4BXSA

Crystal structure of the prothrombinase complex from the venom of pseudonaja textilis
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
326
structure length
248
Chain Sequence
KSCRVDNGNCWHFCKHVQNDIQCSCAEGYLLGEDGHSCVAGGNFSCGRNIKMDCKLGECPWQAALVDEKEGVFCGGTILSPIYVLTAAHCINETETISGEIDKLSVDKIYVHKKFVPPQKAYKFDLAAYDYDIAIIQMKTPIQFVPACLPTADFANQVLMKQDFGIVSGFKSKTLKVLKVPYVDRHTCMVSSETPITPNMFCADSGGPHTTVYRDTHFITGIVSSGKYGNYTKLSKFIPWIKRIMRQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the Prothrombinase Complex from the Venom of Pseudonaja Textilis.
pubmed doi rcsb
source organism Pseudonaja textilis
molecule tags Blood clotting
molecule keywords FACTOR X-LIKE PROTEASE
total genus 37
structure length 248
sequence length 326
ec nomenclature
pdb deposition date 2013-07-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00008 EGF EGF-like domain
A PF00089 Trypsin Trypsin
A PF00594 Gla Vitamin K-dependent carboxylation/gamma-carboxyglutamic (GLA) domain
A PF14670 FXa_inhibition Coagulation Factor Xa inhibitory site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.25.10 Mainly Beta Ribbon Laminin Laminin 4bxsA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4bxsA02
2BM2A 4LZ1H 5B6OA 1O3LA 2VVVL 3GDSA 1MTVA 3T26A 2ODYB 4AZ2B 2UWLA 2WYJA 1W7GH 3SU3A 3ZYDA 2IJOB 1H1BA 4RKOB 4Y79B 3P8GA 3LONA 5EG4A 1N1LA 1GK5A 5IKRA 5LPFA 1C2GA 3U98H 1P2QA 3ZVFA 3QN7A 3KQDL 3LIWB 4DY7B 2TPIZ 1AUJA 1HX2A 2J2UA 3K6ZA 1G36A 3HKJB 1IQIL 2FX4A 3FZDA 4OS5A 3TJNA 2Y5GL 1DWEH 2P93A 3M61U 2CGAA 1J8AA 3SJOA 2BY8X 1MKXK 1L1NA 1HT5A 2XBVL 1BJVA 1ANDA 1LVOA 1O32A 3W95A 3MU5A 7KMEH 3AAUA 4O3UA 2NU2E 1DX5M 2FWWA 5F8XA 1P2KA 2IPHA 3SU2A 4Y7BA 1ZMLA 1HAGE 1GBEA 1GMDF 3TK9A 1AE8H 1GI1A 4DW2U 4AQTA 4IW4E 4OS6A 4O02B 2ZTYA 2XWAA 1QTFA 4YM9A 2FOAA 1J15A 7LPRA 2R2WU 5LPEA 1UZPA 4FUJA 4Q7YA 4JYVH 1HZ8A 5GPIB 2PWXA 3GICB 1DSUA 2P95L 2TGAA 4FU8A 4AFUA 3F6UH 1TX8A 4OGYA 5F6MA 1K9OE 4X1NU 1IQHL 1EMNA 4UFDH 1UK2A 3LOXA 5ESTE 3LKWA 3STIA 1GCTC 2QN5T 2W26B 5AHGH 1D9IA 2WPJS 5EW2H 2IOTA 3MNBA 2EI8A 2R3YA 1TX7A 1IQJL 2BD9A 1BRBE 3RXUA 1ZLRA 1C2JA 4JZDH 4WMFA 3LGTA 4B2CA 4VGCC 5AFZH 5C1XA 1L1GA 2JKHA 1GVLA 2UWPA 1OXGA 1C5UA 4WVPE 1L5GB 3VGCC 4NZLA 4INHA 1RD3B 3BTHE 1P0SH 3SU1A 2D2DA 3GY2A 1TNLA 1A2CH 4DVAU 1YF4A 1EPTC 1EZQA 1UTJA 2BDIA 2HVXA 1O2VA 2V0BA 2H9HA 1MTWA 5KN5C 1TA2A 1BTHH 3EAJA 2HOBA 1BMNH 1TGNA 2YNAA 2ZEBA 6LPRA 1H9IE 4NA9H 2W3KA 2BDYA 1XDTR 1QY6A 2H6MA 1SGIB 2EI8B 1ELTA 4WH6A 1DUEA 5JBAS 4E05H 2ZG0H 1SC8U 3TH2H 1ARCA 2ZHEH 3FCSB 1K1PA 3AW1A 3ZV9A 1IAUA 1BHXF 3PTNA 1Z8IB 3MO6A 1SGPE 3F9GA 1C5NH 1IQNA 4ISIL 1FPHH 5HYOA 5DO4H 2F9BH 2XBVA 1L2EA 2ZECA 1XKAL 1AO5A 1O31A 3P95A 4HI3A 1TOMH 1O2TA 2VGCC 1Z7KA 1OKXA 2ZU1A 3KF2A 2BQ6A 3UQOA 4ZROA 1ZTKA 4RRXA 1UTQA 3SV9A 1NT0A 1ZGIA 3PB1E 1HXFH 1E0FD 5KIRA 1N8OB 2DE8A 2VJ3A 4DGJA 1Q2WA 1E34B 2A5AA 1EXFA 4XBMA 3UTUH 2G5VA 1G30B 1GDQA 4H6TA 1MTSA 3TJVA 3ZZ3A 2BYAX 1EAXA 4A5TS 1DX5I 1OWEA 1IOEA 2GDDA 1UMAH 3SJIA 2BDBA 3EA8A 1BCUH 1MD8A 3PROA 4M7GA 1VCQA 3L3TA 1O3FA 2F9PA 3LDXH 2V35A 1C5PA 4LMFA 4X2WA 3LC3B 2A4OA 1L1JA 3UIRA 1ATEA 4CUFA 1BBRE 3FAOA 2F9NA 1SGQE 2GX4A 2JH0D 2AMDA 4TY7A 2A31A 2HNTF 1BITA 3RXSA 4YT7H 3P70B 4FUFA 1Y3UA 4Y76A 2UWOB 3UUZA 5I46H 1HGTH 2F91A 1C5WB 1RIWB 4K1TA 2MHPA 2XC4A 1HPGA 1SVPA 1BA8B 3MHWU 1YPLH 1GBLA 2AYLA 1O3EA 1C1UH 1ZAQA 1O2UA 1OWKA 5F03A 3ZYJB 3I78A 1P03A 1U67A 2PUXB 3M36L 1GBIA 1IJQA 3IITB 3R05A 3PWBA 1LMJA 1TA6A 3LIWA 1FY5A 1HRTH 3HK3B 2A7HA 2CXVA 3GDUA 1S6FA 4Z6AH 1O3KA 4TWWA 5G4BA 2ANWA 2P3UB 2XBXL 5E8DA 2A7CA 3D65E 4ISHH 4WWYA 1TGTA 3SU4A 4NSVA 3VEQB 3UR9A 1CHGA 1O3HA 4OTJA 1HYLA 1UZJA 2BOKL 1KIGH 1NQLB 1KDQB 1ETRH 2A5KA 2BLVA 2JH5D 4DJZB 1RXPA 2VU8E 2VH0B 2Z9LA 4NWLA 1TONA 4GUXA 1FJSA 1OSSA 5LGOA 2GP9B 3HS5A 4F4OC 3M37L 1TMBH 5JBCE 1QBNA 2CMYA 7ESTE 3B23B 1ANEA 1PPZA 3TBDA 1BBRH 1F0SB 3F6UL 3P5BL 1O38A 2WPHS 4GCHG 5PTPA 4SGBE 4Y6DA 4AX9H 1WHFA 1LVBA 5GJ4B 1MZDA 1O3IA 3EGFA 8LPRA 4O9VA 1WHEA 2GZ8A 1W8BL 1O2XA 4HTCH 1NRNH 3I29A 3M36A 5TJXA 1KXDA 3M3TA 2PHBB 1SGEE 1EAUA 4BTIB 2W5EA 2YNBA 6CHAB 2Y7XA 3BPSE 1D3QB 1TPPA 3LC5A 4MMZB 1GHWH 2KV4A 2PKAB 3LN1A 1DFPA 3MDLA 4E1GA 1NFWA 2SGFE 5HGGA 7GCHF 1W0YH 1O3DA 3A7VA 1Z1JA 3UNRA 4PROA 4TPYA 2W7SA 3DFJA 3M35A 5C2ZA 1NFXA 1V2VT 1DT2A 2BQ6B 4Q2KA 1C9TA 3TK5B 2PLXA 1KLIL 2TGPZ 2EI7A 3LAQA 1MKXH 1AQ7A 2BLOA 1P10A 4UDWH 2ZFFH 5K0HB 2A1DB 5EGMB 5JYIA 2Y5FA 1HIAB 3KNXA 3OTJE 5DJ7A 1GI0A 2BX3A 2RDLA 1OYTH 3S0NA 1SL3A 1F0TA 2VH6B 3HGPA 3LGYA 5CHAB 2VIVA 2VWMA 5T3HA 1DY8A 1T8NA 3BTQE 2G5NA 4BTTB 1PFXC 1SLVB 2FPZA 2BMGA 2G55A 1SGRE 3PMHB 3EDXB 5FX5A 1APQA 4X2YA 4ZKNU 1AVXA 1GJ4H 1MTUA 2ZPQA 2AH4X 1ELCA 3HPTA 3TIUA 1OX1A 1P57B 3LT3A 2W3IA 1XUFA 4ZUHA 4CR9A 3GCHC 4VGCB 3LGWA 2HALA 3T28A 2TGTA 3FP8E 4QT8C 2ZP0H 2F83A 3MTYA 1P9SA 1ZJKA 2JETB 2W86A 5L2ZH 1W3CA 3RC5A 3VGCB 3RXBA 2FDAA 3KQCA 1YPMH 2H1UA 1LQDA 1ZTJA 4GAWA 3ZVBA 1TOZA 1ACBE 1SGCA 1BMMH 2Y7ZA 1DE7H 3LGUA 3EE0B 1EPTB 1TRNA 3ODDA 1DWBH 1FZZA 3VFEA 3SU5A 3S7HB 1TQ7B 4BAOB 2HPQH 5C1UA 4HGCA 1S5SA 2FI4E 2CN0H 4ABAA 1WTHD 1G2LB 5JVZA 1GBFA 1SB1H 2DUCA 3MFJA 1A0LA 2DE9A 3ZZ9A 1A5IA 1KXAA 5GXPA 