2W3IA 1SPJA 5C5NA 3MH6A 4YT6H 3TH4H 1EQHA 4AFQA 1O2UA 1O2KA 1LKBA 3EYDA 1NU7B 1ZTKA 2GT8A 2F83A 4HTCH 3L6PA 3M36L 3FN8A 3KCGH 3QLPH 5CHAC 1DSUA 1S81A 3Q3KA 3BTKE 3RXBA 2PSYA 5T6DA 4Y76B 3E8LA 4NZQA 3GCTF 1LQEA 1BA8B 4DJZB 2VWNA 3KN2A 1NRSH 2WPJS 1JRTA 4FVDA 2PFEA 2UWPB 1IQMA 2VINA 1KTTB 2AIPA 4BNRA 4TSFD 3OTJE 3FOAA 1EAWA 1ELEE 1IQEA 1UK2A 1D3PB 2XW9A 1P2QA 4FUGA 1XDTR 5FPYA 2Y81B 1LVYA 1QNJA 3R05A 1O3DA 3A8CA 3FO8D 2JJLA 2ZU5A 3NUMA 3PRBA 2C3SA 1JWTA 4NWLA 2KV4A 3W94A 1WYKA 1W11U 2WSSD 1MCTA 1GBBA 4GCHG 3Q3XA 1O3HA 3E16B 2XBWA 2ZPSA 3EA8A 2BVXH 1K1OA 3IWMA 5FHTA 1QB1A 2NU2E 3UREA 3PMHB 1FNIA 2A2XH 3QMOA 3B23B 4TY6A 1IOEA 4Y7BB 1O2IA 1XUGA 3H5CB 4BTTA 1O3AA 1NBMD 1W0ZU 4AG1A 1QURH 2BQ6B 3ODFA 3GYLB 1DITH 2GCHG 4A6LA 5FBIA 1GPZA 1UMAH 2XC5L 2BD7A 2PKSB 3QDZB 1GBMA 3VXEH 3N8ZA 1DWBH 1NRRH 1QIUA 4ABAA 1JMOH 1EZQB 3RXIA 1PRHA 2EI8A 1GL0E 1TNIA 2BQWA 4X8TL 4RSPA 5EQSA 1BBRH 1COUA 1U67A 1C5WB 1LHFH 2HPPH 1MQ5L 4A92A 1NRPH 1RXPA 2Y7XB 3DCLA 3I78A 4I8GA 1NU9A 1Z1JA 1O30A 2BOKA 4NGAH 2F9BH 4AB8A 3DUXH 1RTFB 2AMPA 2XWBI 2STBE 2AH4X 2ASUB 3A82A 2WUBA 2F9BL 4CUEA 2KCPA 1HZ8A 5FPTA 3AVZA 1NFYA 1V2UT 1Z71A 2XBYA 5IKQA 1BRUP 2PP6A 3MHWU 3UY9A 3M35A 3SUFA 2UWPA 3MI4A 4SGAE 1UHBA 1K36A 3BTHE 2BY8X 3OX7U 4NZLA 5A2MH 1O2RA 4Y71B 1SLWB 2F9NA 4OTYA 3MH5A 3DFJA 4MG3A 1HREA 2ZPRA 5GCHG 1NM6A 2Y81A 2IJOB 4UD9H 1DWCH 2ZDVH 2PKAB 3DA9B 1MMJN 1FJSA 5PTPA 5FPSA 2PR3B 4GUXA 1FAKH 3LU9B 3PLPA 3T62A 4AOQA 2G52A 4YZUA 4DIIH 1O3MA 3M5LA 2ZA5A 5J4SA 1W13U 3F2HA 1QL7A 3F6UH 2VWOL 1V2OT 5DSFA 1MTNB 1IHTH 1LPGB 5E0GA 1YGCH 3SZEA 1Y5BT 2NU3E 2FLRL 1LDTT 4CRDA 1W0YH 3F9GA 6GCHG 3UQOA 2VH0B 5EW2H 5FX5A 3PROA 3UNQA 1Z6EL 1CEJA 2ULLA 3FP8E 2ZGHA 1NESE 2VJ3A 3ZZ5A 1S6LA 3K9XB 1ANDA 4HI3A 3UOUA 3ZYEA 3SNEA 1EPJA 1FPCH 2OD3B 3O8DA 3EE0B 1BMAA 1DDJA 1GJCB 3HS5A 2D26C 3LH3A 4AFSA 3MO9A 1HJAC 3RXTA 1HAEA 