4BXSA

Crystal structure of the prothrombinase complex from the venom of pseudonaja textilis
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
326
structure length
248
Chain Sequence
KSCRVDNGNCWHFCKHVQNDIQCSCAEGYLLGEDGHSCVAGGNFSCGRNIKMDCKLGECPWQAALVDEKEGVFCGGTILSPIYVLTAAHCINETETISGEIDKLSVDKIYVHKKFVPPQKAYKFDLAAYDYDIAIIQMKTPIQFVPACLPTADFANQVLMKQDFGIVSGFKSKTLKVLKVPYVDRHTCMVSSETPITPNMFCADSGGPHTTVYRDTHFITGIVSSGKYGNYTKLSKFIPWIKRIMRQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FACTOR X-LIKE PROTEASE
publication title Crystal Structure of the Prothrombinase Complex from the Venom of Pseudonaja Textilis.
pubmed doi rcsb
source organism Pseudonaja textilis
molecule tags Blood clotting
total genus 37
structure length 248
sequence length 326
ec nomenclature
pdb deposition date 2013-07-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00008 EGF EGF-like domain
A PF00089 Trypsin Trypsin
A PF00594 Gla Vitamin K-dependent carboxylation/gamma-carboxyglutamic (GLA) domain
A PF14670 FXa_inhibition Coagulation Factor Xa inhibitory site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.25.10 Mainly Beta Ribbon Laminin Laminin 4bxsA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4bxsA02
1TX7A 3T27A 1HJ7A 4NSYA 4AFSA 1ATAA 1TGNA 2H2ZA 3ATWA 1K1JA 1NFXB 2FLGA 3MH5A 1LQDA 1A0LA 5FPTA 1Z6JH 4Y6DB 2GDEH 1AVWA 2VWMK 1ZJKA 4K3JA 1G1RA 4DG4A 1VR1H 2TRMA 5JDUB 4INLA 1NFYB 1BITA 1HJ8A 1H4WA 3LGYA 2ZNKH 1WOFA 1TNLA 2WPLE 3E0NB 1V2MT 1JV2B 2OC8A 4CREA 2ZU4A 2B9LA 1G1QA 2MGPA 3LC5A 3FP7E 3BTME 2ZO3H 1O34A 4RRWA 1BTUA 2VH0B 1S0QA 1NRNH 4GLYA 1P0SL 1S5SA 1UTMA 1N1IA 2O9QA 1S84A 3UR6A 1TPAE 1FY4A 4BTIA 1A5GH 2FPZA 2WYGA 1GMDG 1ZMNA 4WH8A 3RXDA 4SGAE 2RA3A 1RD3B 4UEHH 3LTGD 1NT0A 3SU5A 2F9UA 1TONA 4Q7XA 3FFGL 4Q2KA 5FCKA 2D1JB 2TGDA 1GMDF 1P12E 4QT8C 2Q1JA 4WF8A 1CA8B 1ZMJA 1XXDA 4CSYA 4K5ZA 1EP5A 3VPKA 4HGCA 4BAKB 1O3HA 2BOUA 3KCGL 1PPGE 1GL0E 5E2OA 2GD4B 2QF3A 4K8BA 3LGUA 4J1YA 4ABJA 1AWFH 1UTLM 1GI9B 1O2YA 3ZVAA 1EPTB 4GCHF 1LPZB 3S69A 2CJIA 1UTPA 1ELTA 1YGCH 3U7UG 1SR5C 3B8JA 1AKSB 2BQ6B 3PGHA 1C5QA 4Y79B 3KIDU 3RR3A 4AYVB 1AE8H 1F0RA 1VGCC 1ATEA 1OWKA 2C4FH 1BBRH 3TIUA 1GL1A 5A2MH 4D7FA 5LPRA 4XBDA 1WU1B 4UONA 4AZ2B 2H9EL 1NFXA 1HAVB 1F2SE 3T26A 3CA7A 4ASHA 3TJUA 1XKBC 2GX4A 2BOHB 4ZH8B 3GDSA 1V2KT 1E0FD 4NZLA 4Y6DA 3KQCA 1EGFA 1HB0B 1ZAQA 3N7OA 5L30L 2VWLL 3A7VA 4ISHH 1NFYA 1C2LA 1Y8TA 4X6NA 1MZAA 1AUTL 3IJEB 1SPJA 3K9XB 2VVCK 2P95A 1CU1A 3O8CA 2GKVE 1AB9B 3Q00A 4Y8YA 3SOQA 3NTBA 1G3DA 3BIVH 1HAOH 2J95B 1QBOA 1SHYA 4AORA 1TALA 1K2I1 1YM0A 4YESB 2BD8A 4YM9A 1B0FA 1APOA 1TPPA 2R3UA 4B75A 3C1KA 1GBMA 4CUEA 3AASA 4I8GA 1GHBG 5L2YH 1FJSL 2FMJA 1DVAH 3T25A 1C4Y2 4K69A 2VIQA 5ABWA 1IQML 2B7DL 4K8YA 4AG1A 1MAYA 2WV5A 2G5VA 1M1XB 1C5WB 2D1JA 3CS7L 1XMNB 5KN5C 1GHBF 1KY9A 5CMXH 3JZ1B 1LKAA 1KXFA 1GHYH 3SGBE 1ORFA 2P3FL 4ISLA 3GCTG 2ZGXH 3RM2H 1KLOA 2GD4A 1SGFA 1BMMH 3KL6A 5ETXA 4FUFA 1MCVA 4MNYA 1M9UA 1EPTA 4JYUL 1LPZA 5FX6A 3VFEA 1O2PA 3GCTF 5C1XA 1UCYH 1NRQH 1IQGA 1ZTLA 1AKSA 1O2KA 2BQ6A 2SGQE 4U32A 2AYWA 1MKXH 1TRMA 2W86A 5EQRA 1LO6A 4Y79A 4CRFA 4RS0A 3HO3A 1G3EA 4D7GA 3P8FA 1FLEE 2BXTH 3DT0H 1NO9H 2JH0D 5GDSH 4YT6L 1WU1A 1A7SA 1DWEH 1VCQA 3MQEA 3RXUA 5EW1H 1HAVA 3MU0A 2OYEP 1HAHH 3UNRA 1P04A 1CX2A 2BOHA 4ZH8A 2FWWA 4RRZA 2HLCA 1K22H 4DT7B 1UO6A 3C27B 1Y59T 1G3BA 1ATBA 3T2NA 4F4OC 2GZ9A 4CRDA 4X8SL 2AGEX 3IWMA 2FO9A 1XKAL 3MYWA 4CRAA 3K9XA 1V2QT 1JIRA 3E8LA 1GBAA 4LMFA 4KGAA 3ZZ5A 1GJCB 3A82A 5EG4A 3UNSA 1PPFE 1Z8RA 2G8TA 1IQJL 2J95A 1XM1A 2XNIA 3BEIB 4O1ZA 1C2KA 1C2FA 2ALVA 1J17T 2ZDLA 3M3VA 5JBBE 3RLYH 3KN2A 3NK8A 2JH6D 1EB2A 1AFEH 3C9AC 4D90A 2HOBA 2W3IB 4ISNA 3ZZ9A 1OWDA 3POYA 3L6PA 4B73A 4NA9L 2A32A 1RIWC 1O2IA 3BV9B 4RUTA 4I31A 2ZTXA 3FFGA 1MH0A 2FYRA 2GCHG 1FZZA 4JMYA 4RKOB 3RXQA 1MBQA 2BDCA 3E6PH 2R2MB 2WG4B 1P0SH 2J38B 1BTXA 4WVPE 1GWAA 2VJ1A 3RXTA 3RU4D 2GCHF 2AIPA 1C5YB 3BTKE 2PFEA 1ELEE 1O5AB 1V2LT 2FX6A 3I29A 2Z9KA 3P8NA 4YOGA 4A92A 4GHQA 4CH2B 2C8ZB 3MHWU 4HTCH 5EXNA 1HXEH 1PPCE 4I8KA 4TPIZ 1O5GH 3L33A 2GT7A 4MNXA 2CXVA 1Z8IB 1EXFA 2QXGA 3BEFB 3A7YA 3MU4A 1LKBA 2A5KA 4MMXB 3SJ9A 3KCGH 1UTOA 2FX4A 5EXMA 1UTKA 1UTNA 2A4OA 2XWAA 1EP6A 1PQ5A 4BTUB 2VVVL 2WV4A 3LIWB 3SV6A 2ZDVH 1SGRE 4MTBA 3EA7A 3OLUA 2WFTA 2G4TA 3VEQB 4CBNA 3MH4A 3OX7U 1IHSH 2CMYA 3AAVA 3SUDA 2VWLA 3LU9B 5G4BA 1EPGA 1EAUA 1BBRE 3HPTB 2H9EH 3MNCA 3RXAA 1YPGH 3ZZAA 1EQGA 4K1SA 3LGVA 3A8AA 1F5RA 4A6LA 4E05H 4BNRA 1IQHL 5C5NA 5EW2H 1RGQA 1KTTB 1V2UT 2H1UA 5L30H 3PM3A 2O8WA 3SNBA 4RRXA 2G51A 2W3IA 3TLOA 2RG3A 3E3TA 1BJVA 1N8OB 1DUAA 5COXA 1ABJH 3PLKA 2ZWLH 1COUA 1GBTA 4FUEA 1FJSA 4I33A 1FPCH 1Y3UA 1V2PT 3U8RH 1T8OA 1LVMA 1IQMA 1KXAA 4LOYH 1BTZA 5DPAA 3DFJA 3CS7A 4KKDA 3A86A 2VU8E 1TOMH 5JBAE 1RS0A 6ESTA 1GBBA 4KP0A 1TPGA 2ZGBH 2PTCE 2TGPZ 4HI3A 1SBWA 1NM6A 1F0TA 1HREA 1ANDA 2ZG0H 1SB1H 3MH6A 5AFYH 3FCSB 2B7DH 1ANEA 1V2ST 4A1XA 1FDPA 2ZHQH 2BZ6L 3UNQA 1EAIA 4MNWA 1TOZA 4DURA 1GBCA 1Y3WA 1SOZA 1V2NT 2FYQA 4XBBA 4X1QU 4O02B 4BANB 5GWZA 1TGTA 3EQ0H 2Y5HL 2NU3E 1OYQA 2XC0L 4MLFB 1O2XA 4IN2A 3RXHA 4CUFA 1C5VA 1WYKA 3EGFA 1MU6B 2BVRH 4JZIA 4BTUA 5E2PA 4DCDA 1DDXA 