4BXXG

Arrested rna polymerase ii-bye1 complex
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
171
structure length
171
Chain Sequence
b'MFFIKDLSLNITLHPSFFGPRMKQYLKTKLLEEVEGSCTGKFGYILCVLDYDNIDIQRGRILPTDGSAEFNVKYRAVVFKPFKGEVVDGTVVSCSQHGFEVQVGPMKVFVTKHLMPQDLTFNAGSNPPSYQSSEDVITIKSRIRVKIEGCISQVSSIHAIGSIKEDYLGAI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
publication title Structures of RNA Polymerase II Complexes with Bye1, a Chromatin-Binding Phf3/Dido1 Homologue
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
total genus 29
structure length 171
sequence length 171
ec nomenclature
pdb deposition date 2013-07-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00575 S1 S1 RNA binding domain
G PF03876 SHS2_Rpb7-N SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4bxxG02
3.30.1490.120 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 RNA polymerase Rpb7-like, N-terminal domain 4bxxG01
1IYJB 1CKNB 4P73A 2BA0A 1G291 4LW1A 1GVPA 2I5LX 4AYBG 3U4VA 4X62Q 5IE8A 2C35B 3CCSA 1QVGA 5M3MG 2UXBL 3KOJA 1CSPA 2UXDL 1VQ8A 4ALPA 1VQ6A 1CKNA 1K83H 4R4OA 4OWXB 4DR7Q 2NZOA 3KJOA 1EFWA 1Q81C 1I94Q 4L5RC 5HY6A 3NBHB 1GD7A 4RG1A 4HIDA 1S40A 4OO1I 3CPFA 3I56A 3GTLH 3S17H 2E2HH 5GROA 5IY0A 1A0IA 1RL2A 5C3EG 1OXXK 2IHFA 1U5KA 1X65A 1RIPA 4JI7Q 1SR3A 3K8AA 2Q2IA 3AFPA 3K7AH 4GOPC 4AIMA 4JC0A 4JBMA 1C0AA 4BA2I 2R93G 4P72A 1X3FA 5C4XG 1WFQA 1IBKL 1C9OA 1NE3A 2ZJPA 4LF9Q 1VQLA 4DV5L 1N34L 3M9BA 4C3JH 1N33Q 2CQOA 1P8LA 1FJGQ 3J81j 4DR2Q 1Q8KA 3PF4A 1VQIA 4GKKL 4AH6A 2RF4A 4JBWA 4NXNL 2EIFA 3AQQA 3KLWA 4A76A 3I4NG 2K52A 4WJ3M 1Q7YC 1L2FA 4B3RL 2VZAA 1VQ5A 1JT8A 4DV4L 3HOVH 2DUDA 5IWAL 5K36G 1QUQB 4YY3L 5GAGC 3GTJH 2RHSB 4DPGA 2XTIA 4DUZQ 1C7YA 4GNXA 4LFCQ 2UUAL 2JA8H 2GVAA 3KF8B 1Q82C 4YWMA 2QEXA 3FP9A 1QUQA 2Z0SA 2Q2HA 1JJCB 1Y1VG 3PUXA 4DUYQ 2UUCQ 4P71A 1XNQQ 1HNXQ 4NXMQ 2ZM6Q 5LMNW 3GTQH 3RZOH 4IOAA 2F3IA 3L7ZC 4DV1Q 2B29A 3HKZG 1EOVA 1SMXA 4BBRH 4X64L 2QGQA 3CMAA 3OTOQ 1N36Q 1HR0L 1AH9A 3PCOB 4JOIC 4R4CA 4B3TL 4BY7H 3T1YQ 1IZ6A 1OXSC 1K3RA 2BA1A 1MIUA 4DV7Q 1YITA 2E2IH 1QZHA 4GLXA 1E1OA 3NELA 3BZKA 1VQBA 3KF6B 3ZJYC 2ZJQA 1G51A 1V43A 2KCMA 4Y7NH 2JQOA 4X62L 4KHPL 4C2MH 1EQQA 2E5LQ 4BBSH 4YHHQ 2OTJA 1HH2P 2VNUD 3KF6A 3CCEA 3CXCA 1YBYA 1E22A 4DR1L 3S2HH 2K5HA 2R6GA 3E0EA 3I2ZA 2D0OA 4GN3B 3CCQA 1A63A 3J80c 1WOCA 3CD6A 3CCLA 1VQPA 2EQSA 1K0RA 3AFQA 1UWVA 2BH8A 1EQRA 1IBLL 3ERSX 5IP7G 1IBML 3A0JA 2VUMG 1G6PA 4JI7L 3RR5A 3UDXA 4HIOA 3W5OA 1BKBA 3M3YH 1NBWA 2Q2TA 1WCMG 4A3JH 1K73C 1N34Q 3HOXH 4JG2A 1VQMA 3UDIA 1I5FA 3H15A 4BXXH 4DK6C 2UUBL 3D0FA 4GN5A 1QZGA 4LF9L 2B63H 2R7ZG 1N33L 2NZHA 2D0PA 4O0AA 3H0GH 4QIWE 4PMWA 2H5XA 4DR2L 1YI2A 1FJGL 4LUZA 4QGUA 1BBWA 1PH6A 1Q12A 5IP9G 2JA5H 4A3EH 2R7FA 1LTLA 1WI5A 3UE0A 1TWFH 5LMNQ 2JA6H 3H3VH 1VQHA 3PGZA 4AYBE 1SFOH 1KD1C 4IJLA 1TXYA 4A3KH 1LYLA 1EIYB 3GO5A 2WB1G 3A5ZB 4GOPB 3S15H 3HOYG 2K14A 3TEHB 5IYCG 5FJ8H 4DV2Q 5LMUQ 3LGJA 4LFCL 4HJ9A 3KFUA 1PA6A 1SN8A 2YTYA 4LWCA 2I5HA 1YVCA 4GOPA 4POGA 4OWWB 3I4MG 2FXQA 1KRTA 1PHJA 2OCEA 1MJCA 4QY7A 4QQBX 2ZTEA 3TS0A 2UUCL 1VQFA 1XNQL 4DUYL 1W3SA 1XNRQ 4FDBA 3S1NH 1PV4A 4X64Q 2I5MX 1HNXL 4POFA 4J15A 1HR0Q 2ZM6L 1UE5A 1TWHH 3STBD 4NXML 1OXTA 4A3GG 4B3SL 4A93G 4B3TQ 3M4QA 5FLMH 3M85A 5E7NA 3K81C 1N36L 2CFMA 1JB7A 1HNZL 4YCUA 1HZCA 5M3FG 3T1YL 2YYZA 4JI2L 4DV7L 4OO1G 4A3LH 1VQDA 2YU9H 4KHPQ 4DR6Q 3PV0A 2JEBI 4JI6Q 3E9IA 1PH5A 1YNXA 1B70B 4K0KL 5M3MH 1T9HA 4DR1Q 2VW9A 5GAEC 1PFSA 1I3QH 1VQJA 2E5LL 1TWAH 5GQOA 2XGTA 4YHHL 1DGSA 1CKOA 2Y0SG 3PO3G 3RNUA 1IBLQ 1IBMQ 4JI1Q 4DAMA 3RN2A 1NMGA 1N32Q 5C3EH 4YCVA 1PYBA 4JCVE 4DV6Q 1Y1WH 3EBEA 4JOIA 3U4ZA 1VQ7A 3RLFA 4JI0Q 1IL2A 4DK3C 4DV3L 2UUBQ 2R93H 2A1AA 3CAMA 5C4XH 5C44G 1VQOA 2NVYH 4KI0A 1PH9A 3HKZE 1NY4A 4A3DG 3KYHC 4X65L 2ALYB 4HIMA 2ES2A 1D7QA 5M5YH 3RN5A 3TS2A 3PO2G 3EN2A 2N78A 3J81i 3D31A 4OX9L 1S3OA 1EIFA 2CWAA 2CWPA 3MEFA 1ASZA 1XPUA 3S1RH 2JEAI 4GNXB 3T1HL 3F1ZA 5LMNL 1PH7A 1YHBA 1LM0A 3CCJA 4WJ4A 5IYDG 4APVA 1FVIA 4L5SA 3I4OA 1GKHA 3GDEA 4LF5Q 4R4TA 1YZ6A 3J81c 5LMUL 4DV2L 3HOZG 1H95A 4IPHA 1X55A 1NJIC 1Y1VH 3RLNA 3TRZA 4DR3L 1J5EQ 2AMCB 4B3SQ 1JJGA 1FL0A 4LF8L 1XNRL 1S72A 2LSSA 3EIVA 4JI5L 4GKJQ 2PI2E 2WP8J 1HNZQ 1KHIA 2ZJRA 4IPDA 1UE1A 4JI2Q 5M5WH 1M1KC 5FLXc 2MO0A 2JA7G 3W1BA 2R92G 2JJQA 5GADC 4LFBQ 1WJJA 3J80i 2PNHA 3RLOA 2YV5A 5C0XJ 4A3FG 4L5QA 3KJPA 2KENA 2KHIA 3PUWA 4QJFA 4K0KQ 1HJPA 4XTCS 5BR8Q 1XPOA 1GO3E 3S1MH 4B3MQ 2AWOA 4DR6L 4PG3A 4GS3A 4YCWA 4JI6L 3OW2A 4JYAQ 1VQEA 3HFZB 3TREA 1EWIA 3FKIH 2WB1E 1IXRA 2KCTA 3NEMA 4H02A 4RMFA 2GN5A 2N3SA 2HT1A 1X3EA 4YWLA 4C3IH 4A3BG 4OWTB 4A3CG 4JI1L 1Y14B 2LXJA 1N32L 1OXUA 5IP7H 1VQKA 2VUMH 4DV3Q 1XMQQ 3HOUG 4DV6L 5AJ3Q 4JI0L 2UXCL 2RCNA 4X65Q 1WCMH 2NVTH 3MXNB 2WAQG 5J3BA 5C0XG 1YJ9A 1JE5A 1I6HH 4LF7Q 2D62A 2R7ZH 2A8VA 4OX9Q 4IPCA 2ZTCA 3SGIA 1A62A 4R4QA 2AWNA 4UP7A 5IP9H 3T1HQ 1K8AC 3S14H 1U0LA 1X54A 3CC7A 5C0XI 4EQ5A 1EYGA 2L15A 2QA4A 2EXDA 2VY3A 2K4KA 1PH4A 4DV0L 3HOYH 5IYCH 2GVBA 2Y0SE 2ZTDA 4DR5Q 4LF5L 1SROA 1KAWA 2HIVA 3I4MH 3BU2A 4DR3Q 1VQGA 4NB3A 1K8GA 1E3PA 4LF8Q 2IX1A 3S2DH 2VQEQ 4JI5Q 2PI2A 4MNOA 4P75A 1J5EL 2HHHL 3M4OH 1N9WA 1UE6A 1FGUA 3PSIA 3W1GA 3KDFB 5IYBG 4NPSA 4A3GH 1HNWQ 1KL9A 4A93H 4GKJL 2IY5B 3ULJA 4OONA 4LFAQ 1KIXA 3GTKH 4A3MG 4A75A 1GM5A 4JBKA 3ULPA 1J6QA 1X6OA 3KDFA 2RHQB 5M3FH 4BY1H 1K9MC 3G6EA 1OTCA 4LFBL 1PYSB 2VL6A 4DNIA 1VQAA 2NN6G 2NVXH 3F2CA 3UDGA 3WWVA 3F2BA 1KC8C 5BR8L 4UP9A 1NTGA 4HJAA 2IHEA 2VQFL 1JJ2A 4B3ML 2F4VQ 2JK8A 2HIXA 4GLVB 4JYAL 1BVSA 1V1QA 1WYDA 2Z6KC 3CW2C 3DM3A 3PUVA 3G4SA 1P16A 1AE2A 2A19A 2E2JH 1X56A 2MQHA 4LUVA 2JA9A 5ELNA 3HOWG 3PO3H 2DGYA 2JE6I 2NN6I 2V1CC 3UE1A 3E9HA 3STBC 4A3IG 2OWOA 1VQ4A 3S1QH 4LF6Q 3K80C 4YWKA 4GN4B 1JMCA 4JV5L 3J7ZC 3U58A 2UXCQ 2HQLA 1Q1BA 1XMQL 2E8GA 5AJ3L 1XTDA 5JJKA 2LXKA 2K5VA 5C44H 1A8VA 4JI4Q 4A3DH 1M90C 1YJNA 1YJWA 3F8TA 1XMOL 4LF7L 3J7A5 5M5XH 1XPRA 3GD7A 3PIOA 3PO2H 1D8LA 3I4NH 4IPGA 2UU9L 3PUYA 1X9NA 1N8RC 4IO9A 1OXVA 1Y1WG 1YHQA 1VCIA 1CKMA 4DV0Q 3BZCA 3PF5A 1L1OC 4ME3A 5IYDH 2OQKA 5IT9c 3CMEA 2PMZE 1UEBA 4PZ8A 4TQUS 4X6AH 1L0WA 4AQYL 3Q8DA 4X66Q 1YIJA 4C3HH 4R1JA 2CKZB 1YHAA 3VDYA 1MJEA 3HOZH 4DR5L 2N49A 4UY8C 5JEAJ 1SLJA 1LUZA 4QL5A 1Z47A 3PIPA 4IOCA 2AKWB 2HHHQ 1B8AA 2VQEL 3ER0A 2IT1A 1TWCH 2ATWA 1PH8A 3HOVG 1TWGH 4A4IA 5EAYA 1HNWL 1PVOA 1E24A 3CQZH 3RZDH 2WAQE 3L2PA 4HJ8A 3CP0A 2ID0A 4LF4L 4LFAL 2JA8G 4IFDJ 4MTNA 2JA7H 2R92H 1Z9FA 4A3FH 2OTLA 5HGQA 1AE3A 2VQFQ 1HZBA 3ICEA 3PUZA 4DKAC 3S16H 5DLQE 4JI3L 4OXPA 4PZ7A 4LUOA 1Q46A 4BBRG 2F4VL 4JBJA 2MFIA 1BBUA 3CCMA 2K50A 5JEAG 4BY7G 