3SQEE 4AORA 3VB4A 5JB8E 2F9UA 2GMTC 4MNWA 1G1TA 2HNTF 2Z3DA 4LZ1H 4YLQH 4DT7B 3T29A 3PRDA 2A45B 4U2WA 3I29A 1QL8A 3N8VA 2OC8A 3GDUA 3BG4C 6CHAB 1HYLA 3RXSA 3LJOA 4RI0A 4BTIB 1O36A 1HJAB 2RNLA 1IQIA 1SGTA 2KFWA 3FCSB 2GD4B 3QX5H 1CCFA 4JYUL 1O3NA 4OS2A 1TBQH 1PGEA 1C5PA 1NFYB 2W6JD 1AE5A 2ADXA 1G2MA 1KXBA 1IQKL 3WW7A 2C8ZB 2ZHWH 1MD8A 3PWBA 3ZVAA 2VIWA 3M3SA 1APOA 1F5KU 1GJBB 1K1IA 2YMSD 1ANEA 5IKTA 4Y71A 5K0HA 3ZYGA 3U73A 1PPEE 1T31A 1QR3E 2J94A 2A5IA 4D8NA 1WQSA 4GCHF 4BDWA 4B75A 2UWLB 4Z6AL 2A7CA 1P3CA 1PTHA 1CBWC 1UTMA 1H1BA 2GKVE 3PTNA 4ZXYH 7GCHF 1SLVB 3TGIE 1E1RD 4YZUB 1CSOE 1QHRB 2CMYA 4QT8C 2FOMB 4B74A 5LH8A 3ZZ9A 1WU1B 1GWAA 2J2UA 5C0TA 1F0UA 1C1SA 2K8IA 1N8OB 1LPGA 3LC3B 4U30A 3IG6B 1OSSA 1FY5A 4RT0A 4B6EA 2GP9B 3UNRA 1HXEH 2BD5A 2Q1JB 1TNLA 3PV2A 1O2YA 4X6PA 1DPOA 3V13A 2XBXL 3KYFA 2PUXB 3BEUA 3GICB 2EY4C 2HVXA 1XVOA 1UZJA 1HGTH 2ANMH 5L6NH 1FXYA 3POYA 1F5LA 1FIZA 4K69A 3RMLH 1YPMH 2OYEP 4CRAA 1DFPA 1HPGA 1L1NA 1TMTH 5TCCA 5EW1H 1FAXL 1T8NA 4RKJB 2VU8E 2ZCHP 2Y5GL 5IK2D 1BMMH 1IQEL 2ZKSA 5LPEA 4NIXA 1TNGA 3MNSA 4B6FA 2WPLE 4KGAA 1HAXB 3C27B 4ABJA 4DVAU 5KEDA 1EJNA 1SHHB 1IQFA 1HJ8A 2RDEA 2FLBH 4YTAA 2LP6A 1Q31A 4YO9A 2WPIE 1P01A 2QGRA 3P95A 4ACBA 5EGMB 1H9IE 1SGQE 4AGKA 1F7MA 2A0QB 1HAIH 2O8LA 1BT7A 2GD4A 5C5OA 3FFGA 5EXLA 2LELA 2A5AA 1E36B 4X1SU 1TLEA 1HLTH 4ISLA 1TALA 2FOBA 1CQQA 1O2XA 1OWIA 2H6MA 3RXFA 2SGAA 2BVRH 2BX3A 3ZZ7A 1ESTA 1F0TA 1AZZA 2J9NA 2QF0A 2P3TA 5HM2A 2FOFA 1ZPBA 1O39A 4ZHLU 1UVSH 2EQNA 1TIOA 3F0OA 4Q80A 1A1RA 4YOGA 4O3UA 4NSYA 1O2OA 1BJUA 1J16A 3FKSD 3MFJA 3R0FA 5C1UA 5CDFE 1AO5A 2BYAX 1DY8A 4LOYH 3GY6A 1JIMA 1DX5I 1EJMA 2A7JA 3NKKA 4K8YA 1SC8U 4HFPB 1O5DH 1FY3A 4FETA 2GVFA 1NFXA 1KXAA 4H4FA 5C94A 1EPGA 4A7IA 2UUKB 1EX3A 1QGFA 3LPRA 3STJA 2BQ6A 1QCPA 2BY5X 3RXEA 1URKA 2VBCA 2FI3E 1WTGH 1Z7KA 4NA9H 4DY7B 5FL7D 1W10U 1SGPE 