4BXSA

Crystal structure of the prothrombinase complex from the venom of pseudonaja textilis
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
326
structure length
248
Chain Sequence
b'KSCRVDNGNCWHFCKHVQNDIQCSCAEGYLLGEDGHSCVAGGNFSCGRNIKMDCKLGECPWQAALVDEKEGVFCGGTILSPIYVLTAAHCINETETISGEIDKLSVDKIYVHKKFVPPQKAYKFDLAAYDYDIAIIQMKTPIQFVPACLPTADFANQVLMKQDFGIVSGFKSKTLKVLKVPYVDRHTCMVSSETPITPNMFCADSGGPHTTVYRDTHFITGIVSSGKYGNYTKLSKFIPWIKRIMRQK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FACTOR X-LIKE PROTEASE
publication title Crystal Structure of the Prothrombinase Complex from the Venom of Pseudonaja Textilis.
pubmed doi rcsb
source organism Pseudonaja textilis
molecule tags Blood clotting
total genus 37
structure length 248
sequence length 326
ec nomenclature
pdb deposition date 2013-07-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00008 EGF EGF-like domain
A PF00089 Trypsin Trypsin
A PF00594 Gla Vitamin K-dependent carboxylation/gamma-carboxyglutamic (GLA) domain
A PF14670 FXa_inhibition Coagulation Factor Xa inhibitory site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.25.10 Mainly Beta Ribbon Laminin Laminin 4bxsA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4bxsA02
2GX4A 2VWNL 3BTGE 1PFXL 2ZPQA 4Y8YA 3MH4A 1O3NA 3N8VA 1OXGA 4TWYA 2BZ6L 2OTVA 2ZHQH 3ZVAA 5JBCS 2BOXA 3E3TA 5JYIA 1HAYB 4B2BA 2H9TH 2OQUA 3MU8A 1C1TA 1T8LA 5HM9A 1ARCA 3OLUA 2QYIA 1Y8TA 3D65E 2J38B 2J92A 1GJBB 3SV9A 2FOGA 1T7CA 4E7RG 5DP3A 3U69H 4DIHH 2TGAA 3N8XA 1QQ4A 3KQBL 2FOCA 2H9EL 4BANB 1P2JA 1ZRKA 1J9CL 3DA9B 2H6MA 2UUFB 1O3OA 4D9QA 2FESH 1ZHRA 1SPJA 1V2KT 5LPEA 1FONA 3K6YA 4KTSA 3U8OH 3ZZ3A 1XUHA 2G00A 1TIOA 1IGZA 1BT7A 1UVSH 2OXSA 1O2OA 2FX4A 4ISIL 5F03A 1C5VA 5AFZH 9ESTA 1CHOF 1YF4A 3PO1B 1SL3A 1YYY1 4K69A 2Y80B 5LH8A 1LPGB 2W7UA 2R3YA 3TGIE 3UNRA 1GBLA 3C27B 4CH2B 2ZDLA 1AZ8A 2A4QA 1QGFA 2NU1E 2Q1JA 5E0JA 2MGRA 4I8KA 4U32A 1E36B 2GT8A 2J4IA 1KY9A 4ZH8A 2CMYA 3GDUA 1OWKA 4DURA 3LTFB 1EZSC 1C1SA 2WPKS 4GHTA 3SNAA 1XKAL 1KXFA 3OX7U 2Z9LA 3KQEA 3POYA 2SGPE 2OQ5A 5C1YA 1NFYB 4MMYB 1V2MT 2EI8B 1C5NH 1GHBF 1GBDA 1MTVA 2XBYA 4X6NA 1GG6C 1P0SH 5HM2A 4BDWA 5K0HA 2VWNA 3PMAB 1B0FA 4OS6A 1GBCA 3A8DA 4FU8A 4H42U 1GJ4H 4X2XA 3SU3A 2HGTH 1GMHF 7GCHF 1PPZA 1EPJA 1VCWA 5GDSH 2GD4A 1S5SA 1V6DA 2W2QE 2W26A 2QV1A 1EX3A 3QX5H 1C9TA 4NG9H 3MWIU 3QH0A 1F7ZA 2D2DA 3BTTE 3TJUA 4X6OA 3KQBA 2ZO3H 3ZZ8A 2IN2A 4JZEH 1GPZA 3VPKA 2ZZUH 3FANA 2FX6A 1YUGA 1IQEL 2G51A 4FVDA 5HYOA 3B9FH 5FCKA 2JETC 1MTUA 1YPJH 1GI0A 4ISLA 5DP6A 4Z0KA 2FOAA 5JB8E 3MOCA 1UO6A 2Y82B 3ATWA 1BRBE 1DUAA 2P16L 1MCVA 1BB0B 3VEQB 4TPYA 1P03A 1FE2A 1L0ZA 1DPOA 3SNDA 2OUAA 1OWIA 3CFWA 1CA8B 2ODQA 2AYLA 2ZECA 1MCTA 1HJ9A 1THSH 2TGTA 3F6UL 1ORFA 4MPWA 3U9AH 2EEKA 3SOBB 3P5BL 3MI4A 4NZLA 1DY8A 3A8CA 1A2CH 4D90A 4X8SH 1QY6A 2BZ6H 1OP0A 1URKA 2BX3A 3SI4H 9LPRA 1HGTH 4X2WA 5J4QA 5E8DA 1BMMH 2TGFA 2G8TA 2Y81A 1KTSB 4TWWA 1YPGH 2NU2E 2H9EH 1DX5M 1TX7A 1DOJA 1C2MA 1J9CH 2XBWL 1S6HA 4X8VL 1P2QA 1TRMA 5E2PA 1L4ZA 4HZHA 2GT7A 5EXNA 4CR5A 4K8YA 2FOBA 1GDUA 3KL6B 2QC2A 2F9NA 2O8WA 2VH6B 1GHVH 1O3MA 1F0SA 1C5WB 2GMTB 2ZDKA 1IQEA 4ISIH 1P12E 1SOTA 2BLQA 2WPIE 2J95B 4ISOA 3BTHE 1DS2E 1Y5BT 1RTLA 1HFDA 3LJJA 3C9AC 3P17H 1SHHB 4GAWA 2FI4E 3V64C 4YESB 1HV7A 2C93B 5COXA 4AG2A 2P16A 1ABJH 1LQDA 1KXEA 2ZF0H 4Y6DA 2W2NE 2XC5L 1ZTKA 2B8OH 2I9AA 2C90B 3RXRA 1ZJDA 3ZVFA 4J2YB 3HKIB 2XBVA 4H4FA 4ZAEB 6GCHG 1HBTH 1FI8A 1BMNH 1UHBB 2BD8A 1PTHA 2VVCK 1Q4GA 5JVYA 3MH6A 2JKHL 1C5TA 2DDUA 5DJ7A 1HJAC 2OD3B 1V3XA 5EW2H 2C8ZB 3FAOA 4FVBA 5E8EH 2ZFPH 2ZU5A 4IMQA 4WH8A 1HLTH 2OBQA 1FF7A 1T4VH 3NUMA 1C5QA 1P3CA 5T6GA 2ZNKH 1DUEA 1HYLA 2XBWA 1L1JA 1HRTH 3NTGA 5E2OA 1O2WA 2A0QB 1TOZA 3LU9B 4RN6A 2BYAX 4LZ4B 3SOVA 3R3GB 4X1NU 1JRSA 4WH6A 3ZV8A 3GCNA 1O5CB 4ZHLU 3GISX 4CH8B 1OKXA 2OYUP 2BOUA 2Y6TA 1SFQB 2P95L 2GP9B 1BQYA 4MQAA 2ZDAH 4A7IB 2SGQE 3UUZA 4Y71A 1P02A 4VGCC 3A8AA 2IOTA 4BTUA 4X1SU 2Y7ZB 3F6UH 4U30A 5AHGH 4WMDA 3D62A 2BQ7B 2W3IA 1Z8JB 1SVPA 1BHXF 3BTEE 1CBWC 4RRYA 4FUEA 2CN0H 3E16B 4X8TL 4RUTA 2STAE 2XC5A 3NZIA 1GDNA 3T62A 3TPIZ 1Z8IB 5EODA 1LVOA 1AUJA 1WAYB 2VINA 5L2ZL 5F19A 1NN6A 3FP8E 1UTJA 1H9HE 8KME2 2YOLA 3BV9B 5FXLA 2R0KA 3ATKA 1C2IA 4LMFA 3QWCH 2KAIA 2ZFFH 1HDTH 1EPIA 2BY7X 2STBE 1PJPA 4Y7AB 3HS5A 1BMLA 2JKHA 1P11E 2XRCA 1QL9A 3GCHB 4KKDA 3BTWE 2J34A 3L3TA 1EQHA 3A7TA 4X8VH 3N8WB 4NWKA 3Q77A 1JBUL 1ZOMA 3VB3A 3TNSA 4NSVA 5DPAA 2SNWA 1L5GB 4JYVL 1FPHH 1NU7B 1TGBA 2FI3E 5L6NH 4AFUA 2ZGXH 4CRGA 1DX5I 1THRH 4F4OC 1SZBA 1MD7A 1ZZZA 1DLEA 4WWYA 1XUJA 5JBCE 4ZHMU 1D6RA 3TH2H 1G1QA 1O2KA 2HNTE 3F9GA 3RXSA 1DXPA 1O2IA 2P3UB 4JK5A 3ZZ4A 1N1IA 1MMJN 2Y7XA 3BTKE 2ZCHP 4CHAC 2NU0E 5LGOA 2P95A 1C9PA 2PW8H 1QJ6B 1V2JT 3BT2A 4AX9H 1IQLL 1EZQA 1C5ZB 2NWNA 1BUIA 4INKA 3TH3L 5CE1A 5EXMA 3S69A 1AMHA 1NRNH 2AGGX 3IJEB 4K1SA 2GGVB 1BZXE 1JIRA 1PQ8A 1TBQH 1UK3A 1E38B 4UD9H 2J2UA 1NY22 2C8YB 4BXWA 1A46H 1EQ9A 1UTKA 2OC7A 5HXFA 3MQEA 4Y11E 4OTYA 3LC5B 1T4UH 3P8GA 3IITA 1Y59T 5C1XA 2I6QA 5I25A 3MO3A 1W13U 3P8OA 3HO5A 2WG4B 4GPGA 1TYNA 1O3FA 3M3SA 5H4IB 1FN6A 3RXPA 2Q6DA 2A5AA 3RXMA 1RTFB 3D49H 2BDYA 3U1IB 1ELFA 4ESTE 3SOQA 