2BH2A 4JI8L 4DR4Q 1X3GA 3CC2A 3K0XA 4A3BH 3TQYA 4JV5Q 4A3CH 1Q1EA 4LF6L 1VQNA 1NMFA 2Q2UA 1SE8A 2UXBQ 4PZ6A 2UXDQ 3BJUA 3HOUH 4Y52H 4BBSG 1E1TA 3IRBA 3F2DA 1VQ9A 1MKHA 4LNQA 4IFDG 1SRUA 5H1SE 1HR0W 3I7FA 1XMOQ 2B3GA 2KBNA 3A74A 4JI4L 3FKIG 2MNAA 3K7UC 2MO1A 3CPWA 1W2BA 4DR7L 1I94L 2KHJA 3JC66 2UU9Q 1CSQA 3AYHB 2VS1A 4BA1I 3JAMi 2Z6KA 4L5TA 1VS0A 4O2DA 4IFDI 1XJVA 5C4JH 4GNXC 1QVFA 3AEVA 3U50C 5JJIA 2I0QA 3M7NA 3I55A 1PH2A 3GTGH 1HZAA 4A3JG 1O7IA 4IJHA 2F52A 3HKSA 4EX5A 3HOXG 4AQYQ 1IBKQ 4BXXG 4DV5Q 2PQAB 2B63G 1KXLA 2CCZA 4X66L 3NENA 4GKKQ 4DAYB 3JAMc 3H0GG 1HZ9A 1QVCA 2YTXA 3G48A 3S24A 1I50H 2JA5G 4NXNQ 4A3EG 2PQAA 4HIKA 5ELOA 4B3RQ 4HJ5A 1YEZA 4GLAC 1Q86C 2JA6G 2N8NA 1PH1A 2NVQH 4DV4Q 5JJLA 1CUKA 1R9TH 4MZ9A 3ULLA 1KRSA 5IWAQ 4A3KG 4YY3Q 5IYBH 3CF5A 2IX0A 1EUJA 4LF4Q 1L1OB 2UUAQ 5FJ8G 3GTPH 3GTMH 4TVAB 4A3MH 2OQ0A 3L0OA 1UE7A 3M4PA 4KHZA 4DUZL 3CCRA 3H3VI 1L1OA 5GAHC 4P74A 4R4IA 2ASBA 3FHWA 3CCUA 1VQCA 4JI3Q 3DLLA 2WFWA 3G71A 2AHOB 3B6YA 1B7YB 2K75A 2K5NA 1ASYA 3CCVA 3GTOH 4JI8Q 3OYYA 4UP8A 4HJ7A 3CC4A 4DV1L 5FLMG 3UDFA 4KLKA 4XIGS 3OTOL 3A5UA 3HOWH 1V9PA 4A3IH 1PH3A 4DR4L 2YTVA 1E7ZA 2R7DA 4UPAA 1KQSA 4BY1G 4A3LG
chains in the Genus database with same CATH superfamily
4P73A 3QOJA 3S15B 1R9TA 4AYBG 4X62Q 2C35B 1QVGA 2UXDL 3EVQA 3ORRA 4L8JA 2VPSA 1CKNA 2UVUA 3EPGA 2QF7A 1K83H 2WKCA 3BAAA 3KJOA 1EFWA 4BS9A 4IWYA 1O7YA 4YAKB 1UC8A 4HIDA 4OO1I 3CPFA 3GTLH 2RKSA 1A0IA 1U5KA 2L55A 3RAXA 4JI7Q 1SR3A 2WKDA 3AFPA 4EGQA 5KX5F 3OMCA 3K7AH 1A15A 2R61A 1D1KA 4GOPC 5FK9C 4YQWA 1ZXTA 2DPIA 5C4XG 3A7AB 1NE3A 3N43B 3MEHA 4TV8F 1ENCA 4DV5L 4C3JH 5ELCA 2MUYA 1FJGQ 1KDAA 1PRTC 2O2LD 3P1HA 4RNNA 1KAAA 3ETHA 3IG0A 1K83B 3DXJC 1V1PA 4RCOA 3MR3A 3I4NG 4WJ3M 4DV2H 4IUUA 1EUCB 3GTLB 1CQIB 5C8YF 2Z9HA 2XSCA 3H3VC 5KFJA 2IL8A 1TQOA 4C5AA 2BQ3A 1F2YA 2UUAL 2GVAA 4KD4A 5FO8B 1QNKA 3I4LA 2Q2HA 1JJCB 4HCEA 4DUYQ 2CQAA 2B2TC 4P71A 4C3JB 3L4KA 1HNXQ 3RZOH 2IA6A 2EY5A 4PWQA 4ME5A 3WDNA 3CMAA 2XRSD 3M9MB 4JOIC 3EQLC 3T1YQ 4DR1H 2NU9B 1QZHA 1L0YB 2ZJQA 1G51A 2I46A 4ODGA 4Y7NH 5JVH3 1A6XA 4IRDA 2JN4A 3K3VA 4KHPL 2CW0C 1EQQA 1SNQA 4BBSH 1PLFA 1N32H 4EGVA 1VF7A 2W70A 1E22A 1GLVA 2K5HA 2R6GA 3I2ZA 1CT1D 3RZOB 2EYFA 1EYZA 1WOCA 2V4DA 3CD6A 3UFXB 1Y1VA 1HFGA 4NW2A 3VA5A 3OHAA 2BH8A 1IBML 1EQRA 3KHGA 1JOKA 2MJ8A 3ERSX 5KGUA 2F4IA 5I47A 2FKLA 3UDXA 4I4TF 1AZPA 3RTXA 2Q2TA 4OGQC 4A3JH 2HVRA 5D8DA 1SNOA 3H15A 5DEHA 1DV2A 5H80A 4Y7NB 2AQ3B 2F0MA 4J9NA 4YJ3F 1U4PA 4K5VA 4UCVA 4BBSB 4PDBA 5A35A 4O0AA 1TAEA 3Q1KA 2H5XA 1BBWA 1PH6A 4A3EH 2IW3A 2MP1A 4J1MA 2NU8B 2JA6H 4ZOLF 3PGZA 2A74C 1KD1C 3KLSX 2W6OA 5KKNB 3F8NA 2W57A 5LXTF 1WTVA 3E3XA 3GO5A 4CJ2C 2PZWA 1GSHA 1J5EH 4FM9A 5FJ8H 3NXWA 4DV2Q 1C3OA 4LFCL 3H4BA 4OELB 2L1BA 4A3JB 4LWCA 1N36H 2I5HA 2DNEA 3VPBA 1KRTA 2EY6A 5EWGA 1WTQA 1F77A 1MJCA 1XNQL 1PZJD 3A55A 2I5MX 4NXML 5KG4A 4B3SL 4A3EB 4A93G 4K0KH 2A6EC 2B2UC 3M4QA 5FLMH 1B1ZA 3M85A 2JA6B 1JB7A 3H0GA 4B3MH 5EKLA 1HNZL 4YHHH 2RDJA 5M3FG 5BMVF 2IMWP 2F0EA 2YYZA 3CHBD 4DV7L 4ECWA 1AW7A 4A3LH 4GZYC 2KEEA 4HTHA 2YU9H 3PIP3 3E9IA 2EXZA 3MFGA 2JEFA 1B70B 1T9HA 4DR1Q 3R2TA 5GAEC 1VQJA 1A2UA 4DNTB 1JDEA 1TWAH 4ME6A 1ENFA 5KG0A 5DNFA 2Y0SG 2ASJA 1XMQH 2RCFA 4F88A 3RN2A 1EZ8A 4O4IF 4TQSA 3BG3A 2F0QA 1N32Q 1PYBA 1U4RA 1X3PA 1TWHA 3U4ZA 1VQ7A 4JI0Q 3RLFA 5KFPA 4OX9H 5KG6A 1ULZA 4CKBA 3T1HH 2A1AA 3CAMA 5C44G 1VQOA 2YU9B 4KI0A 2AGQA 4QIWA 2F0KA 4DL7A 2SNMA 1D7QA 3OIQA 5M5YH 3JSNA 3BS1A 3PO2G 1TWAB 4K5WA 3NE5B 3EN2A 2HDLA 4H0LC 1S3OA 3HP3A 2JEAI 3MEFA 3FMCA 2YS7A 1PXUA 4WORA 3CCJA 1GSOA 4K8IA 1FVIA 3SR1A 5KNCA 4L5SA 1E2VA 1C4QA 4HNVA 4LF8H 1SMYC 4NDXA 3MC0B 1STEA 2C9OA 2O03A 3J81c 3HOZG 2B2VC 2F0JA 2KUMA 1H95A 4BWSC 2EYLA 4CJ0B 1NJIC 3I3CA 3RIZA 1TS5A 2FPIB 5M5YB 1J5EQ 2AMCB 1JJGA 3BVGA 1XXGA 5EPLA 4J9QA 3RV4A 4K2KA 4JI5L 5T1IA 1O75A 3R93A 1IW7C 4R9WA 4FO2A 4IPDA 5A2QE 2QEJC 3TMEA 1M1KC 5FLXc 1SYXB 2F4VH 3W1BA 5GADC 4CKEA 2R8HA 1YNJD 3A7LA 5DM63 3BDCA 3AB9A 2KENA 4K0KQ 1HJPA 4XTCS 4M7EA 3S1MH 1GO3E 4EBEA 4C1NK 4JW0A 2AWOA 4B3MQ 4DR6L 1HXYD 1F2MA 2HQEA 2PW7A 4LF6H 2K5WA 5COYA 3U9SA 3LMLA 4FF3A 1SJHD 3FKIH 2ASLA 2UXCH 2P0AA 2AU0A 3KLSA 2DY7A 2GN5A 2N3SA 4YWLA 4WRDA 4FVMA 2K6AA 1S5FD 3MXPA 2KSWA 4A2AA 5J2UF 3HOUG 3HB9A 1XMQQ 3K3PA 1UC9A 5F9NA 3MR6A 1IOVA 3HKZA 3IFDA 2Q8RE 4J9RA 1WCMH 1LABA 2NVTH 5BN5A 2WAQG 3LX0A 5C0XG 2NB0A 4IUVA 3S1MB 5KT7A 2D62A 3A54A 2R7ZH 4KKTA 4XQJA 4OX9Q 3MWDA 4IPCA 5EWFA 5ELDA 1A62A 4R4QA 3SE0A 5IP9H 3T1HQ 3V4SA 4LF5H 1QWYA 1X54A 1ZYRD 3VR2A 5BPHA 2UVRA 3TP5A 1STGA 5F2DA 4M9UA 3PR4A 1EYGA 2C2DA 1KDBA 2SNSA 1SROA 4YR2A 2AUJD 3RAQA 1WCMB 3VYSA 2NVTB 2XCLA 1PRTF 1VBHA 4LF8Q 3EYYA 4XX0B 1STYA 3BQ2A 1TS2A 2R7ZB 3G6XA 3FDSA 4P75A 2VQDA 1DV1A 1N9WA 1BXTA 5IYBG 5JH7F 3KDFB 4A3GH 4NPSA 1BNCA 1RDPD 1NR4A 4V190 4OONA 5KFTA 5GONF 3OMGA 4RB1A 1FR3A 2RSOA 3D6CA 1GM5A 2ZDGA 3ULPA 1T36A 1X6OA 4QWDA 5HBRB 2LKVA 4LFBL 1PYSB 1VQAA 4EFEA 5G3LD 3F2BA 1KC8C 4RKLA 3A8KE 1V51A 1NTGA 4HJAA 2QW7A 2F4VQ 5KFRA 5L1LA 4ECZA 4C1NI 1WYDA 3CW2C 1QE6A 1NUCA 2A19A 2UXDH 1SE2A 3L9AX 2JE6I 2NN6I 3STBC 2V4RA 4A3GB 3Q22A 4LF6Q 3K80C 5KFVA 3BZDB 1UAPA 4K14A 1JMCA 2Q8IB 2YRXA 2UXCQ 2UU9H 1GUSA 1K0SA 4HR7A 5AJ3L 5JJKA 4R8NA 5CMDA 1M90C 2EDGA 1YJWA 2YCHA 1T5XD 1EZ6A 2PW5A 4LF7L 2SCUB 4DLKA 5M5XH 1IYVA 3GD7A 2K28A 1D8LA 4DV5H 1RK6A 2VA3A 1QNUA 1X9NA 1N8RC 2J9GA 4RGMA 3SDZA 4YIJA 2XC9A 1WR2A 3A56A 4LSXA 1CKMA 3OSPA 3BZCA 5IYDH 4YJ2F 1L0WA 3T13A 1JQYD 5KFKA 1J9OA 4J9SA 5AFWA 3QG1A 5JEAJ 1SLJA 4N8FA 2UUAH 5FPOA 3C2PA 3K5HA 2L5TA 3TQTA 1B8AA 5HURA 5M5XB 1TT2A 3PQIA 3RGZA 1TWCH 2ATWA 1PH8A 3HOVG 1TWGH 4A4IA 3RD4A 3QJYA 1UNNC 2K05A 1DOKA 2ZDHA 1L0XB 4EBCA 3L2PA 4IRCA 2JA8G 3CP0A 4EQNA 4LFAL 3KXYT 3GTLA 3MXGA 5IOCA 2R92H 3OUZA 1BQQT 4R8UA 1QILA 3TP7A 3L4JA 4G57A 4MHEA 3NQTA 4O1NA 2WE6A 2QYZA 3HG9A 3PUZA 3OWFA 1ZHSA 5DLQE 5I6WA 3HRZC 4OXPA 3SHLA 2PO4A 3ONAB 4HNUA 5KEEA 1PYWD 2K50A 3JRXA 4BY7G 3Q23A 1X3GA 5KFEA 1TWCB 5C5LA 4IZOA 1TWGB 1IKLA 4Y8VB 2WACA 4DR7H 2F0VA 2PCFB 1GGOA 3TQ1A 4MTEA 3NTIA 2UXDQ 3BJUA 4KN4C 3RV3A 2JA8B 2R92B 3IRBA 4IFDG 1MKHA 1SRUA 1HR0W 4RGTA 2B3GA 2EY2A 4HSPA 4JI4L 1LV9A 3CPWA 2AQ4A 2BR0A 1I94L 3KAJA 2UU9Q 3AYHB 3HS0C 2VS1A 4BA1I 1XJVA 4GNXC 1QVFA 3AEVA 1YNND 3VPCA 3GIIA 2J6UA 4BY7B 1PH2A 3GTGH 1BJTA 4KMUC 2PN1A 3VA7A 3HKSA 3HOXG 4BXXG 1LT6D 4DV5Q 2A6HC 2EE1A 3M4YA 2J0TD 2QDBA 3I90A 3NENA 2CHBD 2VB3X 3DEOA 3H0GG 4DAYB 1STHA 1T3NA 3G48A 1E4EA 3N41B 4LH7A 4XDXA 4HMJA 4MV6A 4RB0A 4RB3C 5I2YA 2I87A 2P5ZX 1XNQH 4N8X1 4LMYA 1B44D 1CZGA 3H4DA 2UUAQ 4NXMH 1NNXA 1MD2D 3GTMH 3GTGB 3QIAA 2OQ0A 1G6ZA 4DV1H 4DUZL 2ICIA 