1T8LA 5FBEA 4JYUH 1NFUB 2OYUP 4R8TB 3LIWA 5DP5A 3BTEE 4XBCA 1C5OH 3ZYJB 5KIRA 1GJ4H 1P57B 1TRNA 2AH4X 1G3CA 3IG6B 1QIXB 3A81A 4AFZA 3RXSA 1O3CA 3A87A 3RLWH 4H6TA 1DT2A 3Q3YA 2PHBB 3A88A 4X2WA 1MCTA 2UWLB 4YT6H 5JBBS 4DIHH 5CHAB 3HKJB 3P8OA 1O5FH 3TBDA 1PQ7A 3HPTA 2A7JA 2FOGA 4UFGH 2FOEA 3OYPA 1YUGA 3GISX 3PWCA 5T3HA 2BD9A 1OB1C 3GCNA 3F68H 2G55A 4I8LA 4CR5A 3TH2H 3VB3A 3LT3A 3L3TA 3LONA 1QRXA 4WXVA 2ILNA 2OINA 3QGNB 1IQJA 5FAHA 1O3BA 5T6DA 2Y38A 4Y7AB 6COXA 1YCPK 3BN9A 1MMJN 1ID5H 1OSSA 3HS7A 4X8SH 1ZGIA 2ALPA 3VXEH 5HMAA 1VGCB 4OS4A 4X8TL 4O3UA 3QMOA 1O3GA 1MTVA 1O5BB 2NU2E 3AW0A 4ABDA 2RCEA 1ZYOA 3P6ZB 3PO1C 2R0KA 9ESTA 2J4IB 2QIQA 2VIDA 3A85A 1E36B 4AOQA 1Z6EL 1F0SB 1LVBA 4Z0KB 4BAQB 2ZECA 4X8VL 3S9BA 4JYVH 1IQIL 4WXIA 1QL7A 4K2YA 3ODDA 4NA9H 1XX9A 1PXXA 4FU8A 2M5TA 1NFWB 1EZXC 2ZFFH 1AZZA 1AI8H 2PWXA 3UFAA 4B2CA 3RXVA 4NSVA 3A83A 1Y3YA 2A31A 1QB1A 2Y80B 1C4U2 2HPQH 1WHEA 3MDLA 2HGTH 1GCDA 3GISB 2BMGA 3MFJA 1OXGA 2Y82B 1PPHE 2EEKA 1GI4A 2AFQB 2OBQA 3QGJA 5BRRE 1HPGA 1NFUA 2ZPSA 3PMAB 3SI3H 2J34B 1LCYA 3SUEA 1U8CB 2VVVA 5C1YA 1ELVA 1RFNB 2FTMA 3M7TA 2AMQA 2K2TA 1CBWC 1MU8B 1GBKA 1GGDC 2EI7B 2PHBA 3M3SA 3GY4A 2P8OC 5B6OA 3N8WA 2UWLA 3LGTA 3TK5B 1B7XB 1EX3A 1YPKH 3AW1A 1CHOG 1ESAA 4I32A 1P9JA 1UZQA 3TGIE 1Y3VA 2FP7B 2CHAC 4LZ4B 1O2OA 1D4PB 3D49H 3MO3A 1QA7A 5CKQA 4NIYA 1CHOF 1C5UA 1YKTA 3PLBA 1GI7B 1O2SA 4NIXA 1WBGB 4Y7AA 1IQHA 1EAWA 4A1VA 1DITH 3PTBA 1DE7H 1ZRBA 1C1PA 1N6XA 1YPHC 3H5CB 4DVAU 1K9OE 3ZYGA 3BTHE 1O3OA 1TBZH 4FUIA 3TITA 2Q6GA 1GJ5H 2BY9X 3GYLB 4ABHA 1URKA 4MPUA 1HXFH 1H1BA 1O0DH 4PH9A 1AIXH 1GI1A 1C1NA 2J4IA 1XKBA 1Z1JA 3HGNA 2FODA 1ELBA 1F0SA 3SNEA 4Z0KA 1RRKA 4OS6A 4X0WU 3P70B 3SBKA 1P03A 2F3CE 2HNTF 1C5MD 3SORA 3OY5U 1NFWA 1IHTH 2GZ8A 3TVJB 2OC0A 5K7RA 1CA0B 1K1LA 1BBRK 1GJ6A 1SQTA 2A2QH 4Y8ZA 1YO8A 1KXBA 2A5IA 3K2UA 3P95A 4XE4A 2QF0A 1SLWB 2ZHWH 1LPGA 1BIOA 1NT1A 2Y80A 4FUJA 4CH8B 5FHTA 1Z8GA 3UR9A 4ABAA 3LN0A 3TK6B 2Y82A 3PMHB 2HRVA 2Y5HA 2XC0A 3N8YB 2FI4E 1NC6A 2TGTA 1C2JA 5DP7A 1P2KA 1A46H 5A0AE 4UE7H 3M7UA 2J34A 4NWLA 1YUKB 2BB4A 2FXRA 2BZ6H 3S9CA 3SJKA 3PLPA 2XTTB 1BT7A 1ANBA 1BTPA 1TMBH 1BTYA 2NWNA 1RIWB 1E38B 3SGQE 1RFNA 1L1NA 1V2OT 1ZSKA 1T7CA 1TGBA 1MKWH 3W95A 4X2YA 1SGTA 3QUMP 1F92A 1O3KA 2EI7A 1MQ5L 3TJNA 4DOQA 2PKAA 2O8LA 3TK5A 3ZZDA 3BTWE 3CS0A 1DWCH 4O3TA 1W14U 2ZP0H 4J2YB 1GI8B 1HRFA 5E8EH 3SN8A 4ESTE 4AQTA 4KELA 3ZZ3A 4MPVA 1O2RA 3Q7DA 4GAWA 2BD5A 5AF9H 4IMZA 1W11U 1FY5A 2NU1E 2ZCHP 3KF2A 3ZZ8A 2WUCA 3SOBB 1BMLA 1BMNH 5EOKA 1L4ZA 1O33A 1V3XB 1SMFE 1HT8A 2FS9A 1DX5I 3KQBL 1UVSH 1D9IA 4NFFA 4AB8A 2Z3EA 2WPJS 1HUTH 2TGAA 1S82A 4X1PU 2H5CA 1VITG 1LHEH 2ZC9H 1BRUP 1DXPA 1Z6EA 2GMTC 1L3YA 2BQWB 2J9NA 4NGAL 2QCYA 2WPKS 1BCUH 4X8TH 1VITF 1IQIA 2Z7FE 2PGBB 2YGOA 3RM0H 3TNSA 1HFDA 1DSUA 3UY9A 2P59A 1TBRH 1K36A 2ZHDA 1V6DA 5AFZH 3SU6A 4WMEA 1ARCA 2PR3B 1TPSA 1YPLH 1GHZA 3Q3KB 1H9IE 3M5OA 3STIA 4A7IB 3TK6A 4IW4E 2P16L 3LH1A 1G2LA 1EMNA 2PSYA 3ZYEA 2BY8X 3SV2H 3N8YA 5ESTE 4ABIA 2ANWA 1ESTA 4YTAA 3HS5A 1ZRKA 3N8ZA 1AWHB 3ASIA 1C2EA 3LC3B 1QTFA 1C1WH 6LPRA 4FVDA 1TNHA 1GJ9B 3SUGA 3BTTE 2OC7A 2RHPA 1HAXB 1KXDA 2YOLA 5FBIA 3JZ2B 1P01A 3ZZ7A 1O3NA 4X6MA 5A8XA 4KTSA 1INCA 1Q31A 3EAJA 5EXLA 3G01A 3ELAL 1F7EA 3PB1E 1GHAG 2WPIE 1F5KU 2WPME 2FLBL 4LXBH 4B76A 2F91A 5TCAA 1TX6A 1UVUH 1C9TA 3MO6A 2ASUB 2ODQA 5HM9A 4AB9A 1ZZZA 4NIWA 4ABBA 1GHAF 2VIOA 4YT7L 3AVZA 1FF7A 2DE9A 1V3XA 5DP4A 2CGAA 4B2BA 2ZFSA 3TGJE 1THPB 2BDHA 3O8BA 1FY8E 1J8AA 3URCA 1ELCA 3ATMA 1ARBA 1HX2A 1EUFA 2VVUL 4WH6A 3QWCH 1UHBB 2ZEBA 2BQWA 1YBWA 3GY3A 1EMOA 5DGJA 4H42U 4OGXA 3RXEA 3Q77A 2G81E 4O03A 2BDAA 4XFQA 1CGHA 1SL3A 1TE0A 4ZKSU 1BOQA 3RXRA 3M5NA 2M74A 2BM2A 3ODFA 2FIRH 6GCHG 1P2OA 4Y0YE 2PR3A 4YZUB 3Q3KA 1AGJA 1TIOA 4ISOA 2VH0A 4A7IA 8LPRA 3LDXH 5GJ4B 1JL9A 1D6WA 1PPZA 1AVXA 6GCHF 1O2ZA 2XBWL 3R0FA 3M5MA 2JKHL 2QXHA 3E91A 4IGDA 5FXLA 1PPEE 1LHGH 2GTBA 1T31A 2ZU1A 1LHFH 3LC3A 4NZQA 4KTCA 1P3CA 2ZDKA 3DHKH 4M10A 1YCPM 3PO1B 3LH3A 3U69H 2SGDE 2XWBI 4X8UL 1HAGE 3E0PB 3SJIA 1LVYA 1MQ5A 1BHXB 2HVXA 1PYTD 2FZZL 1F7MA 4CUDA 4FUDA 1LPKB 1DY9A 2W26B 4JZFL 1J15A 5F19A 4D8NA 1BA8B 1SQAA 3F9GA 2STBE 3MI4A 4CBOA 1WUNH 2AEIH 4BDXA 5CISA 2V6NA 3LKWA 3UPEA 6CHAC 2Q6FA 3DFLA 2Z9IA 5IKVA 1SQOA 2WYJB 1BUIA 2W2QE 2EI6B 3LN1A 1HZ8A 2ZTZA 1JRTA 1LTOA 2SGEE 2ZI2H 3P8GA 1PRHA 2BVSH 3EYDA 4FUHA 4Y7BB 1SGCA 1MBMA 1SLUB 3KQBA 5I46L 4LZ1H 1MOXC 2ZGCA 3SV8A 2NPRA 1UTJA 2UWOB 1MQ6L 1L5GB 5SGAE 2QY0B 1UHBA 3GCHC 4XOJA 5IDKA 1ATDA 1CBWB 1SOTA 4INHA 4K1TA 3Q76A 1WAYB 1K1OA 1XVMA 3UTUH 1P2NA 1X7AC 2P8OB 1AMHA 3LJOA 3U8OH 1GBFA 1W2KH 2VH6B 1MD7A 3D62A 2OBOA 3OLTA 2WG3C 1O5DL 3PWBA 1C5RA 4XDEA 4IMQA 1YPMH 1ZSLA 2CHAB 1APQA 1O2QA 4YZUA 1BB0B 3MU5A 4Y71B 5IKTA 1ETRH 1THSH 5L2ZL 1NS3A 2KAIB 2A2XH 1V2WT 1NY22 4TWWA 4M11A 2P16A 4NGAH 5F8ZA 4HZHA 4BDWA 3T62A 3U1JB 3RXLA 4B74A 1CCVA 5JB8E 1MTNC 4WWYA 4NWKA 3RXJA 1FIWA 3BSQA 1QB9A 1SC8U 3U8TH 7LPRA 2DE8A 1MD8A 2ZCKP 1THRH 1HGTH 2A7CA 2A0QB 2ANMH 1PYTC 1SLVB 1RTFB 1TWXB 2WPIS 2WPMS 1AFQC 1Y5AT 4CRBA 3W94A 2W26A 1UZJA 1BRCE 1HNEE 3NUMA 1NN6A 2C3SA 1SVPA 1SI5H 2STAE 1DS2E 5GXPA 2C8WB 1EPHA 4H6SB 4Z0LA 3CENL 3DUXH 3ZV9A 4DGJA 