1HIAB 1K1LA 3P8NA 4I8HA 2F9UA 1ELVA 1P57B 2WPHS 1XUFA 1YPLH 2EI6B 1UZKA 2WPKE 1V2NT 3FCSB 1TRYA 1V2OT 1AVXA 3KQDL 1FY1A 3QZQA 4YLUA 3IG6B 3Q3XA 2ZTXA 2ZGJA 2ZFTA 2K1QA 3MFJA 4NFEA 1QR3E 1O3PB 1GI3A 2Y5FL 1ABIH 3SI3H 3HATH 3OSYA 3RXQA 4UEHH 3BIUH 2B0FA 1UZQA 2HRVA 3ZZ9A 1TX8A 1ETTH 1GVKB 3SUFA 1ZSLA 3BEFB 4BTTB 1A0LA 1ZSJA 1D3TB 4YZUA 1ETSH 2VWLL 1XMNB 2ZQ2A 3ZZAA 3F9FA 3ATMA 4M11A 1NU9A 3T5FH 2CGAA 3RLWH 3M61U 1T8NA 4RRWA 2BOHB 1V2PT 4X8TH 1EOJA 3GY3A 1IQLA 4B2AA 5DP8A 2VIWA 4Y79A 3GY2A 3QGNB 1MKWH 6GCHF 3TK5B 1ATEA 2WPIS 4NA8A 3A81A 3URDA 3PMHB 1QL7A 1SGIB 4DG4A 3DT0H 2ZTYA 2HVXA 5CKNA 3TGJE 1TMTH 2M74A 4OS5A 3VGCB 1SGTA 5B6OA 1UMAH 1C1QA 1Z6CA 4Z0KB 3ZVBA 3CS0A 2ZDNA 1B0EA 4HI3A 5FPTA 3LONA 1HAEA 3F9EA 3CP7A 1ZPBA 1G36A 1JBUH 3SU2A 3VXFH 2BB4A 1HZ8A 4ABGA 3MHWU 4JYVH 1GI1A 1LCYA 4K1TA 1M9UA 3RDZA 3SW2A 3B8JA 2I6SA 2MGPA 4ABFA 4X2VA 1GHWH 1V2UT 1RJXB 1O30A 3KQDA 1Z1JA 4YTAA 1RFNB 4MNWA 1DDXA 2Y5FA 5FCRA 1RIWB 1WV7H 3PB1E 2P8OB 1AB9B 1JIMA 2R0LA 1A3BH 2ZGHA 3N8YA 1BJVA 4A5TS 4JYTA 1W7XL 4BAOB 1OP2A 1CGIE 1EB2A 3Q3YA 5IKRA 2BX4A 1F5KU 3KGPA 1O5GH 3RXKA 5A8YA 3UNSA 1YUFA 1CQEA 1UTPA 3TH3H 2BQWA 4OGXA 1JL9A 1QRXA 2VWLA 1ESAA 1GBJA 1ATDA 1S82A 1J8AA 1Y5UT 4BDXA 3ODFA 2R2WU 2C8XB 1GHAG 3ZZ5A 1O3IA 1FY8E 3AASA 7LPRA 2FTMA 3H7TA 2BOKL 3SNEA 2HWLB 4IW4E 1S84A 2TGPZ 1XX9A 2BLVA 4DGJA 2FZZL 2WFXB 3PTNA 1LPZA 2GTBA 1LMJA 1SOZA 2FS9A 3A84A 4NFFA 1SLVB 5C1UA 2O8LA 3RLYH 3M36L 1L2EA 1B5GH 2HPPH 4ZKSU 2ZTZA 1A5HA 2BDHA 3RXDA 1MQ6L 2RA0L 1A7SA 1C5PA 1NTPA 1O3AA 1VZQH 2G4TA 2F9OA 3RXVA 3EDXB 1Z1IA 3RXCA 3RC4A 1DWCH 2PFEA 1O2UA 8ESTE 3T27A 4CBOA 3Q76A 5IKVA 1C5YB 1O5AB 1FUJA 4QT8C 2BDCA 1D3DB 2XNIA 4B71A 1H8DH 3OYPA 2A31A 2PKAA 5DP5A 1EJMA 2FOFA 4I8LA 1P2NA 2WUBA 1QBNA 1UCYH 1G3EA 2ZG0H 5GPIB 1GMCG 4B1TA 1YGCL 3HGNA 5EQQA 5TCAA 1GI8B 2ZU4A 3RXTA 3U8RH 4NSYA 2BD5A 5LPFA 1GL0E 1RS0A 1FXYA 1ID5H 3ZZCA 3BG4C 2BMGA 3ZYGA 1CVUA 2FLBL 1CT2E 3OU0A 2G81E 4DCDA 4MNYA 1SGYE 3GYMA 3VXEH 2P3TA 3SV8A 2ZHFH 3FZDA 1N8OB 1BF9A 1QFKH 3M35A 3LC3A 3QZRA 4X6MA 1GJ9B 4PROA 2XC0L 1O2VA 1O33A 1NFUA 2BOKA 4IC6A 4JZ1A 5A8ZA 1HAVA 4MDSA 4OGYA 3RMLH 6ESTA 4DIIH 3SUEA 4AFZA 1BCUH 2EC9H 2Z3EA 3A7YA 4XSKU 2FZZA 2KB9A 2VGCB 4CUEA 2Y5GL 3A88A 3M36A 3ZYEA 1P10A 1VGCB 2JH6D 2ZHEH 2BVSH 2V6NA 4BTUB 1AE5A 1MQ6A 1LO6A 2RA0A 1QRWA 3SQHE 1PPHE 4XDEA 1FLEE 1P8VC 2W3IB 1EPTB 2W3KA 2HNTC 1WYKA 4YOGA 1C1WH 4MPUA 1G1RA 3OY5U 3TZIA 1ZTJA 2PGQB 4LOYH 1OWDA 1IJQA 2ILNA 2P93L 3W94A 4R8TB 1VITH 1C5UA 2Q6FA 3HKJB 1W7XH 5DP4A 4F49A 1GBKA 1SQOA 1C5OH 1MAXA 2KAIB 3RXBA 2UWLB 1P9UA 3V7TA 4O9VA 4IC5A 1NC6A 1G2MB 1MUEB 1WBGB 1HAIH 1ZMLA 1TBZH 3OTJE 2FXRA 5DG6A 1BHXB 1AKSA 2J34B 2VIQA 4OS4A 1P01A 2V3OH 1NFXA 2VIPA 4JK6A 1XM1A 3TIUA 2Z3DA 2YGPA 1N1LA 3QK1A 3EE0B 1MD8A 1O3EA 1SC8U 1X7AC 1TNHA 2CXVA 4ZHAA 3W95A 4TGFA 4XFQA 1EPHA 2XC0A 4ABEA 3LTGD 3UWJH 4WXVA 2ZDMA 1CA0B 1F0UA 2H9HA 1F2SE 5HGGA 1KXBA 2VWMA 3D23A 1A1RA 4UFEH 1C1PA 3GOVB 3LGIA 5JBAS 2ODYB 2Y5GA 4Y76B 2QA9E 3HK3B 4J1YA 1ATAA 5G4BA 2F83A 1G3DA 2Z3CA 3MU0A 5A2MH 3TNTA 4LK4A 2SFAA 1OSSA 1PPCE 3QTVH 1OP8A 1HT8A 1TWXB 1K2I1 1M1XB 3V3MA 1KXAA 5EQSA 4DW2U 1KSNB 1OYTH 1YGCH 3SJ9A 1EKBB 3SUGA 1F0RB 1DICA 3UQOA 5EGMA 3KRKA 4AB9A 1CSOE 1EJAA 5EU8A 1AVWA 1LHFH 2XTTB 2Z7FE 3BEIB 1O2GH 4Q7ZA 3GY4A 2DE9A 2P93A 4Q7XA 2HOBA 1IOEL 5DP9A 1ACBE 2UUYA 3LGVA 1PYTC 3SJKA 3RXOA 4HTCH 2XBVL 1GBEA 1EAXA 2FLBH 2G52A 1ELTA 2ZC9H 3RXLA 3JZ2B 2D1JA 2WPHE 1GHAF 2P94L 3M37L 1HAPH 1ANBA 1HCGB 1WU1A 2BLOA 1YUKB 1NO9H 2ALVA 4CR9A 5C2ZA 2BDIA 1T31A 3ENSA 1FY3A 3M5MA 1CQQA 3PM3A 2NU3E 2O8MA 1ANEA 3SGBE 3SU4A 1D4PB 4OS7A 3PGHA 4BXSA 4A1TA 3T2NA 5E0GA 1WHEA 3R05A 5BRRE 1CU1A 3BTME 4YM9A 3SOSA 1DT2A 3STJA 1GHYH 4X1RU 1QHRB 1K1IA 1AZZA 3A80A 3TJVA 2A4OA 5GIBA 1DDJA 1HB0B 2F91A 4FU7A 2VH0B 3MO6A 2P28B 4WY3A 4RRZA 3SUDA 1I0UA 1BTWA 4THNH 4X2YA 2FOEA 5AVDA 3SO3A 2FDAA 1AGJA 2AYWA 1FPCH 4D8NA 2RCEA 1GMCF 4E05H 1KDQB 2WYGB 3BT1A 1ESTA 1IHTH 1YLDA 4ZKNU 5T6DA 3NK8A 1K1PA 2XYAA 1GCDA 1N7DA 1TABE 2XCNA 1NT0A 3GY6A 3LH1A 1KXDA 3EQ0H 2LNCA 5FHTA 2FIRH 5DO4H 1EZUC 4AYVB 3Q7DA 3MNXA 3HS7A 3NWUA 4RRXA 2ZIQH 3TK6B 1MAYA 2AIPA 1LVBA 5CKMA 4BTIA 2Y5HL 4MMZB 1C4Y2 3PLBA 1HAFA 1IOEA 3UY9A 4LORA 1MKWK 2WPMS 2W2OE 4Y7BA 3LDXH 1J14A 5F8ZA 2RG3A 3UNQA 1G2LA 3M3TA 2BY8X 4Q7YA 1GL1A 3LAQA 2QXGA 1FY4A 3RR3A 5DK1A 2P94A 3M37A 3H5CB 1J15A 2D8WA 1DWEH 2J94B 1UTOA 5JDUB 2BXTH 2OC0A 3PMBB 2OBOA 2XWAA 1O2SA 1EATA 1XUGA 2GDDA 1TNJA 2SNVA 1EXFA 2FYRA 1WSSH 5FBEA 1ZTLA 3AAUA 1XUIA 4Y8XA 4D7FA 1P04A 1SGNE 5F8TA 2LPRA 4AZ2B 1BTPA 1G3BA 3VGCC 1VJAU 2G5NA 3K9XB 1TNIA 3O8BA 4ABHA 3AVZA 1P05A 3PLKA 1GBIA 3RC5A 1E0FD 2GV7A 4MLFB 4H6TA 1EASA 2AMDA 2PLXA 2RHPA 2SGEE 1NFWA 3DFLA 4D0EA 4C16A 2G5VA 1CEJA 4A1XA 1TE0A 1KLJL 2F9VA 1NZIA 1ETRH 5FPSA 1GBBA 2F9BL 1TMUH 3A85A 4B76A 1PQ5A 3UPEA 2FWWA 4RSPA 1MKXH 4UONA 1SI5H 1UZJA 1A3PA 1FAKL 1PGEA 2RNLA 4FM5A 1W11U 4FUJA 1YCPM 1L4DA 2AMPA 4Z0LA 4WJG2 5CHAB 2PR3B 3BG8A 1O39A 2BD3A 3OY6U 4NGAL 1INCA 1Z6EL 5DP7A 2AEIH 3UIRA 1EAIC 3BIVH 4MG3A 2Y5HA 2P8OC 2FYQA 1AB9C 2CHAB 1LVMA 3ZZ7A 1W14U 1LKBA 5A8XA 3LIWB 2TGDA 1GBHA 2FLRL 1XXDA 2RDLA 4NIXA 5C20A 1BRUP 2FP7B 2F3CE 2QF0A 