2FX6A 1OPHB 4I8JA 2TGFA 1JIMA 1C2MA 5JBTA 2WPKE 3MNSA 3ZYIB 1P06A 1C1VH 1VITH 1CEJA 2YOLA 2UWOA 1T31A 5L2ZL 4O3TA 4J2YB 4BANB 2I9AA 2ZCKP 1CA8B 2PSYA 2J2UB 1GJ8B 4DIIH 1Y59T 5EXLA 2OINA 1MZAA 2CHAC 1C2IA 1MCVA 3RMOH 1NM6A 4CUEA 1QB9A 1FAXL 3UNQA 3MWIU 3N8VA 1ZOMA 1N8OC 3F68H 2BY6X 3F9FA 4Y8XA 3LTGD 2Q6FA 2QIQA 5ETXA 3T25A 1S0QA 2CJIA 3QTVH 4YOIA 1AN1E 3RXEA 4AYYB 1GL1A 2PV9B 2FI3E 1Z6CA 2YGPA 4GSOA 4YOJA 2A45B 3SJ9A 4BTUA 1EZSC 1C5OH 1ELBA 4AFZA 1QFKH 4K60A 4CBOA 1LPGB 1MCTA 3E90B 3M3VA 3TK5A 2WYGB 3RXOA 2ZU2A 1SR5C 1HAZB 2FI5E 1GBCA 1ESTA 2KAIB 3HO5A 1JL9A 2K2SB 1ESBA 1WCZA 4D7GA 4TY6A 4CUDA 1RIWC 2WUBA 2PUQL 3V65B 3SOSA 1IQGL 1BTUA 1DSTA 4ZAEB 2SNVA 3IG6B 4B74A 5BPEA 1FFMA 2Z9KA 1DVAH 2M5TA 1FN6A 4GCHF 4I31A 2P8OC 2BY9X 1KXBA 1P9UA 3O8DA 4ZXXL 4RUTA 2VIWA 1HCGA 1GI5A 1YPJH 4YTAA 2Z9IA 1GBKA 3PTBA 1XUHA 3TH3H 4E06H 2RCEA 4MNVA 3UPEA 1XKBA 5K0HA 1S81A 1HJ9A 5E8EH 6ESTA 4LOYH 4H6SB 2V3HH 1L0ZA 1YBWA 3GYLB 1XVMA 3TNTA 4C16A 1DLKB 4JK5A 2H2ZA 1ZHRA 1FXYA 2PW8H 4FUHA 2SNWA 1J17T 1TE0A 2A2XH 3VB3A 3CP7A 1CQQA 1DITH 1O2PA 1FONA 1SMFE 4AOQA 1KSNB 1N6YA 1ESAA 1YYY1 1MAXA 3URCA 1F5LA 2OBOA 1ELVA 1C1RA 3B8JA 4IC5A 4NZQA 1D3TB 2VWLL 1NROH 4I8HA 1F7ZA 3GY8A 1DOJA 2UWPB 1O2JA 3FBYA 1TNKA 2ANKH 3ZVEA 1HFDA 3KN2A 4ZXYL 1PPEE 3LJOA 1MKWH 4MVNA 1XKBC 5E0GA 5EQRA 2R2MB 1O3GA 1QBOA 1UVUH 1AFEH 3SORA 2FS9A 2I6QA 4BTTA 4GLYA 1JOUB 2Y5FL 1PQ7A 1TBZH 2EC9H 3ZZ5A 2BD8A 1O3NA 4LORA 1T8OA 1C4U2 3PYHA 2O8UA 2QXJA 2WPKS 1APOA 5F8TA 3UR6A 1MAYA 3KL6A 4DG4A 4ESTE 1YUGA 1OS8A 2AERH 3MO3A 3A7YA 4JYUL 5FPSA 2NPRA 1AVWA 4H4FA 6CHAC 1IQKL 4WXVA 3RU4D 2HRVA 2VWMK 1C2KA 3RC4A 1O2ZA 2AGIX 1QHRB 1MU8B 3IJEB 2P59A 1N1IA 2NU1E 2P93L 3A7ZA 5FBIA 1A3BH 2XXLA 2VB0A 2G51A 1PRHA 4ABHA 3NJPC 1A3PA 3CS7A 3MH4A 2ZFPH 2WFTA 1O30A 1UZQA 3QO6A 3C9AC 4A7IA 1CBWC 3OU0A 1Z6JH 2W2OE 4R8TB 3V12A 1BTXA 1ELAA 1HDTH 1ZHPA 1ZZZA 5CHAC 2RA0L 1GMHF 5HM2A 2SGAA 4D8NA 3SBKA 3SUDA 3MH7A 1EAIA 1Z8GA 2QYIA 4LZ4B 1UTOA 2Z94A 3E91A 1FIZA 1D6RA 2STAE 5FPTA 2A32A 1D6WA 2WYGA 1O3AA 1WTGH 3B9FH 2D1JA 1BT7A 4K8YA 3UWJH 1OYQA 1BQYA 1FQ3A 4BXSA 2GDEH 1EAIC 2C3SA 3PLBA 4B2AA 2W26A 1O2NA 3RXPA 1NRQH 3GCHB 2SGEE 4AGKA 2FOCA 5IKVA 1GGDC 4IN1A 1W8BH 3UY9A 3SV8A 1AY6H 5TCCA 4ABGA 4D9QA 2A4RA 1SPJA 3VPKA 1L4ZA 2R9PA 3QUMP 1TBRH 4JZFH 2Z9JA 3U73A 4KELA 3SHAH 2NU3E 4Z0KB 5E2PA 4X0WU 2VWLA 2ZDAH 1TNIA 2QY0B 2FLBL 1NS3A 2ZHWH 5C5OA 1FV9A 2XBWA 2J38A 1HJ8A 3FFGL 2ZPSA 1LKAA 1S0RA 1KXCA 1M9UA 2XWBI 2BXTH 3MU0A 3ZVDA 3NTGA 1YLDA 1UVOA 1D3PB 2FOHA 2GCTC 5DGJA 1QL7A 2SGDE 1WBGB 2WUCA 3M7UA 1FLEE 5DKMA 2ZDMA 3Q3KB 1O2KA 1PPBH 1B5GH 1KSNA 1LVMA 1GI7B 1AKSA 4JYTA 3MOCA 3SJKA 5C67A 1THRH 4JZEH 3EYDA 3RP2A 5DK1A 3IWMA 4LK4A 1CCFA 1GBBA 1NN6A 1ZGVA 1V2NT 2ALPA 3S7KB 5BRRE 1GHZA 3SV6A 1BB0B 2J95B 2K2TA 5JBAE 1K1MA 2ZI2H 5CE1A 2GCHF 2Y5HA 4A92A 3UOUA 3RXFA 5FCKA 1O2MA 3TGFA 3M5NA 3RUOA 4ASHA 2P3UA 1K21H 5LPRA 1V2UT 3H7TA 4ISHL 2XC4L 4ZMAH 2NWNA 1BBRK 3TNSA 1QQUA 2P3TA 1MKWK 1JRSA 2PFEA 5I46L 1BRUP 4U2WA 4X1RU 5J4QA 3F9EA 1YGCL 1FUJA 4AORA 1FI8A 2QXIA 1EOLA 2OP9A 2Q6DA 3KK6A 1ORFA 1QRZA 2P16L 1Y8TA 2FYRA 2ZDNA 1UK3A 4I32A 2VIPA 2PTNA 2ZHFH 4YZUA 2ZZUH 2FZZA 2FLGA 4BXWA 4NA8A 1O5DL 1ARBA 1DS2E 1O2RA 2ZWLH 5JDUB 1GBDA 3E1XB 1ZR0A 1FY8E 4OS7A 2J4IB 1JBUH 3TPIZ 1C2LA 5DP6A 5HMAA 1ATAA 4ISNA 5A09A 1TMTH 3DEMA 4BTUB 1IP0A 1BHXB 2BDCA 3ATWA 1V2LT 2CF8H 4I8GA 3VXEH 2J34B 1SG8B 2WPJE 2ANYA 1C1QA 1KTSB 1QJ6B 1RS0A 4NFFA 1IOEL 2XBYA 4E7NA 3UWIA 5AF9H 2EI7B 1EATA 4X8TH 1AE5A 1K22H 2OLGA 3N8ZA 1IOXA 1GL0E 1OWHA 1HUTH 3BTFE 3A87A 5TCAA 1GI3A 1CSOE 4A1TA 3HK6B 1ATBA 3Q3YA 2BZ6H 1PQAA 4ZHAA 3ZVGA 3QK1A 1IVOC 3RU4E 2AYWA 2FOEA 4MPUA 3A89A 5DP9A 1FF7A 2AIPA 4JMYA 4NGAH 2Z6BD 2FLRH 1GHBG 1E37B 3UREA 1JWTA 1YC0A 3ZZ6A 5ABWA 2W2PE 2BVXH 2VH6A 1IQNL 3ASIA 1NESE 1P3CA 3RDZA 1IQGA 1W7XH 1HXEH 4MNXA 2BDAA 4NIYA 1JIRA 3SU6A 1PQ5A 1HRFA 4ISIH 3TLOA 2BD3A 1XUIA 2BTCE 1IHTH 1RTLA 1S84A 3RXKA 3PO1B 3AW0A 3QZRA 1SGYE 6GCHF 2PKSC 1WOFA 1EJAA 1C5MF 3URDA 2B5TB 1HAHH 3BT1A 1XKAC 3BTWE 3CA7A 1TNHA 2BD2A 3BG4B 1JBUL 5FX6A 1C2FA 2ODPA 3SUGA 1HAEA 1TGBA 3AVZA 1KIGL 1TX6A 3CS0A 1TNGA 1RJXB 5FXLA 1EMOA 3E6PH 3V3MA 2VWOL 1TBQH 4X6MA 1BTYA 4NG9L 4AN7A 3KQCL 1LQDB 1GMCG 5EOKA 4CRDA 2FXRA 1P2IA 3F9HA 2OTVA 4CBNA 3POYA 6COXA 2H5DA 1V2PT 5CKNA 3N8YA 3A8DA 3NKKA 1G9IE 4XBDA 1TYNA 4X8VH 3LJJA 2FTLE 1TALA 2H9TH 1SGNE 2ZIQH 3RLWH 2AS9A 1LHEH 1CQEA 2ZGXH 3DD2H 3A8AA 3MH5A 4ZH8A 1Y3YA 1CCVA 4RRZA 2OC0A 1QR3E 9ESTA 3TK6A 2GD4B 3BIVH 3N8XA 1V2TT 1HLTH 4WF8A 2D26C 5EXMA 2BOKA 5C5NA 4YT7L 2FZZL 3LH3A 2RNLA 1GJAB 4FU9A 1FMGA 1QL8A 1TRMA 1INCA 3RXIA 5SGAE 4Y7AA 1G1TA 1CGHA 4B76A 3PMAB 2BHGA 2PTCE 1PGEA 4OTYA 5A0CA 5L6NH 1LPKA 1GCDA 3SV2H 1VZQH 2ZNKH 1W12U 1UZKA 1VGCB 1QIXB 1LVYA 2BY5X 1GDNA 1IQIA 5E0HA 5JBBE 4NSYA 2BZ6L 4YT6L 1NPEB 2WINI 3VB6A 2XRCA 3W94A 1DXPA 3GYMA 1O36A 3SI4H 4AFQA 3UQVA 3U8RH 4RSPA 2QCYA 3PMBB 4MMYB 1QJ1B 1NRSH 1GBAA 2QXHA 4MG3A 4CREA 1G1RA 4IMZA 4BAHB 3FP6E 3EQ0H 1QL9A 3A81A 2ESTE 5IYTA 1CO7E 1UVPA 4O1ZA 1SLWB 1NTPA 1NZIA 1EKBB 4YLQH 1NFYA 4BAMB 2SFAA 1ZYOA 4B73A 3EA7A 2RA0A 1AFQC 3ATMA 2XC5A 3RXCA 5DP4A 5CKMA 1K1NA 2QGRA 3Q3XA 2FESH 3N7OA 