2QY0B 1EZQA 3ZVFA 2EI8B 4NA9L 1ETSH 2BQWB 1YPHE 1OYTH 1SLUB 1YPHC 1LVMA 5HIZA 1RJXB 3OY6U 3OU0A 1FDPA 1C5XB 3MOCA 5HKKD 2G81E 1KLTA 1OWJA 2J38B 4I7YH 2Z94A 1K21H 2WFXB 4I8JA 3LTGD 1A2CH 3UAIC 1BUIA 4E06H 5DPAA 2GMTB 3W1EA 2FI5E 1THSH 3M5NA 4BTUA 1O2TA 2EA3A 2PSXA 4RRXA 2BMGB 2FYRA 1M9UA 3S9BA 2VWOA 5E0HA 3OSYA 1CGIE 4D76A 2K0QA 2YNBA 1ZZZA 5DP6A 5GPIB 5DP7A 2BDHA 1ELBA 1C5OH 1WBGB 4DCDA 1ZAQA 1JOUB 4B2AA 1UHBB 3A7ZA 4NSVA 1BBRE 1TX8A 2UUFB 5JBAE 1Z8RA 3BTQE 2WFTA 1X7AL 3RXHA 2WYJA 1DUAA 2ZFPH 1SGRE 1MUEB 1FUJA 1NN6A 2GZ7A 4OGYA 1KY9A 1FLEE 1KDQB 3SU1A 1L1JA 4X8VH 9ESTA 1MH0A 2W2NE 1GBLA 1W7GH 3Q3YA 1ZOMA 1AZ8A 3MNXA 3RM0H 1INCA 2VJ1A 2VWLL 1QQ4A 1YPKH 3A85A 1LO6A 2P94L 1ARBA 1A0HB 3GY7A 4UFDH 3P70B 4NG9L 5GDSH 3A83A 5JYIA 2PHBB 1MBMA 1UZQA 2ZZUH 2C90B 4MLFB 1OOKB 5CHAB 5EQQA 1TGSZ 1T4UH 5F8XA 1VZQH 3Q77A 1GBTA 1V1IA 1QZ8A 1T7CA 5GXPA 5L2YL 1A0LA 2WPME 1GDNA 2XWAA 4YT7L 1MZDA 1VITF 2PUQH 1T32A 1W0JD 2EI6A 2W3KA 1TNKA 4NIVA 1C9TA 1HAGE 2BZAA 1UK4A 1HAVB 4ISIL 1H9LB 1XUFA 1P11E 3LH1A 2KAIA 3P8OA 1PPGE 1QRZA 4CRCA 1H8DH 1FJSL 2H9TH 5EG4A 1C2JA 3RXUA 3SHCH 2KM0A 3P92A 1C4V2 4WMEA 5E8DA 3GY3A 1HDTH 3TPIZ 1ANCA 2TGFA 2BMGA 1V2KT 9LPRA 1P8VC 3BTGE 5B6OA 1ELGA 4Y76A 3UIRA 1G2MB 4NGAL 2BXTH 3MDLA 2R2MB 2XBXA 4F4OC 1ZHPA 1DXWA 3TJUA 1DQBA 2D1JA 1QB6A 4JYUH 1HIAA 4X8UL 4Q7YA 4UE7H 1GCDA 8GCHG 1D3TB 1C5MD 2EC9H 3UTUH 1OP2A 3ATWA 3O8RA 4JK6A 3S9AA 1A5GH 1CHOG 3MH7A 1BTPA 1UCYE 1UTLM 2JH0D 1BIOA 3LC3A 1CHGA 1EOLA 2HLDD 1UTQA 4INKA 2P3FN 2XC4A 2H2ZA 1KSNB 2PHBA 1C1VH 1TPAE 5EU8A 2Q1JA 1P2KA 2Z9IA 1IQIL 2SGDE 1OWKA 2WPMS 3BT1A 2FTLE 1O2JA 3AK5A 1OS8A 3FFGL 2XC0L 1V2LT 1C2IA 1C5UA 5CISA 1D9IA 1O2NA 1JV2B 2BVSH 2QF5A 4ZH8B 2JETC 3SZNA 4K8BA 3OTPA 3UWIA 2R0KA 1O32A 4A1VA 2SGFE 1XKAC 1DT2A 1L1GA 1GMHG 1EKBB 3BV9B 1WSSH 2SGQE 4K3JA 4D7GA 1MQ6A 1C1RA 3M5OA 1H8IH 1H8HD 1C5YB 3TK5A 