3UTUH 3KK6A 2ZCLP 3S0NA 4YT6L 3RU4E 3NKKA 3QGJA 1FFMA 4M10A 4K8BA 1PXXA 3T29A 3A8BA 4O1ZA 2Y80A 4ZXXL 1LPGA 1TGTA 4IBLH 2A4RA 2C3SA 1C4U2 3CENL 5HMAA 3HPTA 3MU4A 2Y38A 1VITG 1VR1H 1F7MA 3M7QA 1DM4B 3JZ1B 1IP0A 4DT7B 5GWZA 2J9NA 3EYDA 2UWPB 1LPKA 2BQ6B 1UCYK 1XVOA 1PQ7A 3M5LA 4XE4A 3RMMH 2GCTB 2WPLE 1GGDC 2BXUH 1KLIL 3SGAE 1ELCA 3BTFE 1MU6B 1BBRE 1NFYA 1EOLA 2EI8A 4INLA 1VJ9U 1H4WA 4ISNA 1NFUB 2Z6BD 3VB6A 2ULLA 1A61H 4X1QU 3U73A 1IQGL 2GZ8A 3VFEA 4ISHL 3O8RA 1CVWL 4CUFA 3A7XA 1EMOA 3AAVA 3TBDA 3P8FA 1UTNA 8GCHG 1EBVA 1C5XB 1IAUA 4NA7A 1K1MA 5CMXH 1AVGH 1LMWB 1HAGE 1P2KA 1O3CA 1Z6EA 1BJUA 1CGHA 1QB1A 1Y3UA 4IGDA 1SLWB 3EGKH 1TPAE 1F7EA 2C4FH 2XBXL 3SV7A 5GXPA 3LH3A 3VB7A 2EA3A 3BEUA 1QURH 1YPEH 4CSYA 1N8OC 1YC0A 2FEQH 2ZCKP 1SLUB 1APQA 3MYWA 1AN1E 1UVOA 3TGKE 2BLWA 2Q1JB 1GVZA 4TPIZ 2Y82A 3N7OA 2ANYA 2J4IB 2GV6A 1YP9A 4ZH8B 1O2TA 2P59A 2TRMA 3KN2A 2K2SB 5JB9S 3A86A 2BY6X 3CENA 3RXJA 4NIYA 4INHA 1SGPE 1NFXB 2QAAA 2FLGA 1K28D 1HAOH 1RD3B 3ATIA 2RA3A 1FQ3A 4PH9A 4Q80A 1ELDE 3SV2H 1CGJE 1KLJH 3S7KB 1ZJKA 1VGCC 5K0HB 1ATBA 1LQEA 2FI5E 2OINA 2OCVB 1JV2B 1GJ6A 4YLQH 3RMNH 2F9BH 1BMAA 1AHTH 1K9OE 1O3BA 3IWMA 2ZEBA 5DKMA 4ASHA 1OX1A 1EPTC 1ESBA 1OWHA 2GD4B 2R3UA 2W26B 1UK4A 1FAKH 2GKVE 1WTHD 1LHGH 3RM0H 1IQGA 5JBAE 3SNBA 1TNGA 3PO1C 3F9HA 1EGFA 2FOHA 1GI2A 3DHKH 4NGAH 1YKTA 2XC4L 1AFEH 1O5FH 2Z9IA 1ANDA 1A3EH 2VIVA 1K37A 2ZHWH 4OS2A 2DE8A 1PPBH 2BHGA 2CJIA 5L2ZH 1C5MD 1V2RT 1GMDG 2H5CA 1WQVH 4GCHG 4XBCA 2A32A 2FLRH 2Z9GA 1LKAA 1TMBH 3G01A 1KIGL 3KL6A 5A0AE 2BTCE 4R0IA 3PWCA 2VH6A 4NIVA 3S9BA 1O2HA 2A7JA 4YT6H 4E06H 1G9IE 1HNEE 1HJAB 1W10U 3EA8A 2WYJA 3I78A 1C2EA 1EP6A 5EGMB 3V13A 2XBXA 5GCHG 4CUDA 4MPXA 2UWOA 2V35A 5JW1A 3Q3KA 4ZXXH 4JCNA 1X7AL 1Z8RA 1GJDB 1E37B 3RMOH 1ELGA 1O2YA 2IJOB 1BIOA 1JOUB 2ZGCA 4A1VA 3RXGA 1MTSA 1MOXC 1FY5A 1W0YH 1CA0C 1J16A 2WPJS 2BD7A 5A0BA 2TBSA 2ZFSA 1Z8GA 4FUBA 1IQML 2KL7A 1DWBH 1IQNL 5ABWA 2D1JB 1SGCA 3GY5A 1KLIH 3P92A 2FD6A 1G1TA 3UFAA 4BAHB 1P09A 4ABDA 2VU8E 3I77A 2XW9A 3HO3A 1O2RA 3KEEA 5PTPA 2F9PA 3ZZ6A 1BRAA 4XOJA 5K7RA 4ISHH 1OB1C 1UHBA 1TGCA 1CVWH 3BSQA 1FIZA 2PKSB 2Y81B 5GJ4B 2QIQA 3U1JB 4JMYA 1U67A 2NPRA 1G30B 2AS9A 4BOHA 1KTTB 1AIXH 1O32A 1HXFH 4UFFH 1DE7H 1IQJL 1SB1H 4YO9A 1IQHL 1NRPH 4ABIA 2XC4A 1E35B 1D9IA 1C2HA 4BAMB 5J4SA 4WVPE 2A45B 4ZROA 2VWMK 1O2ZA 1H9LB 1JMOH 1L1GA 2AFQB 2JH5D 2BY5X 1F0SB 4O03A 1ZPCA 4OS1A 1C4V2 1TLEA 1EUFA 2ODPA 5C3NA 1MBMA 1NRQH 1KYNA 1SBWA 4OTJA 3M5OA 2VB0A 4U2WA 1DSTA 1GI5A 1K1OA 1PYTD 1C1VH 2OC8A 1SGQE 3PMJA 4I8GA 1O0DH 3ZYJB 1O5DL 3BTDE 1SGDE 2AGIX 3B23B 3PROA 1ELBA 1WTGH 1LQDB 4A7IA 1VITF 1CCVA 4Y6DB 2OYEP 4FUHA 1YCPH 2WPME 2A5KA 4RKJB 5EPNA 3QUMP 1IOXA 4NA9L 2Y7ZA 1C2JA 4Z6AL 2PSXA 1EQGA 4JYUL 2PHBA 2BQ7A 2P3FL 1GBAA 1O3KA 1UVTH 1CX2A 2HLCA 1AD8H 3A7WA 1IQMA 1QBVH 4NWLA 2BO2A 3MO9A 1WHFA 1IQNA 1NESE 1DWDH 2PUQL 1A5GH 3LGUA 2H5DA 1XKBC 4XBMA 3RC6A 4AG1A 5ESTE 2GMTC 1T8OA 1G3CA 1S81A 3PYHA 1V3XB 3KCGL 1BBRH 2W2ME 3GY8A 1SFIA 4X8UL 4M7GA 3ZV9A 1DVAL 2XWBI 8GCHF 2O8TA 3T25A 3URCA 4AORA 3S9CA 1O2LA 4Y7AA 2GZ9A 5EOKA 4O02B 3EA7A 3K6ZA 1OYQA 1IQJA 1S83A 2WPLS 2ZU2A 1LHEH 1NM6A 4WXIA 1WUNH 1IQHA 1QJ1B 3DFJA 1EMNA 1GCTB 1KIGH 1YBWA 3DUXH 4JZDL 1PPFE 3RXFA 3SBKA 4SGAE 3GISB 2VVUL 1IGXA 5ESBA 4X8SL 2ZGBH 1TA6A 1O37A 2EI7A 5C5OA 1C2DA 4ZXYL 4Y71B 1HUTH 1TOMH 4AOQA 2P3UA 3EAJA 3QDZB 2VWOL 3E6PH 3LT3A 2BZAA 5F6MA 1Q3XA 3SU0A 1DIYA 2QXJA 1A0JA 4GSOA 5F8XA 1FMGA 1MTNB 1XFEA 1JWTA 4D0FA 3A87A 3SU5A 1GJAB 3E0PB 7ESTE 1DY9A 1AFQB 3ZYIB 3NXPA 3HK6B 3LOXA 3RXHA 1GHXH 4FXGH 2VJ3A 2A7HA 2P26A 3ZVGA 2TPIZ 1F0TA 1MKXK 3SU6A 3FBYA 3LC5A 4UFGH 2XCFA 1OPHB 1O35A 4FU9A 3PWBA 3O8CA 1HT5A 3PTBA 3O8DA 1K21H 3AW1A 3LN1A 2BDBA 2CF9H 3ZZBA 1GK5A 3ZYDA 5AFYH 1V2LT 3HPTB 5FX6A 2AGEX 3M7UA 4DOQA 3FVFB 5EQRA 2M5TA 1GMDF 1P2OA 5E0HA 1YLCA 1HIAA 1TGNA 2PWXA 4GCHF 5C5NA 4AGKA 3QN7A 1LPKB 1YPKH 2YNAA 3QMOA 1TQ0B 4IN2A 1QIXB 2EI6A 3SN8A 4K2YA 5CHAC 2VIDA 5JBBS 4XL1A 3SGQE 1WQSA 5GCHF 5AF9H 2CHAC 3MDLA 3NT1A 3BTQE 5CISA 3KHVA 1O5DH 7KMEH 3MNCA 2VVUA 2Y7XB 4I33A 3SJOA 1JXPA 1YPHE 1FSBA 4BTTA 2QF3A 2ZI2H 4D76A 4XBBA 1C2LA 1F92A 1TPPA 1EZQB 2V0BA 2BVXH 3TLOA 1AQ7A 4NA9H 2VJ1A 3UWIA 1AI8H 1V2TT 4Z6AH 1W0ZU 4JYUH 2P3FH 2VWOA 1QRZA 3GCHC 3HS6A 2OC1A 2J2UB 5F1AA 1AUTC 4O3UA 2VVVL 3GDVA 2BOHA 2ALPA 4SGBE 2THFB 2CV3A 4FUFA 1K22H 2PUQH 1QL8A 3VB4A 1Z6JH 2P3FN 1XUKA 3TK5A 3IITB 3UOUA 1GBMA 2BD4A 3R0FA 4DY7B 1C1OA 1TPGA 1H1BA 1PQAA 1C1NA 4NZQA 1SGFA 1W12U 3KCGH 3QCWA 3SJIA 2GCTC 4X8UH 3V12A 4HGCA 1DVAH 1A5IA 1B9WA 2ANKH 4KELA 5SGAE 2QGRA 4YT7L 6LPRA 2KV4A 3V65B 1Q2WA 3ATLA 3Q00A 1EAUA 1WOFA 5JB9E 4NIWA 3M5NA 4CRFA 1BTYA 1U6QA 3I29A 1V2VT 1SQTA 3M3VA 5IKTA 4JZDH 4D7GA 2B7DL 3GCWE 6CHAB 1C5LH 2GCHG 2HPQH 5I46L 5EG4A 6COXA 1SMFE 1BTXA 3KQCL 1NRRH 2OP9A 4KTUA 2VNTA 1KLOA 2ZHDA 1RFNA 1HJ8A 1AE8H 4ZXYH 1QB9A 4YZUB 1TPSA 1EAIA 1TFXA 4D9RA 1ZSKA 1O2PA 2HALA 3LKWA 1U8CB 1ELAA 4HFPB 3E91A 1FNIA 2R2MB 3E8LA 3ZVDA 2W2PE 4FUGA 1JRTA 4GHQA 2FODA 1A4WH 2W86A 1QCPA 1CHGA 2PSYA 4G1MB 1MQ5L 4Y79B 3UREA 4COXA 1Z71A 2CJIB 2CF8H 1SHYA 4AFQA 4JZFL 2ZP0H 1ZGIA 5IKQA 4I32A 3TH4H 3ZZDA 2VVVA 3A82A 1O2QA 1TB6H 2YGOA 2ZPSA 3BF6H 