2WFXB 4X8TL 5H4IB 3BTEE 1C5QA 2XCFA 3LPRA 4FVBA 1K28D 1WUNH 3RXAA 1GBHA 1S85A 1LDTT 3WY8A 4ZKSU 3SJ8A 2G00L 3KEEA 4D90A 4PH9A 4AG1A 9LPRA 5L30H 3QH0A 1N6XA 1V2WT 4Y71B 1J16A 1YGCH 5EW1H 1E35B 3DA9B 4X6OA 3E8LA 1AIXH 2ULLA 4F49A 3RMLH 1GVKB 1IHSH 3EA9A 4WY3A 3VB4A 1O5DH 1UCYH 1RRKA 4FUCA 1O2YA 2HNTE 1WV7H 4D9RA 2WPLS 2P3TB 4JK6A 3O8CA 2BOHA 1FY1A 2O9QA 1Q3XA 1XUGA 2KB9A 3A86A 4A6LA 4I7YH 2ZFQH 2VVCA 4CRGA 1Z6EA 1UCYE 4X6NA 3KQDA 1YCPH 3GCWE 3SW2B 1A3EH 1DDXA 1K2I1 3KL6B 1PPCE 2LNCA 5C1YA 2B7DH 1GJDB 3U1JB 3QDZB 1RFNB 2GKVE 3SUFA 4NA7A 4K3JA 2ZA5A 2H9EH 3TJUA 2BB4A 1GJ5H 4Q7ZA 1TOCB 1I0UA 1UTNA 3DHKH 3ZZ8A 1HAXB 5DG6A 4X1SU 1C5XB 1BTPA 1G2MA 4DT7B 2FLBH 4X2XA 2XBWL 3HPTB 4BNRA 3Q7DA 4JZFL 1P04A 2HNTC 1F7EA 1MBMA 2QF0A 1CHOF 1B7XB 2RHPA 1CGIE 2BDGA 2G8TA 1GMCF 4ZHLU 1HCGB 5FHTA 3BT2A 1V2RT 1HAIH 2DDUA 2ZGCA 1SQTA 3OSYA 2ZCHP 3M5MA 2HWLB 2BX4A 1XXDA 1IQLA 4ABDA 2FO9A 1SSXA 1VITG 2WG3C 2PR3A 3R0FA 1BMLA 2C8XB 2Z3EA 1O5CB 4M10A 4GHTA 2AGEX 3RLYH 2SGQE 8GCHF 2F9OA 4IMQA 1C5RA 3CS7L 3OLUA 3GISX 2ZC9H 5FCRA 3PO1C 1WU1A 1K36A 5GWZA 1YPHE 4Y7AB 4CR5A 1C9PA 1AUTL 2B0FA 1VJ9U 4XOJA 3M7QA 3VB7A 1S6HA 1FIWA 1K1LA 4OS1A 1C5YB 3BG4C 1KXEA 2JETC 1G1QA 4IBLH 2HPPH 4YT6H 4MLFB 2FYQA 1F5RA 1LO6A 3O8RA 4DCDA 3GISB 1GI8B 3H7OA 1GJBB 2ZDVH 2VNTA 2C8YB 1W10U 2GMTC 1A7SA 4B2BA 1V3XA 1SLUB 4Y76B 1DXWA 4M11A 5AFYH 1GDUA 3N8WA 2VVUA 3SOBB 2AEIH 1B9WA 1CVWL 2LPRA 2A2QH 5L2YL 1YLCA 2O8WA 1AB9C 1P2MA 2VIDA 2ZGJA 1VJAU 2P3FL 3A88A 4U30A 1H9HE 2TGDA 1A5HA 2PR3B 3FVFB 1YKTA 3IITA 4KTUA 3L6PA 1HAFA 1DDJA 1QNJA 2I6SA 1GBMA 1O5AB 3FZZA 1A0HB 3K6YA 3RMNH 2W2NE 2F9VA 4MMXB 1IGZA 1YP9A 2A5IA 1P0SL 2FEQH 4IC6A 1M1XB 2GT8A 1GBJA 3QX5H 2RA3A 2ZKSA 2H9EL 3SO3A 4FUBA 4UEHH 1T32A 3A7WA 1G3CA 4IGDA 3RXTA 2BOHB 1TGSZ 2CHAB 1LKBA 4CRAA 4JZDL 3E16B 1TGCA 3HO3A 3T27A 3JZ1B 2I9BA 1RGQA 2FP7B 2W3KB 1EZQB 1W14U 1NY22 2WPME 4K69A 3E3TA 1ZPZA 2FMJA 2WG4B 4BAKB 1TPOA 1QRWA 2C4FH 3ATKA 3MI4A 1EZUC 4A1XA 4XSKU 1HV7A 1P2NA 3NUMA 3V64C 3T2NA 3RM0H 3GCXE 1GHAF 2Q1JA 2W2QE 1EQHA 4ZAEA 3SV7A 1O2SA 3D23A 4Y0ZE 4RS0A 1CT4E 1XMNB 3SNCA 1ETTH 5ESBA 1O35A 4ABJA 3LN0A 1F0RB 2Y6TA 1IQKA 1SBWA 1HB0B 2PHBA 2Y38A 1O3OA 1MQ5L 4AG2A 4D0EA 1PJPA 4FUDA 1PYTD 1EPJA 2J4IA 3L33A 2OC1A 2P26A 4I8KA 1A46H 1AMHA 3TH4H 1PPGE 2O8MA 1N7DA 4RRWA 2XTTB 2PUQH 2J9NA 4Y0YE 3KQEL 3U8TH 1C2HA 3AAVA 2OYEP 1LTOA 1P2OA 1QA7A 1C1SA 1G3BA 2WV5A 1XUKA 2P8OB 3KQEA 1T8LA 3QTOH 1NFYB 2O8TA 1DVAL 1EGFA 2B9LA 1IQML 4ZHAB 4CRCA 1FE2A 1NZQH 1X7AC 1ANBA 1D3DB 1O37A 3C27B 1G32B 2VVCK 1G2MB 1IQEL 5EQQA 2OUAA 2ZGHA 1TPAE 2G81E 2VIQA 4X8UH 4ZHMU 2FOMB 2NU4E 3T5FH 1YUFA 2CJIB 4WMDA 3P6ZB 1QRXA 1URKA 1PFXL 4IN2A 1W2KH 3A80A 3BEFB 1BZXE 5EODA 5EQSA 1JXPA 3D62A 3A85A 2J92A 3BTGE 2TBSA 4YESB 1GMDG 3ZYGA 1CHOG 1ID5H 3SGQE 5FAHA 2FTMA 1CE5A 1IQMA 4NA9L 1UK4A 2XC0L 3AASA 1T4VH 3ZZAA 1QBVH 5A8XA 1EP6A 1Y3XA 1AVGH 2FOGA 2WPIS 2OC8A 3NCLA 1A1RA 3NTBA 1AWHB 1VITF 3P17H 2OBQA 2OYUP 1QURH 4XE4A 1RTFB 3RC6A 4MPVA 4JYUH 8GCHG 3ZV8A 3RXHA 4X8SL 2QA9E 3S9CA 4G1MB 3RXDA 3SHCH 1ZMJA 1JMOH 1DIYA 4AGJA 5A0BA 3NPSA 1C5MD 2WV4A 3V7TA 1GI6A 1FSBA 1H4WA 1CT2E 4KTSA 1KLJH 1P09A 1YCPK 1O5FH 1O2HA 4YLUA 2BQ7B 1SHYA 1EPGA 5COXA 1C4Y2 3UOPA 1TFXA 2C90B 3ZZBA 2W3IB 2QXGA 2D1JB 3SI3H 3TGKE 2Y82A 3RXQA 3A7TA 4LXBH 1EPTA 4FUGA 4XFQA 3TJOA 1THPB 2BD5A 4XBBA 1UO6A 5T6DA 1Y3WA 1FAXA 1IQFL 4D76A 5JPMH 4A1VA 1SZBA 3MU4A 5L30L 3O8BA 1C2DA 1LQEA 7GCHG 2XBYL 1GI4A 2Q1JB 1DUAA 1HAYB 1TLEA 2F9UA 3DT0H 2ODQA 3GCTF 1XFEA 4JYVL 1LPKB 2VVVA 1D4PB 1CU1A 4SGAE 3CENA 4H42U 1O3JA 4Y7BB 5CKQA 1J9CH 3T29A 1HBTH 1GJCB 4I8LA 5L2YH 2ZPRA 1GI9B 1W0ZU 1LMWB 4K1SA 1UTPA 4INLA 2QC2A 3HKIB 3SOVA 3GY7A 3MU8A 3P92A 3V0XA 1NFWB 1GJ9B 3OLTA 1S82A 1CVUA 3QMOA 3M5OA 1A61H 4THNH 4KP0A 2ZTZA 3FANA 4Y10E 1V2ST 3BG8A 1EASA 1JRTA 3GCTG 1FY4A 2ZQ2A 1TIOA 2HLCA 1RFNA 2ALVA 3HO4A 4ABIA 1EJMA 4UONA 1TRYA 2UUJB 2G4UA 2G4TA 2GMTB 3SOQA 4TGFA 3SUEA 5J4SA 2JH6D 1JV2B 1GMHG 5JB9E 2FIRH 2GZ9A 1AB9B 3OY5U 1TLDA 5CMXH 1AGJA 1DWCH 1PYTC 2ZFRH 3RXLA 3GY6A 2GCTB 2W2ME 2TRMA 3PLPA 1GHAG 2PKAA 3ELAH 1AZ8A 2Y5GA 2M74A 2VWNA 4KKDA 5I25A 4ISOA 3SGAE 1A5GH 1C5VA 3BEUA 2H5CA 1C1NA 1P3EA 1T7CA 1ZPBA 3PGHA 1ZPCA 5EGMA 5E2OA 3SNDA 3ZZ7A 3QWCH 2AGGX 4BDWA 1Y5BT 1LPGA 1KTTB 1MTNC 2XC0A 4XBCA 2QAAA 1NO9H 2VGCB 1P11E 3ODFA 1AI8H 1OP2A 1WU1B 2ANMH 1HREA 1K1IA 3ESTA 4MTBA 2Y80A 1BTZA 1NPMA 4NCYA 1G2LA 3KIDU 4Y8YA 1GHYH 1MH0A 3KGPA 1GJ7B 3OX7U 1WQSA 1EAWA 2FD6A 4AYVB 1DY9A 4ZKOU 1DICA 5E0JA 3H5CB 4OS4A 1KXFA 2EA3A 5GDSH 1OP0A 3BTME 1V2QT 4WJG2 1SFIA 4X8VL 2BOXA 3S9AA 1YPGH 2C8WB 2FM2A 1OWJA 3Q76A 2GTBA 1U6QA 1NRPH 2G00A 2TIOA 1T4UH 3A82A 1FPCH 2J38B 5DPAA 1C1MA 2WPLE 1SOTA 4CRBA 2VWNL 1MQ5A 2Z3CA 3GY5A 1GHVH 2UUKB 4YOGA 3RMMH 3I77A 1IQEA 4I33A 3U1IB 2ZFTA 1E38B 1PXXA 1MUEB 2C93B 3SNBA 3RU4T 2MGPA 3Q3KA 2ILNA 2CF9H 2C8ZB 5JW1A 1MQ6A 1EP5A 1ETSH 1WQVH 1KLTA 5EPYA 2ZHDA 1O39A 2AMPA 3TVJB 1H9LB 1GJ6A 3E0PB 2ZHQH 2BZAA 4TWYA 2ADXA 2VVUL 2Q6GA 1GWAA 5EPNA 3VB5A 3KCGH 3NK8A 2P3FH 5HM9A 1BOQA 3S69A 4HFPB 2PGQB 2VWOA 1CGJE 1LHCH 3G01A 4OS2A 3N8WB 4FUEA 4X1PU 1OB1C 5IKTA 1S83A 1UCYK 5A8YA 1LPZB 3ELAL 2FODA 4NIVA 1YPEH 3A8BA 1FNIA 4NGAL 