4DFAA 3H3VI 5J2TF 1I4HA 4RGNA 5KYLA 1D5MC 3FHWA 5FO7B 4FS2A 4DV7H 1XYIA 2WFWA 1LO5D 1RCVD 4I7AA 1SYGA 3B6YA 3E6ZX 4RHSA 2K75A 1ASYA 1B53A 3PR5B 3FPUB 2V59A 3UDFA 4J9LA 1CQFA 4KLKA 3OTOL 3J80W 5I2XA 1PH3A 1GHKA 2YTVA 3L3OC 4UAIA 2R7DA 4UPAA 4BY1G 2SEBD 2BA0A 1G291 3K5LA 3GTMB 2I5LX 4APMA 3U4VA 1T94A 4UCTA 1WTOA 2ENBA 5M3MG 2FK1A 4JV0A 2K1BA 1VQ6A 1B6RA 4J9MA 3GTPA 4UCRA 4OWXB 3SXHA 4DR7Q 3WO0A 3C3LA 4Q45A 1J8IA 3DUZA 4ECQA 5HY6A 4DL6A 2ZXRA 2R85A 1CQVA 1S40A 5KG5A 2E2HH 4XYMB 1I6UA 2IHFA 2DZDA 1TY0A 4DK0A 4AIMA 2R93G 3MJFA 4HAEA 1X3FA 4P72A 2OH2A 4ED0A 1IBKL 2ZJPA 1N34L 4P2CB 1SDFA 2JSOA 3DEPA 3GV3A 2FLLA 5EJWA 2C2RA 1VQIA 4WFN3 5CC4A 3CVZA 2BQUA 5KIXA 4AH6A 2RF4A 1K8MA 4NXNL 5BN3A 1E4FT 3KLWA 3I70A 1L2FA 3R5HA 3J81E 3PZPA 3PW4A 1TVXA 2E2HB 2LS01 1D1IA 3NHHA 2PPBC 3TIIA 2J6TA 5IWAL 3GQBA 2E75C 4YY3L 5GAGC 1GYFA 2SOBA 5E3FA 5KFOA 3V96A 2XTIA 4LFCQ 1Y1WB 3SK4A 4IUTA 3MWYW 4YWMA 2QEXA 1QUQA 5HGTA 2CW7A 2BDNA 1XNQQ 1KABA 3KF8A 5FLXE 4NXMQ 2O5JC 4B9WA 1HQMC 1MSHA 2J7ZA 3GTQH 4ECYA 4FS1A 2F3IA 2RQXA 5KFMA 4DV1Q 2KECA 1Z2OX 3HKZG 5EBCA 4X64L 4BBRH 1HR0L 4XT3B 3H20A 2EJGC 2CVRA 2K33A 4DR6H 3PCOB 2WDTA 1SNDA 2DLNA 2DIKA 5JJZA 4B3TL 4CDEC 3TBIB 1OXSC 4DV7Q 1K3RA 2Q8TA 4KHVA 1CI3M 1E1OA 4GLXA 3NELA 3T5HA 1KNEA 4RAZA 3KF6B 3ZJYC 1S0NA 3V6JA 1V43A 1V8QA 2Z4HA 2KCMA 3GILA 1WD1A 4O3QA 5KFZA 1IBLH 4C2MH 4CHTB 2N88A 4O4LF 2O5IC 3NUCA 3BVZA 2F0HA 5CYUA 3WOFA 3TINA 1LTTD 1YBYA 3LNNA 4UCSA 4NP5A 2D0OA 4GN3B 3GTQB 4FF4A 3IL8A 2XVSA 3J80c 2UUBH 2R8KA 1JXLA 2LY7A 4BBRB 2NWGA 1VQPA 4N9PA 2EQSA 1K0RA 1UWVA 5EPKA 4U6PA 3A0JA 2VUMG 5M5WB 4ULLA 3HZXA 1RYSA 1B3AA 2MHVA 3M3YH 1NBWA 5EZYF 3EJIA 1KJIA 4YR3A 4JG2A 1VQMA 1F2ZA 1S5CD 5IT9W 5CORA 4GN5A 1QZGA 4LF9L 2B63H 4WD3A 4C2MB 4WBNF 1N33L 3RMHA 1YI2A 4DR2L 4B9XA 1AUXA 1Q12A 3JRWA 1LTLA 3UE0A 3QWNA 1TWFH 1MZBA 4AYBE 2R7NA 1TXYA 2A73B 3M4IA 4DXGA 1EIYB 1ZYRC 3A5ZB 3DHQA 3S15H 3FKIA 1ESRA 3TEHB 4ZQIA 2FK2A 2D5DA 3KHLA 3LGJA 3H09A 4HJ9A 3Q8PB 3J80L 4LMQD 1PA6A 1M0TA 1YVCA 4GOPA 3I4MG 3NTKA 2XCPA 4JI2H 2OCEA 4F4XA 2B63B 2ZTEA 1VQFA 1RJPA 1PV4A 4LFBH 2F0DA 2RSNA 4J15A 2ZM6L 1UE5A 3STBD 1MI2A 5C5JA 2DJFC 1FGBD 4FYDA 1JWSD 4QB4A 1TWFB 3K5OA 2F0GA 5E7NA 3T51B 3TP6A 4L63B 2FLPA 2R7ZA 2YZGA 1SXTA 1HZCA 4YB8B 1SNMA 2K32A 2VB2X 2VXWA 3BG5A 1VQDA 4DR6Q 3PV0A 2JEBI 1EY6A 1YNXA 3MXUA 3NBIA 3ZYYX 1JC7A 1TS3A 5J1ZA 1I3QH 1EY0A 5GQOA 1CKOA 1ZETA 2WV6D 2B2TA 1HQRD 5D3IB 2KHSA 5FO9B 1IBLQ 4X65H 1EL0A 4LF7H 1BO0A 4DGZA 4OEMB 2WIIB 3EBEA 4JOIA 4KY5A 5C4HA 2FK3A 3PVXA 1IL2A 1RF2D 4DK3C 1FNWA 4DV3L 3T16A 1MBYA 2UUBQ 5C4XH 5DG9A 2NVYH 4A3DG 2F0OA 1NY4A 4AYBB 5ISRA 4CC6A 1S68A 4ECXA 1LTBD 3QO2A 1I3QB 3JAMW 4F4YA 2ZDQA 3NQIA 3H91A 3VR5A 1V4YA 4LAAA 2CWAA 3ND9A 3S1RH 4GNXB 5I9PA 1RYRA 1LM0A 2NTSA 4WJ4A 4DR3H 3I4OA 1GKHA 4C3HG 3BA8A 1YZ6A 5LMUL 1F9RA 1X55A 2ASDA 5C4XB 4JV1A 2ICEC 2NVYB 4MTKA 1JX4A 4LFAH 2B8FA 3TRZA 1DIKA 3KBXA 5DGBA 1FL0A 1XNRL 2R8GA 2KOLA 1HUMA 3G8CA 1EQTA 4FP5D 3I4NB 5J39A 2ZJRA 3S1RB 1UE1A 4JI2Q 4ILWA 1JE4A 3HEJA 2XD4A 3VYUA 2JJQA 3RBDA 4LFBQ 1WJJA 3J80i 3RLOA 4A3FG 2SDFA 3BYYB 1AUVA 1HCZA 3KJPA 4QJFA 1IKMA 4G4KA 5JVG3 2W6QA 2M05A 2W9BA 4PG3A 4GS3A 4JI6L 4C5BA 3OW2A 4PMCA 2RGVA 3GIJA 3K59A 5DLGA 4JI0H 3KTMA 5IT9L 4NMZA 4QWAA 2D2CC 1I4RA 2HT1A 2HUGA 3C1FA 4OWTB 4A3CG 2QILA 4JI4H 2EVBA 3OOCA 1QG7A 1Y14B 2B2UA 2A6HD 2DNCA 1OXUA 2VPQA 1PFMA 1VQKA 2YL2A 3KBGA 2FB9A 2HVQA 2V4QA 4DV6L 2RGRA 1TWCA 5AJ3Q 4X65Q 1DM0B 1N48A 2QCPX 3MXNB 1SE3A 3R8BA 4LF7Q 2A8VA 3BA9A 4MV9A 3T4AC 5KG2A 2FINB 4DV0H 1KTKA 3SGIA 3S14H 4UP7A 1U0LA 1I7LA 3C46A 4EQ5A 1C48A 2L15A 2QA4A 2VY3A 4DL5A 1YNNC 2HHHH 4FF1A 3UI2A 2GVBA 3FDTA 2Y0SE 2ZTDA 4KTAA 2HIVA 1B3QA 3BU2A 4DR3Q 4RUAA 1K8GA 2IX1A 1WTRA 2PI2A 3CU7A 4MNOA 5JVLA 3M4OH 4KKSA 5IGCA 3S14B 3FPPA 4A93H 2VQFH 1ILPA 2M2LA 1JR0D 4LFAQ 4A3MG 4A75A 4JBKA 1VDZA 1A3UA 4I7ZC 5M3FH 3NWSA 4IR9A 4DNIA 1FYCA 1SYDA 2NN6G 1BR9A 2NVXH 3ND8A 3UDGA 3GTGA 1O80A 3MAQA 1K83A 4UP9A 3FMAA 2B2VA 4JV5H 1K1SA 2WB1A 4FXGC 4OIJA 2PZTA 3SK6A 1BVSA 2Z6KC 3P7JA 4JYAL 3PUVA 1ENAA 2IJ0A 2EJFC 3K58A 3HOWG 1BCPB 4A3IG 3M4OB 4KKUA 1SEBD 5NUCA 2W7PA 3DWQA 3JAML 4G3IA 4A93B 1XMOH 1X3QA 3HBLA 4YWKA 3Q2OA 4EG0A 4GN4B 1KNAA 5JVDF 4H13C 3J7ZC 4QW8A 1KDCA 4CDCC 3JZIA 5M3FB 1LTGD 1RJRA 2E8GA 3T5JA 2R8IA 2NVXB 3GTKA 4JI4Q 5C44H 2JXMB 1H9SB 3GTMA 3SI8A 3F8TA 4LK1C 3J7A5 1XPRA 4AQYH 5TSSA 3PIOA 3PO2H 1IBKH 1C8CA 4KY6A 1Q8IA 4IPGA 2IPKD 3V6KA 2Y0SB 4IO9A 3J7YW 4ZLTF 1OXVA 1NCVA 4NXNH 4DV0Q 4MA5A 3CMEA 4X6AH 2PMZE 1UEBA 2G9HD 1F2LA 4HNTA 4R1JA 2CKZB 4CBVA 1YHAA 5CAEB 3WNZA 5IWAH 1MJEA 3HOZH 4DR5L 4UY8C 4LF4H 5C44B 1LUZA 2XRQD 4OIKA 2F1MA 4IOCA 2AKWB 2HHHQ 2VQEL 4Q44A 1GUGA 3PO2B 4ETSA 5CV9A 3CRLC 1HNWL 1EY7A 1I7NA 2FE3A 4JI3H 2WAQE 2ID0A 1A9XA 4QF4A 2E2HA 1KLGD 2JP1A 4MN3A 4JI8H 1JIHA 2E5LH 4IZ8A 1B9NA 3D4WA 2VQFQ 3GV7B 4IUNA 4QCLA 3HOZB 3C1EA 3S16H 3GV8B 5L1JA 1Q46A 5KFGA 1BDOA 3CCMA 4KJNA 4Q0FA 5JEAG 5EDWA 3CC2A 1EYDA 1B50A 3TQYA 4JV5Q 4RGOS 2I8CA 5L1IA 4EQPA 2Q2UA 1SE4A 2EPBA 3Q0AA 4ECVA 3J80E 3HOUH 1GUTA 4Y52H 1AN8A 3CQZA 5H1SE 1UNSA 3I7FA 1XMOQ 5C0XH 2JA7A 2WTFA 3FKIG 3OWEB 5G3LF 1W2BA 3S16B 4UCOA 1U4MA 4IHJF 2PMZB 4JUZA 3JAMi 4R7RA 1VS0A 4LF9H 3W2DA 5KFDA 2UVVA 2OLSA 3M7NA 1Z2PX 2FP4B 3V4ZA 2X6GA 5ELEA 1EY4A 1ESFA 1O7IA 4IJHA 4AQYQ 1M7JA 1IBKQ 2X6LA 2PQAB 3HOUB 1AFPA 4X66L 2K5DA 2PYKA 1I50H 2HDMA 2JA5G 2R3ZA 4NXNQ 2WAQB 4HJ5A 3J7AV 4GLAC 5JJLA 2N8NA 1I4QA 1R9TH 1KRSA 5IWAQ 4A3KG 4YY3Q 5IYBH 3N6XA 4ED8A 1EUJA 4LF4Q 1L1OB 1SSOA 2ZM6H 1Q90A 2CH4A 3KALA 2B39A 1I4XA 3CCRA 1FD7D 2G9DA 4XYQA 5I4DA 4XQQA 1DOMA 5I9OA 1VQCA 4JI3Q 3DLLA 4HQ6A 3G71A 5ELBA 4JK1C 1I50B 2AHOB 4KK7A 4F50A 2K03A 3GTOH 4JI8Q 4UP8A 1IL8A 2QK4A 4PMBA 1R9TB 5JPMC 4LSAA 3OSOA 3R5FA 5D14A 2NUAB 3BJYA 1KQSA 1EWCA 4DA2A 1IYJB 1CKNB 1TWFA 4LW1A 1EHIA 1K3BC 1FKAH 2UXBL 3KOJA 2PQEA 4ECTA 3RUPA 4DN4M 4ALPA 1TA8A 2NZOA 4RB2C 1WTWA 1LTRD 1WTPA 2C28A 1GD7A 3BABA 1EZ1A 3I56A 3QB3A 3S17H 3TZUA 5GROA 5IY0A 3GTOB 1QCBD 2H4OA 5C3EG 1OXXK 3H94A 1T5EA 2A5HA 5D3DA 2K5QA 2FMMA 3VMMA 3A8JE 4G7OC 2FLNA 1C0AA 1DONA 4YAJB 3UQ8A 1EY8A 1L2ZA 5KFAA 4KV6A 1V1PB 4LF9Q 1R4PB 1VQLA 2R7MA 5LHY1 1N33Q 2CQOA 2B2WC 1P8LA 4DR2Q 5KG3A 1Q8KA 3PF4A 1XX8A 2VR1A 4JBWA 5EBDA 2W71A 5IT9E 2WYOA 4ZI7F 4A76A 2EYJA 5LMUH 3G6VA 1VQ5A 5EPJA 1JT8A 4XZ3B 4V0BA 3S17B 1I3QA 2L9HA 5D1OB 5DG8A 4ECSA 3S9WA 3HOVH 4RU9A 5K36G 2F0UA 2KQ3A 3AMUA 3GTJH 1TIID 4DPGA 2X69A 1XNRH 1C7YA 4GNXA 2JA8H 1AZQA 4UHVA 2F0LA 1B2TA 1ZHQA 2KCNA 3F2UA 2C22A 1Y1VG 1RTNA 1IHZA 2ZM6Q 5LMNW 4IOAA 3L7ZC 5J22A 3LWBA 5JOBA 2YZMA 2B29A 1SMXA 4ZUJA 3TSSA 5IGEA 1W96A 4KHPH 