4FUCA 4MPWA 2V3HH 4FUGA 2DUCA 4OTJA 2XCFA 1ACBE 3QH0A 2TPIZ 3RU4T 1OWHA 1G2MB 2EI6A 3ZVCA 1K1IA 4CHAB 3EA9A 1TLEA 4Z6AL 3PYHA 1YC0A 2UUKB 3ZZCA 4X1NU 4XL1A 5A09A 3M5LA 3ELAH 1GG6C 1TQ7B 1HAPH 1GK5A 3FP6E 1QBNA 1PQ8A 2VWNL 1W7GH 2FLBH 4JYTA 1V2TT 2FS8A 1C2GA 3BG8A 4ABGA 4FUBA 4AGKA 5CKNA 2VVUA 4NFEA 2P28B 3V12A 1SLXB 1BRAA 2Z9LA 3QTOH 2H9TH 1P2JA 2OC1A 5DJ7A 5I25A 1QY6A 1QCPA 2VH6A 1IP0A 1O2UA 1ETSH 4C16A 5PTPA 5EPYA 2LPRA 3BG4C 1H9HE 4AG2A 4BAHB 3OY6U 4Y71A 2KB9A 2KAIA 2OUAA 4ZKNU 1K21H 1Y5BT 5IKQA 3NWUA 2F9NA 4GSOA 4A1TA 1DQBA 2XBWA 2I9BA 2KV4A 2I6SA 4WMDA 2JKHA 1EB1H 2ODPA 3PMJA 1OP8A 2VNTA 2F83A 2BHGA 2BOXA 1GDNA 2ZU3A 2J38A 1DM4B 1EKBB 1C5SA 2FI5E 2W3KB 1K28D 3SU1A 3SZNA 1SGNE 2VINA 3MTYA 1TMTH 3GY5A 2GMTB 3NZIA 2FZZA 1XDTR 3D23A 3RXKA 3A7ZA 1DDJA 1UTQA 1DOJA 4YLUA 1EZUC 3EDXB 1O3PB 2FESH 3SNDA 3RMNH 1CT4E 2G00L 2BLOA 3F1SB 2P3FH 2TGFA 1MTWA 4X8UH 1GBJA 3LOXA 2Y81B 1BMAA 1LHCH 2GZ7A 2OXSA 5J4SA 1G2MA 1HBTH 3FZZA 2Y7XB 3TGFA 3U73A 4JZFH 4SGBE 2VGCC 2XYAA 2SNWA 2GP9B 2BLWA 5DG6A 1SHHB 1FSBA 4JZDL 3GYMA 5DP6A 1BHXF 3BTQE 3KHVA 1GI5A 2BD7A 1GBHA 1W0YH 2OQUA 1UCYE 3QCWA 3F9FA 5HYOA 3NT1A 2IOTA 3TGKE 3OU0A 5FX5A 3LJJA 1MQ6A 3MO9A 2EC9H 1NRPH 1PFXC 1O30A 2Y7ZB 3RMLH 2Z3CA 1DLKB 1O2HA 1ZGVA 1T4UH 2XXLA 2ZGHA 3KGPA 4DIIH 3RC6A 1LMWB 5JB8S 3TH3L 1GBIA 1GJDB 2Z6BD 5I46H 2BD2A 3GDVA 5FCRA 1LVOA 2WINI 3LTFB 2SNVA 1GBEA 2BD3A 5H4IB 1IOEL 5EODA 3RMOH 4GVUA 1DUEA 3RXOA 1MKWK 1FFMA 3UWJH 1C4V2 2D26C 3QX5H 8ESTE 1O5DH 1SG8B 4U30A 3QO6A 3BIUH 4YOJA 1DIYA 1KDQB 4RSPA 3T5FH 1YLDA 4BOHA 3ENSB 4G1MB 5A0BA 1QNJA 3MH7A 2FOMB 1T8MA 2W3KA 3GCOA 2FTLE 1CVUA 1ZHMA 3ZVEA 2IJOB 3NXPA 1Q2WA 1PGEA 1X7AL 2OCVB 1A0JA 4IN1A 4VGCC 2QYIA 2WPJE 3QN7A 4K60A 3HATH 2BQ7B 3M7QA 2CN0H 4ZAEB 2GDDA 1L1JA 3SU3A 5JYIA 2F9PA 1C1RA 1DY8A 1OPHB 3SJ8A 2WPKE 3V64C 2ZHEH 3CENA 3KRKA 1FAKL 2Y81A 1IGZA 4CR9A 5K0HB 1G1SA 1H8DH 1QA0A 2Y7XA 3QTVH 1EPIA 1KLTA 3OTJE 1SGYE 4GUXA 1WTGH 1G30B 3RXPA 2AIQA 1P8VC 4ZHLU 1S83A 3RXMA 1XUGA 3NTGA 2W5EA 3RMMH 4DW2U 1FNIA 4OGYA 4RKJB 5HGGA 2VWNA 2UWPB 2AYLA 1A3PA 3GCXE 3E1XB 3SU4A 1IVOC 2K2SB 1JWTA 1IQFL 5BPEA 4Z6AH 2AS9A 2Y7ZA 5E0JA 3MU1A 3BF6H 1J14A 1NTPA 4THNH 1FPHH 1I0UA 4E7NA 1MUEB 3FP8E 1C1VH 5LH8A 1K1MA 2H5DA 5A8ZA 1GPZA 2XCNA 1EAXA 4GHTA 1FE2A 3TNTA 5EGMB 6CHAB 1T32A 1KXEA 2P26A 1QFKL 1AUTC 3BPSE 1GJ7B 1P9UA 1N1LA 3V7TA 4K1EA 2H9HA 1VCWA 1VITH 1HJ9A 3GY6A 3SUFA 1WHFA 3F9EA 1FUJA 1GI3A 2BDBA 2J2UB 1LHDH 2QAAA 1KDQA 1SZBA 3ENSA 1YLCA 2P3FN 2ZCLP 1UJ1A 3GCHB 1W3CA 1YUFA 2XBXL 3SU0A 1GBDA 1HCGB 4ZXYL 1TNGA 4UFDH 3RP2A 3U9AH 2BQ7A 1GCTC 4ZAEA 1GI2A 1Q3XA 1C5XB 3NCLA 5C3NA 4ABFA 1G37A 4JZEL 5C20A 3SO3A 1GVLA 2O8MA 1TGSZ 3GY2A 1C1QA 1N6YA 4ZXXL 2W2OE 1WQSA 2G00A 1OYTH 5GPIB 3CP7A 1AZ8A 5K0HA 3S9AA 3URDA 7GCHG 1O2JA 3B9FH 3N8XA 1O36A 1IOXA 1EZQB 1QB6A 1JBUL 1TAWA 4LORA 2FDAA 1C5MF 1T8NA 7GCHF 2AMDA 1D6RA 1QGFA 1MTSA 1RTLA 4XBMA 2BY5X 2UWPA 1P2MA 5AHGH 4I8HA 2R9PA 1FV9A 1KSNB 2WYGB 1DWBH 3UOPA 3VB5A 1CT0E 7ESTE 2CF9H 1QJ1B 3GDUA 3TU7H 3KQDL 2ZHFH 1CEJA 1O3DA 2Q6DA 4JZDH 4AYYB 1BQYA 1DPOA 2V3OH 1W10U 2C8YB 4D0FA 4AX9H 4ISIL 2LNCA 5JVZA 1AO5A 3A7TA 3H7OA 1N7DA 5FPSA 1ZSJA 2W7UA 2C8XB 2A4QA 1G9IE 2BVXH 4OS5A 3FBYA 2PW8H 3QZQA 5EGMA 1IOEA 2B5TB 3ATLA 1PPBH 9LPRA 4IC6A 1O3AA 1P3EA 2R2WU 4NA7A 1MZDA 3TH3H 3M61U 1SFIA 1ZPBA 1XUJA 2FM2A 3KQEL 3GY8A 3O8RA 2J2UA 2BLQA 2ZQ2A 4BXWA 3A8BA 4O97A 4ZROA 3KK6A 5F1AA 1P9SA 1UCYK 5T6FA 3UQVA 1NPMA 3GCWE 1HCGA 1PFXL 1MKXK 2PUQL 4D0EA 3DD2H 1S81A 3MOCA 1BRBE 4JK6A 1KLIL 1FY3A 4RN6A 1ABIH 4IS5A 2HWLB 2HNTE 3SI4H 3A8DA 2PLXA 3ZZ6A 3BG4B 1IQKL 3Q3XA 2J94B 4X8VH 2SGFE 4F49A 3VB7A 2KL7A 2V35A 3UWIA 1OX1A 2ZFTA 4TPYA 4UD9H 1ZOMA 1EZQA 2FOCA 2OTVA 1HAYB 1O3FA 1L0ZA 3AAUA 1TA6A 3SHCH 2QXIA 1NPEB 1J9CL 1UMAH 2B8OH 2AMPA 3VGCC 2ZFRH 1FAKH 1GJ8B 3VB6A 1SGIB 1H9LB 1OP0A 5TJXA 1KSNA 1EOJA 3TJOA 1XUFA 4B2AA 3FAOA 1OWEA 3TK9A 4MMYB 1IQFA 3ZYIB 1HJAC 1D3TB 1OKXA 2W7SA 1TGCA 5L6NH 3MNSA 1YF4A 4GCHG 2BZAA 5F03A 5CHAC 1AQ7A 1A2CH 1C1MA 1ZHRA 2A7HA 5J4QA 3KL6B 1T4VH 4BAMB 1E34B 2OD3B 2ZU2A 1YPJH 1ADXA 1CHGA 2VGCB 2BXUH 5JW1A 1IQLL 5C2ZA 1GBLA 4B1TA 3I77A 1J16A 4X6PA 3ZVGA 1UVPA 1U6QA 3RC5A 3T29A 1UZKA 2BD4A 3KEEA 2RDLA 4A5TS 2O8TA 1W0ZU 2ZQ1A 2P93L 4MQAA 5F6MA 1P05A 1QFKH 4IC5A 1P2QA 1AE5A 3PROA 2GVFA 4IBLH 3M37L 2XBXA 3MMGA 2D2DA 2ZZUH 3M3TA 1G32B 5CE1A 2UUYA 5DP9A 2HALA 3KNXA 1F7ZA 1O2GH 3FANA 4PROA 1O3LA 4BXSA 5JBCS 1C5LH 3ATKA 3FZDA 2J94A 2ANYA 1Z8JB 3UQOA 3VXFH 2WPHE 1ETTH 5A0CA 1CGIE 1SGDE 1ANCA 1C2IA 1QL8A 3ZVFA 4ZXYH 3QDZB 5C5OA 3BT2A 5C67A 4X2VA 1C1UH 1DX5M 3SU2A 3ZZBA 2YGPA 4TGFA 1TNKA 2ZDMA 1O39A 4HFPB 2ZA5A 4JZEH 1EPJA 2P3UB 2G52A 2QXJA 1P02A 2BOKL 1IQNL 2RA0L 3BTGE 4ZXXH 1YPEH 1EQHA 1BDAA 1NESE 4ZMAH 2AGIX 1VCPA 1A0HB 1CSOE 3NPSA 2ZGJA 1RTKA 1U67A 1O3IA 3S7KB 2Y5FL 5CKMA 4KTUA 1JBUH 3KQDA 2DDUA 4Y0ZE 1TRYA 4VGCB 1UK3A 2FOAA 2PV9B 1HLTH 1UVOA 2FEQH 2VWMA 1O3MA 3NKKA 1TOCB 1Y5UT 1GHVH 1O2NA 1IQEL 1ELAA 2PSXA 2CV3A 1SGEE 1DANH 4MG3A 4X6OA 1TX8A 2ZKSA 1FI8A 2VB0A 3BT1A 1WSSH 1CVWL 2O8UA 3SW2B 1O31A 2FLRL 1F0UA 3WY8A 4X1RU 4ISIH 2BO2A 3P17H 2BDIA 1O35A 2IPHA 1TMUH 2MHPA 3K6YA 3KQEA 3MNXA 3F6UL 5EU8A 3SQEE 