2BQ7A 2FS8A 1FJSL 4OGXA 1XVOA 1SHHB 1THSH 1MBQA 1OWIA 3QCWA 1ZSJA 3A8CA 2FOFA 4YZUB 1QB6A 2BD4A 2KAIA 4J1YA 2GT7A 3K9XB 5JB9S 4Y71A 1A0JA 1BDAA 5GCHF 1KLIH 1W7XL 1EX3A 3SNAA 2PKSB 1YM0A 4WH8A 1ZSKA 4FU7A 3U8OH 4KGAA 3MMGA 4D0FA 3MNXA 4K5ZA 4Y8ZA 2XYAA 4B75A 1O34A 2FLRL 1XXFA 1IQFA 2ZDKA 1C4V2 1XUJA 3NZIA 1BIOA 3S9BA 3EGKH 3PV4A 2ZQ1A 1O2IA 3F1SB 3GDVA 1V2KT 1ZRBA 1Z8RA 2K1QA 1FDPA 2VH0A 1H8IH 1IQLL 1FAKL 1GPZA 3LH1A 1LHFH 1GHBF 2A7JA 2BD7A 2WPMS 2XC5L 2A4QA 2P95A 1C5ZB 3RXVA 1F0UA 2ZDLA 3A83A 2F9BL 1O33A 1F7MA 3ITIA 5T6GA 1O0DH 3RXGA 3KCGL 1UTLM 2Y5HL 3GOVB 3NWUA 2QV1A 2Y80B 3KQBL 1WAYB 4CH8B 1BJUA 1K1JA 3C1KA 3K9XA 2THFB 1TB6H 4IS5A 3MO9A 3SN8A 6GCHG 3GY4A 2PSXA 1SI5H 3LC5B 1SGDE 2OQUA 2Y7XB 4UFFH 2B7DL 5AVDA 3ZVAA 1MQ6L 3Q00A 1LHGH 5JVYA 1YPKH 4Z0KA 5C3NA 4K1EA 1EJNA 1UHBA 1GHXH 1NFUA 4KTCA 1QGFA 2XW9A 2XBXA 1BRAA 4YO9A 1EZXC 4Z0LA 5JB8E 3P8NA 1P01A 2G52A 3PLKA 3QZQA 1Z1IA 1HAVB 3TZIA 1AHTH 4ZXYH 2R0KA 5EU8A 3HS7A 1TWXB 1VGCC 1KLOA 1SGTA 4WMEA 3U69H 3ATIA 3RXRA 1HJAB 1KLJL 1NT1A 3SQEE 4COXA 3ZZCA 3M7TA 1C2EA 1ZMNA 4Q7XA 1PTHA 1P9JA 3LTFB 1TMUH 4JCNA 3BTKE 1G3DA 4K2YA 3JZ2B 4NWKA 8ESTE 5F8ZA 1V2OT 2ZU5A 4AB8A 1P12E 1T8MA 1V2JT 2J94B 2Z9GA 2EEKA 1TNJA 1YUKB 2P28B 1MOXC 1A4WH 1C1PA 4CSYA 3OY6U 1ATDA 5F19A 4CRFA 2EI6B 1AFQB 1O3PB 5K7RA 2P3FN 1GG6C 3CFWA 2V6NA 4MPXA 5EXNA 4D7FA 5DP3A 3BN9A 3ZZDA 1FAKH 2OQ5A 4ZXXH 3OYPA 1GVZA 4FVDA 3RM2H 3TITA 1O3BA 1SLXB 5T6FA 1O2QA 1ZJDA 1UTMA 2VINA 2WPIE 2Y7ZB 1HAVA 1Z71A 5DP7A 1CA0C 4CHAB 3DUXH 1X7AL 2GV7A 3ATLA 1DM4B 1K1OA 5C20A 5DP5A 1AUTC 1BTWA 1YO8A 1MTNB 2GVFA 1SOZA 3TGJE 1H8DH 1SGFG 1WYKA 4FXGH 2OD3B 1Q4GA 4GVUA 2UWLB 2WYJB 1CX2A 1OOKB 3RXJA 1ELGA 2O8LA 3NXPA 3TU7H 4HZHA 1FN8A 3BTDE 2VJ1A 3U9AH 3ZVCA 2XCNA 2ZFSA 2BVSH 2YGOA 1V6DA 3SU0A 4ABFA 2EI6A 3BF6H 3M3SA 4UE7H 3SZNA 1F92A 3RXMA 1ADXA 2Y81B 3GY3A 1J9CL 4U01A 5JBCS 1P02A 2BDHA 4MNYA 3BEIB 1G37A 1C5LH 1P05A 2ZTXA 4XL1A 1J14A 3RR3A 3P8FA 1C5TA 1Z6EL 4R0IA 2CV3A 2R3UA 1ELEE 1QA0A 1BMAA 1NFXB 5HXFA 3HATH 1DQBA 1XX9A 4O97A 3MYWA 5GCHG 2P94A 1EUFA 3TGIE 2ZU4A 3K65B 2B8OH 4X6PA 1TPGA 3D49H 4B71A 5DP8A 1Q31A 2Y82B 8KME2 3LU9B 3GCOA 3M37A 5CISA 2QF3A 1SQOA 3ENSB 3HS6A 3FFGA 4O03A 1HJ7A 4WXIA 2D8WA 4U32A 2Z3DA 4Z6AL 1NU7B 1COUA 1HNEE 1LHDH 4GHQA 4ZKRU 1ZTLA 4RRYA 1ZSLA 1B0FA 1BRCE 4UFEH 1F2SE 4JZEL 5JB8S 2BMGB 4UD9H 2Y81A 3BTTE 3LC3A 1O3MA 1NU9A 1IQHA 1UVTH 2J95A 3Q77A 3KHVA 2NU0E 1KDQA 1ZHMA 4NG9H 4JZ1A 3MQEA 1ABIH 1GCTB 4XLWA 2A0QB 3FP7E 1QB1A 1EQ9A 2WPHE 3DFLA 1NRRH 3A7XA 4RKJB 1C1WH 1SGFA 2XNIA 4ZH8B 1P2JA 1Y5UT 2ZGBH 1SQAA 2KL7A 1E36B 1OP8A 2J34A 4Q80A 4Y6DB 1XM1A 2R0LA 4Y79A 4XDEA 1ELFA 1RTKA 1BUIA 1DPOA 4NFEA 5GIBA 1W11U 2AMQA 1PPHE 2V3OH 1B0EA 1O5BB 1UHBB 3ENSA 1EQGA 3M5LA 2BOUA 4B1TA 2BLWA 1C1OA 1C1TA 2W7UA 1EPIA 3BSQA 4BTIA 3TK6B 1O5GH 3ZZ4A 5IDKA 5JBBS 4BOHA 3ZYEA 3CENL 2F3CE 2ZO3H 5A0AE 4TYDA 1K37A 1ZRKA 1F5KU 4NIXA 3V13A 1QFKL 4BDXA 3SNEA 1QJ7B 3LGIA 2BQWA 3QGJA 3BIUH 2GGVB 4X2VA 1AZZA 1UVSH 2J94A 3MH6A 3UFAA 1MMJN 3UNSA 4MPWA 1HT8A 3SGBE 3MU1A 3K2UA 2ZF0H 1AD8H 1VCWA 1LPZA 1O5EH 3HGNA 3VXFH 1PQ8A 5IKQA 2ZCLP 1CBWB 1F0SA 5LH8A 2MGRA 2P94L 1U8CB 3R3GB 1QCPA 1AKSB 1BF9A 3LGVA 2ASUB 4AFSA 3PMJA 1SFQB 1L3YA 1OWDA 2HGTH 1CT0E 1DWDH 2AFQB 2VIOA 4ABBA 1HIAA 1MU6B 2P16A 1MD7A 1LCYA 4JZIA 1F0RA 1QQ4A 5A8ZA 1G1SA 2AIQA 1ANCA 3KRKA 1ABJH 1L4DA 4K8BA 1NFUB 1EBVA 4DIHH 2BQWB 4A7IB 3N8YB 3A84A 3E0NB 5FBEA 1TAWA 2OXSA 4Y11E 1GGDB 2GD4A 5FPYA 1V3XB 2BO2A 4FM5A 1AWFH 1FY3A 1HJAC 2GCHG 5F1AA 1UTKA 4ISLA 2OCVB 5FDQA 1O2OA 1YCPM 1EOJA 1G3EA 1KYNA 4MQAA 3SW2A 1TPSA 1HAPH 3STJA 3PWCA 2Z7FE 4MNWA 4E7RG 3PM3A 1AU8A 2BXUH 2RG3A 3U7UG 3MNCA 3KQBA 2FOBA 3SQHE 4BAQB 5A2MH 2STBE 2BY7X 1O3CA 2GZ7A 1Z8JB 4DURA 1KY9A 2JKHL 1DLEA 1V2MT 1GG6B 2BVRH 4X8SH 1VR1H 1GBTA 4NIWA 1WSSH 3P8OA 1TABE 4X1QU 1IQJA 4TPIZ 1PPFE 1TQ0B 2IN2A 4ABEA 3TH3L 2ZU3A 4RN6A 1UJ1A 1GI2A 3NT1A 4CH2B 1CA0B 2A4GA 4CHAC 1YPHC 2SGPE 1DANH 4GPGA 1CVWH 1W13U 1O2WA 1EB2A 1HAOH 1C5SA 3GCNA 2UUFB 1IGXA 3QGNB 1EB1H 1O2LA 3T62A 2UUYA 2OC7A 1P8VC 3BV9B 2PGBB 2GV6A 1EPHA 4UFGH 3QLPH 4MDSA 1NC6A 1VCPA 2BLQA 1Y3VA 4INKA 4DOQA 4X8UL 1ELDE 4AB9A 1O2GH 4FUIA 1Y5AT
chains in the Genus database with same CATH superfamily
2BM2A 4LZ1H 5B6OA 1O3LA 2VVVL 3GDSA 1MTVA 3T26A 2ODYB 4AZ2B 2UWLA 2WYJA 2YGQA 1W7GH 3SU3A 3ZYDA 2IJOB 1H1BA 2J97A 4RKOB 4Y79B 1W0JD 3LONA 3P8GA 1YWUA 4AC9A 5EG4A 1N1LA 1GK5A 5IKRA 5LPFA 1C2GA 3U98H 1P2QA 3ZVFA 3QN7A 3KQDL 3F0PA 3LIWB 4DY7B 2TPIZ 1AUJA 1HX2A 2J2UA 3K6ZA 1G36A 3HKJB 1IQIL 2FX4A 3FZDA 4OS5A 3TJNA 2Y5GL 1DWEH 2P93A 3M61U 2CGAA 1J8AA 3SJOA 2BY8X 1MKXK 4P00A 5T1VA 1L1NA 1HT5A 2XBVL 1BJVA 1ANDA 1LVOA 1O32A 3W95A 3MU5A 7KMEH 3AAUA 4O3UA 2NU2E 1DX5M 2FWWA 5F8XA 1P2KA 2IPHA 3SU2A 4Y7BA 1ZMLA 1HAGE 1GBEA 5C94A 1GMDF 3TK9A 1AE8H 1GI1A 4DW2U 3H09A 4AQTA 4IW4E 1WXRA 4OS6A 3FKSD 4O02B 2ZTYA 2XWAA 1QTFA 4YM9A 2FOAA 1J15A 7LPRA 2R2WU 5LPEA 1UZPA 4FUJA 4Q7YA 4JYVH 1HZ8A 5GPIB 2PWXA 3GICB 1DSUA 2P95L 2TGAA 4FU8A 2F43B 4AFUA 3F6UH 1TX8A 2LP6A 4OGYA 1K9OE 5F6MA 4X1NU 1IQHL 3KQ5A 1EMNA 2BSFA 4UFDH 1UK2A 3LOXA 5ESTE 3LKWA 3STIA 1GCTC 2QN5T 2W26B 5AHGH 1D9IA 2WPJS 5EW2H 2IOTA 3MNBA 