4JI6H 2F0IA 4R4CA 2KCCA 4BY7H 3MZ5A 3WOEA 4ED6A 1S03G 1IZ6A 1QJOA 4ED3A 1MIUA 3HOVB 1YITA 2E2IH 5IGBA 5KFWA 1S0OA 3GTJB 1VQBA 3G6JB 2JQOA 1RODA 4L6TB 2NTTA 4M1UB 3QR8A 4IFDH 3RFCA 1IBMH 1HH2P 3CXCA 1V1OA 4DR1L 1B9MA 1A63A 2IBKA 4C3IG 3CCLA 3BVMA 1M8AA 5IP7G 1SYCA 1CZWA 1SAPA 4FU0A 3RR5A 3V05A 2XN9C 1PDQA 3W5OA 2E2IB 1BKBA 3K5MA 1EYAA 3HOXH 2R6FA 4BXXH 3UDIA 1I5FA 4ZK9B 4DK6C 2ZXOA 5E4XA 2K7VA 1DXMA 2RBMA 4O2AF 2DJGC 1SYBA 5KFLA 1SCUB 2D0PA 2RA4A 3H0GH 4HEDA 4QIWE 4RH6A 3K57A 3RGXA 4IRKA 4QGUA 4LFCH 3MXNA 4O3RA 2R7FA 5CR3A 1WI5A 1SFOH 1WVLA 5EKKA 3MHBA 2WB1G 4WJWA 3HOYG 5IYCG 4B3SH 5EWEA 5LMUQ 3SK5A 3KFUA 1M4VA 2YTYA 3HOXB 4POGA 1HNZH 4KJOA 2FXQA 3PIO3 4G7ZC 4QY7A 2HJWA 2UUCL 5KFHA 4Q8EA 1XNRQ 4FDBA 5A2QW 3H0GB 1TWHH 1OXTA 3NWTA 4DNRB 1Q3LA 4X3KA 1SNPA 3K81C 1N36L 2E74C 1SFOB 4IWXA 1H9RA 4NLGA 2HD3A 4JYAH 3G6YA 3I12A 4LH6A 3U9TA 2I07B 4MIUA 2JA6A 4OO1G 1VBGA 4KHPQ 4JI6Q 2X0SA 1PH5A 4K0KL 3MWEA 5M3MH 2PNRC 1JWUD 1K8OA 5KFBA 2E5LL 2XIWA 1LTSD 2XGTA 4YHHL 1DGSA 2EYPA 3RB6A 4F8MA 4DAVA 5C1PA 4FNFA 3PO3G 5KFFA 2FJZA 1TWHB 4K6LA 1S5BD 3RNUA 2W8KA 1IBMQ 4DAMA 2JEJA 3VPDA 2W9AA 4EBDA 1Y1WH 4DV6Q 2OF1A 4QIWB 5CV4A 4EFBA 2DPJA 3DMUA 4BY1B 2B2YC 2R93H 3BQ1A 3HKZE 2ALYB 4HIMA 2ES2A 5M3MB 1DOLA 1U4LA 4O42A 3RN5A 1A3VA 5DLFA 3TS2A 2YU9A 2N78A 2GLTA 3D31A 2NVXA 4OX9L 2F0WA 2V5AA 2CWPA 3TZDA 3BQ0A 4DR5H 3T1HL 2CZGA 1TWAA 5LMNL 3S1QB 1SNCA 1PH7A 5D65A 1ML0D 4O3SA 1B33N 1PTOH 4APVA 2R87A 2VQEH 3W3AA 4EEQA 4JI5H 1X32A 1HTLD 3CRKC 1HNWH 5I6YA 2W6ZA 2R93B 2NU6B 1DZ1A 4ZKBB 1G8ZD 1Z7TA 4EQOA 2IX3A 4B3SQ 1ZQ7A 4LF8L 4K8JA 4NKLA 3EIVA 3OUUA 2WP8J 3C0FB 1HNZQ 1KHIA 3KAKA 1BCPC 5M5WH 1LT3D 5T1GA 2AGOA 2JA7G 3SE7A 2NBFA 1PTOB 2YV5A 1CS0A 4L5QA 2IP4A 5L1KA 2KHIA 3PUWA 1HUNA 1D6EC 1D5ZC 3MTSA 2PVPA 2R84A 5KG7A 4JYAQ 5CBEE 1JB3A 5CA0F 1VQEA 3R23A 4RZQA 3OIPA 3TREA 3DWAA 4J0MA 1ICFB 4N9TA 5JPNC 3PW2A 4H02A 2EOTA 4A3BG 1STNA 5FD6A 1CM9A 4ZYSA 3IN5A 3HKZB 3M7GA 5LL6X 4JI1L 2LXJA 1GUOA 2VA2A 2VUMH 4YP3A 4ABNA 4QWBA 2UXCL 2RCNA 3ETJA 4GC6A 5DG7A 4FBUA 5J3BA 1YJ9A 1JE5A 2ZJTA 5EKIA 4MV3A 2HCCA 2ZTCA 3RB4A 3PW5A 2AWNA 5FKAC 1FNVA 4X66H 4HSVA 4DL2A 5A2QL 4HCSA 1FNUA 1PTOD 5JQWA 2EXDA 2K4KA 3D8GA 3URYA 1EY5A 2VUMB 3OHXC 4DR5Q 2YZNA 3TN2A 1TS4A 4LF5L 3T5LA 1KAWA 2L11A 1ILQA 3I4MH 4CC5A 1MSGA 1VQGA 4NB3A 4MV8A 1E3PA 4IQZA 3S2DH 2VQEQ 4JI5Q 1WCMA 1OWTA 1PZID 5IGDA 1UE6A 3PSIA 1H9JA 3W1GA 1HNWQ 2FJ2A 2VOBA 3M9OB 1KL9A 4GKJL 3GQCA 3I73A 3ULJA 1KIXA 1KLUD 4JV2A 4DL3A 1PZKD 2A69D 1J6QA 3KDFA 2GPWA 2RHQB 1K9MC 3G6EA 4U68A 1OTCA 2CQYA 2VL6A 4MTDA 3N42B 4J9OA 3WWVA 5BR8L 1HA5A 1QOHA 4PNYA 2IHEA 3I4MB 2JK8A 3G4SA 4FXKC 2E2JH 1P16A 1AE2A 2LMCB 3S2DB 2UXBH 4LUVA 1AP0A 2JA9A 3VYRA 1JCKB 4OHJA 3UE1A 1CA5A 1EIGA 1VAJA 2AUKA 1E2WA 3N52A 4HR7B 4RWSC 5KFUA 4O3OA 4ZAIA 5KFXA 2XGPA 2QDLA 1RD9D 2NU7B 3U58A 2HQLA 3X3MA 3MFHA 1XTDA 1S10A 3R3OA 2LXKA 4A3DH 1YJNA 3PN1A 4ZHQF 1BOSA 2Z8LA 5EQ0A 2PBZA 2E2JB 3I4NH 4MV4A 2UU9L 3PUYA 4MA0A 3M9NB 2V58A 5LYJF 2JEGA 3GIKA 2BDOA 3LWUA 3GTOA 1L1OC 4ME3A 1SEIA 2YS6A 4OL7A 5IT9c 4MV1A 2RVLA 4C3JG 4X66Q 4C3HH 3I8ZA 2A68D 1ET6A 3Q8QB 1G2TA 2N49A 2HCIA 4A3DB 4QL5A 1Z47A 1EFID 1GUWA 3G7LA 5KFCA 2C00A 1VF5C 3ER0A 4UDUC 2IT1A 1KJQA 2KA7A 1JDBB 3I91A 5EAYA 4R8UB 1E24A 1MGSA 3RZDH 3RUZA 4HJ8A 3K5IA 4ECRA 1LTAD 2R82A 4MTNA 5KT5A 5D1OA 3K7AB 1Z9FA 4A3FH 2OTLA 2R7KA 4XT1B 4C3HB 1MHWC 2R8JA 2AGPA 2BQRA 4PZ7A 4LUOA 4JBJA 3X3NA 2K04A 5C6AA 1E2ZA 1BBUA 2L4NA 2N55A 3EFXD 2BH2A 1LLRD 5EGTA 3K0XA 4TRDA 1EYCA 4A3CH 1Q1EA 1VQNA 1I94H 1NMFA 3RZDB 5KT4A 2UXBQ 1TWGA 2I80A 4BBSG 1E1TA 4ZQ3A 1DCZA 3F2DA 4A3FB 1WTXA 1E4GT 3N8DA 2D9UA 3RB0A 3GTJA 5M9OA 2R92A 3A74A 2L0CA 1SYEA 2MNAA 5K2MA 4DR7L 4TV9F 3JC66 1CSQA 4EYHB 2Z6KA 5KNBA 2ZT9C 4O2DA 1EOTA 1S4ZA 3TP8A 5DQGA 1W6JA 2XNAC 3U50C 4GC7A 5DAUA 5E1FA 4FXDA 1RKNA 1B6SA 4A3JG 2F52A 2J6SA 1PX2A 3KLRA 1E4EB 1S5DD 1I6VC 3RB3A 2E2IA 3JAMc 3J81W 1HZ9A 3S24A 1CA6A 4A3EG 4KD3A 4HIKA 4DUZH 2OXPA 2HVSA 4Q8FA 2JA6G 2NVQH 4DAYA 1HA6A 4C5CA 2FMAA 4IR1A 1CUKA 2EY1A 4MZ9A 3ULLA 3CF5A 2IX0A 2UUCH 3OHBA 1EEID 1JWMD 3KHRA 1KEEA 2CH4W 5FJ8G 3GTPH 1ZEQX 4A3MH 3L0OA 3M4PA 5FLXW 3MA2B 3IAYA 3BYTB 3OTOH 5GAHC 4RCNA 2ASBA 2NN6H 3CCUA 3VR3A 4EEYA 5E4WC 5T14A 1B7YB 3MVVA 2W7OA 2K5NA 4RNMA 1EU3A 3CCVA 3O13A 4DV1L 1Y8PB 5FLMG 2NVQB 3K5NA 2EYHA 4XYOA 1TY2A 4XIGS 5CV7A 3A5UA 5CBAE 4A3IH 1BCPF 3HOWH 4DR4L 5KFIA 3NGDA 1E7ZA 3BDLA 5LL6b 4A3LG 4PV1C 3GTPB 5F9LA 1C30A 1GVPA 5CV6A 4A3MB 1SFOA 1VMPA 5IE8A 3CCSA 1CSPA 1VQ8A 3GIQA 4R4OA 1RJQA 4FBTA 2NUCA 1Q81C 1I94Q 4L5RC 5CB4F 3NBHB 3T56B 4RG1A 4K2LA 3GV5B 4X3UA 3EPIA 1N34H 2DWCA 1WSCA 1E0BA 1RL2A 1UEAB 1X65A 1RIPA 3K6OA 5KG1A 3HOWB 3K8AA 2FMCA 2Q2IA 1D2BA 2MPMA 3KK7A 1VMCA 4ZCKA 4A3IB 2YRWA 4E4TA 4JBMA 4JC0A 4RAYA 1EEFD 1U9RA 4BA2I 5DGAA 4TSSA 1WFQA 1C9OA 5LMNH 2LFNA 3M9BA 4YY3H 4JPBW 3J81j 1OO9B 4HYKA 4GKKL 5JUMA 4O2BF 2EIFA 3AQQA 3P75A 2K52A 1BCPD 1Q7YC 4B3RL 1JOOA 2VZAA 4DV4L 1HTPA 4I50F 1RHPA 1RJTA 2DUDA 3I72A 1QUQB 3JSLA 4EGJA 2BE5D 4EVOA 2RHSB 4DUZQ 4RHRA 4X64H 1ET9A 1HR0H 3KF8B 1Q82C 1BGWA 3FP9A 1ICWA 4B3TH 2Z0SA 4U673 2UUCQ 3PUXA 1EUDB 3GLKA 1Y1WA 3EA6A 2R93A 1EOVA 5C5MA 1B04A 1ZKOA 1GOZA 2QGQA 3OTOQ 1N36Q 1AH9A 1KJ8A 4LJZC 5FPRA 5JEAH 3VYTA 2KEDA 4ID6A 2BA1A 2R86A 3BZKA 2V9WA 1D5XC 1XWEA 2FPPB 1B4OA 4CDFC 4Q5VA 4M8AA 3EROA 4X62L 2AQ2B 2E5LQ 2W9CB 4JI1H 4YHHQ 2OTJA 2VNUD 1R4QB 3KF6A 3CCEA 3S2HH 1BF4A 1CE8A 3E5SA 5DQIA 3E0EA 3CCQA 1KBLA 5JAVA 5DQHA 2TSSA 4XYLB 4F4WA 3J81L 4UCUA 3SEBA 1JOQA 3AFQA 1IBLL 3GTQA 1N33H 4DR2H 1G6PA 2PZUA 2XGQA 4JI7L 3MR5A 4HIOA 5KFNA 1WCMG 1K73C 1N34Q 2UUBL 1TKWB 3D0FA 1BBXC 2R7ZG 1Y8OB 2NZHA 5FLXL 1SYFA 1FJGL 4PMWA 1PVOA 4O3PA 4DK1A 4LUZA 2JA5H 3S2HB 5IP9G 3MWMA 2WINB 2KVMA 1CHQD 4C2MA 3FKIB 5LMNQ 3H3VH 1VQHA 4IJLA 5CGKA 1GSAA 4A3KH 3MFIA 1LYLA 2FHTA 4GOPB 2K14A 3SK8A 4RFBA 2E76C 1M6VA 1XTCD 1PTOC 1CQJB 4GKJH 2C5CA 1SN8A 4TKOB 4UFZA 5KT3A 1TU2B 1PRTB 4OWWB 3OW7A 4J6HA 1PHJA 4QQBX 2VUMA 3TS0A 3S1NH 1LACA 3RBEA 4DUYL 1W3SA 2J4XA 2B2WA 4X64Q 1HNXL 4POFA 1HR0Q 2JA5B 4A3GG 4B3TQ 2B63A 5BR8H 4HMIA 4IUQA 1HHVA 2CFMA 3SVMA 4YCUA 3T1YL 4A3KB 4JI2L 4O3NA 2HGSA 5EOYA 4PQXA 3FRPB 4CKCA 1EY9A 4TUYF 2A69C 3H6MA 1S97A 1WTHA 2G5DA 1Y69U 2VW9A 2ZXPA 1PFSA 2XCAA 1PK8A 3D4DA 2GPSA 2ALZA 3S1NB 3KHHA 4DV3H 2EYOA 1Z2NX 1S0MA 4L1KA 4JI1Q 3DWPA 1NMGA 1AEXA 2XWBB 1IOWA 1LT5D 5C3EH 4YCVA 3V6HA 2TMPA 4JCVE 4IN3A 2RDGA 1PRTD 1EIHA 1PH9A 3A8IE 3KYHC 4X65L 3ERQA 3GIMA 4ECUA 3NPPA 4Z9CB 2YYAA 2F0PA 3J81i 3QZ7A 4AYBA 4I55F 5C3WA 1EIFA 1XPUA 1ASZA 3T53B 3K0YA 3F1ZA 5KRUA 1I4PA 4RKBA 2FFKB 4F87A 1YHBA 3DM1A 4QW9A 3FEWX 2OEOA 5IYDG 