3SNDA 1Y5AT 3ZYDA 3F9FA 2ZHFH 3NK8A 1D3DB 3SI3H 2OTVA 3GCNA 4U32A 2EI7A 3LN0A 3GY5A 1E34B 3LC5B 5HXFA 1Y59T 1Z8JB 2YOLA 4I8LA 4YESB 1O3EA 3C9AC 3M7TA 4IMQA 1EPHA 2C8WB 1QQUA 2G5NA 3RLYH 1C2MA 1J17T 1HBTH 1L2EA 2B7DL 2B5TB 1L0ZA 1G9IE 8LPRA 1LPZB 1RS0A 4WF8A 5EXMA 1HIAB 1GG6C 4NG9H 1ZHMA 5L2ZL 1BCUH 1GHWH 2Z9LA 1SGCA 1AU8A 1AFEH 1OX1A 1Y3WA 4X1RU 1YKTA 4KTUA 2B8OH 3B9FH 2JH6D 1OYQA 1AB9B 1TB6H 2A32A 5JBAS 1OHHD 1IQFL 5CHBA 3BEIB 2ZCKP 4XBCA 4GLYA 1KSNA 1NO9H 1IQNL 1Y5UT 5B6LA 4X2VA 2J5UA 2QXIA 6COXA 1AVXA 2VB0A 2V3MA 2NU4E 1YCPH 1EAXA 1ORFA 3MU4A 5DO4H 1JRSA 1PQ8A 1RRKA 3LGVA 3AAUA 4FUBA 1NTPA 1GI3A 1ETTH 2XXLA 3K6ZA 4MPUA 2SNWA 1IQJA 3HK6B 3SJKA 3NTBA 3TK6A 1UTNA 2A4QA 3EA9A 4YOIA 3RXKA 2P8OC 1DSTA 1P2NA 2J38A 2PTNA 1SQAA 3S7HB 1C9PA 1C1UH 1K9OE 4UFEH 3A8DA 3QH0A 2BM2A 3OEHD 1YY3A 1O5BB 1GMCG 3SW2B 2HOBA 3TK5B 2ZFSA 3D62A 3E0NB 2C4FH 4BTUB 3NRLA 3TBDA 1C2EA 7LPRA 4F55A 1GG6B 1QL9A 4JK5A 1N1IA 2AFQB 1BMLA 4FM5A 1TGNA 3LGUA 2NU1E 1B0FA 2OUAA 1G30B 1FSBA 6LPRA 5CE1A 3FP6E 4I31A 1NT1A 2WV5A 4Y79B 3PM3A 2ZEBA 3KQEA 4CBOA 1FPHH 5DGJA 1ELTA 2AYLA 3AW0A 3MO3A 1TPPA 1SQTA 3V12A 2VWNL 4X6MA 3ZYIB 4ZHAB 1HJ9A 4H6SB 3BN9A 4CH2B 2OP9A 3SJ8A 1TBZH 3SV2H 1NC6A 4XDEA 3NJPC 1XM1A 2HNTC 3QO6A 1UCYH 1O0DH 2JKHL 3ATLA 2FOEA 1UVUH 3EAJA 4ASUD 2FS8A 3L33A 1MD7A 5COXA 2J97A 2ZDMA 2ZG0H 4ACAA 3N8WA 4AN7A 2P16L 1MTWA 4PH9A 2BT7A 2LNCA 5C1XA 3V7TA 4K2YA 1AVWA 1CGHA 1JBUL 2JETB 1ZSJA 4GU4A 4ABIA 4FOUC 3RXVA 1O3PB 2I6QA 1G3EA 4J2YB 4B2BA 3M7UA 3HS7A 1C1OA 4TGFA 3GYMA 2O8TA 1M1XB 2MGPA 4JZFL 1ELCA 1SR5C 3SUEA 2XCFA 4X0WU 3P6ZB 2XC5A 5FXLA 1B9WA 1OB1C 4K5ZA 1QFKL 2BD2A 3G01A 3U1JB 5A09A 1DUEA 1ZHRA 3TK6B 1AIXH 1HAVA 1MZAA 1EMNA 1PFXC 1GJ7B 3KEEA 3LTFB 2GX4A 2BLQA 1EPIA 3DFLA 3OFND 1XUIA 1CE5A 4ABHA 1SQRA 2ZC9H 3TVJB 1K37A 1XXFA 1CBWB 1BMNH 3HGPA 4Q7ZA 1GBDA 3OAAD 4E05H 1FIWA 5CKNA 