2EI8A 2R3YA 1TX7A 2CK3D 1IQJL 2BD9A 1BRBE 3RXUA 1ZLRA 1C2JA 4JZDH 4WMFA 3LGTA 4B2CA 4VGCC 1H8HD 5AFZH 2XOKD 5C1XA 1L1GA 2JKHA 1GVLA 2UWPA 1OXGA 1C5UA 4WVPE 1L5GB 3VGCC 4NZLA 3AK5A 4INHA 1RD3B 3BTHE 3PRDA 1P0SH 3SU1A 2D2DA 2EY4C 1TNLA 3GY2A 1A2CH 4DVAU 1YF4A 1EPTC 1EZQA 1UTJA 2BDIA 2HVXA 1O2VA 2V0BA 2H9HA 1MTWA 5KN5C 1TA2A 1BTHH 3EAJA 2HOBA 1BMNH 1TGNA 2YNAA 2ZEBA 6LPRA 1H9IE 4NA9H 2W3KA 1FX0B 2BDYA 1XDTR 1QY6A 2H6MA 1SGIB 2EI8B 1ELTA 2KM0A 4WH6A 1DUEA 5JBAS 4E05H 2ZG0H 1SC8U 3TH2H 1ARCA 2ZHEH 3FCSB 1K1PA 3AW1A 3ZV9A 1IAUA 1BHXF 3DCLA 1Z8IB 3PTNA 3MO6A 1SGPE 3F9GA 1C5NH 1IQNA 4ISIL 1FPHH 5HYOA 2KR7A 5DO4H 2F9BH 2XBVA 1L2EA 2YMSD 2ZECA 1XKAL 1AO5A 1O31A 3P95A 4HI3A 1TOMH 2KZ4A 1O2TA 2VGCC 3FO8D 1Z7KA 1OKXA 2ZU1A 5CHBA 3KF2A 2BQ6A 3UQOA 4ZROA 1ZTKA 4RRXA 1UTQA 3SV9A 1NT0A 1ZGIA 3PB1E 1HXFH 1E0FD 5KIRA 1N8OB 2DE8A 2VJ3A 4DGJA 1Q2WA 1E34B 2A5AA 1EXFA 4XBMA 3UTUH 2G5VA 1G30B 1GDQA 4H6TA 1MTSA 3TJVA 3ZZ3A 2BYAX 1EAXA 4A5TS 5B6LA 1DX5I 1OWEA 1IOEA 2GDDA 1UMAH 3SJIA 2BDBA 3EA8A 1BCUH 1MD8A 3PROA 4M7GA 1VCQA 3L3TA 4Z1MD 1O3FA 2F9PA 3LDXH 2V35A 1C5PA 1NBME 4LMFA 4X2WA 3LC3B 2A4OA 1L1JA 3UIRA 1ATEA 4CUFA 1BBRE 3FAOA 2F9NA 1SGQE 2GX4A 2JH0D 2AMDA 4HG6A 2A31A 2HNTF 4TY7A 1BITA 3RXSA 4YT7H 3P70B 4FUFA 1Y3UA 4Y76A 2UWOB 3UUZA 5I46H 1HGTH 2F91A 1C5WB 1RIWB 4K1TA 2MHPA 2XC4A 1HPGA 1SVPA 1BA8B 3MHWU 1YPLH 2KNIA 1GBLA 3OTPA 2AYLA 1O3EA 1C1UH 1ZAQA 1O2UA 1OWKA 5F03A 3ZYJB 3I78A 1P03A 1U67A 2PUXB 3M36L 1GBIA 1IJQA 3IITB 3R05A 3PWBA 1LMJA 1TA6A 3LIWA 1FY5A 1HRTH 3HK3B 2A7HA 2CXVA 3GDUA 1S6FA 4Z6AH 1O3KA 4TWWA 5G4BA 2ANWA 2P3UB 2XBXL 5E8DA 2A7CA 3D65E 4ISHH 4WWYA 1TGTA 3SU4A 4NSVA 3VEQB 3UR9A 1CHGA 1O3HA 4OTJA 1HYLA 3CNRA 1UZJA 2BOKL 1KIGH 1NQLB 1KDQB 1ETRH 2A5KA 2BLVA 2JH5D 4DJZB 1RXPA 2VU8E 2VH0B 2Z9LA 4NWLA 1TONA 4GUXA 1FJSA 1OSSA 5LGOA 2GP9B 3HS5A 4F4OC 3M37L 1TMBH 5JBCE 1QBNA 2CMYA 7ESTE 3B23B 1ANEA 1PPZA 1LMMA 3TBDA 1BBRH 1F0SB 3F6UL 3P5BL 1O38A 2WPHS 4GCHG 5PTPA 4SGBE 4Y6DA 4AX9H 1WHFA 1LVBA 5GJ4B 1MZDA 1O3IA 3EGFA 8LPRA 4O9VA 1WHEA 2GZ8A 1W8BL 1O2XA 2EQNA 1NRNH 4HTCH 3I29A 3M36A 5TJXA 1KXDA 3M3TA 2PHBB 1SGEE 1EAUA 4BTIB 2W5EA 2YNBA 6CHAB 2Y7XA 3BPSE 1TPPA 1D3QB 3LC5A 4MMZB 1GHWH 2KV4A 5KEDA 2PKAB 3LN1A 1DFPA 3MDLA 4E1GA 1NFWA 2SGFE 5HGGA 7GCHF 1W0YH 1O3DA 3A7VA 1Z1JA 3UNRA 4PROA 4TPYA 2W7SA 3DFJA 3M35A 5C2ZA 1NFXA 1UW7A 1V2VT 1DT2A 2BQ6B 4Q2KA 1C9TA 3TK5B 2PLXA 1KLIL 2TGPZ 2EI7A 3LAQA 1MKXH 1AQ7A 2BLOA 1P10A 4UDWH 2KCAA 2ZFFH 3OEED 5K0HB 2A1DB 5EGMB 5JYIA 2Y5FA 1HIAB 3KNXA 3OTJE 5DJ7A 1GI0A 2BX3A 2RDLA 1OYTH 3F0OA 3S0NA 1SL3A 1F0TA 2VH6B 3HGPA 3LGYA 5CHAB 2VIVA 2VWMA 5T3HA 1DY8A 1T8NA 3BTQE 2G5NA 4BTTB 1PFXC 1SLVB 3VG8A 2FPZA 3ZIAD 2BMGA 2G55A 1SGRE 3PMHB 3EDXB 5FX5A 1APQA 4X2YA 4ZKNU 1AVXA 1GJ4H 1MTUA 2ZPQA 2AH4X 1ELCA 3HPTA 3TIUA 1OX1A 2F4LA 1P57B 3LT3A 2W3IA 1XUFA 4ZUHA 4CR9A 3GCHC 4VGCB 3LGWA 2HALA 3T28A 2TGTA 3FP8E 4QT8C 2ZP0H 2F83A 3MTYA 1P9SA 1ZJKA 2JETB 2W86A 5L2ZH 1W3CA 3RC5A 3VGCB 3RXBA 2FDAA 3KQCA 1YPMH 1SKYE 1LQDA 1ZTJA 2H1UA 4GAWA 1TOZA 3ZVBA 1ACBE 1SGCA 2QE7D 1BMMH 2Y7ZA 1DE7H 3LGUA 3EE0B 1EPTB 1TRNA 3ODDA 1DWBH 1FZZA 3VFEA 3SU5A 3S7HB 1TQ7B 4BAOB 2HPQH 5C1UA 4HGCA 1S5SA 2FI4E 2CN0H 4ABAA 1G2LB 5JVZA 1GBFA 1SB1H 1WTHD 2DUCA 3MFJA 1A0LA 2DE9A 3ZZ9A 1A5IA 1KXAA 5GXPA 2FX6A 1OPHB 4I8JA 2TGFA 1JIMA 1C2MA 5JBTA 2WPKE 3MNSA 3ZYIB 1P06A 3W1EA 1V1IA 1C1VH 1VITH 2L74A 1CEJA 3S6XA 2YOLA 2UWOA 1T31A 5L2ZL 4O3TA 4J2YB 4BANB 2I9AA 2ZCKP 3KYGA 1CA8B 2PSYA 2J2UB 1GJ8B 4DIIH 1Y59T 5EXLA 2OINA 1MZAA 2CHAC 1C2IA 1MCVA 3RMOH 1NM6A 4CUEA 1QB9A 1FAXL 3UNQA 3MWIU 3N8VA 1ZOMA 1N8OC 3F68H 2BY6X 3F9FA 4Y8XA 3LTGD 2Q6FA 2QIQA 5ETXA 3T25A 1S0QA 2CJIA 2JJ1D 2K0QA 3QTVH 4YOIA 1AN1E 3RXEA 4AYYB 1GL1A 2PV9B 2FI3E 1Z6CA 2YGPA 2L6OA 1EFRD 4GSOA 4YOJA 2A45B 3SJ9A 4BTUA 1EZSC 1C5OH 1ELBA 4AFZA 1QFKH 4K60A 4CBOA 1LPGB 1MCTA 3E90B 1YLNA 3M3VA 3TK5A 2WYGB 3RXOA 2ZU2A 1SR5C 2BT7A 1HAZB 2FI5E 1GBCA 1ESTA 2KAIB 3HO5A 1JL9A 2K2SB 1ESBA 1WCZA 4D7GA 4TY6A 4CUDA 1RIWC 2WUBA 2PUQL 3V65B 3SOSA 1IQGL 1BTUA 1DSTA 4ZAEB 2SNVA 3IG6B 4B74A 5BPEA 1FFMA 2Z9KA 1DVAH 2M5TA 1FN6A 4GCHF 4I31A 2P8OC 2BY9X 1KXBA 1P9UA 3O8DA 4ZXXL 4RUTA 2VIWA 1HCGA 1GI5A 1YPJH 4YTAA 2Z9IA 1GBKA 3PTBA 1XUHA 2YMSB 3TH3H 4E06H 2RCEA 4MNVA 3UPEA 1XKBA 5K0HA 1S81A 1HJ9A 5E8EH 4ZCNA 6ESTA 4LOYH 4H6SB 2V3HH 1L0ZA 1YBWA 3GYLB 1XVMA 3TNTA 4C16A 1DLKB 4JK5A 2H2ZA 3F2HA 1ZHRA 1FXYA 2PW8H 4FUHA 2SNWA 1J17T 1TE0A 2A2XH 3VB3A 3CP7A 1CQQA 1DITH 1O2PA 1FONA 1SMFE 4AOQA 1KSNB 1N6YA 1ESAA 1YYY1 1MAXA 3URCA 1F5LA 2OBOA 1ELVA 1C1RA 3B8JA 4IC5A 4NZQA 1D3TB 2VWLL 1NROH 4I8HA 1F7ZA 3GY8A 1DOJA 2WPDD 2UWPB 1O2JA 3FBYA 1TNKA 2ANKH 3ZVEA 1HFDA 3KN2A 4ZXYL 1PPEE 3LJOA 1MKWH 4MVNA 1XKBC 5E0GA 5EQRA 2R2MB 1O3GA 1QBOA 1UVUH 1AFEH 3SORA 2FS9A 2I6QA 4BTTA 4GLYA 1JOUB 2Y5FL 1PQ7A 1TBZH 2EC9H 3ZZ5A 2BD8A 1O3NA 4LORA 1T8OA 1C4U2 3PYHA 1E1RD 2O8UA 2QXJA 2WPKS 1APOA 5F8TA 3UR6A 1MAYA 3KL6A 4DG4A 4ESTE 1YUGA 1OS8A 2AERH 3MO3A 3A7YA 4JYUL 1V1HA 5FPSA 2NPRA 1AVWA 4H4FA 6CHAC 1IQKL 4WXVA 2AHME 2HRVA 2VWMK 1C2KA 3RU4D 3RC4A 1O2ZA 2AGIX 1QHRB 1MU8B 3IJEB 2P59A 1N1IA 2NU1E 2P93L 3A7ZA 2JJ2D 5FBIA 1A3BH 2XXLA 2VB0A 2G51A 1PRHA 