5C3EB 5K36H 2EYMA 4K5XA 3Q6SA 3GDEA 2Z1CA 4LF5Q 1JLLB 2C2EA 4R4TA 4DV2L 4X3TA 4IPHA 5CA1F 1CK1A 5KFSA 2AQ1B 1GJXA 4IUPA 2CW8A 1Y1VH 2A68C 3RLNA 4R8IA 4U7CA 4DR3L 4HN7A 4MAMA 1GXDC 1S72A 2LSSA 1BNZA 2JYOA 2NVYA 3BDOA 3GP7A 4GKJQ 3OPOA 1VKZA 2PI2E 2DY8A 3NSWA 1WD0A 2GA4B 5IYZF 3R5XA 2MO0A 3FVQA 2R92G 4J9KA 2PNHA 5C0XJ 2W9BB 2CW0D 4ZUIA 1STAA 2B8GA 5BR8Q 5L37A 5CV8A 2L12A 1XPOA 3QZ8A 1JKJB 4I7HA 3CKIB 4YCWA 1F9PA 4QWEA 1JICA 1LTID 4B08A 4DV6H 3P20A 1Y1VB 3HFZB 1EWIA 4RUCA 2WB1E 1GHJA 1IXRA 2OT2A 2KCTA 3NEMA 1NAPA 4RMFA 4Q43A 3PMFA 1X3EA 4C3IH 1BXRA 2W8LA 2F03A 2F0SA 2FPGB 1N32L 3VR6A 3HGBA 5IP7H 4DV3Q 4CDDC 4BWGB 4JI0L 2XIGA 2F0NA 4RAUC 1O7LA 3U9OA 3DF7A 3NP8A 1F9SA 2NYZD 1I6HH 5LA6F 4DL4A 3OSNA 1JORA 1W6KA 2RDFA 4IAJA 4DAPA 3ORQA 1K8AC 2F3VA 1EU4A 1H9MA 5IGFA 2IWHA 3JAME 3CC7A 2W6NA 3E0JA 3V2TA 5C0XI 4C3IB 4YBZB 3J7AF 4XXEA 1CTMA 1UUPA 5KNDA 2MGSA 1PH4A 4ED7A 4DV0L 3GIPA 3HOYH 4EYIB 4CGYB 5IYCH 2VUGA 1STBA 2XWJB 4ZRZA 2B2YA 1I6HB 1A3TA 4H44C 1HFNA 3RF2A 2JEIA 2A6ED 1II3A 4I65A 1J5EL 2HHHL 2ATLA 1FGUA 5FD5A 2Z4IA 1DJRD 1RK5A 2IY5B 5CV5A 1KJJA 2F3WA 3GTKH 2O4XA 2F0FA 5DM73 4C56C 1K28A 4DU9A 2F0TA 3IKJA 4BY1H 2WB1B 5C3XA 4OO1H 3HOYB 4Q0YA 3F2CA 4E6IA 4DR4H 1JJ2A 2VQFL 4B3ML 3HXLA 2HIXA 4GLVB 1V1QA 3DM3A 1RTOA 4J8QA 1I4GA 1X56A 2MQHA 5LL6S 1NSNS 5ELNA 4G7HC 2DGYA 3PO3H 2V1CC 2OWOA 3S1QH 3E9HA 1VQ4A 4ZKCB 4IALA 1W93A 5KYIA 3LWEA 5IODA 3GTKB 4DXFA 4JV5L 2DN8A 1NR2A 1Q1BA 1XMQL 2R7LA 2W6MA 3LP8A 2K5VA 1A8VA 1XMOL 5LP6F 3N6RA 1BUVT 5LOVF 1H9SA 3GV6A 4CJ1B 1DD2A 5IIFA 2M00A 3NBHA 5FOBB 3PO3B 4GKKH 3D4RA 4H7BA 1Y1WG 1SMYD 4FF2A 1YHQA 1VCIA 3J7AK 4TQRA 3PF5A 2M9VA 2UVWA 2Y0SA 2OQKA 4PZ8A 4TQUS 4B3RH 4AQYL 3Q8DA 1YIJA 4DV4H 3VDYA 5ELFA 5L9XA 2MCTA 5HV6A 3PIPA 1IW7D 1GUNA 1EWHA 1M0WA 1TR5A 1G2SA 3R2IA 2KJXA 1KC7A 5KT2A 1Y8NB 3CQZH 4IFDJ 4LF4L 1O7ZA 1QB5D 2JA7H 3MFYA 1S5ED 5BN4A 3Q8SB 2BE5C 1IYUA 1H9KA 1PTOF 5HGQA 1HRJA 3ITPA 1XDNA 1AE3A 1HZBA 3ICEA 4KY7A 3N44B 4DKAC 4O4HF 4F4ZA 4JI3L 2F4VL 4KN7C 4BBRG 2E2DC 4X3SA 2MFIA 3TDQA 3NK9A 1K1QA 1O78A 4X62H 5BPFA 4YR0A 2QKIC 3KUPA 4JI8L 3QFFA 4DR4Q 2EZVA 3D6WA 5K5PA 4A3BH 2RDHA 1CHPD 4QMGA 3CQZB 4S3SA 4LF6L 1SE8A 3IFTA 3N40P 4PZ6A 5KT6A 1SJED 2BCOA 3D3RA 3NTHA 2JA7B 1S9FA 1VQ9A 4LNQA 1YNJC 4A2BA 4ED1A 4JI7H 2KBNA 3TIGA 4F7XA 3K7UC 2MO1A 1KJ9A 2NZ1D 2KHJA 2W9CA 1SBBB 2EJMA 4L5TA 4IFDI 4XQNA 1A2TA 5C4JH 1F9QA 1FJGH 5JJIA 3VR4A 2I0QA 3I55A 2PMZA 1HZAA 4A3BB 3GIDA 2K01A 2W6PA 4K6DA 4EX5A 2BOSA 5KFYA 1PMRA 2B63G 4QWCA 1KXLA 2CCZA 4MV7A 4GKKQ 1DYQA 1LT4D 5D1PA 1QVCA 2YTXA 4JVZA 1WH2A 2PQAA 3AU7A 5ELOA 4B3RQ 2H1EA 1YEZA 1Q86C 1PH1A 5IGGA 4DV4Q 1EQVA 1G91A 5C1OA 2WAQA 3E5NA 3MR2A 1PFNA 2RDIA 3QOLA 3Q24A 4DUYH 5C4JB 3RJ0A 1HNXH 1ONLA 1Z6HA 4TVAB 4J9PA 4KHZA 4ED2A 1UE7A 1N56A 3M3YB 1L1OA 4RNOA 4P74A 3H40A 2Z6BA 4R4IA 3PW0A 4QUFA 1AN7A 3WO1A 4RZRA 3T1YH 4QUCA 3PW7A 4IURA 5C4ZA 4DF7A 2YW2A 1PFBA 3OYYA 3CC4A 4HJ7A 1CFMA 1HPCA 3T5KA 1I50A 4RA8A 5KFQA 3Q8RB 1V9PA 2JA5A
chains in the Genus database with same CATH topology
1IYJB 1CKNB 4P73A 2BA0A 1G291 4LW1A 1GVPA 2I5LX 4AYBG 3U4VA 4X62Q 5IE8A 2C35B 3CCSA 1QVGA 5M3MG 2UXBL 3KOJA 1CSPA 2UXDL 1VQ8A 4ALPA 1VQ6A 1CKNA 1K83H 4R4OA 4OWXB 4DR7Q 2NZOA 3KJOA 1EFWA 1Q81C 1I94Q 4L5RC 5HY6A 3NBHB 1GD7A 4RG1A 4HIDA 1S40A 4OO1I 3CPFA 3I56A 3GTLH 3S17H 2E2HH 5GROA 5IY0A 1A0IA 1RL2A 5C3EG 1OXXK 2IHFA 1U5KA 1X65A 1RIPA 4JI7Q 1SR3A 3K8AA 2Q2IA 3AFPA 3K7AH 4GOPC 4AIMA 4JC0A 4JBMA 1C0AA 4BA2I 2R93G 4P72A 1X3FA 5C4XG 1WFQA 1IBKL 1C9OA 1NE3A 2ZJPA 4LF9Q 1VQLA 4DV5L 1N34L 3M9BA 4C3JH 1N33Q 2CQOA 1P8LA 1FJGQ 3J81j 4DR2Q 1Q8KA 3PF4A 1VQIA 4GKKL 4AH6A 2RF4A 4JBWA 4NXNL 2EIFA 3AQQA 3KLWA 4A76A 3I4NG 2K52A 4WJ3M 1Q7YC 1L2FA 4B3RL 2VZAA 1VQ5A 1JT8A 4DV4L 3HOVH 2DUDA 5IWAL 5K36G 1QUQB 4YY3L 5GAGC 3GTJH 2RHSB 4DPGA 2XTIA 4DUZQ 1C7YA 4GNXA 4LFCQ 2UUAL 2JA8H 2GVAA 3KF8B 1Q82C 4YWMA 2QEXA 3FP9A 1QUQA 2Z0SA 2Q2HA 1JJCB 1Y1VG 3PUXA 4DUYQ 2UUCQ 4P71A 1XNQQ 1HNXQ 4NXMQ 2ZM6Q 5LMNW 3GTQH 3RZOH 4IOAA 2F3IA 3L7ZC 4DV1Q 2B29A 3HKZG 1EOVA 1SMXA 4BBRH 4X64L 2QGQA 3CMAA 3OTOQ 1N36Q 1HR0L 1AH9A 3PCOB 4JOIC 4R4CA 4B3TL 4BY7H 3T1YQ 1IZ6A 1OXSC 1K3RA 2BA1A 1MIUA 4DV7Q 1YITA 2E2IH 1QZHA 4GLXA 1E1OA 3NELA 3BZKA 1VQBA 3KF6B 3ZJYC 2ZJQA 1G51A 1V43A 2KCMA 4Y7NH 2JQOA 4X62L 4KHPL 4C2MH 1EQQA 2E5LQ 4BBSH 4YHHQ 2OTJA 1HH2P 2VNUD 3KF6A 3CCEA 3CXCA 1YBYA 1E22A 4DR1L 3S2HH 2K5HA 2R6GA 3E0EA 3I2ZA 2D0OA 4GN3B 3CCQA 1A63A 3J80c 1WOCA 3CD6A 3CCLA 1VQPA 2EQSA 1K0RA 3AFQA 1UWVA 2BH8A 1EQRA 1IBLL 3ERSX 5IP7G 1IBML 3A0JA 2VUMG 1G6PA 4JI7L 3RR5A 3UDXA 4HIOA 3W5OA 1BKBA 3M3YH 1NBWA 2Q2TA 1WCMG 4A3JH 1K73C 1N34Q 3HOXH 4JG2A 1VQMA 3UDIA 1I5FA 3H15A 4BXXH 4DK6C 2UUBL 3D0FA 4GN5A 1QZGA 4LF9L 2B63H 2R7ZG 1N33L 2NZHA 2D0PA 4O0AA 3H0GH 4QIWE 4PMWA 2H5XA 4DR2L 1YI2A 1FJGL 4LUZA 4QGUA 1BBWA 1PH6A 1Q12A 5IP9G 2JA5H 4A3EH 2R7FA 1LTLA 1WI5A 3UE0A 1TWFH 5LMNQ 2JA6H 3H3VH 1VQHA 3PGZA 4AYBE 1SFOH 1KD1C 4IJLA 1TXYA 4A3KH 1LYLA 1EIYB 3GO5A 2WB1G 3A5ZB 4GOPB 3S15H 3HOYG 2K14A 3TEHB 5IYCG 5FJ8H 4DV2Q 5LMUQ 3LGJA 4LFCL 4HJ9A 3KFUA 1PA6A 1SN8A 2YTYA 4LWCA 2I5HA 1YVCA 4GOPA 4POGA 4OWWB 3I4MG 2FXQA 1KRTA 1PHJA 2OCEA 1MJCA 4QY7A 4QQBX 2ZTEA 3TS0A 2UUCL 1VQFA 1XNQL 4DUYL 1W3SA 1XNRQ 4FDBA 3S1NH 1PV4A 4X64Q 2I5MX 1HNXL 4POFA 4J15A 1HR0Q 2ZM6L 1UE5A 1TWHH 3STBD 4NXML 1OXTA 4A3GG 4B3SL 4A93G 4B3TQ 3M4QA 5FLMH 3M85A 5E7NA 3K81C 1N36L 2CFMA 1JB7A 1HNZL 4YCUA 1HZCA 5M3FG 3T1YL 2YYZA 4JI2L 4DV7L 4OO1G 4A3LH 1VQDA 2YU9H 4KHPQ 4DR6Q 3PV0A 2JEBI 4JI6Q 3E9IA 1PH5A 1YNXA 1B70B 4K0KL 5M3MH 1T9HA 4DR1Q 2VW9A 5GAEC 1PFSA 1I3QH 1VQJA 2E5LL 1TWAH 5GQOA 2XGTA 4YHHL 1DGSA 1CKOA 2Y0SG 3PO3G 3RNUA 1IBLQ 1IBMQ 4JI1Q 4DAMA 3RN2A 1NMGA 1N32Q 5C3EH 4YCVA 1PYBA 4JCVE 4DV6Q 1Y1WH 3EBEA 4JOIA 3U4ZA 1VQ7A 3RLFA 4JI0Q 1IL2A 4DK3C 4DV3L 2UUBQ 2R93H 2A1AA 3CAMA 5C4XH 5C44G 1VQOA 2NVYH 4KI0A 1PH9A 3HKZE 1NY4A 4A3DG 3KYHC 4X65L 2ALYB 4HIMA 2ES2A 1D7QA 5M5YH 3RN5A 3TS2A 3PO2G 3EN2A 2N78A 3J81i 3D31A 4OX9L 1S3OA 1EIFA 2CWAA 2CWPA 3MEFA 1ASZA 1XPUA 3S1RH 2JEAI 4GNXB 3T1HL 3F1ZA 5LMNL 1PH7A 1YHBA 1LM0A 3CCJA 4WJ4A 5IYDG 4APVA 1FVIA 4L5SA 3I4OA 1GKHA 3GDEA 4LF5Q 4R4TA 1YZ6A 3J81c 5LMUL 4DV2L 3HOZG 1H95A 4IPHA 1X55A 1NJIC 1Y1VH 3RLNA 3TRZA 4DR3L 1J5EQ 2AMCB 4B3SQ 1JJGA 1FL0A 4LF8L 1XNRL 1S72A 2LSSA 3EIVA 4JI5L 4GKJQ 2PI2E 2WP8J 1HNZQ 1KHIA 2ZJRA 4IPDA 1UE1A 4JI2Q 5M5WH 1M1KC 5FLXc 2MO0A 2JA7G 3W1BA 2R92G 2JJQA 5GADC 4LFBQ 1WJJA 3J80i 2PNHA 3RLOA 2YV5A 5C0XJ 4A3FG 4L5QA 3KJPA 2KENA 2KHIA 3PUWA 4QJFA 4K0KQ 1HJPA 4XTCS 5BR8Q 1XPOA 1GO3E 3S1MH 4B3MQ 2AWOA 4DR6L 4PG3A 4GS3A 4YCWA 4JI6L 3OW2A 4JYAQ 1VQEA 3HFZB 3TREA 