2K2TA 1CE5A 1P2MA 5BPEA 2ANWA 3E1XB 2WYJB 1BTUA 5T3HA 1RXPA 2UWOB 3BG4B 1FAXL 1XXFA 1S0QA 3ODDA 3Q3KB 1C1UH 5JBTA 1HPGA 4TY6A 1PFXC 1O5EH 2ZWLH 3VB5A 1O3HA 2Z9KA 1N6XA 3GDSA 3QTOH 3ZVCA 1W8BL 1O31A 2WPJE 1SQAA 4MNVA 1RGQA 5FBIA 2A1DB 5ETXA 1MTWA 2VIOA 3SW2B 3DEMA 4ZKOU 4FUDA 1N6YA 3SJ8A 1XDTR 3K65B 2FPZA 4E7NA 4MVNA 3QO6A 1K36A 5EXLA 4Y8ZA 1AO5A 4CREA 4ZMAH 1NRSH 4ZUHA 1MBQA 1YPMH 1CT4E 2A5IA 1COUA 3N8YB 3K2UA 4X6PA 2ZKSA 3KQCA 3PV4A 5FDQA 2ANMH 1ZHMA 3NPSA 1V2WT 1VCPA 3E90B 1DXWA 1GJCB 4I7YH 3WY8A 2BQWB 4ABBA 3HGPA 8LPRA 3L6PA 1NQLB 3MTYA 2BDGA 2PTNA 1KLTA 4X0WU 1PPEE 1TPOA 4IS5A 4WMEA 1C5RA 3MH5A 3BPSE 3MU5A 3T26A 2NU4E 4RS0A 3AW0A 4BAKB 1AY6H 1MU8B 3V0XA 1ZHPA 1D3PB 1GBTA 1MQ5A 1L1NA 5CKQA 1O38A 1O36A 1ZPZA 1LPZB 1FJSL 3SZNA 4BAQB 1UJ1A 1TNLA 4O3TA 4BNRA 1DQBA 1Z7KA 3A7VA 4B73A 2J38A 1QJ7B 2UUKB 3SORA 1XKAC 1UTMA 4RKOB 1O3JA 1S6FA 3SU1A 4YT7H 1RIWC 1DITH 2ESTE 1ARBA 1FAXA 3GCOA 2D26C 2ZPRA 2AIQA 5EPYA 2ZU3A 1GG6B 3SNCA 1SLXB 5C67A 2PKSC 2A7CA 1HRFA 1IHSH 2WG3C 1HAZB 4JZIA 3TJOA 1TOCB 1IQIL 1GWAA 3KF2A 2PKAB 2B7DH 2PHBB 2SGDE 1NROH 3TVJB 1LDTT 1BOQA 1QA7A 5I46H 1IQKL 2O9QA 1EPTA 1OOKB 3SQEE 1QQUA 1TA2A 3S7HB 5JVZA 4Q2KA 3DD2H 2WV5A 3N8ZA 1ZYOA 5FX5A 2QCYA 1Y5AT 5A0CA 1GDQA 2A4GA 1O3LA 4WF8A 1GVLA 1YCPK 4A6LA 2FOMB 5EW1H 5T6FA 1OWEA 1MH0A 2PTCE 1NT1A 2BMGB 2UWLA 3C1KA 1FIWA 3UQVA 2Q6GA 3UR9A 2JETB 1G2MA 2W7SA 2MHPA 2P3TB 2OLGA 1OS8A 2AMQA 2BD9A 4CRDA 5FAHA 4UDWH 4DJZB 3HO4A 4JZFH 1G32B 3LC3B 3ASIA 2WINI 2WV4A 4TY7A 1QTFA 2AERH 1O2MA 1UCYE 1GI9B 1HAVB 4AB8A 4NCYA 1QBOA 1C2FA 1BBRK 4DVAU 3LGYA 2DUCA 2Z9JA 1C2GA 1FJSA 1MZAA 4AYYB 3NJPC 4ABAA 3UOPA 4YOIA 4GUXA 2EI7B 1DSUA 2QXIA 2BY9X 3CA7A 1LHDH 5TJXA 2BM2A 4K3JA 3BN9A 3H7OA 1W8BH 1Y3VA 1ZR0A 1TBRH 3GCTG 2H1UA 4Y76A 1ZGVA 3L33A 5LPRA 3U7UG 2ZA5A 3MNBA 2XXLA 5DGJA 2W3KB 1HJ7A 1Y3WA 4Y0ZE 1O2NA 1EAWA 1H8IH 2GCHF 3SV6A 1EJNA 1C5SA 1O2JA 1IQIA 4GLYA 4Y0YE 3A89A 1YPHC 1KSNA 1J17T 5L2YL 1IQKA 4I31A 3LGWA 1HAHH 1BA8B 1F0RA 2YNBA 3QLPH 5L30L 1UZPA 3RU4T 5JB8S 2WUCA 3LGTA 4MMXB 1GCTC 3A7ZA 2Z94A 2TIOA 1FV9A 1F5LA 1OWJA 1SGEE 2VGCC 3U98H 1KXCA 1AKSB 3FFGL 1S85A 1LHCH 3LJOA 1FDPA 3RM2H 4K5ZA 3EA9A 1Q31A 3RU4D 1T8MA 4CRCA 2VVCA 4CRBA 4WMFA 1ZLRA 4I8JA 4ZHAB 1O3GA 3CS7L 3ELAL 2G4UA 1GI4A 2IPHA 1HCGA 1ZMNA 5JBBE 4K60A 3U8TH 2ZFQH 4U01A 1IQFL 1MTNC 4ABJA 1CCFA 3TJNA 1GJ7B 1K1NA 4GVUA 5KIRA 1D6WA 4AQTA 1HAXB 4IMZA 4MNXA 1C2KA 1CHOG 1AFQC 1P06A 4KP0A 1NPMA 5FPYA 1Y3XA 1EP5A 3P6ZB 1QA0A 2O8UA 2PV9B 4FUIA 3RUOA 1EPGA 4KGAA 1C1RA 3KNXA 4CRAA 1G37A 2VH0A 1UTLM 3RXIA 1SSXA 3TU7H 1XKBA 3MMGA 1P3EA 2W5EA 1LTOA 3F68H 3F1SB 1FN8A 2JH0D 1GHBG 2J95A 1QFKL 2GVFA 1KDQA 3RP2A 2WYGA 1V2ST 4IN1A 1GI6A 3KIDU 1DANH 4UFDH 1MZDA 1P9JA 1ZRBA 1SGFG 1O5BB 1QB6A 2QXHA 2V3HH 1C1MA 2QY0B 2PGBB 1CT0E 1GMHG 7GCHG 2FM2A 1YM0A 3TK6A 3GY7A 2BVRH 1C5MF 2HNTF 3MH7A 1BTHH 1SG8B 2QN5T 3GYLB 1K1JA 3FFGA 2ADXA 1APOA 3RXEA 4TYDA 1WU1B 1H9IE 2I9BA 4ZAEA 1B7XB 1EZXC 3RXAA 1ZAQA 1UVPA 3ENSB 1F5RA 1W7GH 2SGFE 1V2QT 1A0HB 3CS7A 5IYTA 3LN0A 4VGCB 1ELEE 1GJ8B 3E0NB 2R9PA 2BD2A 1BRCE 2ZQ1A 2J94A 1TNKA 2C8WB 4XLWA 3T28A 1IQFA 1NS3A 4AGJA 1CBWB 1AUTL 2A2XH 2BDAA 4H6SB 1YO8A 3M7TA 3MNSA 4ZKRU 3STIA 4FUCA 1BDAA 1GBFA 3K9XA 5JPMH 4E1GA 1TLDA 3LPRA 2SGAA 2GDEH 1P2IA 3GICB 1LVYA 2G55A 4Y10E 1RRKA 5L2YH 1ZMJA 1T32A 1DFPA 1W3CA 1UTQA 2ASUB 5L30H 1P0SL 3FZZA 1HXEH 2ZFRH 1NZQH 3EGFA 4XBDA 1GI7B 4B75A 2ZU1A 1TGSZ 1IVOC 4K1EA 1TRNA 1QNJA 3ESTA 3P95A 6CHAC 4BTIB 4B2CA 3MU1A 2FS8A 1PRHA 2UUJB 4MTBA 4MPVA 4Y7BB 4UE7H 2PR3A 3UR6A 2GZ7A 4NG9L 1RTKA 3A83A 1EB1H 1O3DA 1G2LB 1GGDB 1AWHB 1TONA 4AFSA 3PLPA 1HX2A 2ZDVH 3ELAH 2G00L 4JZEL 5KN5C 1AWFH 4KTCA 1XVMA 1BTZA 3LIWA 1UVUH 1VCQA 2H2ZA 3SHAH 3FP7E 3ITIA 3S9AA 4CHAB 1THPB 4LZ1H 5A09A 1TAWA 2FMJA 3OLTA 1WCZA 2B9LA 2FTLE 3SHCH 4CBNA 1NPEB 1ADXA 1PPGE 4X1PU 1TX6A 3TGFA 1E34B 2AH4X 2FO9A 1FZZA 1HREA 4O97A 1AU8A 1GHZA 1Y3YA 5TCCA 4YOJA 1D3QB 3P70B 1UK2A 3N8WA 2A2QH 3NTBA 3GCTF 4A92A 1TQ7B 2WFTA 1CO7E 1TALA 1W2KH 3ZVEA 1S0RA 1L3YA 1SGRE 2B5TB 1O2XA 4B74A 1SR5C 4LXBH 5IDKA 1G1SA 1O34A 3KQEL 1ANCA 4AN7A 3TK9A 1DLKB 1BITA 1NFWB 3RXUA 1GJ5H 1P9SA 2UWPA 3NCLA 2PUXB 2BQ6A 3GCXE 3FP6E 2XBYL 3TITA
chains in the Genus database with same CATH superfamily
2GX4A 2YMSC 2VWNL 3BTGE 1PFXL 2ZPQA 4Y8YA 3MH4A 1O3NA 3N8VA 1OXGA 4TWYA 2BZ6L 2OTVA 2ZHQH 3ZVAA 5JBCS 2HVYB 1KKEA 2BOXA 3E3TA 5JYIA 1HAYB 4B2BA 2H9TH 2OQUA 3MU8A 1C1TA 1T8LA 5HM9A 1ARCA 3OLUA 2QYIA 1Y8TA 3D65E 2J38B 2J92A 1GJBB 3OTPA 3SV9A 2FOGA 1T7CA 4E7RG 5DP3A 3U69H 4DIHH 2TGAA 3N99A 3N8XA 1QQ4A 3KQBL 2FOCA 2H9EL 4BANB 1P2JA 1ZRKA 1J9CL 3DA9B 2H6MA 2VRSA 1H8ED 2UUFB 1O3OA 2K8IA 2FESH 4D9QA 1ZHRA 1SPJA 4RI0A 1V2KT 5LPEA 1FONA 3K6YA 3WWBA 4KTSA 3U8OH 3ZZ3A 1XUHA 2G00A 5GNDA 1TIOA 1IGZA 1BT7A 1UVSH 2OXSA 1O2OA 2FX4A 4ISIL 5F03A 1C5VA 5AFZH 9ESTA 1CHOF 1YF4A 3PO1B 1SL3A 1YYY1 4K69A 2YGQA 2Y80B 1LPGB 2W7UA 2R3YA 5LH8A 3TGIE 3UNRA 1GBLA 3C27B 4CH2B 2ZDLA 1AZ8A 2A4QA 1QGFA 2NU1E 2HORA 2Q1JA 5E0JA 2MGRA 4I8KA 4U32A 1E36B 2GT8A 2J4IA 1KY9A 4ZH8A 2CMYA 3N7DA 3GDUA 1OWKA 4DURA 3LTFB 1EZSC 1C1SA 2WPKS 3CNRA 4GHTA 3SNAA 1XKAL 1KXFA 3OX7U 2Z9LA 3KQEA 3POYA 2SGPE 2OQ5A 5C1YA 