4XD7D 4ABHA 3NJPC 1A3PA 3CS7A 3MH4A 2ZFPH 2WFTA 1O30A 1UZQA 3QO6A 3C9AC 4A7IA 1CBWC 3OU0A 1Z6JH 2W2OE 4R8TB 5FL7D 2QF5A 3V12A 1BTXA 1ELAA 1HDTH 1ZHPA 1ZZZA 5CHAC 2RA0L 1GMHF 5HM2A 2SGAA 4D8NA 2KCPA 3SBKA 3SUDA 3MH7A 1EAIA 1Z8GA 2QYIA 4LZ4B 1UTOA 2Z94A 3E91A 1FIZA 1D6RA 2STAE 5FPTA 2A32A 1COWD 1D6WA 2WYGA 1O3AA 1WTGH 3B9FH 2D1JA 1BT7A 4K8YA 3UWJH 1OYQA 2WZQA 1BQYA 2XNDD 1FQ3A 4BXSA 2GDEH 1EAIC 2C3SA 3PLBA 4B2AA 2W26A 1O2NA 3RXPA 1NRQH 3GCHB 2SGEE 4AGKA 2FOCA 5IKVA 1GGDC 4IN1A 1W8BH 3UY9A 3SV8A 1AY6H 5TCCA 4ABGA 4D9QA 2A4RA 1SPJA 3VPKA 1L4ZA 2R9PA 3QUMP 1TBRH 4JZFH 2Z9JA 3U73A 4KELA 3SHAH 2NU3E 4Z0KB 5E2PA 4X0WU 2VWLA 2ZDAH 1TNIA 2QY0B 2FLBL 3KYFA 1NS3A 2ZHWH 5C5OA 1FV9A 2XBWA 2J38A 1HJ8A 3FFGL 2ZPSA 1LKAA 1S0RA 1KXCA 1M9UA 2XWBI 2BXTH 3MU0A 3ZVDA 3NTGA 1UVOA 1YLDA 1D3PB 2FOHA 2GCTC 5DGJA 1QL7A 2SGDE 1WBGB 2WUCA 3M7UA 1FLEE 5DKMA 2ZDMA 3Q3KB 1O2KA 1PPBH 1B5GH 1KSNA 1LVMA 1GI7B 1AKSA 4JYTA 3PV5A 3MOCA 3SJKA 3WWBA 5C67A 1THRH 4JZEH 3EYDA 3RP2A 5DK1A 3IWMA 4LK4A 1CCFA 1GBBA 3UAIC 1NN6A 1ZGVA 1V2NT 2ALPA 3S7KB 5BRRE 1GHZA 3SV6A 1BB0B 2J95B 2K2TA 5JBAE 1K1MA 2ZI2H 5CE1A 2GCHF 2Y5HA 4A92A 3UOUA 3RXFA 5FCKA 1O2MA 3TGFA 3M5NA 3RUOA 4ASHA 2P3UA 1K21H 5LPRA 1V2UT 3H7TA 2GJGA 4ISHL 2XC4L 4ZMAH 2NWNA 1BBRK 3TNSA 1QQUA 2P3TA 1MKWK 1JRSA 2PFEA 5I46L 1BRUP 4U2WA 4X1RU 5J4QA 3F9EA 1YGCL 1FUJA 4AORA 1FI8A 2V7QD 2QXIA 1EOLA 2OP9A 2Q6DA 3KK6A 1ORFA 1QRZA 2P16L 1Y8TA 2FYRA 2ZDNA 1UK3A 4I32A 2VIPA 2PTNA 2ZHFH 4YZUA 2ZZUH 2FZZA 2FLGA 4BXWA 2PP6A 4NA8A 1O5DL 1ARBA 1DS2E 1O2RA 2ZWLH 4DT4A 5JDUB 1GBDA 3E1XB 1ZR0A 1FY8E 4OS7A 2J4IB 1JBUH 3TPIZ 1C2LA 5DP6A 5HMAA 1ATAA 4ISNA 5A09A 1TMTH 3DEMA 4BTUB 1IP0A 1BHXB 2BDCA 3ATWA 1V2LT 2CF8H 4I8GA 3VXEH 2J34B 1SG8B 2WPJE 2ANYA 1C1QA 1KTSB 1QJ6B 1RS0A 4NFFA 1IOEL 2XBYA 4E7NA 3UWIA 5AF9H 2EI7B 1EATA 4I86A 4X8TH 1AE5A 1K22H 2OLGA 3N8ZA 1IOXA 1GL0E 1OWHA 5C0UA 1HUTH 3BTFE 3A87A 5TCAA 1GI3A 1CSOE 4A1TA 3HK6B 1ATBA 3Q3YA 2BZ6H 1PQAA 4ZHAA 3ZVGA 3QK1A 1IVOC 3RU4E 2AYWA 2FOEA 3N99A 4MPUA 3A89A 5DP9A 1FF7A 2AIPA 4JMYA 4NGAH 2Z6BD 3OAAD 2FLRH 1GHBG 1E37B 3UREA 1JWTA 1YC0A 3ZZ6A 5ABWA 2W2PE 2BVXH 2VH6A 1IQNL 3ASIA 1NESE 5KECA 1P3CA 3RDZA 1IQGA 1W7XH 1HXEH 2JJLA 2BDAA 4MNXA 4NIYA 1JIRA 3SU6A 1PQ5A 1HRFA 4ISIH 3TLOA 2BD3A 1XUIA 2BTCE 1IHTH 1RTLA 1S84A 3RXKA 3PO1B 3AW0A 3QZRA 3FOAA 1SGYE 6GCHF 2PKSC 1WOFA 1EJAA 1C5MF 3URDA 2B5TB 1HAHH 3BT1A 1XKAC 3BTWE 3CA7A 1TNHA 2BD2A 3BG4B 1JBUL 5FX6A 1C2FA 2ODPA 3SUGA 1HAEA 1TGBA 3AVZA 1KIGL 1TX6A 3CS0A 1TNGA 1RJXB 5FXLA 1EMOA 3E6PH 3V3MA 2VWOL 1TBQH 4X6MA 1BTYA 4NG9L 4AN7A 3KQCL 1LQDB 1GMCG 3OE7D 5EOKA 4CRDA 2FXRA 1P2IA 3F9HA 2OTVA 4CBNA 3POYA 6COXA 1KMHB 2H5DA 1V2PT 5CKNA 3N8YA 3A8DA 3NKKA 1G9IE 4XBDA 1TYNA 4X8VH 3LJJA 2FTLE 1TALA 2H9TH 1SGNE 2ZIQH 3RLWH 2AS9A 1LHEH 4ACBA 1CQEA 2ZGXH 3DD2H 3A8AA 3MH5A 2HLDD 1Y3YA 4ZH8A 2W6JD 1CCVA 4RRZA 2OC0A 1QR3E 9ESTA 3TK6A 2GD4B 3BIVH 3N8XA 1V2TT 1HLTH 4WF8A 2D26C 5EXMA 2BOKA 5C5NA 4YT7L 2FZZL 3LH3A 2RNLA 3FN8A 1GJAB 4FU9A 1FMGA 1QL8A 1TRMA 1INCA 3RXIA 5SGAE 4Y7AA 1G1TA 1CGHA 4B76A 3PMAB 2BHGA 2PTCE 1PGEA 4OTYA 5A0CA 5L6NH 1LPKA 1GCDA 3SV2H 1VZQH 2ZNKH 1W12U 1UZKA 1VGCB 1QIXB 1LVYA 2BY5X 1GDNA 2J98A 1IQIA 5E0HA 5JBBE 4NSYA 5DSFA 2BZ6L 4YT6L 1NPEB 2WINI 3VB6A 2XRCA 3W94A 1DXPA 3GYMA 1O36A 3SI4H 4AFQA 3UQVA 3U8RH 4RSPA 2QCYA 3PMBB 4MMYB 1QJ1B 1NRSH 1GBAA 2QXHA 4MG3A 4CREA 1G1RA 4IMZA 4BAHB 3FP6E 3EQ0H 1QL9A 3A81A 2ESTE 5IYTA 1CO7E 1UVPA 4O1ZA 1SLWB 1NTPA 1NZIA 1EKBB 4YLQH 1NFYA 4BAMB 2SFAA 1ZYOA 4B73A 3EA7A 2RA0A 1AFQC 3ATMA 2XC5A 3RXCA 5DP4A 5CKMA 4RT1A 1K1NA 2QGRA 3Q3XA 2FESH 3N7OA 2WFXB 4X8TL 5H4IB 3BTEE 1C5QA 2XCFA 3LPRA 4FVBA 1K28D 1WUNH 3RXAA 1GBHA 1S85A 1LDTT 3WY8A 4ZKSU 3SJ8A 2G00L 3KEEA 4D90A 4PH9A 4AG1A 9LPRA 5L30H 3QH0A 1N6XA 1V2WT 4Y71B 1J16A 1YGCH 5EW1H 1E35B 3DA9B 4X6OA 3E8LA 1AIXH 2ULLA 4F49A 3RMLH 1GVKB 1IHSH 3EA9A 4WY3A 3VB4A 5HIYA 1O5DH 1UCYH 1RRKA 4FUCA 1O2YA 2HNTE 1WV7H 4D9RA 2WPLS 2P3TB 4JK6A 3O8CA 4Q63A 2BOHA 1FY1A 2O9QA 1Q3XA 1XUGA 2KB9A 3A86A 4A6LA 4I7YH 2ZFQH 2VVCA 4CRGA 1Z6EA 1UCYE 4X6NA 3KQDA 1YCPH 3GCWE 3SW2B 1A3EH 1DDXA 1K2I1 3KL6B 1PPCE 2LNCA 5C1YA 2B7DH 1GJDB 3U1JB 3QDZB 1RFNB 2GKVE 3SUFA 4NA7A 4K3JA 2ZA5A 2H9EH 3TJUA 2BB4A 1GJ5H 4Q7ZA 1TOCB 1I0UA 1UTNA 3DHKH 5EJLA 3ZZ8A 1HAXB 5DG6A 4X1SU 1C5XB 1W0KD 1BTPA 1G2MA 4DT7B 2FLBH 4X2XA 2XBWL 3HPTB 4BNRA 3Q7DA 4JZFL 1P04A 2HNTC 1F7EA 1MBMA 2QF0A 1CHOF 1B7XB 2RHPA 1CGIE 2BDGA 2G8TA 1GMCF 4ZHLU 1HCGB 5FHTA 3BT2A 1V2RT 1HAIH 2DDUA 2ZGCA 2IPQX 1SQTA 3OSYA 2ZCHP 3M5MA 2HWLB 2BX4A 1XXDA 1IQLA 4ABDA 2FO9A 1SSXA 1VITG 2WG3C 2PR3A 3R0FA 1BMLA 2C8XB 2Z3EA 1O5CB 4M10A 4GHTA 2AGEX 3RLYH 2SGQE 8GCHF 1MABB 2F9OA 4IMQA 1C5RA 3CS7L 3OLUA 3GISX 1BMFD 2ZC9H 5FCRA 2VRSA 3PO1C 1WU1A 1K36A 5GWZA 1YPHE 4Y7AB 4CR5A 1C9PA 1AUTL 2B0FA 1VJ9U 4XOJA 3M7QA 3VB7A 1S6HA 1FIWA 1K1LA 3SYJA 4OS1A 1C5YB 3BG4C 1KXEA 2JETC 1G1QA 4IBLH 2HPPH 4YT6H 4MLFB 2FYQA 1F5RA 1LO6A 3O8RA 4DCDA 3GISB 1GI8B 3H7OA 1GJBB 2ZDVH 2VNTA 2C8YB 1W10U 2GMTC 1A7SA 4B2BA 1V3XA 1SLUB 4Y76B 2M2AA 1DXWA 4M11A 5AFYH 1GDUA 3N8WA 2VVUA 3SOBB 2AEIH 1B9WA 1CVWL 2LPRA 2A2QH 5L2YL 1YLCA 2O8WA 1AB9C 1P2MA 4B6EA 2VIDA 2ZGJA 1VJAU 2P3FL 