1EWIA 3FKIH 2WB1E 1IXRA 2KCTA 3NEMA 4H02A 4RMFA 2GN5A 2N3SA 2HT1A 1X3EA 4YWLA 4C3IH 4A3BG 4OWTB 4A3CG 4JI1L 1Y14B 2LXJA 1N32L 1OXUA 5IP7H 1VQKA 2VUMH 4DV3Q 1XMQQ 3HOUG 4DV6L 5AJ3Q 4JI0L 2UXCL 2RCNA 4X65Q 1WCMH 2NVTH 3MXNB 2WAQG 5J3BA 5C0XG 1YJ9A 1JE5A 1I6HH 4LF7Q 2D62A 2R7ZH 2A8VA 4OX9Q 4IPCA 2ZTCA 3SGIA 1A62A 4R4QA 2AWNA 4UP7A 5IP9H 3T1HQ 1K8AC 3S14H 1U0LA 1X54A 3CC7A 5C0XI 4EQ5A 1EYGA 2L15A 2QA4A 2EXDA 2VY3A 2K4KA 1PH4A 4DV0L 3HOYH 5IYCH 2GVBA 2Y0SE 2ZTDA 4DR5Q 4LF5L 1SROA 1KAWA 2HIVA 3I4MH 3BU2A 4DR3Q 1VQGA 4NB3A 1K8GA 1E3PA 4LF8Q 2IX1A 3S2DH 2VQEQ 4JI5Q 2PI2A 4MNOA 4P75A 1J5EL 2HHHL 3M4OH 1N9WA 1UE6A 1FGUA 3PSIA 3W1GA 3KDFB 5IYBG 4NPSA 4A3GH 1HNWQ 1KL9A 4A93H 4GKJL 2IY5B 3ULJA 4OONA 4LFAQ 1KIXA 3GTKH 4A3MG 4A75A 1GM5A 4JBKA 3ULPA 1J6QA 1X6OA 3KDFA 2RHQB 5M3FH 4BY1H 1K9MC 3G6EA 1OTCA 4LFBL 1PYSB 2VL6A 4DNIA 1VQAA 2NN6G 2NVXH 3F2CA 3UDGA 3WWVA 3F2BA 1KC8C 5BR8L 4UP9A 1NTGA 4HJAA 2IHEA 2VQFL 1JJ2A 4B3ML 2F4VQ 2JK8A 2HIXA 4GLVB 4JYAL 1BVSA 1V1QA 1WYDA 2Z6KC 3CW2C 3DM3A 3PUVA 3G4SA 1P16A 1AE2A 2A19A 2E2JH 1X56A 2MQHA 4LUVA 2JA9A 5ELNA 3HOWG 3PO3H 2DGYA 2JE6I 2NN6I 2V1CC 3UE1A 3E9HA 3STBC 4A3IG 2OWOA 1VQ4A 3S1QH 4LF6Q 3K80C 4YWKA 4GN4B 1JMCA 4JV5L 3J7ZC 3U58A 2UXCQ 2HQLA 1Q1BA 1XMQL 2E8GA 5AJ3L 1XTDA 5JJKA 2LXKA 2K5VA 5C44H 1A8VA 4JI4Q 4A3DH 1M90C 1YJNA 1YJWA 3F8TA 1XMOL 4LF7L 3J7A5 5M5XH 1XPRA 3GD7A 3PIOA 3PO2H 1D8LA 3I4NH 4IPGA 2UU9L 3PUYA 1X9NA 1N8RC 4IO9A 1OXVA 1Y1WG 1YHQA 1VCIA 1CKMA 4DV0Q 3BZCA 3PF5A 1L1OC 4ME3A 5IYDH 2OQKA 5IT9c 3CMEA 2PMZE 1UEBA 4PZ8A 4TQUS 4X6AH 1L0WA 4AQYL 3Q8DA 4X66Q 1YIJA 4C3HH 4R1JA 2CKZB 1YHAA 3VDYA 1MJEA 3HOZH 4DR5L 2N49A 4UY8C 5JEAJ 1SLJA 1LUZA 4QL5A 1Z47A 3PIPA 4IOCA 2AKWB 2HHHQ 1B8AA 2VQEL 3ER0A 2IT1A 1TWCH 2ATWA 1PH8A 3HOVG 1TWGH 4A4IA 5EAYA 1HNWL 1PVOA 1E24A 3CQZH 3RZDH 2WAQE 3L2PA 4HJ8A 3CP0A 2ID0A 4LF4L 4LFAL 2JA8G 4IFDJ 4MTNA 2JA7H 2R92H 1Z9FA 4A3FH 2OTLA 5HGQA 1AE3A 2VQFQ 1HZBA 3ICEA 3PUZA 4DKAC 3S16H 5DLQE 4JI3L 4OXPA 4PZ7A 4LUOA 1Q46A 4BBRG 2F4VL 4JBJA 2MFIA 1BBUA 3CCMA 2K50A 5JEAG 4BY7G 2BH2A 4JI8L 4DR4Q 1X3GA 3CC2A 3K0XA 4A3BH 3TQYA 4JV5Q 4A3CH 1Q1EA 4LF6L 1VQNA 1NMFA 2Q2UA 1SE8A 2UXBQ 4PZ6A 2UXDQ 3BJUA 3HOUH 4Y52H 4BBSG 1E1TA 3IRBA 3F2DA 1VQ9A 1MKHA 4LNQA 4IFDG 1SRUA 5H1SE 1HR0W 3I7FA 1XMOQ 2B3GA 2KBNA 3A74A 4JI4L 3FKIG 2MNAA 3K7UC 2MO1A 3CPWA 1W2BA 4DR7L 1I94L 2KHJA 3JC66 2UU9Q 1CSQA 3AYHB 2VS1A 4BA1I 3JAMi 2Z6KA 4L5TA 1VS0A 4O2DA 4IFDI 1XJVA 5C4JH 4GNXC 1QVFA 3AEVA 3U50C 5JJIA 2I0QA 3M7NA 3I55A 1PH2A 3GTGH 1HZAA 4A3JG 1O7IA 4IJHA 2F52A 3HKSA 4EX5A 3HOXG 4AQYQ 1IBKQ 4BXXG 4DV5Q 2PQAB 2B63G 1KXLA 2CCZA 4X66L 3NENA 4GKKQ 4DAYB 3JAMc 3H0GG 1HZ9A 1QVCA 2YTXA 3G48A 3S24A 1I50H 2JA5G 4NXNQ 4A3EG 2PQAA 4HIKA 5ELOA 4B3RQ 4HJ5A 1YEZA 4GLAC 1Q86C 2JA6G 2N8NA 1PH1A 2NVQH 4DV4Q 5JJLA 1CUKA 1R9TH 4MZ9A 3ULLA 1KRSA 5IWAQ 4A3KG 4YY3Q 5IYBH 3CF5A 2IX0A 1EUJA 4LF4Q 1L1OB 2UUAQ 5FJ8G 3GTPH 3GTMH 4TVAB 4A3MH 2OQ0A 3L0OA 1UE7A 3M4PA 4KHZA 4DUZL 3CCRA 3H3VI 1L1OA 5GAHC 4P74A 4R4IA 2ASBA 3FHWA 3CCUA 1VQCA 4JI3Q 3DLLA 2WFWA 3G71A 2AHOB 3B6YA 1B7YB 2K75A 2K5NA 1ASYA 3CCVA 3GTOH 4JI8Q 3OYYA 4UP8A 4HJ7A 3CC4A 4DV1L 5FLMG 3UDFA 4KLKA 4XIGS 3OTOL 3A5UA 3HOWH 1V9PA 4A3IH 1PH3A 4DR4L 2YTVA 1E7ZA 2R7DA 4UPAA 1KQSA 4BY1G 4A3LG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IYJ B;  1CKN B;  4P73 A;  2BA0 A;  1G29 1;  4LW1 A;  1GVP A;  2I5L X;  4AYB G;  3U4V A;  4X62 Q;  5IE8 A;  2C35 B;  3CCS A;  1QVG A;  5M3M G;  2UXB L;  3KOJ A;  1CSP A;  2UXD L;  1VQ8 A;  4ALP A;  1VQ6 A;  1CKN A;  1K83 H;  4R4O A;  4OWX B;  4DR7 Q;  2NZO A;  3KJO A;  1EFW A;  1Q81 C;  1I94 Q;  4L5R C;  5HY6 A;  3NBH B;  1GD7 A;  4RG1 A;  4HID A;  1S40 A;  4OO1 I;  3CPF A;  3I56 A;  3GTL H;  3S17 H;  2E2H H;  5GRO A;  5IY0 A;  1A0I A;  1RL2 A;  5C3E G;  1OXX K;  2IHF A;  1U5K A;  1X65 A;  1RIP A;  4JI7 Q;  1SR3 A;  3K8A A;  2Q2I A;  3AFP A;  3K7A H;  4GOP C;  4AIM A;  4JC0 A;  4JBM A;  1C0A A;  4BA2 I;  2R93 G;  4P72 A;  1X3F A;  5C4X G;  1WFQ A;  1IBK L;  1C9O A;  1NE3 A;  2ZJP A;  4LF9 Q;  1VQL A;  4DV5 L;  1N34 L;  3M9B A;  4C3J H;  1N33 Q;  2CQO A;  1P8L A;  1FJG Q;  3J81 j;  4DR2 Q;  1Q8K A;  3PF4 A;  1VQI A;  4GKK L;  4AH6 A;  2RF4 A;  4JBW A;  4NXN L;  2EIF A;  3AQQ A;  3KLW A;  4A76 A;  3I4N G;  2K52 A;  4WJ3 M;  1Q7Y C;  1L2F A;  4B3R L;  2VZA A;  1VQ5 A;  1JT8 A;  4DV4 L;  3HOV H;  2DUD A;  5IWA L;  5K36 G;  1QUQ B;  4YY3 L;  5GAG C;  3GTJ H;  2RHS B;  4DPG A;  2XTI A;  4DUZ Q;  1C7Y A;  4GNX A;  4LFC Q;  2UUA L;  2JA8 H;  2GVA A;  3KF8 B;  1Q82 C;  4YWM A;  2QEX A;  3FP9 A;  1QUQ A;  2Z0S A;  2Q2H A;  1JJC B;  1Y1V G;  3PUX A;  4DUY Q;  2UUC Q;  4P71 A;  1XNQ Q;  1HNX Q;  4NXM Q;  2ZM6 Q;  5LMN W;  3GTQ H;  3RZO H;  4IOA A;  2F3I A;  3L7Z C;  4DV1 Q;  2B29 A;  3HKZ G;  1EOV A;  1SMX A;  4BBR H;  4X64 L;  2QGQ A;  3CMA A;  3OTO Q;  1N36 Q;  1HR0 L;  1AH9 A;  3PCO B;  4JOI C;  4R4C A;  4B3T L;  4BY7 H;  3T1Y Q;  1IZ6 A;  1OXS C;  1K3R A;  2BA1 A;  1MIU A;  4DV7 Q;  1YIT A;  2E2I H;  1QZH A;  4GLX A;  1E1O A;  3NEL A;  3BZK A;  1VQB A;  3KF6 B;  3ZJY C;  2ZJQ A;  1G51 A;  1V43 A;  2KCM A;  4Y7N H;  2JQO A;  4X62 L;  4KHP L;  4C2M H;  1EQQ A;  2E5L Q;  4BBS H;  4YHH Q;  2OTJ A;  1HH2 P;  2VNU D;  3KF6 A;  3CCE A;  3CXC A;  1YBY A;  1E22 A;  4DR1 L;  3S2H H;  2K5H A;  2R6G A;  3E0E A;  3I2Z A;  2D0O A;  4GN3 B;  3CCQ A;  1A63 A;  3J80 c;  1WOC A;  3CD6 A;  3CCL A;  1VQP A;  2EQS A;  1K0R A;  3AFQ A;  1UWV A;  2BH8 A;  1EQR A;  1IBL L;  3ERS X;  5IP7 G;  1IBM L;  3A0J A;  2VUM G;  1G6P A;  4JI7 L;  3RR5 A;  3UDX A;  4HIO A;  3W5O A;  1BKB A;  3M3Y H;  1NBW A;  2Q2T A;  1WCM G;  4A3J H;  1K73 C;  1N34 Q;  3HOX H;  4JG2 A;  1VQM A;  3UDI A;  1I5F A;  3H15 A;  4BXX H;  4DK6 C;  2UUB L;  3D0F A;  4GN5 A;  1QZG A;  4LF9 L;  2B63 H;  2R7Z G;  1N33 L;  2NZH A;  2D0P A;  4O0A A;  3H0G H;  4QIW E;  4PMW A;  2H5X A;  4DR2 L;  1YI2 A;  1FJG L;  4LUZ A;  4QGU A;  1BBW A;  1PH6 A;  1Q12 A;  5IP9 G;  2JA5 H;  4A3E H;  2R7F A;  1LTL A;  1WI5 A;  3UE0 A;  1TWF H;  5LMN Q;  2JA6 H;  3H3V H;  1VQH A;  3PGZ A;  4AYB E;  1SFO H;  1KD1 C;  4IJL A;  1TXY A;  4A3K H;  1LYL A;  1EIY B;  3GO5 A;  2WB1 G;  3A5Z B;  4GOP B;  3S15 H;  3HOY G;  2K14 A;  3TEH B;  5IYC G;  5FJ8 H;  4DV2 Q;  5LMU Q;  3LGJ A;  4LFC L;  4HJ9 A;  3KFU A;  1PA6 A;  1SN8 A;  2YTY A;  4LWC A;  2I5H A;  1YVC A;  4GOP A;  4POG A;  4OWW B;  3I4M G;  2FXQ A;  1KRT A;  1PHJ A;  2OCE A;  1MJC A;  4QY7 A;  4QQB X;  2ZTE A;  3TS0 A;  2UUC L;  1VQF A;  1XNQ L;  4DUY L;  1W3S A;  1XNR Q;  4FDB A;  3S1N H;  