2BX4A 1DICA 1EOLA 1S85A 3A7XA 1XFEA 1GGDB 4ZHAB 5EQQA 5JB9E 3V3MA 4NIVA 2VWOL 3FVFB 1O38A 2F9OA 3HO5A 3R3GB 3ZV8A 1PJPA 3ZZ4A 1Z71A 1HT5A 3PV4A 8KME2 2WPLS 2QGRA 3V65B 1QJ7B 1RXPA 2J92A 1QBVH 3HKIB 3QZRA 4YOIA 1AN1E 2HPPH 1B9WA 3ZVDA 3T28A 2PKSC 3RXCA 4AGJA 1IQKA 1QR3E 4CRGA 1YYY1 1C1TA 2JETC 5IYTA 2PUQH 4ZKOU 3F9HA 1CA0C 3A89A 1GHWH 1WCZA 1KLIH 1XUHA 2P3TB 3RUOA 1DFPA 4AFQA 4COXA 1O5EH 3HK6B 5GIBA 4AN7A 1ZMLA 3O8DA 1HIAB 1DLEA 1C1SA 2P3UA 1GMCG 1MTUA 5EPNA 1Z1IA 1NU9A 1GVKB 3A7WA 1V2JT 1OS8A 1TFXA 4XLWA 4BTTB 4JYVL 1ZJDA 2GCTC 1GMCF 1LPKA 1YP9A 1C2MA 2WFXB 1GDQA 4OS2A 3M36L 2THFB 1SSXA 1FY1A 3D65E 1XVOA 1UZPA 3EGKH 3I78A 1QQ4A 1GCTB 4XSKU 2I6QA 5TCCA 1ZLRA 1J9CH 1H8IH 2QN5T 1Q4GA 1IGXA 3E90B 1TYNA 2WYJA 3RXBA 3UREA 3QLPH 3OSYA 2VVCA 1P11E 1LQEA 1BJUA 1OOKB 2F9BL 4Y7BA 1GJBB 3SW2A 1TABE 4FXGH 1A4WH 2BYAX 4NG9L 1EJAA 1ELGA 2D8WA 5HXFA 1IQLA 1RJXB 2A4RA 2UWOA 5ESBA 1TBQH 2G4UA 2QC2A 3UOUA 3RXIA 1SGFG 2YNBA 2W2PE 4ZHAA 5AVDA 4U01A 4YT7H 2PUXB 2P93A 1CQQA 1L4DA 1S6FA 2WPHS 3UIRA 5FPYA 5HM2A 1NQLB 3LGWA 2BLVA 2Z94A 2W2ME 3M37A 1S0RA 1BF9A 1EBVA 1ZHPA 1VZQH 3GICB 3PTNA 5DP8A 1CQEA 1HRTH 4AFUA 3NJPC 1KXCA 1GI0A 1CT2E 2C93B 2TIOA 1C2DA 1KIGL 3GY7A 4TWYA 4MNVA 1NZQH 2P94L 3BEUA 1W7XL 1HAFA 3VB4A 1TA2A 2P3TA 2W2NE 1HYLA 2XBVL 1D3DB 4M7GA 1TPOA 1HIAA 1AY6H 2ULLA 2Z9JA 1FAXL 2GV6A 4I7YH 1AHTH 3DEMA 1SFQB 1KLJL 1VJ9U 4ZKRU 2BOKA 1IQNA 2RA0A 4BTTA 4Q7ZA 1O5CB 1W8BL 2I9AA 4ZUHA 3ZYDA 1QL9A 4UFFH 4OS7A 2XW9A 4O9VA 5LPFA 2C90B 3IITB 4YO9A 3SV7A 2RNLA 2A4GA 3ZVBA 2Y5FA 3RXFA 4BAOB 4MPXA 1TB6H 1O37A 1FMGA 3HK3B 3MU8A 1B0EA 1AU8A 3EA8A 3P92A 1K1PA 1SGPE 1QHRB 2AERH 2OQ5A 2JH5D 2MGRA 4GPGA 5DP3A 1IQEA 1O2WA 2AGGX 1IAUA 2BX3A 5T6GA 1EPTC 2PGQB 3HGPA 3BTDE 2ESTE 1K1NA 5E0HA 5JB9S 1O2VA 4X2XA 4FU7A 3SGAE 1HV7A 4D9RA 2OLGA 1NZIA 4TY7A 4INKA 1FXYA 2XC5L 1EASA 1ZTKA 3RU4E 2BMGB 2QA9E 1E35B 3VGCB 2XC4L 2R3YA 1C1OA 2BDGA 5F8XA 3DA9B 7KMEH 1C5TA 3TZIA 2Y5GL 3V0XA 4RRYA 1CVWH 1DSTA 2OP9A 4D9QA 1BTWA 2FLRH 2VWOA 1G36A 1OWJA 2GGVB 2XBYL 1JOUB 4MMZB 1CE5A 4TYDA 3SHAH 1HJAB 3ATIA 3F6UH 5JVYA 2H6MA 2G5NA 2V0BA 3N8WB 2VIWA 1D3QB 2ZPQA 5JBTA 1AB9C 1A1RA 3MWIU 2A1DB 1OWIA 2K1QA 4MVNA 2A5AA 3SNCA 5L2ZH 3HO4A 1FONA 1MAXA 1QJ6B 1P09A 1TNIA 1EJMA 2SGPE 2ZF0H 2EI8B 5EQSA 1C5ZB 3IITA 3EE0B 5E0GA 1G1TA 1HAZB 3M36A 1E37B 1WV7H 1JRSA 1UVTH 1GVZA 5A8YA 1SGQE 5IKRA 1AD8H 3SOSA 4E7RG 1C9PA 1EZSC 1C5NH 1VJAU 4OS1A 1S6HA 1CO7E 1V2VT 1FIZA 1QQUA 1A5HA 3ITIA 1IJQA 1BTHH 1NRRH 2ZPRA 3SOVA 3H7TA 1GI6A 5C1UA 3N8VA 1C2HA 2GV7A 4MDSA 4WY3A 2SFAA 4Q7YA 2XRCA 1HAIH 2PTNA 1L1GA 3MNBA 1LPGB 3P5BL 1JMOH 4FVBA 3CFWA 1O2TA 3SJOA 3V13A 1AUJA 4TY6A 4JCNA 2EA3A 3PMBB 1ZR0A 4X1SU 3GOVB 1O3JA 3RDZA 1ELDE 4WJG2 2F9BH 1TQ0B 2TBSA 1PQAA 1NRSH 4FM5A 4R0IA 4LK4A 2QV1A 4NG9H 2GT8A 4ZHMU 1GHXH 2BY7X 1DXWA 1YGCL 1A5IA 1L2EA 2IN2A 1PTHA 1OP2A 3QK1A 1GMHG 1F5LA 1O32A 1ZPZA 1A3BH 3E16B 2PKAB 5JPMH 2SGAA 1XUIA 3UUZA 2ANKH 2P94A 1WQVH 2VIPA 3LAQA 1GMHF 1JXPA 1ZTJA 4FU9A 4Y8XA 3TPIZ 4Y11E 1O3EA 4B71A 2XBVA 4U2WA 3HS6A 4Y76B 2F9VA 1KYNA 1P06A 3A80A 1KIGH 1LMJA 1P10A 1FAXA 5LGOA 1XUKA 5E8DA 5F8TA 2BY6X 1O2LA 3U98H 8GCHG 1GJAB 4ISHL 2EI8A 1ZPCA 2ZDNA 5JBAS 1A61H 1W7XH 2ZDAH 4YLQH 5DK1A 4H4FA 3TH4H 2ZTYA 1UK2A 1ESBA 1EJNA 1CGJE 8GCHF 3SV9A 4UDWH 4WMFA 1LQDB 1Y3XA 2NU0E 1HDTH 2CF8H 4Y10E 4ABEA 3KQCL 3R05A 1KLJH 1LDTT 3A8CA 1XXFA 4I8JA 1O2MA 1TLDA 1NROH 1W8BH 2VIVA 3TJVA 5GCHG 4NCYA 2VJ3A 2PKSB 3RXGA 5LPEA 3M35A 5L2YL 2P95L 2FD6A 1ELFA 3BTFE 1DWDH 1YPHE 1DVAL 1EAIC 1Z7KA 4D76A 2JETB 3SNAA 1MTNB 2Y6TA 1K37A 2NU4E 1GDUA 3K6ZA 5GCHF 5JBCE 2ZIQH 5FDQA 3RC4A 3LC5B 4OTYA 2FOBA 1FN8A 5DO4H 4E1GA 1C5PA 1G2LB 1UK4A 4JZ1A 4CHAC 3S7HB 4BTIB 2XC5A 4Q80A 3ESTA 2WUBA 3LPRA 2XC4A 2YNAA 1KTSB 1W12U 1AFQB 3STJA 1V2RT 2ADXA 2GCTB 2Z9GA 1TNJA 1BZXE 2Y5GA 3SQHE 1YCPH 1Z6CA 2FOHA 1HAEA 2FI3E 2Q1JB 2XBYA 2R0LA 1WTHD 2ZFPH 3S0NA 2Z3DA 4CRCA 1FQ3A 1NU7B 2B0FA 1D3PB 3LGIA 4DJZB 1QURH 1QRZA 2A45B 3A84A 4NA8A 3U1IB 4DY7B 4E06H 1XKAC 1FN6A 1EQ9A 2UUJB 2ZU5A 1CCFA 3K65B 2BTCE 1QRWA 1B5GH 4JK5A 3B23B 2CJIB 1IQGL 1A3EH 2FOFA 2HNTC 4UFEH 2ODYB 1EATA 1GG6B 5DKMA 4Y76A 1W13U 2UUFB 1P2IA 1JIMA 2ZFQH 1N8OC 2BDYA 1F0RB 1AVGH
chains in the Genus database with same CATH superfamily
1TX7A 3T27A 1HJ7A 4NSYA 4AFSA 1ATAA 1TGNA 2H2ZA 3ATWA 1K1JA 1NFXB 2FLGA 3MH5A 1LQDA 2RFKC 1A0LA 5FPTA 1Z6JH 4Y6DB 2GDEH 1AVWA 2VWMK 1ZJKA 4K3JA 1G1RA 4DG4A 1VR1H 2TRMA 5JDUB 2WV9A 1NFYB 1BITA 4INLA 1HJ8A 1H4WA 3LGYA 2ZNKH 1WOFA 1TNLA 2WPLE 3E0NB 1V2MT 1JV2B 2OC8A 4CREA 2ZU4A 2B9LA 1G1QA 2MGPA 3LC5A 3FP7E 3BTME 2ZO3H 1O34A 2HOXA 4RRWA 1BTUA 2VH0B 1S0QA 1NRNH 4GLYA 1P0SL 1S5SA 1UTMA 1N1IA 2O9QA 1S84A 3UR6A 1TPAE 1FY4A 4BTIA 1A5GH 2FPZA 2WYGA 1GMDG 1ZMNA 4WH8A 3RXDA 4SGAE 2RA3A 1RD3B 4UEHH 3LTGD 1NT0A 3SU5A 2F9UA 1TONA 2KFWA 4Q7XA 3FFGL 3KYGA 4Q2KA 5FCKA 2D1JB 2TGDA 1GMDF 1P12E 4QT8C 2Q1JA 4WF8A 1CA8B 1ZMJA 4RT1A 1XXDA 4CSYA 4K5ZA 1EP5A 3VPKA 4HGCA 4BAKB 1O3HA 2BOUA 3KCGL 1PPGE 1GL0E 5E2OA 2GD4B 2QF3A 4K8BA 3LGUA 4J1YA 4ABJA 1AWFH 1UTLM 1GI9B 1O2YA 2EQNA 3ZVAA 1EPTB 4GCHF 1LPZB 3S69A 2CJIA 1UTPA 1ELTA 1YGCH 2KZ4A 3U7UG 1SR5C 1VKYA 3B8JA 1AKSB 2BQ6B 3PGHA 1C5QA 4Y79B 