3A88A 4U30A 1H9HE 2TGDA 1A5HA 2PR3B 3FVFB 1YKTA 3IITA 4KTUA 3L6PA 1HAFA 1DDJA 1QNJA 3OEHD 5HKKD 2I6SA 1GBMA 1O5AB 3FZZA 1A0HB 3K6YA 3RMNH 2W2NE 2F9VA 4MMXB 1IGZA 1YP9A 2A5IA 1P0SL 2FEQH 4IC6A 1M1XB 2GT8A 1GBJA 3QX5H 2RA3A 2ZKSA 2H9EL 3SO3A 4FUBA 4UEHH 1T32A 3A7WA 1G3CA 4IGDA 3RXTA 2BOHB 1TGSZ 2CHAB 1LKBA 4CRAA 4JZDL 3E16B 1TGCA 3HO3A 5EIYA 3T27A 2RFKC 3JZ1B 2I9BA 1RGQA 2FP7B 2W3KB 1EZQB 1W14U 1NY22 2WPME 4K69A 3E3TA 1ZPZA 2FMJA 2WG4B 4BAKB 1TPOA 1QRWA 2C4FH 3ATKA 3MI4A 1EZUC 4A1XA 4XSKU 1HV7A 1P2NA 3NUMA 3V64C 3T2NA 2J5UA 3RM0H 3GCXE 1GHAF 2Q1JA 2W2QE 1EQHA 4ZAEA 3SV7A 1O2SA 3D23A 4Y0ZE 4RS0A 1CT4E 1XMNB 2WV9A 3SNCA 1ETTH 5ESBA 1O35A 4ABJA 3LN0A 1F0RB 2Y6TA 1IQKA 1SBWA 1HB0B 2PHBA 2Y38A 1O3OA 1MQ5L 4AG2A 4D0EA 1PJPA 4FUDA 1PYTD 1EPJA 2J4IA 3L33A 2OC1A 2P26A 4I8KA 5DN6D 1A46H 1AMHA 3TH4H 1PPGE 2O8MA 1N7DA 4RRWA 2K8IA 2XTTB 2PUQH 2J9NA 4Y0YE 3KQEL 3U8TH 1C2HA 3AAVA 2OYEP 1LTOA 1P2OA 1QA7A 1C1SA 1G3BA 2WV5A 1XUKA 2P8OB 3KQEA 1T8LA 2JDID 3QTOH 1NFYB 2O8TA 1DVAL 1EGFA 2B9LA 1IQML 4ZHAB 4CRCA 1FE2A 1NZQH 1X7AC 1ANBA 1D3DB 1O37A 3C27B 1G32B 2VVCK 1G2MB 1IQEL 3GS9A 2OUAA 2ZGHA 5EQQA 1TPAE 2G81E 2VIQA 4X8UH 4ZHMU 2FOMB 2NU4E 3T5FH 1YUFA 2CJIB 4WMDA 3P6ZB 1VKYA 1QRXA 2KX4A 1URKA 1PFXL 4IN2A 1W2KH 1E79D 3A80A 3BEFB 1BZXE 5EODA 5EQSA 1JXPA 3D62A 3A85A 2J92A 3BTGE 2TBSA 4YESB 1GMDG 3ZYGA 1CHOG 5CDFE 1ID5H 3SGQE 1QIUA 5FAHA 2FTMA 1CE5A 1IQMA 4NA9L 1UK4A 2XC0L 3AASA 1T4VH 3ZZAA 1QBVH 5A8XA 1EP6A 1Y3XA 1AVGH 2FOGA 2WPIS 3MQKC 2OC8A 3N7EA 3NCLA 1A1RA 3NTBA 1AWHB 1VITF 3P17H 2OBQA 2OYUP 1QURH 4XE4A 1RTFB 3RC6A 4MPVA 4JYUH 8GCHG 3ZV8A 3RXHA 4X8SL 2QA9E 3S9CA 4G1MB 3RXDA 3SHCH 1ZMJA 1JMOH 1DIYA 4AGJA 5A0BA 3NPSA 1C5MD 2WV4A 3V7TA 1GI6A 1SQRA 1FSBA 1H4WA 1CT2E 4KTSA 1KLJH 1P09A 1YCPK 1O5FH 1O2HA 4YLUA 4OM9A 2BQ7B 1SHYA 1EPGA 5COXA 1C4Y2 3UOPA 1TFXA 2C90B 3ZZBA 2W3IB 2QXGA 2D1JB 3SI3H 3TGKE 2Y82A 3RXQA 3A7TA 4LXBH 1EPTA 4FUGA 4XFQA 3TJOA 1THPB 2BD5A 4XBBA 1UO6A 1OHHD 5T6DA 1Y3WA 1FAXA 1IQFL 4D76A 5JPMH 4A1VA 1SZBA 3MU4A 5L30L 3O8BA 1C2DA 1LQEA 7GCHG 2XBYL 1GI4A 2Q1JB 1DUAA 1HAYB 1TLEA 2F9UA 3DT0H 4M9FA 2ODQA 3GCTF 1XFEA 4JYVL 1LPKB 2VVVA 1D4PB 1CU1A 4SGAE 3CENA 4H42U 1O3JA 4Y7BB 5CKQA 1J9CH 3T29A 1HBTH 1GJCB 4I8LA 5L2YH 2ZPRA 1GI9B 1W0ZU 1LMWB 4K1SA 4RT0A 1UTPA 4INLA 2QC2A 3HKIB 3SOVA 3GY7A 3MU8A 3P92A 3V0XA 1NFWB 1GJ9B 1K0HA 3OLTA 1S82A 1CVUA 3QMOA 3M5OA 1A61H 4THNH 4KP0A 2ZTZA 3FANA 4Y10E 1V2ST 3BG8A 1EASA 1JRTA 3DSOA 3GCTG 1FY4A 2ZQ2A 1TIOA 2HLCA 1RFNA 2ALVA 3HO4A 4ABIA 1EJMA 4UONA 1TRYA 2UUJB 2G4UA 2G4TA 2GMTB 5C17A 3SOQA 3U28C 1YY3A 4TGFA 3SUEA 5J4SA 2JH6D 1JV2B 1GMHG 5JB9E 2FIRH 2GZ9A 1AB9B 3OY5U 1TLDA 5CMXH 1AGJA 1DWCH 1PYTC 2ZFRH 3RXLA 3GY6A 2GCTB 2W2ME 2TRMA 3PLPA 1GHAG 2PKAA 3ELAH 1AZ8A 2Y5GA 2M74A 2VWNA 4KKDA 5I25A 2VBCA 4ISOA 3SGAE 1A5GH 1C5VA 3BEUA 2H5CA 1C1NA 1P3EA 1T7CA 1ZPBA 3PGHA 1ZPCA 5EGMA 5E2OA 3SNDA 3ZZ7A 3QWCH 2AGGX 4BDWA 1Y5BT 1LPGA 1KTTB 1MTNC 2XC0A 4XBCA 2QAAA 1NO9H 2VGCB 1P11E 3ODFA 1AI8H 1QZ8A 1OP2A 1WU1B 2ANMH 1HREA 1K1IA 2QF4A 3ESTA 4MTBA 2Y80A 1BTZA 1NPMA 4NCYA 1G2LA 3KIDU 4Y8YA 1GHYH 1MH0A 3KGPA 1GJ7B 3OX7U 1WQSA 1EAWA 2FD6A 4AYVB 1DY9A 4ZKOU 1DICA 5E0JA 3H5CB 4OS4A 1KXFA 2EA3A 5GDSH 1OP0A 3BTME 1V2QT 4WJG2 1SFIA 4X8VL 2BOXA 3S9AA 1YPGH 2C8WB 2FM2A 1OWJA 3Q76A 2GTBA 1U6QA 1NRPH 2G00A 2TIOA 4ASUD 1T4UH 3A82A 1FPCH 2J38B 5DPAA 1C1MA 2WPLE 1SOTA 2J98B 2VWNL 1MQ5A 4CRBA 2Z3CA 3GY5A 1GHVH 2UUKB 4YOGA 2WSSD 3RMMH 3I77A 1IQEA 4I33A 3U1IB 2ZFTA 1E38B 1PXXA 1MUEB 2H9EC 2C93B 3SNBA 3RU4T 2MGPA 3EE7A 3Q3KA 2ILNA 2CF9H 2C8ZB 5JW1A 1MQ6A 1EP5A 1ETSH 1WQVH 1KLTA 5EPYA 5F53A 2ZHDA 1O39A 2AMPA 3TVJB 1H9LB 1GJ6A 3E0PB 2ZHQH 2BZAA 3F3BA 4TWYA 2ADXA 2VVUL 2Q6GA 4TT3D 1GWAA 5EPNA 3VB5A 3KCGH 3NK8A 4FOUC 2P3FH 5HM9A 1BOQA 3S69A 4F48B 4HFPB 2PGQB 2VWOA 1CGJE 1LHCH 3G01A 4OS2A 3N8WB 4FUEA 4X1PU 1OB1C 5IKTA 1S83A 1UCYK 5A8YA 1LPZB 3ELAL 2FODA 4NIVA 1YPEH 3A8BA 1FNIA 4NGAL 2BQ7A 2FS8A 1FJSL 4OGXA 1XVOA 1SHHB 1THSH 1MBQA 1OWIA 3QCWA 1ZSJA 3A8CA 2FOFA 2HVYB 4YZUB 1QB6A 2BD4A 2KAIA 4J1YA 2GT7A 3K9XB 5JB9S 4Y71A 1A0JA 1BDAA 5GCHF 1KLIH 1W7XL 2OK5A 1EX3A 3SNAA 2PKSB 1YM0A 4WH8A 1ZSKA 4FU7A 3U8OH 4KGAA 3MMGA 4D0FA 3MNXA 4K5ZA 4Y8ZA 2XYAA 4B75A 1O34A 2FLRL 2JIZD 3OFND 1XXFA 1IQFA 2ZDKA 4RI0A 1C4V2 1XUJA 3NZIA 1BIOA 3S9BA 3EGKH 3PV4A 2ZQ1A 1O2IA 3F1SB 3GDVA 1V2KT 1ZRBA 1Z8RA 2K1QA 4YXWD 4B6FA 1FDPA 2VH0A 1H8IH 1IQLL 1FAKL 1GPZA 3LH1A 1LHFH 1GHBF 2A7JA 2BD7A 2WPMS 2XC5L 2A4QA 2P95A 4TSFD 1C5ZB 3RXVA 1F0UA 2ZDLA 3A83A 2F9BL 1O33A 1F7MA 4GU4A 3ITIA 5T6GA 1O0DH 3RXGA 3KCGL 1UTLM 2Y5HL 3GOVB 3NWUA 1WDIA 2QV1A 2Y80B 3KQBL 1WAYB 4CH8B 1BJUA 1K1JA 3C1KA 3K9XA 2THFB 1TB6H 4IS5A 3MO9A 3SN8A 6GCHG 3DSGA 3GY4A 1H8ED 2PSXA 1SI5H 3LC5B 1SGDE 2OQUA 2Y7XB 4UFFH 2B7DL 5AVDA 3ZVAA 1MQ6L 5IK2D 5HIZA 3Q00A 1LHGH 5JVYA 1YPKH 2RDEA 2V3MA 4Z0KA 5C3NA 4K1EA 1EJNA 1UHBA 1GHXH 1NFUA 4KTCA 1QGFA 2XW9A 2XBXA 1BRAA 4YO9A 1EZXC 4Z0LA 5JB8E 3P8NA 1P01A 2G52A 3PLKA 2HORA 3QZQA 1Z1IA 1HAVB 3F2FA 3TZIA 1AHTH 4ZXYH 2R0KA 5EU8A 3HS7A 1TWXB 1VGCC 1KLOA 5C0TA 1SGTA 4WMEA 3U69H 3ATIA 3RXRA 1HJAB 1KLJL 1NT1A 3SQEE 4COXA 3ZZCA 3M7TA 1C2EA 1ZMNA 4Q7XA 1PTHA 1P9JA 3LTFB 