1PV4 A;  4X64 Q;  2I5M X;  1HNX L;  4POF A;  4J15 A;  1HR0 Q;  2ZM6 L;  1UE5 A;  1TWH H;  3STB D;  4NXM L;  1OXT A;  4A3G G;  4B3S L;  4A93 G;  4B3T Q;  3M4Q A;  5FLM H;  3M85 A;  5E7N A;  3K81 C;  1N36 L;  2CFM A;  1JB7 A;  1HNZ L;  4YCU A;  1HZC A;  5M3F G;  3T1Y L;  2YYZ A;  4JI2 L;  4DV7 L;  4OO1 G;  4A3L H;  1VQD A;  2YU9 H;  4KHP Q;  4DR6 Q;  3PV0 A;  2JEB I;  4JI6 Q;  3E9I A;  1PH5 A;  1YNX A;  1B70 B;  4K0K L;  5M3M H;  1T9H A;  4DR1 Q;  2VW9 A;  5GAE C;  1PFS A;  1I3Q H;  1VQJ A;  2E5L L;  1TWA H;  5GQO A;  2XGT A;  4YHH L;  1DGS A;  1CKO A;  2Y0S G;  3PO3 G;  3RNU A;  1IBL Q;  1IBM Q;  4JI1 Q;  4DAM A;  3RN2 A;  1NMG A;  1N32 Q;  5C3E H;  4YCV A;  1PYB A;  4JCV E;  4DV6 Q;  1Y1W H;  3EBE A;  4JOI A;  3U4Z A;  1VQ7 A;  3RLF A;  4JI0 Q;  1IL2 A;  4DK3 C;  4DV3 L;  2UUB Q;  2R93 H;  2A1A A;  3CAM A;  5C4X H;  5C44 G;  1VQO A;  2NVY H;  4KI0 A;  1PH9 A;  3HKZ E;  1NY4 A;  4A3D G;  3KYH C;  4X65 L;  2ALY B;  4HIM A;  2ES2 A;  1D7Q A;  5M5Y H;  3RN5 A;  3TS2 A;  3PO2 G;  3EN2 A;  2N78 A;  3J81 i;  3D31 A;  4OX9 L;  1S3O A;  1EIF A;  2CWA A;  2CWP A;  3MEF A;  1ASZ A;  1XPU A;  3S1R H;  2JEA I;  4GNX B;  3T1H L;  3F1Z A;  5LMN L;  1PH7 A;  1YHB A;  1LM0 A;  3CCJ A;  4WJ4 A;  5IYD G;  4APV A;  1FVI A;  4L5S A;  3I4O A;  1GKH A;  3GDE A;  4LF5 Q;  4R4T A;  1YZ6 A;  3J81 c;  5LMU L;  4DV2 L;  3HOZ G;  1H95 A;  4IPH A;  1X55 A;  1NJI C;  1Y1V H;  3RLN A;  3TRZ A;  4DR3 L;  1J5E Q;  2AMC B;  4B3S Q;  1JJG A;  1FL0 A;  4LF8 L;  1XNR L;  1S72 A;  2LSS A;  3EIV A;  4JI5 L;  4GKJ Q;  2PI2 E;  2WP8 J;  1HNZ Q;  1KHI A;  2ZJR A;  4IPD A;  1UE1 A;  4JI2 Q;  5M5W H;  1M1K C;  5FLX c;  2MO0 A;  2JA7 G;  3W1B A;  2R92 G;  2JJQ A;  5GAD C;  4LFB Q;  1WJJ A;  3J80 i;  2PNH A;  3RLO A;  2YV5 A;  5C0X J;  4A3F G;  4L5Q A;  3KJP A;  2KEN A;  2KHI A;  3PUW A;  4QJF A;  4K0K Q;  1HJP A;  4XTC S;  5BR8 Q;  1XPO A;  1GO3 E;  3S1M H;  4B3M Q;  2AWO A;  4DR6 L;  4PG3 A;  4GS3 A;  4YCW A;  4JI6 L;  3OW2 A;  4JYA Q;  1VQE A;  3HFZ B;  3TRE A;  1EWI A;  3FKI H;  2WB1 E;  1IXR A;  2KCT A;  3NEM A;  4H02 A;  4RMF A;  2GN5 A;  2N3S A;  2HT1 A;  1X3E A;  4YWL A;  4C3I H;  4A3B G;  4OWT B;  4A3C G;  4JI1 L;  1Y14 B;  2LXJ A;  1N32 L;  1OXU A;  5IP7 H;  1VQK A;  2VUM H;  4DV3 Q;  1XMQ Q;  3HOU G;  4DV6 L;  5AJ3 Q;  4JI0 L;  2UXC L;  2RCN A;  4X65 Q;  1WCM H;  2NVT H;  3MXN B;  2WAQ G;  5J3B A;  5C0X G;  1YJ9 A;  1JE5 A;  1I6H H;  4LF7 Q;  2D62 A;  2R7Z H;  2A8V A;  4OX9 Q;  4IPC A;  2ZTC A;  3SGI A;  1A62 A;  4R4Q A;  2AWN A;  4UP7 A;  5IP9 H;  3T1H Q;  1K8A C;  3S14 H;  1U0L A;  1X54 A;  3CC7 A;  5C0X I;  4EQ5 A;  1EYG A;  2L15 A;  2QA4 A;  2EXD A;  2VY3 A;  2K4K A;  1PH4 A;  4DV0 L;  3HOY H;  5IYC H;  2GVB A;  2Y0S E;  2ZTD A;  4DR5 Q;  4LF5 L;  1SRO A;  1KAW A;  2HIV A;  3I4M H;  3BU2 A;  4DR3 Q;  1VQG A;  4NB3 A;  1K8G A;  1E3P A;  4LF8 Q;  2IX1 A;  3S2D H;  2VQE Q;  4JI5 Q;  2PI2 A;  4MNO A;  4P75 A;  1J5E L;  2HHH L;  3M4O H;  1N9W A;  1UE6 A;  1FGU A;  3PSI A;  3W1G A;  3KDF B;  5IYB G;  4NPS A;  4A3G H;  1HNW Q;  1KL9 A;  4A93 H;  4GKJ L;  2IY5 B;  3ULJ A;  4OON A;  4LFA Q;  1KIX A;  3GTK H;  4A3M G;  4A75 A;  1GM5 A;  4JBK A;  3ULP A;  1J6Q A;  1X6O A;  3KDF A;  2RHQ B;  5M3F H;  4BY1 H;  1K9M C;  3G6E A;  1OTC A;  4LFB L;  1PYS B;  2VL6 A;  4DNI A;  1VQA A;  2NN6 G;  2NVX H;  3F2C A;  3UDG A;  3WWV A;  3F2B A;  1KC8 C;  5BR8 L;  4UP9 A;  1NTG A;  4HJA A;  2IHE A;  2VQF L;  1JJ2 A;  4B3M L;  2F4V Q;  2JK8 A;  2HIX A;  4GLV B;  4JYA L;  1BVS A;  1V1Q A;  1WYD A;  2Z6K C;  3CW2 C;  3DM3 A;  3PUV A;  3G4S A;  1P16 A;  1AE2 A;  2A19 A;  2E2J H;  1X56 A;  2MQH A;  4LUV A;  2JA9 A;  5ELN A;  3HOW G;  3PO3 H;  2DGY A;  2JE6 I;  2NN6 I;  2V1C C;  3UE1 A;  3E9H A;  3STB C;  4A3I G;  2OWO A;  1VQ4 A;  3S1Q H;  4LF6 Q;  3K80 C;  4YWK A;  4GN4 B;  1JMC A;  4JV5 L;  3J7Z C;  3U58 A;  2UXC Q;  2HQL A;  1Q1B A;  1XMQ L;  2E8G A;  5AJ3 L;  1XTD A;  5JJK A;  2LXK A;  2K5V A;  5C44 H;  1A8V A;  4JI4 Q;  4A3D H;  1M90 C;  1YJN A;  1YJW A;  3F8T A;  1XMO L;  4LF7 L;  3J7A 5;  5M5X H;  1XPR A;  3GD7 A;  3PIO A;  3PO2 H;  1D8L A;  3I4N H;  4IPG A;  2UU9 L;  3PUY A;  1X9N A;  1N8R C;  4IO9 A;  1OXV A;  1Y1W G;  1YHQ A;  1VCI A;  1CKM A;  4DV0 Q;  3BZC A;  3PF5 A;  1L1O C;  4ME3 A;  5IYD H;  2OQK A;  5IT9 c;  3CME A;  2PMZ E;  1UEB A;  4PZ8 A;  4TQU S;  4X6A H;  1L0W A;  4AQY L;  3Q8D A;  4X66 Q;  1YIJ A;  4C3H H;  4R1J A;  2CKZ B;  1YHA A;  3VDY A;  1MJE A;  3HOZ H;  4DR5 L;  2N49 A;  4UY8 C;  5JEA J;  1SLJ A;  1LUZ A;  4QL5 A;  1Z47 A;  3PIP A;  4IOC A;  2AKW B;  2HHH Q;  1B8A A;  2VQE L;  3ER0 A;  2IT1 A;  1TWC H;  2ATW A;  1PH8 A;  3HOV G;  1TWG H;  4A4I A;  5EAY A;  1HNW L;  1PVO A;  1E24 A;  3CQZ H;  3RZD H;  2WAQ E;  3L2P A;  4HJ8 A;  3CP0 A;  2ID0 A;  4LF4 L;  4LFA L;  2JA8 G;  4IFD J;  4MTN A;  2JA7 H;  2R92 H;  1Z9F A;  4A3F H;  2OTL A;  5HGQ A;  1AE3 A;  2VQF Q;  1HZB A;  3ICE A;  3PUZ A;  4DKA C;  3S16 H;  5DLQ E;  4JI3 L;  4OXP A;  4PZ7 A;  4LUO A;  1Q46 A;  4BBR G;  2F4V L;  4JBJ A;  2MFI A;  1BBU A;  3CCM A;  2K50 A;  5JEA G;  4BY7 G;  2BH2 A;  4JI8 L;  4DR4 Q;  1X3G A;  3CC2 A;  3K0X A;  4A3B H;  3TQY A;  4JV5 Q;  4A3C H;  1Q1E A;  4LF6 L;  1VQN A;  1NMF A;  2Q2U A;  1SE8 A;  2UXB Q;  4PZ6 A;  2UXD Q;  3BJU A;  3HOU H;  4Y52 H;  4BBS G;  1E1T A;  3IRB A;  3F2D A;  1VQ9 A;  1MKH A;  4LNQ A;  4IFD G;  1SRU A;  5H1S E;  1HR0 W;  3I7F A;  1XMO Q;  2B3G A;  2KBN A;  3A74 A;  4JI4 L;  3FKI G;  2MNA A;  3K7U C;  2MO1 A;  3CPW A;  1W2B A;  4DR7 L;  1I94 L;  2KHJ A;  3JC6 6;  2UU9 Q;  1CSQ A;  3AYH B;  2VS1 A;  4BA1 I;  3JAM i;  2Z6K A;  4L5T A;  1VS0 A;  4O2D A;  4IFD I;  1XJV A;  5C4J H;  4GNX C;  1QVF A;  3AEV A;  3U50 C;  5JJI A;  2I0Q A;  3M7N A;  3I55 A;  1PH2 A;  3GTG H;  1HZA A;  4A3J G;  1O7I A;  4IJH A;  2F52 A;  3HKS A;  4EX5 A;  3HOX G;  4AQY Q;  1IBK Q;  4BXX G;  4DV5 Q;  2PQA B;  2B63 G;  1KXL A;  2CCZ A;  4X66 L;  3NEN A;  4GKK Q;  4DAY B;  3JAM c;  3H0G G;  1HZ9 A;  1QVC A;  2YTX A;  3G48 A;  3S24 A;  1I50 H;  2JA5 G;  4NXN Q;  4A3E G;  2PQA A;  4HIK A;  5ELO A;  4B3R Q;  4HJ5 A;  1YEZ A;  4GLA C;  1Q86 C;  2JA6 G;  2N8N A;  1PH1 A;  2NVQ H;  4DV4 Q;  5JJL A;  1CUK A;  1R9T H;  4MZ9 A;  3ULL A;  1KRS A;  5IWA Q;  4A3K G;  4YY3 Q;  5IYB H;  3CF5 A;  2IX0 A;  1EUJ A;  4LF4 Q;  1L1O B;  2UUA Q;  5FJ8 G;  3GTP H;  3GTM H;  4TVA B;  4A3M H;  2OQ0 A;  3L0O A;  1UE7 A;  3M4P A;  4KHZ A;  4DUZ L;  3CCR A;  3H3V I;  1L1O A;  5GAH C;  4P74 A;  4R4I A;  2ASB A;  3FHW A;  3CCU A;  1VQC A;  4JI3 Q;  3DLL A;  2WFW A;  3G71 A;  2AHO B;  3B6Y A;  1B7Y B;  2K75 A;  2K5N A;  1ASY A;  3CCV A;  3GTO H;  4JI8 Q;  3OYY A;  4UP8 A;  4HJ7 A;  3CC4 A;  4DV1 L;  5FLM G;  3UDF A;  4KLK A;  4XIG S;  3OTO L;  3A5U A;  3HOW H;  1V9P A;  4A3I H;  1PH3 A;  4DR4 L;  2YTV A;  1E7Z A;  2R7D A;  4UPA A;  1KQS A;  4BY1 G;  4A3L G; 