3KIDU 3RR3A 4AYVB 1AE8H 1F0RA 1VGCC 1ATEA 1OWKA 2C4FH 1BBRH 3TIUA 1GL1A 5A2MH 4D7FA 5LPRA 4A94C 4XBDA 5T1VA 1WU1B 4UONA 4AZ2B 2H9EL 2LP6A 1NFXA 1HAVB 4XRNA 1F2SE 3T26A 3CA7A 4ASHA 3TJUA 1XKBC 2GX4A 2BOHB 4ZH8B 3GDSA 1V2KT 1E0FD 4NZLA 4Y6DA 3KQCA 1EGFA 1HB0B 1ZAQA 3OTPA 3N7OA 5L30L 2VWLL 3A7VA 3N7EA 4ISHH 1NFYA 5EJZA 1C2LA 1Y8TA 4X6NA 1MZAA 1AUTL 3IJEB 1SPJA 3K9XB 2VVCK 2P95A 1CU1A 3O8CA 2GKVE 1AB9B 3Q00A 4Y8YA 3SOQA 3NTBA 1G3DA 3BIVH 1HAOH 2J95B 1QBOA 1SHYA 4AORA 1TALA 1K2I1 1YM0A 4YESB 2BD8A 4YM9A 4YXWD 1B0FA 1APOA 1TPPA 2WHXA 2R3UA 4B75A 3C1KA 1GBMA 4CUEA 3AASA 4I8GA 1GHBG 3N99A 5L2YH 1FJSL 2FMJA 1DVAH 3T25A 1C4Y2 4K69A 2VIQA 5ABWA 1IQML 2B7DL 4K8YA 4AG1A 1MAYA 2WV5A 2G5VA 1M1XB 1C5WB 2XOKD 1LMMA 3CS7L 1XMNB 2D1JA 5KN5C 1GHBF 1YLNA 1EFRD 4I86A 1KY9A 5CMXH 3JZ1B 1LKAA 1KXFA 1GHYH 3SGBE 1ORFA 2P3FL 4ISLA 3GCTG 2ZGXH 3RM2H 4ASUD 1KLOA 2GD4A 1SGFA 1BMMH 3KL6A 5ETXA 4FUFA 1MCVA 4MNYA 1M9UA 1EPTA 4JYUL 1LPZA 5FX6A 3VFEA 1O2PA 3GCTF 5C1XA 1UCYH 1NRQH 1IQGA 1ZTLA 1AKSA 1O2KA 2BQ6A 2SGQE 4U32A 2AYWA 1MKXH 1TRMA 2W86A 5EQRA 1LO6A 4Y79A 4CRFA 4RS0A 3HO3A 1G3EA 4D7GA 3P8FA 1FLEE 2BXTH 3DT0H 1NO9H 2JH0D 5GDSH 4YT6L 1WU1A 4Q4LA 1A7SA 1DWEH 1VCQA 1NBMD 3MQEA 3RXUA 5EW1H 1HAVA 2WZQA 3MU0A 2OYEP 1HAHH 4B6FA 3UNRA 1P04A 1CX2A 2BOHA 4ZH8A 2FWWA 4RRZA 2HLCA 1K22H 4DT7B 1UO6A 3C27B 1Y59T 1G3BA 1ATBA 3T2NA 3U28C 4F4OC 2GZ9A 4CRDA 4X8SL 2AGEX 2BT7A 3IWMA 2FO9A 1XKAL 3MYWA 4CRAA 3K9XA 1V2QT 1JIRA 3E8LA 1GBAA 4LMFA 3DSGA 4KGAA 3ZZ5A 1GJCB 3A82A 5EG4A 3UNSA 1PPFE 1Z8RA 2G8TA 1IQJL 2J95A 1XM1A 2XNIA 3BEIB 4O1ZA 1C2KA 1C2FA 2ALVA 1J17T 2ZDLA 3M3VA 5JBBE 3RLYH 3KN2A 5DN6D 3NK8A 2JH6D 1EB2A 1AFEH 3C9AC 4D90A 2HOBA 2W3IB 2HLDD 4ISNA 3ZZ9A 1OWDA 3POYA 3L6PA 4B73A 4NA9L 2A32A 1KKEA 1RIWC 1WXRA 1O2IA 3BV9B 4RUTA 4I31A 1V1IA 2ZTXA 3FFGA 1MH0A 2FYRA 2GCHG 1FZZA 4JMYA 4RKOB 3RXQA 4AC9A 1MBQA 2BDCA 3E6PH 2R2MB 2WG4B 1P0SH 2J38B 1BTXA 4WVPE 1GWAA 2VJ1A 3RXTA 3RU4D 2GCHF 5B6LA 2AIPA 1C5YB 3BTKE 2PFEA 1ELEE 1O5AB 1V2LT 2FX6A 3I29A 2Z9KA 3P8NA 4YOGA 4A92A 4GHQA 4CH2B 2C8ZB 3MHWU 4HTCH 5EXNA 1HXEH 1PPCE 4I8KA 4TPIZ 1O5GH 3L33A 2GT7A 4MNXA 2CXVA 1Z8IB 1EXFA 2QXGA 3BEFB 3A7YA 3MU4A 1LKBA 2A5KA 4MMXB 3SJ9A 3KCGH 1UTOA 2FX4A 5EXMA 1BMFD 1UTKA 1UTNA 2A4OA 2XWAA 1EP6A 1PQ5A 4BTUB 2VVVL 2WV4A 3LIWB 3SV6A 2ZDVH 1SGRE 4MTBA 3EA7A 3OLUA 2WFTA 2G4TA 3VEQB 4CBNA 3MH4A 3OX7U 1QIUA 1IHSH 2CMYA 3AAVA 3SUDA 2VWLA 3LU9B 5G4BA 1EPGA 1EAUA 1BBRE 3HPTB 2H9EH 3MNCA 3RXAA 1YPGH 3ZZAA 1EQGA 4K1SA 3LGVA 3A8AA 1F5RA 4A6LA 4E05H 4BNRA 1IQHL 5C5NA 5EW2H 1RGQA 1KTTB 1V2UT 2H1UA 5L30H 3PM3A 2O8WA 3SNBA 4RRXA 2G51A 2W3IA 3TLOA 2RG3A 3E3TA 1BJVA 1N8OB 1DUAA 5COXA 1ABJH 3PLKA 2K8IA 2ZWLH 1COUA 1GBTA 4FUEA 1FJSA 3W1EA 4I33A 1FPCH 1Y3UA 1V2PT 3U8RH 1T8OA 1LVMA 1IQMA 1KXAA 4LOYH 1BTZA 5DPAA 3DFJA 3CS7A 4KKDA 3A86A 2VU8E 1TOMH 5JBAE 1RS0A 6ESTA 1GBBA 4KP0A 1TPGA 2ZGBH 2PTCE 2TGPZ 4HI3A 1SBWA 1NM6A 1F0TA 1HREA 1ANDA 2ZG0H 1SB1H 3MH6A 5AFYH 3FCSB 2B7DH 1ANEA 1V2ST 4A1XA 1FDPA 2ZHQH 2BZ6L 3UNQA 1EAIA 4MNWA 1TOZA 4DURA 1GBCA 1Y3WA 1SOZA 1V2NT 2FYQA 3F0PA 4X1QU 4XBBA 4O02B 4BANB 5GWZA 1TGTA 3EQ0H 2Y5HL 2NU3E 1OYQA 2XC0L 4MLFB 1O2XA 4IN2A 5F53A 4CUFA 1C5VA 1WYKA 3EGFA 1MU6B 2BVRH 4JZIA 4BTUA 5E2PA 4DCDA 1DDXA 1T8LA 5FBEA 4JYUH 1NFUB 2OYUP 4R8TB 3LIWA 5DP5A 3BTEE 4XBCA 1C5OH 3ZYJB 5KIRA 1GJ4H 1P57B 1TRNA 2AH4X 1G3CA 3IG6B 1QIXB 3A81A 4AFZA 3RXSA 1O3CA 3A87A 3RLWH 4H6TA 1DT2A 3Q3YA 2PHBB 3A88A 4X2WA 1MCTA 2UWLB 4YT6H 5JBBS 4DIHH 5CHAB 3PRDA 3HKJB 3P8OA 1O5FH 3TBDA 1PQ7A 3HPTA 2A7JA 2FOGA 4UFGH 2FOEA 3OYPA 1YUGA 3GISX 3PWCA 5T3HA 2BD9A 1OB1C 3GCNA 3F68H 2G55A 4I8LA 4CR5A 3TH2H 3VB3A 3LT3A 3L3TA 3LONA 1QRXA 4WXVA 3ZIAD 2ILNA 2OINA 3QGNB 1IQJA 5FAHA 1O3BA 5C0UA 5T6DA 2Y38A 4Y7AB 6COXA 1YCPK 3BN9A 1MMJN 3UAIC 1ID5H 1OSSA 3HS7A 4X8SH 1ZGIA 2ALPA 3VXEH 5HMAA 1VGCB 4OS4A 4X8TL 4O3UA 3QMOA 1O3GA 1MTVA 1O5BB 2NU2E 3AW0A 4ABDA 2GJGA 1ZYOA 2RCEA 3P6ZB 3PO1C 2R0KA 9ESTA 2J4IB 2QIQA 5EPNA 2VIDA 3A85A 1E36B 4AOQA 1Z6EL 3UB0A 1F0SB 1LVBA 4Z0KB 4BAQB 2ZECA 4X8VL 3S9BA 4JYVH 1IQIL 4WXIA 1QL7A 3PV5A 4K2YA 3ODDA 4NA9H 1XX9A 1PXXA 4FU8A 2M5TA 1NFWB 1EZXC 2ZFFH 3F2HA 1AZZA 1AI8H 2PWXA 3UFAA 4B2CA 3RXVA 4NSVA 3A83A 1Y3YA 2A31A 1QB1A 2YMSD 2Y80B 1C4U2 2HPQH 1WHEA 3MDLA 2HGTH 1GCDA 3GISB 2BMGA 3MFJA 1OXGA 2Y82B 1PPHE 2EEKA 1GI4A 2AFQB 2OBQA 3QGJA 5BRRE 1HPGA 1NFUA 2ZPSA 3PMAB 3SI3H 2J34B 1LCYA 3SUEA 1U8CB 2VVVA 1OHHD 5C1YA 1ELVA 1RFNB 2FTMA 3M7TA 2AMQA 2K2TA 1CBWC 1MU8B 1GBKA 1GGDC 2EI7B 2PHBA 3M3SA 3GY4A 2P8OC 5B6OA 3N8WA 2UWLA 3LGTA 3TK5B 1B7XB 1EX3A 2J98B 1YPKH 3AW1A 1CHOG 1ESAA 4I32A 1P9JA 1UZQA 3TGIE 2WZPP 1Y3VA 2FP7B 2CHAC 4LZ4B 1O2OA 1D4PB 3D49H 3MO3A 1QA7A 5CKQA 4NIYA 1CHOF 1C5UA 1YKTA 3PLBA 1GI7B 1O2SA 4NIXA 1WBGB 4Y7AA 1IQHA 1EAWA 4A1VA 1DITH 3PTBA 1DE7H 1ZRBA 1C1PA 1N6XA 1YPHC 3H5CB 4DVAU 1K9OE 2KCPA 3ZYGA 3BTHE 1O3OA 1TBZH 4FUIA 3TITA 2Q6GA 1GJ5H 2BY9X 3GYLB 4ABHA 1URKA 4MPUA 1HXFH 1H1BA 1O0DH 4PH9A 1AIXH 1GI1A 1C1NA 1WDIA 2J4IA 1MABB 4ZCNA 1XKBA 1Z1JA 3HGNA 2FODA 1ELBA 1F0SA 3SNEA 4Z0KA 1RRKA 4OS6A 4X0WU 3P70B 3SBKA 1P03A 2F3CE 2HNTF 1C5MD 3SORA 3OY5U 4P00A 1NFWA 1IHTH 3SYJA 2GZ8A 3TVJB 2OC0A 5K7RA 1CA0B 