1NFYB 4MMYB 1V2MT 2EI8B 1C5NH 1GHBF 1GBDA 1MTVA 2XBYA 4X6NA 2V7QD 1GG6C 1P0SH 5HM2A 4BDWA 5K0HA 2VWNA 3PMAB 1B0FA 4OS6A 1GBCA 3A8DA 4FU8A 5C0TA 4H42U 1GJ4H 4X2XA 5CDFE 3SU3A 2HGTH 2KCOA 1GMHF 7GCHF 1PPZA 1EPJA 1VCWA 5GDSH 2GD4A 1S5SA 1V6DA 2W2QE 2W26A 2QV1A 1EX3A 3QX5H 3WWFA 1C9TA 4NG9H 3MWIU 3QH0A 1F7ZA 1QZ8A 2D2DA 3BTTE 2XOKD 3TJUA 4X6OA 3KQBA 2ZO3H 3ZZ8A 2IN2A 4JZEH 1GPZA 3VPKA 2ZZUH 3FANA 2FX6A 1YUGA 1IQEL 2G51A 4FVDA 5HYOA 5C17A 3B9FH 5FCKA 2JETC 1MTUA 1YPJH 1GI0A 4ISLA 5DP6A 4Z0KA 2FOAA 5JB8E 4F55A 3MOCA 1UO6A 4XD7D 2Y82B 3ATWA 1BRBE 1DUAA 2P16L 1MCVA 1BB0B 3VEQB 4TPYA 1P03A 4ACAA 1FE2A 1L0ZA 1DPOA 3SNDA 2OUAA 1OWIA 2J98B 3CFWA 1CA8B 2ODQA 2AYLA 2ZECA 1MCTA 1HJ9A 1THSH 2TGTA 3F6UL 1ORFA 4MPWA 3U9AH 2EEKA 3SOBB 3P5BL 3MI4A 4NZLA 1DY8A 3A8CA 1A2CH 4D90A 4X8SH 1QY6A 2BZ6H 1MABB 3FN8A 1OP0A 1URKA 2BX3A 3SI4H 1E1RD 1HGTH 9LPRA 4X2WA 5J4QA 5C94A 5E8DA 1BMMH 2TGFA 2G8TA 2Y81A 1KTSB 4TWWA 1YPGH 2NU2E 2H9EH 1DX5M 1TX7A 1DOJA 1C2MA 1J9CH 2XBWL 1S6HA 4X8VL 1P2QA 1TRMA 5E2PA 1L4ZA 4HZHA 2GT7A 5EXNA 4CR5A 4K8YA 2FOBA 1GDUA 3KL6B 2QC2A 2F9NA 2O8WA 2VH6B 1GHVH 1O3MA 1F0SA 1C5WB 2GMTB 2ZDKA 1IQEA 4ISIH 1P12E 1SOTA 2BLQA 2WPIE 2J95B 4ISOA 3BTHE 1DS2E 1Y5BT 1RTLA 1HFDA 3LJJA 3C9AC 3P17H 3F2HA 1SHHB 4GAWA 2FI4E 3V64C 4YESB 1HV7A 2C93B 5COXA 1FX0B 4AG2A 2P16A 1ABJH 1LQDA 1KXEA 1COWD 2ZF0H 4Y6DA 2W2NE 2XC5L 1ZTKA 2B8OH 2I9AA 2C90B 3RXRA 1ZJDA 3ZVFA 4J2YB 3HKIB 2XBVA 4H4FA 4ZAEB 6GCHG 1HBTH 1FI8A 1BMNH 1UHBB 2BD8A 1PTHA 2VVCK 1Q4GA 5JVYA 3MH6A 2JKHL 1C5TA 2DDUA 5DJ7A 1HJAC 2OD3B 1V3XA 5EW2H 2C8ZB 3FAOA 4FVBA 5E8EH 2ZFPH 2ZU5A 4IMQA 4WH8A 1HLTH 2OBQA 2BSFA 1FF7A 1T4VH 3NUMA 1C5QA 1P3CA 5T6GA 2ZNKH 1DUEA 1HYLA 2XBWA 1L1JA 1HRTH 3NTGA 5E2OA 1O2WA 2A0QB 1TOZA 3LU9B 4RN6A 2BYAX 4LZ4B 3SOVA 3R3GB 4X1NU 1JRSA 4WH6A 1YY3A 3ZV8A 3GCNA 1O5CB 4ZHLU 3GISX 4CH8B 1OKXA 2OYUP 2BOUA 3S6XA 1SFQB 2P95L 2GP9B 2Y6TA 1BQYA 4MQAA 2ZDAH 4A7IB 2SGQE 3UUZA 4Y71A 2QF5A 1P02A 4VGCC 3A8AA 2IOTA 4BTUA 4X1SU 2Y7ZB 3F6UH 4U30A 5AHGH 4WMDA 3D62A 2BQ7B 2W3IA 1Z8JB 1SVPA 1BHXF 3BTEE 1CBWC 4RRYA 4FUEA 2CN0H 3E16B 4X8TL 2JJ1D 4RUTA 2STAE 2XC5A 3NZIA 1GDNA 3T62A 3TPIZ 1Z8IB 5EODA 1LVOA 1AUJA 1WAYB 2VINA 5L2ZL 5F19A 1NN6A 3FP8E 4DT4A 1UTJA 1H9HE 8KME2 2YOLA 3BV9B 5FXLA 2R0KA 3ATKA 4I86A 5HIZA 1C2IA 4LMFA 3QWCH 2KAIA 3GS9A 2ZFFH 1HDTH 1EPIA 2BY7X 2STBE 4HG6A 1PJPA 4Y7AB 3HS5A 1BMLA 2JKHA 1P11E 2XRCA 4P02A 1QL9A 3GCHB 4KKDA 3BTWE 2J34A 3L3TA 1EQHA 3A7TA 3N7EA 4X8VH 3N8WB 4NWKA 3Q77A 1JBUL 1ZOMA 3VB3A 3TNSA 4NSVA 5DPAA 2SNWA 1L5GB 4JYVL 1FPHH 1NU7B 1TGBA 2FI3E 5L6NH 4AFUA 2ZGXH 4CRGA 1DX5I 1THRH 4F4OC 1SZBA 1MD7A 1ZZZA 1DLEA 4WWYA 1XUJA 5JBCE 3VG8A 4ZHMU 1D6RA 3TH2H 1G1QA 1O2KA 2HNTE 3F9GA 3RXSA 2J5UA 1DXPA 1O2IA 2P3UB 4JK5A 3ZZ4A 1N1IA 1MMJN 3WW7A 2Y7XA 3BTKE 2ZCHP 4CHAC 2NU0E 5LGOA 2P95A 1C9PA 2PW8H 1QJ6B 1V2JT 3BT2A 4AX9H 1IQLL 1EZQA 1C5ZB 2NWNA 1BUIA 5KGOA 4INKA 3TH3L 5CE1A 5EXMA 3S69A 2F43B 1AMHA 1NRNH 2AGGX 3IJEB 4K1SA 2GGVB 1BZXE 1JIRA 1PQ8A 1TBQH 1UK3A 1E38B 4UD9H 2J2UA 1NY22 2C8YB 4BXWA 5EIYA 1A46H 1EQ9A 1UTKA 2OC7A 5HXFA 3MQEA 4Y11E 4OTYA 3LC5B 1T4UH 3P8GA 3IITA 1Y59T 5C1XA 2I6QA 5I25A 3MO3A 1W13U 3P8OA 3HO5A 2WG4B 4GPGA 1TYNA 1O3FA 3PRDA 3M3SA 5H4IB 1FN6A 3RXPA 2Q6DA 2A5AA 3RXMA 4B6FA 2W6ID 1RTFB 3D49H 2BDYA 3U1IB 1ELFA 4ESTE 3SOQA 1HIAB 1K1LA 3P8NA 4I8HA 2F9UA 1ELVA 1P57B 2WPHS 1XUFA 1YPLH 2YMSD 2EI6B 1UZKA 2WPKE 1V2NT 3FCSB 1TRYA 1V2OT 1AVXA 3KQDL 1FY1A 3QZQA 4YLUA 3IG6B 3Q3XA 2ZTXA 2ZGJA 2ZFTA 2K1QA 3MFJA 4NFEA 1QR3E 1O3PB 1GI3A 2Y5FL 1ABIH 3SI3H 3HATH 3OSYA 3RXQA 4UEHH 3BIUH 2B0FA 1UZQA 2HRVA 3ZZ9A 1TX8A 1ETTH 1GVKB 3OE7D 3SUFA 1ZSLA 3BEFB 4BTTB 1A0LA 1ZSJA 1D3TB 4YZUA 1ETSH 2VWLL 1XMNB 2ZQ2A 1E79D 3ZZAA 3F9FA 3ATMA 4M11A 1NU9A 2KCPA 3T5FH 2CGAA 3RLWH 3M61U 1T8NA 4RRWA 2BOHB 1V2PT 4X8TH 1EOJA 3GY3A 1IQLA 4B2AA 5DP8A 2VIWA 4Y79A 3GY2A 3QGNB 1MKWH 6GCHF 3TK5B 1ATEA 2WPIS 4NA8A 3A81A 3URDA 3PMHB 1QL7A 1SGIB 4DG4A 3DT0H 2ZTYA 2HVXA 5CKNA 3TGJE 1TMTH 4OM9A 2M74A 4OS5A 3VGCB 1SGTA 5B6OA 1UMAH 1C1QA 1Z6CA 4Z0KB 3ZVBA 3CS0A 2ZDNA 1B0EA 4HI3A 5FPTA 3LONA 1HAEA 3F9EA 2KZ4A 3CP7A 1ZPBA 1G36A 1JBUH 3SU2A 3VXFH 2BB4A 1HZ8A 4ABGA 3MHWU 4JYVH 1GI1A 1LCYA 4K1TA 1M9UA 3RDZA 3SW2A 3B8JA 2I6SA 2MGPA 4ABFA 4X2VA 1GHWH 1V2UT 1RJXB 1O30A 3KQDA 1Z1JA 4YTAA 1RFNB 2QE7D 4MNWA 1DDXA 2Y5FA 5FCRA 1RIWB 1WV7H 3PB1E 5F53A 2P8OB 1AB9B 1JIMA 2R0LA 1A3BH 2ZGHA 3N8YA 1BJVA 4A5TS 4JYTA 1W7XL 4BAOB 1OP2A 2WV9A 1CGIE 1EB2A 3Q3YA 5IKRA 4FETA 2BX4A 1F5KU 3KGPA 1O5GH 3RXKA 5A8YA 3UNSA 1YUFA 1CQEA 1UTPA 3TH3H 2BQWA 4OGXA 1JL9A 1QRXA 2VWLA 1ESAA 1GBJA 1ATDA 1S82A 1J8AA 1SKYE 4BDXA 1Y5UT 2R2WU 3ODFA 2C8XB 1GHAG 3ZZ5A 1O3IA 1FY8E 3AASA 7LPRA 2FTMA 3H7TA 2BOKL 3SNEA 2HWLB 4IW4E 1S84A 2TGPZ 3PV2A 1XX9A 2BLVA 4DGJA 2FZZL 2WFXB 3PTNA 1LPZA 2K0QA 2GTBA 4Z1MD 1LMJA 1SOZA 2FS9A 3A84A 4NFFA 1SLVB 4E06H 5C1UA 2O8LA 3RLYH 3M36L 1L2EA 1B5GH 2HPPH 4ZKSU 2ZTZA 1A5HA 3OAAD 2BDHA 3RXDA 1MQ6L 2RA0L 1A7SA 1C5PA 1NTPA 1O3AA 1VZQH 2G4TA 2F9OA 3RXVA 3EDXB 1Z1IA 3RXCA 3RC4A 1DWCH 2PFEA 1O2UA 8ESTE 3T27A 4CBOA 3Q76A 5IKVA 1C5YB 1O5AB 1FUJA 4QT8C 2BDCA 1D3DB 2XNIA 3FOAA 4B71A 1H8DH 3OYPA 2A31A 2PKAA 5DP5A 1EJMA 