3PMAB 2VWLA 4F48B 4Q63A 2CHAC 3JZ1B 2P94A 2FX6A 3BTTE 1P2OA 4E7RG 1FMGA 1KLJL 1P2MA 1E37B 4ASHA 5IDKA 2VIPA 2BX4A 2SFAA 4X1PU 4NA7A 2V7QD 3N7DA 1O5DL 1P09A 1KIGL 3U9AH 4KKDA 3C1KA 1BRAA 1FF7A 2GGVB 3U69H 5F19A 3TGJE 3SHAH 2Q6GA 5DP4A 2ZDNA 2IJD1 1VKYA 3PGHA 1P03A 2BDIA 2WHXA 2AYWA 2J98B 3SU4A 1Q2WA 3PYHA 3NT1A 1WAYB 1G37A 1MKXK 3N8WB 1NRQH 4BAKB 4COXA 3E3TA 3A89A 3VFEA 3F9HA 3SORA 5HIYA 3RXQA 2C8XB 4D0EA 5C67A 1SGEE 3IITB 1WV7H 3ZV9A 2V0BA 3FZDA 5FCRA 3E90B 4K1TA 5FCKA 1V2NT 1O3GA 4H42U 1TBRH 1C5RA 3T5FH 1ZGVA 1SB1H 2F9VA 2Q6DA 4FU8A 1DY9A 3LAQA 3AASA 2FMJA 1CT0E 1NZQH 1GBIA 1AUJA 1MU8B 1P02A 2PW8H 1B5GH 3N7EA 3TJOA 1K1NA 2QA9E 3BF6H 1DOJA 3VXFH 5JB8S 2WZQA 3ZVDA 4B71A 4BAOB 2ODYB 4XOJA 2EI7B 4ZKOU 1FE2A 4ZKRU 1AVGH 3GCHC 4DG4A 1TWXB 1QTFA 2BT8A 3K2UA 3M5MA 4O1ZA 1EPTB 5JDUB 2YNAA 5F53A 2JIZD 3QCWA 2G5VA 5JB9E 2AHME 3F1SB 2XC4L 3SUDA 1BDAA 4AYYB 2VVVL 1GGDC 5FX6A 1JXPA 5E0JA 1S85A 1TQ0B 1PFXL 2QIQA 2VWMA 5AFZH 2FIRH 1A46H 4GAWA 5EJ1A 2XC0A 5FBEA 2Y5FL 5DP3A 4AFUA 2GDEH 3ESTA 2H5DA 4K1EA 2V35A 5DK1A 1A0JA 4O03A 6GCHF 4NWKA 1C1PA 1G1SA 2VH6B 1HAZB 1O5FH 3U28C 3SOQA 3U7UG 1C2KA 1HT8A 1BTWA 3GS9A 1AMHA 1BHXF 1ZJKA 2RHPA 3M37L 3D49H 4FVBA 3VB3A 2KNIA 1IHSH 4LMFA 1HAPH 2UUYA 3M61U 4XFQA 1ETRH 2J2UB 1WU1A 3T26A 3TITA 1GI8B 4GPGA 1LQDA 1TPSA 1TX7A 4JYVH 3Q00A 1WDIA 1AN1E 5HYOA 1KKEA 1O2MA 2THFB 2BOHB 1SGDE 1XUKA 3IITA 2P8OB 4UDWH 3P8FA 1YCPM 4HGCA 3UB0A 4WWYA 1S84A 3FBYA 1LMJA 2ANYA 1RFNA 2F43B 5L30H 3PB1E 5EPNA 2ZGCA 1ARCA 4FUFA 1Z6EA 4DIHH 1Y3UA 2NPRA 3PLKA 3SN8A 2RA0L 3SBKA 4E7NA 2ESTE 2WV9A 1SQOA 2GJGA 4R0IA 1F0RA 1GBHA 2CXVA 1CVWH 1O31A 3LONA 1OP0A 5EPYA 3F2GA 1C2HA 4Z0KB 2AERH 1B0EA 2FTMA 4AGJA 1FAXA 2KAIB 3KQBL 4OS7A 2FD6A 1UO6A 2SGPE 1EXFA 4ZXXH 1C5QA 3HO3A 3E0PB 3S9CA 2Y80A 1O2SA 1QB9A 2SGEE 4ABFA 5GNDA 1P3EA 1ZPZA 1FY4A 1ELDE 1K1PA 2VIQA 4UONA 2Z3CA 4IN2A 