1K1LA 1BBRK 1GJ6A 1SQTA 2A2QH 2YMSC 4Y8ZA 1YO8A 1KXBA 2A5IA 3K2UA 3P95A 4XE4A 2QF0A 1SLWB 2ZHWH 1LPGA 1BIOA 1NT1A 2Y80A 4FUJA 4CH8B 5FHTA 1Z8GA 3UR9A 4ABAA 3LN0A 3TK6B 5HIYA 2Y82A 3PMHB 2HRVA 2Y5HA 2XC0A 3N8YB 2FI4E 1NC6A 2TGTA 1C2JA 5DP7A 1P2KA 1A46H 5A0AE 4UE7H 3M7UA 2F43B 2J34A 1YUKB 2BB4A 4NWLA 2FXRA 2BZ6H 3S9CA 3SJKA 3PLPA 2XTTB 1BT7A 1ANBA 1BTPA 1TMBH 1BTYA 2NWNA 1RIWB 1E38B 3SGQE 1RFNA 1L1NA 2VBCA 1V2OT 1ZSKA 1T7CA 1TGBA 1MKWH 3W95A 4X2YA 1SGTA 3QUMP 1F92A 1O3KA 2EI7A 1MQ5L 3TJNA 4DOQA 2PKAA 2O8LA 3TK5A 4Z1MD 3ZZDA 3BTWE 3CS0A 1DWCH 4O3TA 1W14U 2ZP0H 4J2YB 1GI8B 5EJLA 1HRFA 5E8EH 3SN8A 5C0TA 4ESTE 4AQTA 4KELA 3ZZ3A 4MPVA 1H8ED 1O2RA 3Q7DA 4GAWA 2BD5A 5AF9H 4IMZA 1W11U 1UW7A 1FY5A 2NU1E 2ZCHP 3KF2A 3ZZ8A 2WUCA 3SOBB 1BMLA 1BMNH 5EOKA 1L4ZA 1O33A 1V3XB 1SMFE 1HT8A 2FS9A 1DX5I 3KQBL 1UVSH 1D9IA 4NFFA 4AB8A 2Z3EA 2WPJS 1HUTH 2TGAA 1S82A 4X1PU 2H5CA 1VITG 1LHEH 2ZC9H 1BRUP 2JJ2D 1DXPA 1Z6EA 2GMTC 1L3YA 2BQWB 2J9NA 4NGAL 2QCYA 2WPKS 1BCUH 4X8TH 1VITF 1IQIA 2Z7FE 2PGBB 2YGOA 3RM0H 3TNSA 1HFDA 1DSUA 3UY9A 2P59A 1TBRH 1K36A 2ZHDA 1V6DA 5AFZH 3SU6A 4WMEA 1ARCA 2PR3B 1TPSA 1YPLH 1GHZA 3Q3KB 1H9IE 3M5OA 3STIA 4A7IB 3TK6A 4IW4E 2P16L 3LH1A 1G2LA 2JDID 1EMNA 2PSYA 3ZYEA 2BY8X 3SV2H 3N8YA 5ESTE 4ABIA 5C94A 2ANWA 1ESTA 4YTAA 3FN8A 3HS5A 1ZRKA 3N8ZA 1AWHB 3ASIA 1C2EA 3LC3B 1QTFA 2V3MA 1C1WH 6LPRA 4FVDA 1TNHA 1GJ9B 3SUGA 3BTTE 2OC7A 2RHPA 1HAXB 1KXDA 2YOLA 5FBIA 3JZ2B 1P01A 3ZZ7A 1O3NA 1W0JD 4X6MA 5A8XA 4KTSA 1INCA 1Q31A 3EAJA 1KMHB 5EXLA 1COWD 3G01A 3ELAL 1F7EA 3PB1E 5EIYA 1GHAG 2WPIE 1F5KU 2WPME 2FLBL 4LXBH 4B76A 2F91A 5TCAA 1TX6A 1UVUH 1C9TA 3MO6A 2ASUB 2ODQA 5HM9A 4AB9A 1ZZZA 4NIWA 4ABBA 1GHAF 2VIOA 4YT7L 3AVZA 3PRBA 1FF7A 2DE9A 1V3XA 5DP4A 2CGAA 4B2BA 2ZFSA 3TGJE 1THPB 2BDHA 3O8BA 1FY8E 3EE7A 1J8AA 3URCA 1ELCA 2KX4A 3ATMA 1ARBA 1HX2A 1EUFA 2VVUL 4WH6A 3QWCH 3OAAD 1UHBB 2ZEBA 2BQWA 1YBWA 3GY3A 1EMOA 5DGJA 4H42U 4OGXA 3RXEA 3Q77A 2G81E 4O03A 2BDAA 1E1RD 1CGHA 4XFQA 1SL3A 1TE0A 4ZKSU 1BOQA 3RXRA 3M5NA 2M74A 2BM2A 3ODFA 2FIRH 6GCHG 1P2OA 4Y0YE 2PR3A 4YZUB 3Q3KA 1AGJA 1TIOA 4ISOA 2VH0A 4A7IA 8LPRA 3LDXH 5GJ4B 1JL9A 1D6WA 1PPZA 1AVXA 6GCHF 2J97A 1O2ZA 2XBWL 3R0FA 3M5MA 2JKHL 2QXHA 3E91A 4IGDA 5FXLA 1PPEE 1LHGH 3N7DA 2GTBA 1T31A 2ZU1A 1LHFH 3LC3A 4NZQA 3S6XA 4KTCA 1P3CA 2ZDKA 2KM0A 3DHKH 4M10A 1YCPM 3PO1B 3LH3A 3U69H 2SGDE 2XWBI 4X8UL 1HAGE 3E0PB 3SJIA 1LVYA 1MQ5A 1BHXB 2HVXA 1PYTD 2FZZL 1F7MA 4CUDA 4FUDA 1LPKB 1DY9A 2W26B 4JZFL 1J15A 5F19A 4D8NA 1BA8B 1SQAA 3DCLA 2STBE 3F9GA 3MI4A 4CBOA 1WUNH 2AEIH 4BDXA 2EY4C 5CISA 2V6NA 3LKWA 3UPEA 6CHAC 2Q6FA 3DFLA 2Z9IA 5IKVA 1SQOA 2WYJB 1BUIA 2BT8A 2W2QE 2EI6B 3LN1A 1HZ8A 2ZTZA 1JRTA 1LTOA 2SGEE 4ACAA 2ZI2H 3P8GA 1PRHA 2BVSH 3EYDA 4FUHA 4ACBA 4Y7BB 1SGCA 1MBMA 1SLUB 3KQBA 5I46L 4LZ1H 1MOXC 2ZGCA 3SV8A 2NPRA 1UTJA 2UWOB 1MQ6L 1L5GB 5SGAE 2QY0B 1UHBA 3GCHC 4XOJA 5IDKA 1ATDA 1CBWB 1SOTA 4INHA 4K1TA 3Q76A 1WAYB 1K1OA 1XVMA 3UTUH 1P2NA 1X7AC 2P8OB 1AMHA 3LJOA 3NRLA 3U8OH 2J5UA 1GBFA 1W2KH 2VH6B 1MD7A 3D62A 2OBOA 3OLTA 2WG3C 1O5DL 3PWBA 1C5RA 4XDEA 4IMQA 1YPMH 1ZSLA 2CHAB 4DT4A 1APQA 1O2QA 4YZUA 1BB0B 3MU5A 4Y71B 5IKTA 1ETRH 1THSH 5L2ZL 1NS3A 2KAIB 2A2XH 1V2WT 1NY22 4TWWA 4M11A 2P16A 4NGAH 5F8ZA 4HZHA 4BDWA 3T62A 3U1JB 3RXLA 4B74A 1CCVA 5JB8E 1MTNC 4WWYA 4NWKA 3RXJA 1FIWA 3BSQA 1QB9A 1SC8U 3U8TH 2W6ID 5IK2D 7LPRA 2DE8A 1MD8A 2ZCKP 1THRH 4TSFD 1HGTH 2A7CA 2A0QB 2ANMH 1PYTC 1S6LA 1SLVB 1RTFB 1TWXB 2WPIS 2WPMS 1AFQC 1Y5AT 4CRBA 3W94A 2W26A 1UZJA 1BRCE 1HNEE 3NUMA 1NN6A 2C3SA 2IJD1 1SVPA 1SI5H 2STAE 1DS2E 5GXPA 2C8WB 1EPHA 4H6SB 2YMSB 4Z0LA 3CENL 3DUXH 3ZV9A 4DGJA 4FUCA 4MPWA 2V3HH 4FUGA 2DUCA 4OTJA 2XCFA 1ACBE 3QH0A 2TPIZ 3RU4T 1OWHA 1G2MB 2EI6A 3ZVCA 1K1IA 4CHAB 3EA9A 1TLEA 4Z6AL 3PYHA 1YC0A 2UUKB 3ZZCA 4X1NU 4XL1A 5A09A 3M5LA 3ELAH 1GG6C 1TQ7B 1HAPH 1GK5A 3FP6E 1QBNA 1PQ8A 2VWNL 1W7GH 2FLBH 4JYTA 1V2TT 2FS8A 1C2GA 3BG8A 4ABGA 4FUBA 4AGKA 5CKNA 2VVUA 4NFEA 2P28B 3V12A 1SLXB 1BRAA 2Z9LA 3QTOH 2H9TH 1P2JA 2OC1A 5DJ7A 5I25A 1QY6A 1QCPA 2VH6A 1IP0A 1O2UA 1ETSH 4C16A 5PTPA 5EPYA 2LPRA 3BG4C 1H9HE 4AG2A 4BAHB 3OY6U 4Y71A 2KB9A 2KAIA 2OUAA 1SQRA 4ZKNU 1K21H 1Y5BT 5IKQA 3NWUA 2F9NA 4GSOA 4A1TA 1DQBA 2XBWA 2I9BA 2KV4A 2I6SA 4WMDA 2JKHA 1EB1H 2ODPA 3PMJA 1OP8A 2VNTA 2F83A 2BHGA 2BOXA 1GDNA 2ZU3A 2KCAA 2J38A 1DM4B 1EKBB 1C5SA 2FI5E 2W3KB 1K28D 3SU1A 3SZNA 1SGNE 2VINA 3MTYA 1TMTH 3GY5A 2GMTB 3NZIA 2FZZA 1XDTR 3D23A 3RXKA 3A7ZA 1DDJA 1UTQA 1DOJA 4YLUA 1EZUC 3EDXB 1O3PB 2FESH 3SNDA 3RMNH 1CT4E 2G00L 2BLOA 3F1SB 2P3FH 2TGFA 1MTWA 4X8UH 2JJ1D 1GBJA 3LOXA 2Y81B 1BMAA 1LHCH 2GZ7A 2OXSA 5J4SA 1G2MA 1HBTH 3FZZA 2Y7XB 3TGFA 3U73A 4JZFH 4SGBE 2VGCC 2XYAA 2SNWA 2GP9B 2BLWA 5DG6A 1SHHB 1FSBA 4JZDL 3GYMA 5DP6A 3RXHA 1BHXF 3BTQE 3KHVA 1GI5A 2BD7A 1GBHA 1W0YH 2OQUA 1UCYE 3QCWA 3F9FA 5HYOA 3NT1A 2IOTA 3TGKE 3OU0A 5FX5A 3LJJA 1MQ6A 3MO9A 2EC9H 4B6EA 1NRPH 1PFXC 1O30A 2Y7ZB 3RMLH 2Z3CA 1DLKB 1O2HA 1ZGVA 1T4UH 2XXLA 2ZGHA 3KGPA 4DIIH 3RC6A 1LMWB 5JB8S 3TH3L 1GBIA 1GJDB 2Z6BD 5I46H 2BD2A 3GDVA 5FCRA 1LVOA 2WINI 3LTFB 2SNVA 1GBEA 2BD3A 5H4IB 1IOEL 5EODA 3RMOH 4GVUA 1DUEA 3RXOA 1MKWK 1FFMA 3UWJH 1C4V2 2D26C 3QX5H 8ESTE 5C17A 