2FOFA 4I8LA 1P2NA 2WUBA 1QBNA 1UCYH 1G3EA 2ZG0H 5GPIB 1GMCG 4B1TA 1YGCL 3HGNA 2EY4C 5EQQA 5TCAA 1GI8B 2ZU4A 3RXTA 3U8RH 4NSYA 2BD5A 5LPFA 1GL0E 1RS0A 1FXYA 1ID5H 3ZZCA 3BG4C 2BMGA 3ZYGA 1CVUA 2FLBL 1CT2E 3OU0A 2G81E 4DCDA 4MNYA 1SGYE 3GYMA 3VXEH 2P3TA 3SV8A 2ZHFH 3FZDA 1N8OB 1BF9A 1QFKH 3M35A 3LC3A 3QZRA 4X6MA 1GJ9B 4PROA 2XC0L 1O2VA 1O33A 1NFUA 2BOKA 4IC6A 4JZ1A 5A8ZA 1HAVA 4MDSA 4OGYA 3RMLH 6ESTA 4DIIH 3SUEA 4AFZA 1BCUH 2GJGA 5C0UA 2EC9H 2Z3EA 3A7YA 4XSKU 2FZZA 2KB9A 2VGCB 4CUEA 2Y5GL 3A88A 2JJLA 3M36A 3ZYEA 1P10A 1VGCB 2JH6D 2ZHEH 2BVSH 2V6NA 4BTUB 1AE5A 1MQ6A 1LO6A 2RA0A 1QRWA 3SQHE 1PPHE 4XDEA 1FLEE 1P8VC 2W3IB 1EPTB 2W3KA 2HNTC 1WYKA 4YOGA 1C1WH 4MPUA 1G1RA 3OY5U 3TZIA 1ZTJA 2PGQB 4LOYH 1OWDA 1IJQA 2ILNA 1WXRA 2P93L 4Q63A 3W94A 4R8TB 1VITH 1C5UA 2Q6FA 3HKJB 1W7XH 5DP4A 4F49A 1GBKA 1SQOA 1C5OH 1MAXA 2KAIB 3RXBA 2UWLB 1P9UA 3V7TA 4O9VA 4IC5A 1NC6A 1G2MB 1MUEB 1WBGB 1HAIH 1ZMLA 1TBZH 3OTJE 2FXRA 5DG6A 1BHXB 1AKSA 2J34B 2VIQA 4OS4A 1P01A 2V3OH 1NFXA 2VIPA 4JK6A 1XM1A 3TIUA 2Z3DA 2YGPA 1N1LA 3QK1A 3EE0B 1MD8A 1O3EA 1SC8U 1X7AC 1TNHA 2CXVA 4ZHAA 3W95A 4TGFA 4XFQA 1EPHA 2XC0A 4ABEA 3LTGD 3UWJH 4WXVA 2RFKC 2ZDMA 1CA0B 1F0UA 2H9HA 1F2SE 5HGGA 1KXBA 2VWMA 3D23A 1A1RA 4UFEH 1C1PA 3GOVB 3LGIA 4TT3D 5JBAS 2ODYB 2Y5GA 4Y76B 2QA9E 3HK3B 4J1YA 1ATAA 5G4BA 2F83A 4GU3A 1G3DA 2Z3CA 3MU0A 5A2MH 3TNTA 4LK4A 2SFAA 1OSSA 1PPCE 3QTVH 1OP8A 1HT8A 1TWXB 1K2I1 1M1XB 3V3MA 1KXAA 5EQSA 4DW2U 1KSNB 1OYTH 1YGCH 3SJ9A 1EKBB 3SUGA 1F0RB 1DICA 3UQOA 5EGMA 3KRKA 4AB9A 1CSOE 1EJAA 5EU8A 1AVWA 1LHFH 2XTTB 2Z7FE 3BEIB 1O2GH 4Q7ZA 3GY4A 2DE9A 2P93A 4Q7XA 4ACBA 2HOBA 1IOEL 5DP9A 1ACBE 2UUYA 3LGVA 1PYTC 3SJKA 3RXOA 4HTCH 2XBVL 1GBEA 1EAXA 2FLBH 2G52A 1ELTA 2ZC9H 2JDID 3RXLA 3JZ2B 5B6LA 2D1JA 2WPHE 1GHAF 2KFWA 2P94L 3M37L 1HAPH 1ANBA 1HCGB 1WU1A 2BLOA 1YUKB 3KYGA 1NO9H 2ALVA 4CR9A 5C2ZA 2BDIA 1T31A 3ENSA 1FY3A 3M5MA 1CQQA 3PM3A 2NU3E 2O8MA 1ANEA 3SGBE 3SU4A 1D4PB 4OS7A 3PGHA 2HLDD 4BXSA 4A1TA 3T2NA 5E0GA 1WHEA 3R05A 5BRRE 1CU1A 3BTME 4YM9A 3SOSA 1DT2A 4YXWD 3STJA 1GHYH 4X1RU 1QHRB 1K1IA 1AZZA 3A80A 1H8HD 3TJVA 2A4OA 5GIBA 1DDJA 1HB0B 2F91A 4FU7A 2VH0B 3FKSD 3MO6A 2P28B 4WY3A 4RRZA 3SUDA 1I0UA 1BTWA 4THNH 4X2YA 2FOEA 5AVDA 3SO3A 2FDAA 1AGJA 2AYWA 1FPCH 4D8NA 2RCEA 1GMCF 4E05H 1KDQB 2WYGB 3BT1A 1ESTA 1IHTH 1YLDA 4ZKNU 5T6DA 3NK8A 1K1PA 2XYAA 1GCDA 1N7DA 1TABE 2XCNA 1NT0A 3GY6A 3LH1A 1KXDA 3EQ0H 2LNCA 5FHTA 2FIRH 5DO4H 1EZUC 5IK2D 4AYVB 3Q7DA 3MNXA 3HS7A 3NWUA 4Q4LA 4RRXA 2ZIQH 3H09A 3TK6B 1MAYA 2AIPA 1LVBA 5CKMA 4BTIA 2Y5HL 4MMZB 1C4Y2 3PLBA 1HAFA 1IOEA 2JIZD 4LORA 3UY9A 1MKWK 2WPMS 2W2OE 4Y7BA 3LDXH 1J14A 2CK3D 2YMSB 5F8ZA 2RG3A 3UNQA 1G2LA 3M3TA 2BY8X 4Q7YA 1GL1A 3LAQA 2QXGA 1FY4A 3RR3A 5DK1A 2P94A 3M37A 3H5CB 1J15A 2D8WA 2LP6A 1DWEH 2J94B 1UTOA 5JDUB 2BXTH 2OC0A 3PMBB 2OBOA 2XWAA 3DSOA 1O2SA 1EATA 1XUGA 2GDDA 1TNJA 2SNVA 1EXFA 2FYRA 1WSSH 5FBEA 1ZTLA 3AAUA 1XUIA 1NBME 2W6JD 4Y8XA 4D7FA 1P04A 1SGNE 5F8TA 2LPRA 4AZ2B 1BTPA 1G3BA 2IJD1 3VGCC 1VJAU 2G5NA 3K9XB 1TNIA 3O8BA 4ABHA 3AVZA 1P05A 2KCYA 3PLKA 1GBIA 3RC5A 1E0FD 2GV7A 4MLFB 4H6TA 1EASA 2AMDA 2PLXA 2RHPA 2SGEE 1NFWA 3DFLA 4D0EA 4C16A 2G5VA 1CEJA 4A1XA 1TE0A 1KLJL 2F9VA 1NZIA 1ETRH 5FPSA 1GBBA 2F9BL 1TMUH 3A85A 4B76A 1PQ5A 3UPEA 2FWWA 4RSPA 1MKXH 4UONA 1SI5H 1UZJA 1A3PA 1FAKL 1PGEA 2RNLA 4FM5A 1W11U 4FUJA 1YCPM 1L4DA 2AMPA 4Z0LA 4WJG2 5CHAB 2PR3B 3BG8A 1O39A 2BD3A 3NRLA 4NGAL 3OY6U 1INCA 1OHHD 1Z6EL 5DP7A 2AEIH 3UIRA 1EAIC 3BIVH 4MG3A 2Y5HA 2P8OC 2FYQA 1AB9C 2CHAB 1LVMA 2IPQX 3ZZ7A 1W14U 1LKBA 5A8XA 3LIWB 2TGDA 1GBHA 2FLRL 1XXDA 2RDLA 4NIXA 5C20A 1BRUP 2FP7B 2F3CE 2QF0A 3UTUH 3KK6A 2ZCLP 3S0NA 4YT6L 3RU4E 3NKKA 3QGJA 1FFMA 4M10A 3OEED 4K8BA 1PXXA 3T29A 3A8BA 1K0HA 4O1ZA 2Y80A 4ZXXL 1LPGA 1TGTA 4IBLH 2A4RA 2C3SA 1C4U2 3CENL 5HMAA 3HPTA 3MU4A 2Y38A 1VITG 3PV5A 1VR1H 1F7MA 3M7QA 1DM4B 3KYFA 3JZ1B 1IP0A 4DT7B 5GWZA 2J9NA 3EYDA 2UWPB 1LPKA 2BQ6B 4TSFD 1UCYK 1XVOA 3DCLA 1PQ7A 3M5LA 4XE4A 3RMMH 2GCTB 2WPLE 1GGDC 2BXUH 1KLIL 3SGAE 1ELCA 3BTFE 1MU6B 1BBRE 1NFYA 1EOLA 2EI8A 4INLA 1VJ9U 1H4WA 4ISNA 1NFUB 2Z6BD 3VB6A 2ULLA 1A61H 4X1QU 3U73A 1IQGL 2GZ8A 3VFEA 4ISHL 2WSSD 3O8RA 1CVWL 4CUFA 3A7XA 1EFRD 2V3MA 1EMOA 2KM0A 3AAVA 3TBDA 3P8FA 1UTNA 8GCHG 1EBVA 1C5XB 1IAUA 4NA7A 1K1MA 5CMXH 1AVGH 1LMWB 1HAGE 1P2KA 1O3CA 5KECA 1Z6EA 1BJUA 1CGHA 1QB1A 1Y3UA 4IGDA 1SQRA 1SLWB 3EGKH 1TPAE 1F7EA 2C4FH 2XBXL 3SV7A 5GXPA 3LH3A 3VB7A 2EA3A 3BEUA 1QURH 1YPEH 4CSYA 1N8OC 1YC0A 2FEQH 2ZCKP 1SLUB 1APQA 3MYWA 1AN1E 1UVOA 3TGKE 2BLWA 2Q1JB 1LMMA 3W1EA 1GVZA 4TPIZ 2Y82A 3N7OA 2ANYA 2J4IB 2GV6A 1YP9A 4ZH8B 1O2TA 2P59A 2TRMA 3KN2A 2K2SB 5JB9S 3A86A 2BY6X 3CENA 3RXJA 2J98A 4NIYA 4INHA 1SGPE 1NFXB 2QAAA 2FLGA 1K28D 1HAOH 1RD3B 4ASUD 3ATIA 2RA3A 1WDIA 1FQ3A 4PH9A 4Q80A 1ELDE 5EJLA 3SV2H 1CGJE 1KLJH 3S7KB 1ZJKA 1VGCC 5K0HB 1ATBA 1LQEA 2FI5E 2OINA 2OCVB 1JV2B 1GJ6A 4YLQH 3RMNH 2F9BH 1BMAA 1AHTH 1K9OE 1O3BA 3IWMA 2ZEBA 5DKMA 4ASHA 1OX1A 1EPTC 1ESBA 1OWHA 2GD4B 2R3UA 2W26B 1UK4A 1FAKH 2GKVE 1WTHD 1LHGH 3RM0H 1IQGA 5JBAE 3OFND 3SNBA 1TNGA 3PO1C 3F9HA 1EGFA 2FOHA 1GI2A 3DHKH 4NGAH 1YKTA 2XC4L 1AFEH 1O5FH 2Z9IA 1ANDA 1A3EH 2VIVA 1K37A 2ZHWH 