3U8RH 1EFRD 1SBWA 1D6RA 3CS7L 2P16A 1C5LH 5DP5A 3PMBB 1C1TA 1TRYA 4IMZA 1QA0A 1MKXH 1KXEA 3S69A 2FEQH 2RDLA 3ZZBA 4BXSA 3GCOA 4FUIA 4LXBH 2I9AA 3CFWA 3TGKE 3KQ5A 4ZHAA 3A7TA 1MTSA 2YGPA 2IN2A 1O2QA 4H6TA 1ZRKA 3V64C 4INLA 1KLIH 5T6FA 1VR1H 1MOXC 1TA6A 1PPCE 1FQ3A 4X2XA 4MPXA 3QWCH 1FFMA 4WH8A 3HGNA 2P3UA 1O3BA 2DE8A 4YT6L 2QXHA 3SV7A 2AGEX 1O5CB 4SGBE 1LHDH 2C8YB 1LPKB 1C2DA 8GCHF 2WPJE 2M2AA 1NQLB 1C1MA 4DGJA 1YPJH 2BXUH 3AAVA 3OY5U 1GHBG 1EAIA 2DE9A 4CRGA 1IQLA 2PGQB 1W8BH 2Y38A 3KQEL 1P05A 2ZGJA 3BTWE 2BLWA 1PYTC 1V2RT 5LGOA 1G2LB 4RUTA 1FY8E 1QA7A 4KTSA 2KZ4A 4TYDA 3TU7H 3F2FA 1GHBF 1J9CL 4F49A 3PTBA 3MNCA 3GCWE 3TNTA 3MO6A 4E1GA 1OWDA 3A86A 2FWWA 1G3BA 2CF8H 1YLNA 5C3NA 1GI4A 3SOBB 2WZPP 2YMSC 1KMHB 1CQEA 2BHGA 2HNTE 3UR9A 3BTEE 1P9JA 5H4IB 4AFZA 2JDID 1O2LA 2EEKA 3V65B 1EQ9A 1VCWA 1TFXA 1GVKB 1NT0A 1ATDA 2AGIX 3ODDA 3LGWA 1OWEA 1BZXE 3EA7A 4M9FA 2OC1A 3SNAA 4PROA 1FZZA 4VGCB 2K1QA 1EBVA 1HRTH 3GISX 1FI8A 4CREA 1AWHB 2RA3A 2A2QH 4MMYB 2YGOA 1BITA 1DM4B 5A8XA 1GJ6A 2FLRH 1F7EA 2OINA 1Z6JH 1MABB 2XBVA 2H5CA 1TONA 1CCVA 4MNYA 3SU2A 4RRYA 1O38A 5DJ7A 2ZU3A 1C1NA 4XRNA 1L5GB 2F9PA 2WV4A 4TY7A 2W5EA 3QGJA 2A4OA 1L3YA 1FONA 1RTLA 5CKMA 1KDQA 1GCTC 2VNTA 3QUMP 3VGCC 3H7OA 1C1QA 2FP7B 1GI6A 1TX6A 3UR6A 3VB6A 1BJVA 5JBCE 4NIYA 1S6FA 4Y8YA 3MU5A 5TCAA 4AG2A 1H9HE 4RKOB 1CVWL 2FZZL 1G36A 2TRMA 1LMWB 1SGIB 1C4Y2 1XKAL 1O37A 1U6QA 2WG3C 1ZMJA 1P57B 5E2PA 3DHKH 1ATBA 4ISHL 2JH5D 2P93L 1W8BL 5HMAA 3BTME 1QRWA 4X8UH 3T2NA 3ZIAD 1D3QB 4MPWA 1IQGL 2W2OE 4XSKU 2H9EC 1SGYE 3KQCA 4Y8XA 2B0FA 2BY9X 2P95A 4JCNA 3EDXB 2RG3A 3T27A 1OP8A 1EGFA 1HNEE 4CUFA 1IAUA 1NFUA 1HV7A 5T1VA 4P02A 3N7OA 3RC6A 2WYGA 4KTCA 4XD7D 1RIWB 1FN8A 2R0LA 3SU5A 1MTUA 1P12E 1ZJDA 3SW2A 4LZ4B 1IJQA 1HXFH 2BLOA 1APQA 5A0BA 5JBCS 1DICA 1XVMA 2M74A 2ZTXA 4XLWA 2IPQX 2B9LA 2Y82A 3M3TA 4LK4A 4Z6AH 5GWZA 