1O5DH 1SG8B 4U30A 3QO6A 3BIUH 4YOJA 1DIYA 1KDQB 4RSPA 3T5FH 1YLDA 4BOHA 3ENSB 4G1MB 5A0BA 1QNJA 2BSFA 2FOMB 3MH7A 1T8MA 2W3KA 3GCOA 2FTLE 1CVUA 1ZHMA 3ZVEA 1H8HD 2IJOB 2WSSD 3NXPA 1Q2WA 1PGEA 1X7AL 2OCVB 1A0JA 4IN1A 4VGCC 2QYIA 2WPJE 3QN7A 4K60A 3HATH 2BQ7B 3M7QA 2CN0H 4ZAEB 2GDDA 1L1JA 3SU3A 5JYIA 2F9PA 1C1RA 1DY8A 1K0HA 1OPHB 3SJ8A 2WPKE 3V64C 2ZHEH 3CENA 3KRKA 1FAKL 2Y81A 1IGZA 1SKYE 4CR9A 5K0HB 1G1SA 1H8DH 1QA0A 2Y7XA 3F2FA 3QTVH 1EPIA 1KLTA 3OTJE 1SGYE 4GUXA 1WTGH 1G30B 3RXPA 2AIQA 1P8VC 3WWFA 4ZHLU 1S83A 3RXMA 1XUGA 3NTGA 2W5EA 3RMMH 4DW2U 1FNIA 4OGYA 4RKJB 5HGGA 2VWNA 2UWPB 2AYLA 1A3PA 3GCXE 3E1XB 3SU4A 1IVOC 2K2SB 1JWTA 1IQFL 5BPEA 4Z6AH 2AS9A 2Y7ZA 5E0JA 3MU1A 3BF6H 1J14A 1NTPA 4THNH 1FPHH 1I0UA 3FO8D 4E7NA 3MQKC 1MUEB 3FP8E 1C1VH 5LH8A 1K1MA 2H5DA 5A8ZA 1GPZA 2XCNA 1EAXA 4GHTA 1FE2A 3TNTA 5EGMB 6CHAB 1T32A 1KXEA 2P26A 1QFKL 1AUTC 3BPSE 1GJ7B 1P9UA 2AHME 1N1LA 3V7TA 4K1EA 2H9HA 1VCWA 1VITH 1HJ9A 3GY6A 3SUFA 1WHFA 3F9EA 1FUJA 1GI3A 2BDBA 5FL7D 2J2UB 1LHDH 2QAAA 1KDQA 1SZBA 3ENSA 1YLCA 2P3FN 2ZCLP 1UJ1A 3GCHB 1W3CA 1YUFA 2XBXL 3SU0A 1GBDA 1HCGB 4ZXYL 1TNGA 4UFDH 3RP2A 3U9AH 2BQ7A 1GCTC 4ZAEA 1GI2A 1Q3XA 1C5XB 3NCLA 5C3NA 4ABFA 1G37A 4JZEL 5C20A 3SO3A 1GVLA 2O8MA 1TGSZ 3GY2A 1C1QA 1N6YA 4ZXXL 2W2OE 1WQSA 2G00A 2V7QD 1OYTH 3F0OA 5GPIB 3CP7A 1AZ8A 2L74A 5K0HA 3S9AA 3URDA 7GCHG 1O2JA 3B9FH 3N8XA 5HKKD 1O36A 1IOXA 1EZQB 1QB6A 1JBUL 1TAWA 2YGQA 4LORA 2FDAA 1C5MF 1T8NA 7GCHF 2AMDA 1D6RA 1QGFA 1MTSA 4RI0A 1RTLA 4XBMA 2BY5X 2UWPA 1P2MA 5AHGH 4I8HA 2R9PA 2L6OA 1FV9A 1KSNB 2WYGB 1DWBH 3UOPA 3VB5A 2J98A 1CT0E 7ESTE 2CF9H 1QJ1B 3GDUA 3TU7H 3KQDL 2ZHFH 1CEJA 1O3DA 2Q6DA 4JZDH 4AYYB 1BQYA 1DPOA 2V3OH 2KCYA 1W10U 2C8YB 4D0FA 4AX9H 4ISIL 2LNCA 5JVZA 1AO5A 3A7TA 3H7OA 1N7DA 5FPSA 1ZSJA 2W7UA 2C8XB 2A4QA 1G9IE 2HORA 2BVXH 4OS5A 3FBYA 2PW8H 3QZQA 5EGMA 1IOEA 2B5TB 3ATLA 1PPBH 9LPRA 4IC6A 1O3AA 1P3EA 2R2WU 3OEED 4NA7A 4GU3A 1MZDA 3TH3H 3M61U 1SFIA 1ZPBA 1XUJA 2FM2A 3KQEL 3GY8A 3O8RA 2J2UA 2BLQA 2ZQ2A 4BXWA 3A8BA 4O97A 4ZROA 3KK6A 5F1AA 1P9SA 1UCYK 5T6FA 3F2GA 3UQVA 1NPMA 3GCWE 1HCGA 1PFXL 1MKXK 4XD7D 2PUQL 4D0EA 3DD2H 1S81A 4M9FA 3MOCA 1BRBE 4JK6A 1KLIL 1FY3A 4RN6A 1ABIH 4IS5A 2HWLB 2HNTE 3SI4H 3A8DA 2PLXA 3DSPA 3ZZ6A 3BG4B 1IQKL 3Q3XA 2J94B 4X8VH 2SGFE 4F49A 2W6JD 3VB7A 2KL7A 2V35A 3UWIA 5EJ1A 1OX1A 2ZFTA 4TPYA 4UD9H 1ZOMA 1EZQA 2FOCA 2OTVA 1HAYB 1O3FA 1L0ZA 3AAUA 1TA6A 3SHCH 2QXIA 1NPEB 1J9CL 1UMAH 2B8OH 2AMPA 3VGCC 2ZFRH 1FAKH 1GJ8B 3VB6A 1SGIB 1H9LB 1OP0A 5TJXA 1KSNA 1EOJA 3TJOA 1XUFA 4B2AA 3FAOA 3F3BA 1OWEA 3TK9A 4MMYB 1IQFA 5KEDA 3ZYIB 1HJAC 1D3TB 1OKXA 2W7SA 1TGCA 5L6NH 3MNSA 1YF4A 4GCHG 2BZAA 2JIZD 5F03A 5CHAC 1AQ7A 1A2CH 1C1MA 1ZHRA 2A7HA 5J4QA 3KL6B 4HG6A 1T4VH 4BAMB 1E34B 2OD3B 2ZU2A 1YPJH 1ADXA 1CHGA 2VGCB 2BXUH 5JW1A 1IQLL 5C2ZA 1GBLA 4B1TA 3I77A 1J16A 4X6PA 3ZVGA 1UVPA 1U6QA 3RC5A 3T29A 1UZKA 2BD4A 3KEEA 2RDLA 4A5TS 2O8TA 1W0ZU 2ZQ1A 2P93L 4MQAA 5F6MA 1P05A 1QFKH 4IC5A 1P2QA 1AE5A 3PROA 2GVFA 4IBLH 3M37L 2XBXA 3MMGA 2D2DA 2ZZUH 3M3TA 1G32B 5CE1A 2UUYA 1YY3A 5DP9A 2HALA 3KNXA 1F7ZA 1O2GH 3FANA 4PROA 1O3LA 4BXSA 5JBCS 1C5LH 3ATKA 3FZDA 2J94A 2ANYA 1Z8JB 3UQOA 3VXFH 2WPHE 1ETTH 5A0CA 1CGIE 1SGDE 1ANCA 1C2IA 1QL8A 3ZVFA 4ZXYH 3QDZB 5C5OA 3BT2A 5C67A 4X2VA 1C1UH 1DX5M 3SU2A 3ZZBA 2YGPA 4TGFA 1TNKA 2ZDMA 1O39A 4FETA 4HFPB 2ZA5A 4JZEH 1EPJA 2P3UB 2G52A 2QXJA 1P02A 2BOKL 1IQNL 2RA0L 3BTGE 4ZXXH 1YPEH 1EQHA 1BDAA 1NESE 3H09A 4ZMAH 2AGIX 1VCPA 1A0HB 1CSOE 2RDEA 2LELA 3NPSA 3PV2A 2ZGJA 1RTKA 1U67A 1O3IA 3S7KB 2Y5FL 5CKMA 4KTUA 1JBUH 3KQDA 2DDUA 4Y0ZE 2KNIA 1TRYA 4VGCB 1UK3A 2FOAA 2PV9B 1HLTH 4OM9A 1UVOA 2FEQH 2VWMA 1O3MA 3NKKA 1TOCB 1Y5UT 1GHVH 2QF4A 1O2NA 1IQEL 1ELAA 2PSXA 2CV3A 1SGEE 1DANH 4MG3A 4X6OA 1TX8A 2ZKSA 1FI8A 1E79D 2VB0A 3BT1A 1WSSH 1CVWL 2O8UA 3SW2B 1O31A 2FLRL 1F0UA 3WY8A 1LK9A 4X1RU 4ISIH 2BO2A 5CDFE 3P17H 2BDIA 1O35A 2IPHA 1TMUH 2MHPA 3K6YA 3KQEA 3MNXA 3F6UL 5EU8A 3SQEE 2BX4A 1DICA 1EOLA 1S85A 3A7XA 1XFEA 1GGDB 4ZHAB 5EQQA 5JB9E 3V3MA 4NIVA 2VWOL 3FVFB 1O38A 2F9OA 3HO5A 3R3GB 3ZV8A 1PJPA 1FX0B 3ZZ4A 1Z71A 1HT5A 3PV4A 8KME2 2WPLS 2QGRA 3V65B 1QJ7B 1RXPA 2J92A 1QBVH 3HKIB 3QZRA 4YOIA 2XNDD 1AN1E 2HPPH 1B9WA 3ZVDA 5CHBA 3T28A 2PKSC 3RXCA 4AGJA 1IQKA 1QR3E 4CRGA 1YYY1 1C1TA 2JETC 5IYTA 2PUQH 4ZKOU 3F9HA 1CA0C 3A89A 1GHWH 1WCZA 4P02A 1KLIH 1XUHA 2P3TB 3RUOA 1DFPA 4AFQA 4COXA 1O5EH 3HK6B 5GIBA 4AN7A 2IPQX 1ZMLA 3O8DA 1HIAB 1DLEA 1C1SA 2P3UA 1GMCG 1MTUA 2QE7D 1Z1IA 1NU9A 1GVKB 3A7WA 1V2JT 1OS8A 1TFXA 4XLWA 4BTTB 3WW7A 4JYVL 1ZJDA 2GCTC 1GMCF 1LPKA 1YP9A 1C2MA 2WFXB 1GDQA 4OS2A 3M36L 2THFB 1SSXA 1FY1A 3D65E 1XVOA 1UZPA 3EGKH 3I78A 1QQ4A 1GCTB 4XSKU 2I6QA 5TCCA 1ZLRA 1J9CH 1H8IH 2QN5T 1Q4GA 1IGXA 3E90B 5GNDA 1TYNA 2WYJA 3RXBA 3UREA 3QLPH 3OSYA 2VVCA 1P11E 1LQEA 1BJUA 1OOKB 2F9BL 4Q63A 4Y7BA 1GJBB 3SW2A 1TABE 4FXGH 1A4WH 2BYAX 4NG9L 1EJAA 1ELGA 2D8WA 5HXFA 1IQLA 1RJXB 2A4RA 2UWOA 5ESBA 1TBQH 2G4UA 2QC2A 3UOUA 3RXIA 1SGFG 2YNBA 2W2PE 4ZHAA 5AVDA 4U01A 4YT7H 2F4LA 2P93A 1CQQA 1L4DA 1S6FA 2PUXB 2WPHS 3UIRA 5FPYA 5HM2A 1NQLB 2KR7A 2M2AA 3LGWA 2BLVA 2Z94A 2W2ME 3M37A 3KYFA 1S0RA 1BF9A 1EBVA 3AK5A 1ZHPA 1VZQH 3GICB 3PTNA 