4OS2A 2DE8A 1PPBH 2BHGA 2CJIA 5L2ZH 1C5MD 1V2RT 1GMDG 2H5CA 1WQVH 4GCHG 4XBCA 2A32A 2FLRH 2Z9GA 1LKAA 1TMBH 3G01A 1KIGL 3KL6A 5A0AE 2BTCE 4R0IA 3PWCA 2VH6A 4NIVA 3S9BA 1O2HA 2A7JA 4YT6H 3F0PA 1G9IE 1HNEE 1HJAB 1W10U 2PP6A 2WYJA 3EA8A 1C2EA 1EP6A 5EGMB 3I78A 2XBXA 3UAIC 5GCHG 4CUDA 1BMFD 4MPXA 2UWOA 2V35A 5JW1A 3Q3KA 4ZXXH 4JCNA 1X7AL 1Z8RA 1GJDB 1E37B 3RMOH 1ELGA 1V1HA 1O2YA 2IJOB 1BIOA 1V1IA 1JOUB 2ZGCA 4A1VA 3RXGA 1MTSA 1MOXC 1FY5A 1W0YH 1CA0C 1J16A 2WPJS 2BD7A 5A0BA 2TBSA 2ZFSA 1Z8GA 4FUBA 1IQML 2KL7A 1DWBH 1IQNL 5ABWA 2D1JB 1SGCA 3GY5A 1KLIH 3P92A 2FD6A 1G1TA 2WZQA 3UFAA 4BAHB 1P09A 4ABDA 2VU8E 3I77A 2WHXA 2XW9A 3HO3A 1O2RA 3KEEA 5PTPA 2F9PA 3ZZ6A 1BRAA 4XOJA 5K7RA 4ISHH 1OB1C 1UHBA 2JJ2D 1TGCA 2VBCA 1CVWH 3BSQA 1FIZA 2PKSB 2Y81B 5GJ4B 2QIQA 3U1JB 4JMYA 1U67A 2NPRA 1G30B 2AS9A 4BOHA 1KTTB 1AIXH 3F2FA 1O32A 1HXFH 4UFFH 1DE7H 1IQJL 1SB1H 4YO9A 1IQHL 1NRPH 4ABIA 2XC4A 1E35B 1D9IA 1C2HA 4BAMB 5J4SA 4WVPE 2A45B 4ZROA 2VWMK 1O2ZA 1H9LB 1JMOH 1L1GA 2AFQB 2JH5D 2BY5X 1F0SB 2KNIA 4O03A 1ZPCA 4OS1A 4RT0A 1C4V2 1TLEA 1EUFA 2ODPA 5C3NA 1MBMA 1NRQH 1KYNA 1SBWA 4OTJA 3M5OA 2VB0A 4U2WA 1DSTA 1VKYA 1GI5A 1K1OA 1PYTD 1C1VH 2OC8A 1SGQE 3PMJA 4I8GA 1O0DH 3ZYJB 1O5DL 3BTDE 1SGDE 2AGIX 3B23B 3PROA 1ELBA 1WTGH 1LQDB 4A7IA 1VITF 1CCVA 4Y6DB 2OYEP 4FUHA 1YCPH 2WPME 2A5KA 4RKJB 5EPNA 3QUMP 1IOXA 3F3BA 4NA9L 2Y7ZA 1C2JA 4Z6AL 2PSXA 1EQGA 4JYUL 2PHBA 2BQ7A 2P3FL 1GBAA 1O3KA 1UVTH 1CX2A 2HLCA 1AD8H 3A7WA 1IQMA 1QBVH 3KQ5A 4NWLA 2BO2A 3MO9A 1WHFA 1IQNA 1NESE 1DWDH 2PUQL 1A5GH 3LGUA 2H5DA 3AK5A 1XKBC 4XBMA 3RC6A 4AG1A 5ESTE 2GMTC 1T8OA 1G3CA 1S81A 3PYHA 1V3XB 3KCGL 1BBRH 2W2ME 3GY8A 1SFIA 4X8UL 4M7GA 3ZV9A 1DVAL 2XWBI 8GCHF 2O8TA 3T25A 3URCA 4AORA 3S9CA 1O2LA 2L74A 4Y7AA 2GZ9A 5EOKA 2M2AA 4O02B 3EA7A 3K6ZA 1OYQA 1IQJA 1S83A 2WPLS 2ZU2A 1LHEH 4B6EA 1NM6A 4WXIA 1WUNH 1IQHA 1QJ1B 3DFJA 1EMNA 1GCTB 1KIGH 1YBWA 3DUXH 4JZDL 1PPFE 3RXFA 3SBKA 4SGAE 3GISB 2VVUL 1IGXA 5ESBA 4X8SL 2ZGBH 1TA6A 1O37A 2EI7A 5C5OA 1C2DA 4ZXYL 4Y71B 1HUTH 1TOMH 4AOQA 2P3UA 3EAJA 5EJZA 3QDZB 2VWOL 3E6PH 3LT3A 2BZAA 5F6MA 1Q3XA 3SU0A 1DIYA 2QXJA 1A0JA 4GSOA 5F8XA 1FMGA 1MTNB 1XFEA 1JWTA 4D0FA 5T1VA 3A87A 3SU5A 1GJAB 3E0PB 7ESTE 1DY9A 1AFQB 3ZYIB 3NXPA 3HK6B 3LOXA 3RXHA 1GHXH 4FXGH 2VJ3A 2A7HA 2P26A 3ZVGA 4ZCNA 2TPIZ 1F0TA 1MKXK 3SU6A 3FBYA 3LC5A 4UFGH 2XCFA 1OPHB 1O35A 5HKKD 4FU9A 3PWBA 3O8CA 1HT5A 3PTBA 3O8DA 1K21H 3AW1A 3LN1A 2BDBA 2CF9H 3SYJA 3ZZBA 1GK5A 3ZYDA 5AFYH 1V2LT 3HPTB 5FX6A 2AGEX 3M7UA 4DOQA 3FVFB 5EQRA 2M5TA 1GMDF 1P2OA 5E0HA 2J97A 1YLCA 1HIAA 1TGNA 2PWXA 4GCHF 5C5NA 3DSGA 4AGKA 3QN7A 1LPKB 1YPKH 2YNAA 3QMOA 1TQ0B 4IN2A 1QIXB 2EI6A 3SN8A 4K2YA 5CHAC 2VIDA 5JBBS 4XL1A 3SGQE 1WQSA 5GCHF 5AF9H 2CHAC 3MDLA 3NT1A 3BTQE 5CISA 3KHVA 1O5DH 7KMEH 3MNCA 2VVUA 2Y7XB 4I33A 3SJOA 1JXPA 1YPHE 1FSBA 4BTTA 2QF3A 2ZI2H 4D76A 4XBBA 1C2LA 1F92A 1YWUA 1TPPA 1EZQB 2V0BA 2BVXH 3TLOA 1AQ7A 4NA9H 2VJ1A 3UWIA 1AI8H 1V2TT 4Z6AH 1W0ZU 4JYUH 2P3FH 2VWOA 1QRZA 1W0KD 3GCHC 3HS6A 2OC1A 2J2UB 3UB0A 5F1AA 1AUTC 4O3UA 2VVVL 4RT1A 3GDVA 2BOHA 2ALPA 4SGBE 2THFB 2CV3A 4FUFA 1K22H 2PUQH 1QL8A 3VB4A 2KX4A 3U28C 1Z6JH 2P3FN 1XUKA 5CHBA 3TK5A 3ZIAD 3IITB 3UOUA 1GBMA 2BD4A 3R0FA 4DY7B 1C1OA 1TPGA 1PQAA 1H1BA 1C1NA 3EE7A 1SGFA 1W12U 4NZQA 3KCGH 3QCWA 3SJIA 2GCTC 4X8UH 3V12A 4HGCA 1DVAH 1A5IA 1B9WA 2ANKH 4KELA 5SGAE 2QGRA 4YT7L 6LPRA 2KV4A 3V65B 1Q2WA 3ATLA 3Q00A 1EAUA 1WOFA 5JB9E 4NIWA 3M5NA 4CRFA 1BTYA 1U6QA 3I29A 1V2VT 1SQTA 3M3VA 5IKTA 4JZDH 4D7GA 2B7DL 3GCWE 6CHAB 1C5LH 2GCHG 2HPQH 5I46L 5EG4A 6COXA 1SMFE 1BTXA 3KQCL 1NRRH 2OP9A 4KTUA 2VNTA 1KLOA 2ZHDA 1RFNA 1HJ8A 1AE8H 4ZXYH 1QB9A 4YZUB 1TPSA 1EAIA 1TFXA 4D9RA 1ZSKA 1O2PA 2HALA 3LKWA 1U8CB 1ELAA 4HFPB 3E91A 1FNIA 2R2MB 3E8LA 3ZVDA 2W2PE 4FUGA 1JRTA 4GHQA 2FODA 1A4WH 2W86A 1QCPA 1CHGA 2PSYA 5DSFA 4G1MB 1MQ5L 4Y79B 3UREA 4COXA 1Z71A 2CJIB 2CF8H 1SHYA 4AFQA 4JZFL 2ZP0H 1ZGIA 5IKQA 4I32A 3TH4H 3V13A 3ZZDA 2VVVA 3A82A 1O2QA 1TB6H 2YGOA 2ZPSA 3BF6H 2K2TA 1CE5A 1P2MA 4M9FA 5BPEA 2ANWA 3E1XB 2LELA 2KCAA 2WYJB 1BTUA 5T3HA 1RXPA 2UWOB 3BG4B 1FAXL 1XXFA 1S0QA 3ODDA 3Q3KB 1C1UH 5JBTA 1HPGA 4TY6A 1PFXC 1O5EH 2ZWLH 3VB5A 1O3HA 2Z9KA 1N6XA 3GDSA 3QTOH 3ZVCA 1W8BL 1O31A 2WPJE 1SQAA 4MNVA 1RGQA 5FBIA 2A1DB 5ETXA 1MTWA 2VIOA 3SW2B 3DEMA 3PRBA 4ZKOU 4FUDA 1N6YA 3SJ8A 1XDTR 3K65B 2FPZA 4E7NA 4MVNA 3QO6A 2OK5A 1K36A 5EXLA 4Y8ZA 4XRNA 2H9EC 1AO5A 4CREA 4ZMAH 1NRSH 4ZUHA 1MBQA 1YPMH 1CT4E 2A5IA 1COUA 3N8YB 3K2UA 4X6PA 2ZKSA 3KQCA 3PV4A 5FDQA 2ANMH 1ZHMA 3NPSA 1V2WT 1VCPA 3E90B 1DXWA 1GJCB 4I7YH 3WY8A 2BQWB 4ABBA 3HGPA 8LPRA 3L6PA 1NQLB 1W0JD 3MTYA 2BDGA 2PTNA 1KLTA 4X0WU 1PPEE 1TPOA 4IS5A 4WMEA 1C5RA 3MH5A 3BPSE 3MU5A 1UW7A 2NU4E 4RS0A 3AW0A 3T26A 4BAKB 1AY6H 1MU8B 3V0XA 1ZHPA 1D3PB 1GBTA 1MQ5A 1L1NA 5CKQA 1O38A 1O36A 1ZPZA 1LPZB 1FJSL 3SZNA 4BAQB 1UJ1A 1TNLA 4O3TA 4BNRA 1DQBA 1Z7KA 2QF4A 3A7VA 5EJ1A 4B73A 2J38A 1QJ7B 2L6OA 2UUKB 3SORA 1XKAC 1UTMA 4RKOB 1O3JA 1S6FA 3SU1A 4YT7H 1RIWC 1DITH 2ESTE 1ARBA 1FAXA 3GCOA 2D26C 2ZPRA 2AIQA 5EPYA 2ZU3A 1GG6B 3SNCA 1SLXB 5C67A 2PKSC 2A7CA 1HRFA 1IHSH 2WG3C 1HAZB 4JZIA 3TJOA 1TOCB 1IQIL 1GWAA 3KF2A 2PKAB 2B7DH 2PHBB 2SGDE 1NROH 