5A0AE 3SOVA 2A4RA 4WXIA 2L6OA 2G51A 1YGCL 1UZKA 1BTZA 2WUCA 3UOPA 2SNVA 4OS1A 4Y8ZA 2VVUL 5ESBA 1P0SL 4AZ2B 5L2ZH 2W2QE 3V0XA 4IN1A 3ZZDA 6ESTA 2VVCA 4I8KA 5G4BA 3S6XA 1ZSLA 1H8ED 1GMHF 1VGCB 2W86A 2Q6FA 3KCGL 4ABBA 3ZZ4A 7GCHG 5L30L 3CENA 1GJAB 2GCTC 1GL1A 2TGTA 2R3UA 3H09A 4B2CA 2G55A 1G1RA 1WTHD 2C93B 4X6OA 2QAAA 2VH6A 4YM9A 2PGBB 2BY7X 1GJ5H 1O3OA 1P2IA 1VCPA 1GBEA 1UZPA 3U1IB 2ALPA 1LHCH 1O3KA 1GMDG 3KQBA 1Y3XA 2ZGXH 3L3TA 1O2GH 4ZXXL 5DG6A 5E2OA 2WINI 1TGBA 3BT2A 1A3BH 3FVFB 3ZZ8A 3RR3A 2FLGA 3RXLA 3VPKA 1C5MF 2J34A 1GBAA 3RXGA 1RFNB 1GVZA 5IYTA 2KB9A 3ATIA 2VVVA 1ACBE 2HVYB 4ZH8A 1TYNA 1T4VH 2D8WA 3JZ2B 3NCLA 4INHA 3SJIA 4TWYA 2W7UA 1OWHA 2GV7A 2ZU2A 1YLDA 4FU9A 1NFUB 1IQHL 4VGCC 2BY6X 4Z0KA 4CHAB 1XX9A 3SGAE 4NIWA 2K2SB 1GHAG 1ZMNA 1O3CA 2GV6A 1DLKB 2CGAA 2Z9JA 2HGTH 2CHAB 1O2WA 1QY6A 3SV8A 1AWFH 2FYQA 4ZMAH 1K2I1 2BD4A 2ZDLA 4A94C 2ODPA 3ENSB 1FAKL 1O33A 2OXSA 1MQ6L 3FP7E 1GJ4H 4FUCA 1NROH 4Y7AA 5AFYH 4YXWD 3LC5A 3GDSA 2OYUP 1YLCA 1Z6CA 1WQVH 5ESTE 5CKQA 5A8ZA 2FI4E 1B7XB 3MWIU 2G4TA 1KLOA 3A7XA 4ZAEB 3MMGA 1QJ1B 1CT2E 4WVPE 3QTOH 2OQUA 4B1TA 1GJ9B 1BRBE 2QF3A 2P59A 3GY2A 1I0UA 4JZEH 1AI8H 1E35B 1F5RA 1TNHA 2ZIQH 2ZQ1A 4M7GA 3M36A 3RXAA 1AHTH 3UWJH 1SOTA 2F91A 3RDZA 2DUCA 3LN1A 3TH3L 2ZWLH 3DSOA 3OLTA 4A1XA 4UFFH 1AE8H 2AS9A 4M11A 1WHFA 1BTUA 2NWNA 1VITH 4OGXA 3MU8A 3KRKA 4X2YA 1NY22 2CF9H 1Z8IB 4MPVA 1ZYOA 3LT3A 4XBMA 3P5BL 3DT0H 3LKWA 3FZZA 3SU3A 3NPSA 2FOGA 2FS9A 1C5NH 1WXRA 2WG4B 1VCQA 3V3MA 2V3OH 1F0SB 2ZDKA 3GCTG 1P0SH 3I77A 4D9RA 3U8OH 2HOXA 1WHEA 1AUTL 1SGFA 4ESTE 3NZIA 1YCPK 1EP6A 5JBBS 1IOEL 1G2LA 3KIDU 3DSPA 2GCTB 2K2TA 4JYTA 3SO3A 5C0UA 1FV9A 2BDGA 5KN5C 1LK9A 2Z6BD 1EPTC 1ZTJA 3GOVB 1NZIA 2J95A 4GU3A 2J92A 2Y6TA 1C2LA 1TABE 5IKRA 4FUHA 3RLWH 4CRFA 3F3BA 3HK3B 3P17H 5J4QA 1TE0A 4FXGH 1MQ5A 1U8CB 1EPTA 1GJ8B 2QN5T 1ZMLA 1YUKB 1GHVH 4CR9A 2OC7A 3RXOA