5DP8A 1CQEA 1HRTH 4AFUA 3NJPC 1KXCA 1GI0A 1CT2E 2C93B 2TIOA 1C2DA 1KIGL 3GY7A 4TWYA 4MNVA 1NZQH 3KQ5A 2P94L 3BEUA 1W7XL 1NBME 1HAFA 3VB4A 1TA2A 2P3TA 2W2NE 1HYLA 2XBVL 1D3DB 4M7GA 1TPOA 1HIAA 1AY6H 2ULLA 2Z9JA 1FAXL 2GV6A 4I7YH 1AHTH 3DEMA 1SFQB 1KLJL 1VJ9U 4ZKRU 2BOKA 1IQNA 2RA0A 4BTTA 4Q7ZA 1O5CB 1W8BL 2I9AA 4ZUHA 3ZYDA 1QL9A 4UFFH 4OS7A 2XW9A 4O9VA 5LPFA 2C90B 3IITB 4YO9A 3SV7A 2RNLA 2A4GA 3ZVBA 2Y5FA 3RXFA 4BAOB 4MPXA 4FOUC 1TB6H 1O37A 1FMGA 3HK3B 3MU8A 1B0EA 1AU8A 3EA8A 3P92A 1K1PA 1SGPE 1QHRB 2AERH 2OQ5A 2JH5D 2MGRA 4GPGA 5DP3A 1IQEA 1O2WA 2AGGX 1IAUA 2BX3A 5T6GA 1EPTC 2WPDD 2QF5A 2PGQB 3HGPA 3BTDE 2ESTE 1K1NA 5E0HA 5JB9S 5HIZA 1O2VA 4X2XA 3SZEA 4FU7A 3SGAE 1HV7A 4D9RA 3WWBA 2OLGA 1NZIA 4TY7A 4INKA 1FXYA 3VG8A 1EASA 2XC5L 1ZTKA 3RU4E 2BMGB 2QA9E 1E35B 3VGCB 2XC4L 2R3YA 1C1OA 2BDGA 5F8XA 3DA9B 7KMEH 4F55A 1C5TA 3FKSD 3TZIA 2Y5GL 3V0XA 4RRYA 1CVWH 1DSTA 2OP9A 4D9QA 1BTWA 2FLRH 2VWOA 1G36A 1OWJA 2GGVB 2XBYL 1JOUB 4MMZB 1CE5A 4TYDA 3SHAH 1HJAB 3ATIA 3F6UH 5JVYA 2H6MA 2G5NA 2V0BA 3N8WB 3OEHD 2VIWA 1D3QB 2ZPQA 5JBTA 1AB9C 1A1RA 4TT3D 3MWIU 2A1DB 1OWIA 2K1QA 4MVNA 5KECA 2A5AA 3SNCA 1QZ8A 5L2ZH 3HO4A 1FONA 1MAXA 1QJ6B 1P09A 1TNIA 1EJMA 2SGPE 2ZF0H 2EI8B 5EQSA 1C5ZB 3IITA 3EE0B 5KGOA 2K0QA 5E0GA 3OFND 1G1TA 1HAZB 3M36A 1E37B 1WV7H 1JRSA 1UVTH 1GVZA 5A8YA 1SGQE 2CK3D 5IKRA 1AD8H 3SOSA 4E7RG 1C9PA 1EZSC 1C5NH 1VJAU 4OS1A 1S6HA 1CO7E 1V2VT 1FIZA 1QQUA 2KCOA 1A5HA 1W0KD 3ITIA 1IJQA 1BTHH 1NRRH 2ZPRA 3SOVA 3H7TA 1GI6A 5C1UA 3N8VA 1C2HA 2GV7A 4MDSA 4WY3A 2SFAA 4Q7YA 2XRCA 1HAIH 2PTNA 1L1GA 3MNBA 1LPGB 3P5BL 1JMOH 4FVBA 3CFWA 1O2TA 3SJOA 3V13A 1AUJA 4TY6A 4JCNA 2EA3A 3PMBB 1ZR0A 4X1SU 3GOVB 1O3JA 3RDZA 1ELDE 4WJG2 2F9BH 1TQ0B 2TBSA 2H9EC 1PQAA 2JJLA 1NRSH 4FM5A 4R0IA 4LK4A 2QV1A 4NG9H 2GT8A 4ZHMU 1GHXH 2BY7X 1DXWA 1YGCL 1A5IA 1L2EA 2IN2A 1PTHA 1OP2A 3QK1A 3OE7D 1GMHG 1F5LA 1O32A 1ZPZA 1A3BH 3E16B 2PKAB 5JPMH 2SGAA 1XUIA 2OK5A 3UUZA 2ANKH 2P94A 1WQVH 2VIPA 3LAQA 1GMHF 1JXPA 1ZTJA 4FU9A 4Y8XA 3TPIZ 4Y11E 2HVYB 1O3EA 4B71A 1YWUA 2XBVA 4U2WA 3HS6A 4Y76B 2F9VA 1KYNA 1P06A 3A80A 4RT0A 1KIGH 1LMJA 1P10A 1FAXA 5LGOA 1XUKA 2VRSA 5E8DA 5F8TA 2BY6X 1O2LA 3U98H 8GCHG 1GJAB 4ISHL 2EI8A 1ZPCA 2ZDNA 5JBAS 1A61H 1W7XH 2ZDAH 4YLQH 5DK1A 3DSOA 4H4FA 3TH4H 2ZTYA 1UK2A 1ESBA 1EJNA 1CGJE 8GCHF 3SV9A 4UDWH 4WMFA 1LQDB 1Y3XA 2NU0E 1HDTH 2CF8H 4Y10E 4ABEA 4F48B 3KQCL 3R05A 1KLJH 1LDTT 3A8CA 1XXFA 3CNRA 4I8JA 1O2MA 1TLDA 1NROH 1W8BH 2VIVA 3TJVA 5GCHG 4NCYA 2VJ3A 2PKSB 3RXGA 5LPEA 3M35A 5L2YL 2P95L 2FD6A 1ELFA 3BTFE 1DWDH 1YPHE 1DVAL 1EAIC 1Z7KA 4D76A 2JETB 4GU4A 3SNAA 1MTNB 2Y6TA 1K37A 1V1HA 2NU4E 1GDUA 3K6ZA 5GCHF 5JBCE 2ZIQH 5FDQA 3RC4A 3LC5B 4OTYA 2FOBA 1FN8A 5DO4H 4E1GA 1C5PA 2PP6A 1G2LB 1UK4A 4JZ1A 4CHAC 3S7HB 4BTIB 2XC5A 4Q80A 3ESTA 2WUBA 3LPRA 2XC4A 2YNAA 1KTSB 1W12U 1AFQB 3GS9A 3STJA 1V2RT 2ADXA 2GCTB 2Z9GA 1TNJA 1BZXE 2Y5GA 3FOAA 3SQHE 1YCPH 1Z6CA 2FOHA 1HAEA 2FI3E 2Q1JB 2XBYA 2R0LA 1WTHD 2ZFPH 1E1QD 2Z3DA 3S0NA 4CRCA 1FQ3A 1NU7B 2B0FA 1D3PB 3LGIA 4DJZB 1QURH 1QRZA 2A45B 3A84A 4NA8A 3U1IB 4DY7B 4E06H 1XKAC 1FN6A 1EQ9A 2UUJB 2ZU5A 1CCFA 3K65B 2BTCE 1QRWA 1B5GH 4JK5A 3B23B 2CJIB 1IQGL 1A3EH 2FOFA 2HNTC 4UFEH 2ODYB 1EATA 5DSFA 1GG6B 5DKMA 4Y76A 1W13U 2UUFB 1P2IA 1JIMA 2ZFQH 1N8OC 2BDYA 1F0RB 1AVGH
chains in the Genus database with same CATH topology
1TX7A 3T27A 1HJ7A 4NSYA 4AFSA 1ATAA 1TGNA 2H2ZA 3ATWA 1K1JA 1NFXB 2FLGA 3MH5A 1LQDA 1A0LA 5FPTA 1Z6JH 4Y6DB 2GDEH 1AVWA 2VWMK 1ZJKA 4K3JA 1G1RA 4DG4A 1VR1H 2TRMA 5JDUB 4INLA 1NFYB 1BITA 1HJ8A 1H4WA 3LGYA 2ZNKH 1WOFA 1TNLA 2WPLE 3E0NB 1V2MT 1JV2B 2OC8A 4CREA 2ZU4A 2B9LA 1G1QA 2MGPA 3LC5A 3FP7E 3BTME 2ZO3H 1O34A 4RRWA 1BTUA 2VH0B 1S0QA 1NRNH 4GLYA 1P0SL 1S5SA 1UTMA 1N1IA 2O9QA 1S84A 3UR6A 1TPAE 1FY4A 4BTIA 1A5GH 2FPZA 2WYGA 1GMDG 1ZMNA 4WH8A 3RXDA 4SGAE 2RA3A 1RD3B 4UEHH 3LTGD 1NT0A 3SU5A 2F9UA 1TONA 4Q7XA 3FFGL 4Q2KA 5FCKA 2D1JB 2TGDA 1GMDF 1P12E 4QT8C 2Q1JA 4WF8A 1CA8B 1ZMJA 1XXDA 4CSYA 4K5ZA 1EP5A 3VPKA 4HGCA 4BAKB 1O3HA 2BOUA 3KCGL 1PPGE 1GL0E 5E2OA 2GD4B 2QF3A 4K8BA 3LGUA 4J1YA 4ABJA 1AWFH 1UTLM 1GI9B 1O2YA 3ZVAA 1EPTB 4GCHF 1LPZB 3S69A 2CJIA 1UTPA 1ELTA 1YGCH 3U7UG 1SR5C 3B8JA 1AKSB 2BQ6B 3PGHA 1C5QA 4Y79B 3KIDU 3RR3A 4AYVB 1AE8H 1F0RA 1VGCC 1ATEA 1OWKA 2C4FH 1BBRH 3TIUA 1GL1A 5A2MH 4D7FA 5LPRA 4A94C 4XBDA 1WU1B 4UONA 4AZ2B 2H9EL 1NFXA 1HAVB 1F2SE 3T26A 3CA7A 4ASHA 3TJUA 1XKBC 2GX4A 2BOHB 4ZH8B 3GDSA 1V2KT 1E0FD 4NZLA 4Y6DA 3KQCA 1EGFA 1HB0B 1ZAQA 3N7OA 5L30L 2VWLL 3A7VA 4ISHH 1NFYA 1C2LA 1Y8TA 4X6NA 1MZAA 1AUTL 3IJEB 1SPJA 3K9XB 2VVCK 2P95A 1CU1A 3O8CA 2GKVE 1AB9B 3Q00A 4Y8YA 3SOQA 3NTBA 1G3DA 3BIVH 1HAOH 2J95B 1QBOA 1SHYA 4AORA 1TALA 1K2I1 1YM0A 4YESB 2BD8A 4YM9A 1B0FA 1APOA 1TPPA 2R3UA 4B75A 3C1KA 1GBMA 4CUEA 3AASA 4I8GA 1GHBG 5L2YH 1FJSL 2FMJA 1DVAH 3T25A 1C4Y2 4K69A 2VIQA 5ABWA 1IQML 2B7DL 4K8YA 4AG1A 1MAYA 2WV5A 2G5VA 1M1XB 1C5WB 1LMMA 3CS7L 1XMNB 2D1JA 5KN5C 1GHBF 1KY9A 5CMXH 3JZ1B 1LKAA 1KXFA 1GHYH 3SGBE 1ORFA 2P3FL 4ISLA 3GCTG 2ZGXH 3RM2H 1KLOA 2GD4A 1SGFA 1BMMH 3KL6A 5ETXA 4FUFA 1MCVA 4MNYA 1M9UA 1EPTA 4JYUL 1LPZA 5FX6A 3VFEA 1O2PA 3GCTF 5C1XA 1UCYH 1NRQH 1IQGA 1ZTLA 1AKSA 1O2K