3TVJB 1LDTT 1BOQA 1QA7A 5I46H 1IQKL 2O9QA 3OEHD 1EPTA 3FO8D 1OOKB 3SQEE 1QQUA 1TA2A 3S7HB 5JVZA 4Q2KA 3DD2H 2WV5A 3N8ZA 1ZYOA 5FX5A 2QCYA 1Y5AT 4FOUC 5A0CA 1GDQA 2A4GA 1O3LA 4WF8A 1GVLA 1YCPK 4A6LA 2FOMB 5EW1H 5T6FA 1OWEA 1MH0A 2PTCE 1NT1A 2BMGB 2UWLA 3C1KA 1FIWA 3UQVA 2Q6GA 3UR9A 2JETB 1G2MA 2W7SA 2MHPA 2P3TB 2OLGA 2BT8A 1OS8A 2AMQA 2BD9A 4CRDA 5FAHA 4UDWH 4DJZB 3HO4A 4JZFH 1G32B 3LC3B 3MQKC 3ASIA 2WINI 2AHME 2WV4A 4TY7A 1QTFA 2AERH 1NBMD 1O2MA 1UCYE 1GI9B 1HAVB 2XNDD 4AB8A 4NCYA 1QBOA 3SZEA 1C2FA 1BBRK 4DVAU 3LGYA 2DUCA 2Z9JA 3F2GA 1C2GA 1FJSA 1MZAA 4AYYB 3NJPC 4ABAA 3UOPA 4YOIA 4GUXA 2EI7B 1DSUA 2QXIA 2BY9X 3CA7A 1LHDH 5TJXA 2BM2A 2WPDD 2EQNA 4K3JA 3BN9A 3H7OA 1W8BH 1Y3VA 1ZR0A 1TBRH 3GCTG 2H1UA 4Y76A 4F48B 1ZGVA 3L33A 5LPRA 3U7UG 2ZA5A 3MNBA 2XXLA 5DGJA 2W3KB 1HJ7A 1Y3WA 4Y0ZE 1O2NA 1EAWA 2KR7A 1H8IH 2GCHF 3SV6A 1EJNA 1C5SA 1O2JA 1IQIA 4GLYA 4Y0YE 3A89A 2F4LA 1YPHC 1KSNA 1J17T 5L2YL 1IQKA 4I31A 3LGWA 1HAHH 1BA8B 1F0RA 2YNBA 3QLPH 5L30L 1UZPA 3RU4T 5JB8S 2WUCA 3LGTA 4MMXB 1GCTC 3A7ZA 2Z94A 2TIOA 1FV9A 1F5LA 1OWJA 1SGEE 2VGCC 3U98H 1KXCA 1AKSB 3FFGL 1S85A 2RDEA 1LHCH 3LJOA 1FDPA 2WZPP 3RM2H 4K5ZA 3EA9A 1Q31A 3RU4D 1T8MA 4CRCA 2VVCA 4CRBA 1YLNA 4WMFA 1ZLRA 4I8JA 4ZHAB 1O3GA 3CS7L 3ELAL 2G4UA 1GI4A 2IPHA 1HCGA 1ZMNA 5JBBE 4K60A 4P00A 3U8TH 2ZFQH 4U01A 1IQFL 1MTNC 4ABJA 1CCFA 3TJNA 1GJ7B 1K1NA 4GVUA 5KIRA 1D6WA 4AQTA 1HAXB 4IMZA 4MNXA 1C2KA 1CHOG 1AFQC 4A94C 1P06A 4KP0A 1NPMA 5FPYA 1Y3XA 1EP5A 3P6ZB 1QA0A 5KEDA 2O8UA 2PV9B 4FUIA 3RUOA 1EPGA 5HIYA 4KGAA 1C1RA 3KNXA 4CRAA 1G37A 2VH0A 1UTLM 3RXIA 1SSXA 3TU7H 1XKBA 3MMGA 1P3EA 2W5EA 1LTOA 3F68H 3F1SB 1FN8A 2JH0D 1GHBG 2J95A 1QFKL 2GVFA 1KDQA 3RP2A 2WYGA 1V2ST 4IN1A 5DN6D 1GI6A 3KIDU 1DANH 4UFDH 1S6LA 1MZDA 1P9JA 1ZRBA 1SGFG 1O5BB 1QB6A 2QXHA 2V3HH 1C1MA 2QY0B 2PGBB 1CT0E 1GMHG 7GCHG 2FM2A 1YM0A 3TK6A 3GY7A 2BVRH 1C5MF 2HNTF 3MH7A 1BTHH 1SG8B 2QN5T 3GYLB 1K1JA 3FFGA 2ADXA 1LK9A 1APOA 3RXEA 4TYDA 1WU1B 1H9IE 2I9BA 4ZAEA 1B7XB 1EZXC 3RXAA 1ZAQA 1UVPA 3ENSB 1F5RA 1W7GH 2SGFE 1V2QT 1A0HB 3CS7A 5IYTA 3LN0A 4VGCB 2HOXA 1ELEE 1GJ8B 2R9PA 3E0NB 2BD2A 1BRCE 2ZQ1A 2J94A 1TNKA 1QIUA 2C8WB 4XLWA 3T28A 1IQFA 1NS3A 4AGJA 1CBWB 1AUTL 2A2XH 2BDAA 4H6SB 1YO8A 3F0OA 3M7TA 3MNSA 4ZKRU 3STIA 4FUCA 1BDAA 1GBFA 3K9XA 5JPMH 4E1GA 1TLDA 3LPRA 2SGAA 2BT7A 2GDEH 1P2IA 3GICB 5FL7D 1LVYA 2G55A 4Y10E 1RRKA 5L2YH 1ZMJA 1T32A 1DFPA 1W3CA 1UTQA 2ASUB 5L30H 1P0SL 3FZZA 1HXEH 2ZFRH 1NZQH 3EGFA 4XBDA 1GI7B 4B75A 2ZU1A 1TGSZ 1IVOC 4K1EA 1TRNA 1QNJA 3ESTA 3P95A 6CHAC 4BTIB 4B2CA 3MU1A 2FS8A 1PRHA 2UUJB 4MTBA 4MPVA 4Y7BB 4UE7H 4AC9A 2PR3A 3UR6A 2GZ7A 4NG9L 1RTKA 3A83A 1EB1H 1O3DA 1G2LB 1GGDB 1AWHB 1TONA 4AFSA 3PLPA 1HX2A 2ZDVH 3ELAH 2G00L 4JZEL 5KN5C 1AWFH 4KTCA 1XVMA 1BTZA 3LIWA 1UVUH 1VCQA 2H2ZA 3SHAH 3FP7E 3ITIA 3S9AA 4CHAB 1THPB 4LZ1H 5A09A 1TAWA 2FMJA 3OLTA 1WCZA 2B9LA 2FTLE 3SHCH 4CBNA 1NPEB 1ADXA 1PPGE 4X1PU 1TX6A 1E1QD 3TGFA 1E34B 2AH4X 2FO9A 1FZZA 1KMHB 1HREA 4O97A 1AU8A 1GHZA 1Y3YA 5TCCA 4YOJA 1D3QB 4GU4A 3P70B 1UK2A 3N8WA 2A2QH 3NTBA 3GCTF 4A92A 1TQ7B 2WFTA 1CO7E 1TALA 1W2KH 3DSPA 3ZVEA 1S0RA 1L3YA 1SGRE 2B5TB 1O2XA 4B74A 1SR5C 4LXBH 5IDKA 1G1SA 1O34A 3KQEL 1ANCA 4AN7A 3TK9A 1DLKB 1BITA 1NFWB 3RXUA 1GJ5H 1P9SA 2UWPA 3NCLA 2PUXB 2BQ6A 3GCXE 3FP6E 2XBYL 3TITA
chains in the Genus database with same CATH topology
2GX4A 2VWNL 3BTGE 1PFXL 2ZPQA 4Y8YA 3MH4A 1O3NA 3N8VA 1OXGA 4TWYA 2BZ6L 2OTVA 2ZHQH 3ZVAA 5JBCS 2BOXA 3E3TA 5JYIA 1HAYB 4B2BA 2H9TH 2OQUA 3MU8A 1C1TA 1T8LA 5HM9A 1ARCA 3OLUA 2QYIA 1Y8TA 3D65E 2J38B 2J92A 1GJBB 3SV9A 2FOGA 1T7CA 4E7RG 5DP3A 3U69H 4DIHH 2TGAA 3N8XA 1QQ4A 3KQBL 2FOCA 2H9EL 4BANB 1P2JA 1ZRKA 1J9CL 3DA9B 2H6MA 2UUFB 1O3OA 4D9QA 2FESH 1ZHRA 1SPJA 1V2KT 5LPEA 1FONA 3K6YA 4KTSA 3U8OH 3ZZ3A 1XUHA 2G00A 1TIOA 1IGZA 1BT7A 1UVSH 2OXSA 1O2OA 2FX4A 4ISIL 5F03A 1C5VA 5AFZH 9ESTA 1CHOF 1YF4A 3PO1B 1SL3A 1YYY1 4K69A 2YGQA 2Y80B 1LPGB 2W7UA 2R3YA 5LH8A 3TGIE 3UNRA 1GBLA 3C27B 4CH2B 2ZDLA 1AZ8A 2A4QA 1QGFA 2NU1E 2Q1JA 5E0JA 2MGRA 4I8KA 4U32A 1E36B 2GT8A 2J4IA 1KY9A 4ZH8A 2CMYA 3GDUA 1OWKA 4DURA 3LTFB 1EZSC 1C1SA 2WPKS 4GHTA 3SNAA 1XKAL 1KXFA 3OX7U 2Z9LA 3KQEA 3POYA 2SGPE 2OQ5A 5C1YA 1NFYB 4MMYB 1V2MT 2EI8B 1C5NH 1GHBF 1GBDA 1MTVA 2XBYA 4X6NA 1GG6C 1P0SH 5HM2A 4BDWA 5K0HA 2VWNA 3PMAB 1B0FA 4OS6A 1GBCA 3A8DA 4FU8A 4H42U 1GJ4H 4X2XA 3SU3A 2HGTH 1GMHF 7GCHF 1PPZA 1EPJA 1VCWA 5GDSH 2GD4A 1S5SA 1V6DA 2W2QE 2W26A 2QV1A 1EX3A 3QX5H 1C9TA 4NG9H 3MWIU 3QH0A 1F7ZA 2D2DA 3BTTE 3TJUA 4X6OA 3KQBA 2ZO3H 3ZZ8A 2IN2A 4JZEH 1GPZA 3VPKA 2ZZUH 3FANA 2FX6A 1YUGA 1IQEL 2G51A 4FVDA 5HYOA 3B9FH 5FCKA 2JETC 1MTUA 1YPJH 1GI0A 4ISLA 5DP6A 4Z0KA 2FOAA 5JB8E 3MOCA 1UO6A 2Y82B 3ATWA 1BRBE 1DUAA 2P16L 1MCVA 1BB0B 3VEQB 4TPYA 1P03A 1FE2A 1L0ZA 1DPOA 3SNDA 2OUAA 1OWIA 3CFWA 1CA8B 2ODQA 2AYLA 2ZECA 1MCTA 1HJ9A 1THSH 2TGTA 3F6UL 1ORFA 4MPWA 3U9AH 2EEKA 3SOBB 3P5BL 3MI4A 4NZLA 1DY8A 3A8CA 1A2CH 4D90A 4X8SH 1QY6A 2BZ6H 1OP0A 1URKA 2BX3A 3SI4H 9LPRA 1HGTH 4X2WA 5J4QA 5E8DA 1BMMH 2TGFA 2G8TA 2Y81A 1KTSB 4TWWA 1YPGH 2NU2E 2H9EH 1DX5M 1TX7A 1DOJA 1C2MA 1J9CH 2XBWL 1S6HA 4X8VL 1P2QA 1TRMA 5E2PA 1L4ZA 4HZHA 2GT7A 5EXNA 4CR5A 4K8YA </