1TMUH 4F55A 4JCNA 3BTKE 1G3DA 4K2YA 3JZ2B 4NWKA 8ESTE 5F8ZA 5EJ1A 1V2OT 2ZU5A 4AB8A 1P12E 1T8MA 1V2JT 2J94B 2Z9GA 2EEKA 1TNJA 1YUKB 2P28B 1MOXC 4ACAA 1A4WH 1C1PA 4CSYA 3OY6U 1ATDA 5F19A 4CRFA 2EI6B 1AFQB 1O3PB 4P02A 2P3FN 5K7RA 1GG6C 3CFWA 2V6NA 4MPXA 5EXNA 4D7FA 5DP3A 3BN9A 3ZZDA 1FAKH 2OQ5A 4ZXXH 3OYPA 1GVZA 4FVDA 3RM2H 3TITA 1O3BA 1SLXB 5T6FA 1O2QA 1ZJDA 1UTMA 2VINA 2WPIE 2Y7ZB 1HAVA 1Z71A 2KCYA 5DP7A 1CA0C 4CHAB 3DUXH 1X7AL 2GV7A 3ATLA 1DM4B 3N7DA 1K1OA 5C20A 5DP5A 1AUTC 1BTWA 1YO8A 1MTNB 2GVFA 1SOZA 3TGJE 1H8DH 1SGFG 1WYKA 4FXGH 2OD3B 1Q4GA 4GVUA 1LK9A 2UWLB 2WYJB 1CX2A 1OOKB 3RXJA 1ELGA 2O8LA 3NXPA 3TU7H 4HZHA 1FN8A 3BTDE 2WZPP 2VJ1A 3U9AH 3ZVCA 2XCNA 2ZFSA 2BVSH 2YGOA 1V6DA 3SU0A 4ABFA 2EI6A 3BF6H 3M3SA 4UE7H 3SZNA 2W6ID 1F92A 3RXMA 1ADXA 2Y81B 3GY3A 1J9CL 4U01A 5JBCS 1P02A 2BDHA 4MNYA 3NRLA 3BEIB 1G37A 1NBMD 3UB0A 1C5LH 1P05A 2ZTXA 4XL1A 1J14A 3RR3A 3P8FA 1C5TA 1Z6EL 4R0IA 2CV3A 2R3UA 1ELEE 1QA0A 1BMAA 1NFXB 5HXFA 3HATH 1DQBA 1XX9A 4O97A 3MYWA 5GCHG 2P94A 1EUFA 3TGIE 2ZU4A 3K65B 2B8OH 4X6PA 1TPGA 3D49H 4B71A 5DP8A 1Q31A 2WHXA 2Y82B 8KME2 3LU9B 3GCOA 3M37A 5CISA 2QF3A 1SQOA 3ENSB 3HS6A 3FFGA 4O03A 1HJ7A 4WXIA 2D8WA 4U32A 2Z3DA 3PRBA 3SZEA 4Z6AL 1NU7B 1COUA 1HNEE 1LHDH 4GHQA 4ZKRU 1ZTLA 2YMSC 4RRYA 1ZSLA 1B0FA 1BRCE 4UFEH 1F2SE 4JZEL 5JB8S 2BMGB 4GU3A 4UD9H 2Y81A 3BTTE 3LC3A 1O3MA 1NU9A 1IQHA 1UVTH 2J95A 3Q77A 3KHVA 2NU0E 1KDQA 1ZHMA 4NG9H 4JZ1A 3MQEA 1ABIH 1GCTB 4XLWA 2A0QB 3FP7E 1QB1A 1EQ9A 2WPHE 3DFLA 1NRRH 3A7XA 4RKJB 1C1WH 1SGFA 2XNIA 4ZH8B 1P2JA 3F2GA 1Y5UT 2ZGBH 1E1QD 1SQAA 2KL7A 1E36B 1OP8A 2J34A 4Q80A 4Y6DB 1XM1A 2R0LA 4Y79A 4XDEA 1ELFA 1RTKA 1BUIA 1DPOA 4NFEA 5GIBA 1W11U 2AMQA 1PPHE 2V3OH 1B0EA 1O5BB 1UHBB 3ENSA 1EQGA 3M5LA 2BOUA 4B1TA 2BLWA 1C1OA 1C1TA 2W7UA 1EPIA 3BSQA 4BTIA 3TK6B 1O5GH 3ZZ4A 5IDKA 5JBBS 4BOHA 5EJZA 3ZYEA 3CENL 2F3CE 2ZO3H 5A0AE 4TYDA 1K37A 1ZRKA 1F5KU 4NIXA 3V13A 1QFKL 4BDXA 3SNEA 1QJ7B 3LGIA 2BQWA 3QGJA 3BIUH 2GGVB 4X2VA 1AZZA 1UVSH 2J94A 3MH6A 3UFAA 1MMJN 3UNSA 4MPWA 1HT8A 3SGBE 3MU1A 3K2UA 2HOXA 1AD8H 2ZF0H 1VCWA 1LPZA 1O5EH 3HGNA 3VXFH 1PQ8A 5IKQA 2ZCLP 1CBWB 1F0SA 5LH8A 2MGRA 2P94L 1U8CB 3R3GB 1QCPA 5KGOA 1AKSB 1BF9A 2KFWA 3LGVA 2ASUB 4AFSA 3PMJA 1SFQB 1L3YA 1OWDA 2HGTH 1CT0E 2IJD1 1DWDH 2AFQB 2VIOA 4ABBA 1HIAA 1MU6B 2P16A 1MD7A 1LCYA 4JZIA 1F0RA 1QQ4A 5A8ZA 1G1SA 2AIQA 1ANCA 4FETA 3KRKA 1ABJH 1L4DA 4K8BA 1NFUB 1EBVA 4DIHH 3WWFA 2BQWB 4A7IB 3N8YB 3A84A 3E0NB 5FBEA 1TAWA 2OXSA 4Y11E 1GGDB 2GD4A 5FPYA 1V3XB 2BO2A 4FM5A 1AWFH 1FY3A 1HJAC 2GCHG 5F1AA 1UTKA 4ISLA 2OCVB 5FDQA 1O2OA 1YCPM 1EOJA 1G3EA 1KYNA 4MQAA 3SW2A 1TPSA 1HAPH 3STJA 3PWCA 2Z7FE 4MNWA 4E7RG 3PM3A 1AU8A 2BXUH 2RG3A 3U7UG 3MNCA 3KQBA 2FOBA 3DSPA 3SQHE 4BAQB 4Q4LA 5A2MH 2STBE 2BY7X 1O3CA 2GZ7A 1Z8JB 4DURA 1KY9A 2KCOA 2JKHL 1DLEA 1KKEA 1V2MT 1GG6B 2BVRH 4X8SH 5GNDA 1VR1H 1GBTA 4NIWA 1WSSH 3WW7A 3P8OA 1TABE 4A94C 4X1QU 1IQJA 4TPIZ 4XRNA 1PPFE 1TQ0B 1S6LA 2IN2A 2BT8A 4ABEA 3TH3L 2ZU3A 4RN6A 1UJ1A 1GI2A 3NT1A 4CH2B 1CA0B 2A4GA 4CHAC 1YPHC 2SGPE 1DANH 4GPGA 1CVWH 1W13U 1O2WA 1EB2A 1HAOH 1C5SA 3GCNA 2UUFB 1IGXA 3QGNB 1EB1H 1O2LA 3T62A 2UUYA 2OC7A 1P8VC 3BV9B 2PGBB 2GV6A 1EPHA 4UFGH 3QLPH 3PV2A 2LELA 4MDSA 1NC6A 1VCPA 2BLQA 1Y3VA 4INKA 4DOQA 4X8UL 1ELDE 4AB9A 1O2GH 4FUIA 1Y5AT
chains in the Genus database with same CATH topology
2BM2A 4LZ1H 5B6OA 1O3LA 2VVVL 3GDSA 1MTVA 3T26A 2ODYB 4AZ2B 2UWLA 2WYJA 2YGQA 1W7GH 3SU3A 3ZYDA 2IJOB 1H1BA 4RKOB 4Y79B 3P8GA 3LONA 5EG4A 1N1LA 1GK5A 5IKRA 5LPFA 1C2GA 3U98H 1P2QA 3ZVFA 3QN7A 3KQDL 3LIWB 4DY7B 2TPIZ 1AUJA 1HX2A 2J2UA 3K6ZA 1G36A 3HKJB 1IQIL 2FX4A 3FZDA 4OS5A 3TJNA 2Y5GL 1DWEH 2P93A 3M61U 2CGAA 1J8AA 3SJOA 2BY8X 1MKXK 1L1NA 1HT5A 2XBVL 1BJVA 1ANDA 1LVOA 1O32A 3W95A 3MU5A 7KMEH 3AAUA 4O3UA 2NU2E 1DX5M 2FWWA 5F8XA 1P2KA 2IPHA 3SU2A 4Y7BA 1ZMLA 1HAGE 1GBEA 1GMDF 3TK9A 1AE8H 1GI1A 4DW2U 4AQTA 4IW4E 4OS6A 4O02B 2ZTYA 2XWAA 1QTFA 4YM9A 2FOAA 1J15A 7LPRA 2R2WU 5LPEA 1UZPA 4FUJA 4Q7YA 4JYVH 1HZ8A 5GPIB 2PWXA 3GICB 1DSUA 2P95L 2TGAA 4FU8A 4AFUA 3F6UH 1TX8A 4OGYA 5F6MA 1K9OE 4X1NU 1IQHL 1EMNA 4UFDH 1UK2A 3LOXA 5ESTE 3LKWA 3STIA 1GCTC 2QN5T 2W26B 5AHGH 1D9IA 2WPJS 5EW2H 2IOTA 3MNBA 2EI8A 2R3YA 1TX7A 1IQJL 2BD9A 1BRBE 3RXUA 1ZLRA 1C2JA 4JZDH 4WMFA 3LGTA 4B2CA 4VGCC 5AFZH 5C1XA 1L1GA 2JKHA 1GVLA 2UWPA 1OXGA 1C5UA 4WVPE 1L5GB 3VGCC 4NZLA 4INHA 1RD3B 3BTHE 1P0SH 3SU1A 2D2DA 3GY2A 1TNLA 1A2CH 4DVAU 1YF4A 1EPTC 1EZQA 1UTJA 2BDIA 2HVXA 1O2VA 2V0BA 2H9HA 1MTWA 5KN5C 1TA2A 1BTHH 3EAJA 2HOBA 1BMNH 1TGNA 2YNAA 2ZEBA 6LPRA 1H9IE 4NA9H 2W3KA 2BDYA 1XDTR 1QY6A 2H6MA 1SGIB 2EI8B 1ELTA 4WH6A 1DUEA 5JBAS 4E05H 2ZG0H 1SC8U 3TH2H 1ARCA 2ZHEH 3FCSB 1K1PA 3AW1A 3ZV9A 1IAUA 1BHXF 3PTNA 1Z8IB 3MO6A 1SGPE 3F9GA 1C5NH 1IQNA 4ISIL 1FPHH 5HYOA 5DO4H 2F9BH 2XBVA 1L2EA 2ZECA 1XKAL 1AO5A 1O31A 3P95A 4HI3A 1TOMH 1O2TA 2VGCC 1Z7KA 1OKXA 2ZU1A 3KF2A 2BQ6A 3UQOA 4ZROA 1ZTKA 4RRXA 1UTQA 3SV9A 1NT0A 1ZGIA 3PB1E 1HXFH 1E0FD 5KIRA 1N8OB 2DE8A 2VJ3A 4DGJA 1Q2WA 1E34B 2A5AA 1EXFA 4XBMA 3UTUH 2G5VA 1G30B 1GDQA 4H6TA 1MTSA 3TJVA 3ZZ3A 2BYAX 1EAXA 4A5TS 1DX5I 1OWEA 1IOEA 2GDDA 1UMAH 3SJIA 2BDBA 3EA8A 1BCUH 1MD8A 3PROA 4M7GA 1VCQA