chains in the Genus database with same CATH topology
5GIBA 1SOZA 4Y79A 1LMMA 2XTTB 4WMFA 1UTPA 2I6SA 1EP5A 3RC5A 1BTHH 1RIWC 3M3VA 2P93A 3TJVA 1DIYA 4M10A 2ZHQH 1ATAA 7KMEH 3WY8A 5ETXA 1TRMA 1S5SA 2YGQA 4IBLH 5ABWA 1IQGA 5JB9S 4WH6A 3EGFA 3BEFB 1MBQA 1PQAA 3NTGA 3Q3KB 1GVLA 1TNJA 3MNBA 1SVPA 3SNBA 1SGNE 1AFQB 1ESAA 2ZFFH 4I33A 1ESBA 1O3IA 1HUTH 1MTVA 1NPMA 1LQDB 2FPZA 5A8YA 3EQ0H 4CR5A 2PV9B 1E38B 1KLIL 1HB0B 1YC0A 2BOHA 1S83A 1UVOA 2P28B 1KLJH 1ZPCA 1UCYK 3TJNA 5E8EH 2Z9KA 1P9SA 1NFWB 1YYY1 1DLEA 2MGRA 5F8TA 4ZKSU 1NRNH 1T8OA 1L4ZA 1A4WH 1W14U 4ZXYL 1PYTD 3A88A 1GHZA 1LHGH 1LVOA 1BBRK 2GTBA 1DE7H 3CENL 1T8LA 3ZZCA 2XBVL 8ESTE 1QJ6B 1SI5H 2IPHA 4BTTB 2NU0E 1TA2A 3PO1B 1AB9C 3ELAH 1W2KH 1O34A 2FOCA 4X2WA 1SL3A 5EXNA 3N8YA 2ZNKH 3EGKH 2ZTYA 1SHYA 2OQ5A 1DDXA 1KXCA 2ZU1A 1C2GA 2O9QA 4ZKNU 1MAXA 2BOKL 1V3XA 2FXRA 3QZQA 5SGAE 2W26A 1A3EH 4NFFA 4Y0ZE 2BOXA 2OBQA 2WPKS 3MH4A 1VJAU 1JL9A 5DP8A 3QN7A 1O5AB 2ZDAH 1CU1A 2XBYL 1TQ7B 1V2MT 1HRFA 3SV9A 1IQHA 2F3CE 3F68H 3K65B 3TIUA 2OBOA 2P3UB 1ZLRA 3VB7A 1AQ7A 1O3JA 1C5VA 2FESH 2BDAA 2CJIB 2BD9A 2JKHA 1TMBH 4O97A 1NS3A 1THPB 3BG4B 4B76A 6CHAC 2ANKH 4GSOA 3H7TA 2AMQA 4BDXA 2HALA 1N6XA 2GCHF 1YPEH 1GI2A 3RUOA 4THNH 2XNIA 2PKSC 1K1LA 2PKAA 5CMXH 5F03A 5I46L 2Y5HA 4XBDA 1L4DA 4ISOA 4DURA 2TIOA 1XMNB 3U98H 1BOQA 1O3FA 3TNSA 1AD8H 4OS5A 4D7FA 4UEHH 5I46H 1QIXB 4CSYA 1CX2A 1J14A 1N6YA 1BTYA 3AW1A 1FN6A 4K1SA 1EB2A 2G8TA 1VGCC 1C5TA 1SFIA 2P26A 1HAOH 3R3GB 2VH0A 2UUJB 4X1QU 3SUGA 2ZQ2A 2I9BA 3N8XA 3O8CA 3GCHB 1GHYH 1ZRBA 2BD8A 2GDDA 3ENSA 5JBTA 1GI7B 1EZSC 3T25A 1BTXA 2FX4A 3RXMA 1YPLH 3HPTA 1Q3XA 1TOZA 4ABGA 3MU1A 1UK3A 2VGCB 1HCGB 3HKIB 3BG8A 1XUHA 2Y7ZB 3BTFE 1PPHE 3SV6A 4AX9H 4MNXA 3RMOH 4ZHMU 1V3XB 1ZR0A 1DX5M 2FLBL 1K1JA 4BXWA 1GBCA 4GHTA 3LJJA 3P8GA 4CHAC 2P3FH 5IKVA 1V2TT 2R9PA 2TPIZ 1GBJA 1YM0A 5L2YH 1SSXA