#chains in the Genus database with same CATH topology
 4P73 A;  3QOJ A;  3S15 B;  1R9T A;  4AYB G;  4X62 Q;  2C35 B;  1QVG A;  2UXD L;  3EVQ A;  3ORR A;  4L8J A;  2VPS A;  1CKN A;  2UVU A;  3EPG A;  2QF7 A;  1K83 H;  2WKC A;  3BAA A;  3KJO A;  1EFW A;  4BS9 A;  4IWY A;  1O7Y A;  4YAK B;  1UC8 A;  4HID A;  4OO1 I;  3CPF A;  3GTL H;  2RKS A;  1A0I A;  1U5K A;  2L55 A;  3RAX A;  4JI7 Q;  1SR3 A;  2WKD A;  3AFP A;  4EGQ A;  5KX5 F;  3OMC A;  3K7A H;  1A15 A;  2R61 A;  1D1K A;  4GOP C;  5FK9 C;  4YQW A;  1ZXT A;  2DPI A;  5C4X G;  3A7A B;  1NE3 A;  3N43 B;  3MEH A;  4TV8 F;  1ENC A;  4DV5 L;  4C3J H;  5ELC A;  2MUY A;  1FJG Q;  1KDA A;  1PRT C;  2O2L D;  3P1H A;  4RNN A;  1KAA A;  3ETH A;  3IG0 A;  1K83 B;  3DXJ C;  1V1P A;  4RCO A;  3MR3 A;  3I4N G;  4WJ3 M;  4DV2 H;  4IUU A;  1EUC B;  3GTL B;  1CQI B;  5C8Y F;  2Z9H A;  2XSC A;  3H3V C;  5KFJ A;  2IL8 A;  1TQO A;  4C5A A;  2BQ3 A;  1F2Y A;  2UUA L;  2GVA A;  4KD4 A;  5FO8 B;  1QNK A;  3I4L A;  2Q2H A;  1JJC B;  4HCE A;  4DUY Q;  2CQA A;  2B2T C;  4P71 A;  4C3J B;  3L4K A;  1HNX Q;  3RZO H;  2IA6 A;  2EY5 A;  4PWQ A;  4ME5 A;  3WDN A;  3CMA A;  2XRS D;  3M9M B;  4JOI C;  3EQL C;  3T1Y Q;  4DR1 H;  2NU9 B;  1QZH A;  1L0Y B;  2ZJQ A;  1G51 A;  2I46 A;  4ODG A;  4Y7N H;  5JVH 3;  1A6X A;  4IRD A;  2JN4 A;  3K3V A;  4KHP L;  2CW0 C;  1EQQ A;  1SNQ A;  4BBS H;  1PLF A;  1N32 H;  4EGV A;  1VF7 A;  2W70 A;  1E22 A;  1GLV A;  2K5H A;  2R6G A;  3I2Z A;  1CT1 D;  3RZO B;  2EYF A;  1EYZ A;  1WOC A;  2V4D A;  3CD6 A;  3UFX B;  1Y1V A;  1HFG A;  4NW2 A;  3VA5 A;  3OHA A;  2BH8 A;  1IBM L;  1EQR A;  3KHG A;  1JOK A;  2MJ8 A;  3ERS X;  5KGU A;  2F4I A;  5I47 A;  2FKL A;  3UDX A;  4I4T F;  1AZP A;  3RTX A;  2Q2T A;  4OGQ C;  4A3J H;  2HVR A;  5D8D A;  1SNO A;  3H15 A;  5DEH A;  1DV2 A;  5H80 A;  4Y7N B;  2AQ3 B;  2F0M A;  4J9N A;  4YJ3 F;  1U4P A;  4K5V A;  4UCV A;  4BBS B;  4PDB A;  5A35 A;  4O0A A;  1TAE A;  3Q1K A;  2H5X A;  1BBW A;  1PH6 A;  4A3E H;  2IW3 A;  2MP1 A;  4J1M A;  2NU8 B;  2JA6 H;  4ZOL F;  3PGZ A;  2A74 C;  1KD1 C;  3KLS X;  2W6O A;  5KKN B;  3F8N A;  2W57 A;  5LXT F;  1WTV A;  3E3X A;  3GO5 A;  4CJ2 C;  2PZW A;  1GSH A;  1J5E H;  4FM9 A;  5FJ8 H;  3NXW A;  4DV2 Q;  1C3O A;  4LFC L;  3H4B A;  4OEL B;  2L1B A;  4A3J B;  4LWC A;  1N36 H;  2I5H A;  2DNE A;  3VPB A;  1KRT A;  2EY6 A;  5EWG A;  1WTQ A;  1F77 A;  1MJC A;  1XNQ L;  1PZJ D;  3A55 A;  2I5M X;  4NXM L;  5KG4 A;  4B3S L;  4A3E B;  4A93 G;  4K0K H;  2A6E C;  2B2U C;  3M4Q A;  5FLM H;  1B1Z A;  3M85 A;  2JA6 B;  1JB7 A;  3H0G A;  4B3M H;  5EKL A;  1HNZ L;  4YHH H;  2RDJ A;  5M3F G;  5BMV F;  2IMW P;  2F0E A;  2YYZ A;  3CHB D;  4DV7 L;  4ECW A;  1AW7 A;  4A3L H;  4GZY C;  2KEE A;  4HTH A;  2YU9 H;  3PIP 3;  3E9I A;  2EXZ A;  3MFG A;  2JEF A;  1B70 B;  1T9H A;  4DR1 Q;  3R2T A;  5GAE C;  1VQJ A;  1A2U A;  4DNT B;  1JDE A;  1TWA H;  4ME6 A;  1ENF A;  5KG0 A;  5DNF A;  2Y0S G;  2ASJ A;  1XMQ H;  2RCF A;  4F88 A;  3RN2 A;  1EZ8 A;  4O4I F;  4TQS A;  3BG3 A;  2F0Q A;  1N32 Q;  1PYB A;  1U4R A;  1X3P A;  1TWH A;  3U4Z A;  1VQ7 A;  4JI0 Q;  3RLF A;  5KFP A;  4OX9 H;  5KG6 A;  1ULZ A;  4CKB A;  3T1H H;  2A1A A;  3CAM A;  5C44 G;  1VQO A;  2YU9 B;  4KI0 A;  2AGQ A;  4QIW A;  2F0K A;  4DL7 A;  2SNM A;  1D7Q A;  3OIQ A;  5M5Y H;  3JSN A;  3BS1 A;  3PO2 G;  1TWA B;  4K5W A;  3NE5 B;  3EN2 A;  2HDL A;  4H0L C;  1S3O A;  3HP3 A;  2JEA I;  3MEF A;  3FMC A;  2YS7 A;  1PXU A;  4WOR A;  3CCJ A;  1GSO A;  4K8I A;  1FVI A;  3SR1 A;  5KNC A;  4L5S A;  1E2V A;  1C4Q A;  4HNV A;  4LF8 H;  1SMY C;  4NDX A;  3MC0 B;  1STE A;  2C9O A;  2O03 A;  3J81 c;  3HOZ G;  2B2V C;  2F0J A;  2KUM A;  1H95 A;  4BWS C;  2EYL A;  4CJ0 B;  1NJI C;  3I3C A;  3RIZ A;  1TS5 A;  2FPI B;  5M5Y B;  1J5E Q;  2AMC B;  1JJG A;  3BVG A;  1XXG A;  5EPL A;  4J9Q A;  3RV4 A;  4K2K A;  4JI5 L;  5T1I A;  1O75 A;  3R93 A;  1IW7 C;  4R9W A;  4FO2 A;  4IPD A;  5A2Q E;  2QEJ C;  3TME A;  1M1K C;  5FLX c;  1SYX B;  2F4V H;  3W1B A;  5GAD C;  4CKE A;  2R8H A;  1YNJ D;  3A7L A;  5DM6 3;  3BDC A;  3AB9 A;  2KEN A;  4K0K Q;  1HJP A;  4XTC S;  4M7E A;  3S1M H;  1GO3 E;  4EBE A;  4C1N K;  4JW0 A;  2AWO A;  4B3M Q;  4DR6 L;  1HXY D;  1F2M A;  2HQE A;  2PW7 A;  4LF6 H;  2K5W A;  5COY A;  3U9S A;  3LML A;  4FF3 A;  1SJH D;  3FKI H;  2ASL A;  2UXC H;  2P0A A;  2AU0 A;  3KLS A;  2DY7 A;  2GN5 A;  2N3S A;  4YWL A;  4WRD A;  4FVM A;  2K6A A;  1S5F D;  3MXP A;  2KSW A;  4A2A A;  5J2U F;  3HOU G;  3HB9 A;  1XMQ Q;  3K3P A;  1UC9 A;  5F9N A;  3MR6 A;  1IOV A;  3HKZ A;  3IFD A;  2Q8R E;  4J9R A;  1WCM H;  1LAB A;  2NVT H;  5BN5 A;  2WAQ G;  3LX0 A;  5C0X G;  2NB0 A;  4IUV A;  3S1M B;  5KT7 A;  2D62 A;  3A54 A;  2R7Z H;  4KKT A;  4XQJ A;  4OX9 Q;  3MWD A;  4IPC A;  5EWF A;  5ELD A;  1A62 A;  4R4Q A;  3SE0 A;  5IP9 H;  3T1H Q;  3V4S A;  4LF5 H;  1QWY A;  1X54 A;  1ZYR D;  3VR2 A;  5BPH A;  2UVR A;  3TP5 A;  1STG A;  5F2D A;  4M9U A;  3PR4 A;  1EYG A;  2C2D A;  1KDB A;  2SNS A;  1SRO A;  4YR2 A;  2AUJ D;  3RAQ A;  1WCM B;  3VYS A;  2NVT B;  2XCL A;  1PRT F;  1VBH A;  4LF8 Q;  3EYY A;  4XX0 B;  1STY A;  3BQ2 A;  1TS2 A;  2R7Z B;  3G6X A;  3FDS A;  4P75 A;  2VQD A;  1DV1 A;  1N9W A;  1BXT A;  5IYB G;  5JH7 F;  3KDF B;  4A3G H;  4NPS A;  1BNC A;  1RDP D;  1NR4 A;  4V19 0;  4OON A;  5KFT A;  5GON F;  3OMG A;  4RB1 A;  1FR3 A;  2RSO A;  3D6C A;  1GM5 A;  2ZDG A;  3ULP A;  1T36 A;  1X6O A;  4QWD A;  5HBR B;  2LKV A;  4LFB L;  1PYS B;  1VQA A;  4EFE A;  5G3L D;  3F2B A;  1KC8 C;  4RKL A;  3A8K E;  1V51 A;  1NTG A;  4HJA A;  2QW7 A;  2F4V Q;  5KFR A;  5L1L A;  4ECZ A;  4C1N I;  1WYD A;  3CW2 C;  1QE6 A;  1NUC A;  2A19 A;  2UXD H;  1SE2 A;  3L9A X;  2JE6 I;  2NN6 I;  3STB C;  2V4R A;  4A3G B;  3Q22 A;  4LF6 Q;  3K80 C;  5KFV A;  3BZD B;  1UAP A;  4K14 A;  1JMC A;  2Q8I B;  2YRX A;  2UXC Q;  2UU9 H;  1GUS A;  1K0S A;  4HR7 A;  5AJ3 L;  5JJK A;  4R8N A;  5CMD A;  1M90 C;  2EDG A;  1YJW A;  2YCH A;  1T5X D;  1EZ6 A;  2PW5 A;  4LF7 L;  2SCU B;  4DLK A;  5M5X H;  1IYV A;  3GD7 A;  2K28 A;  1D8L A;  4DV5 H;  1RK6 A;  2VA3 A;  1QNU A;  1X9N A;  1N8R C;  2J9G A;  4RGM A;  3SDZ A;  4YIJ A;  2XC9 A;  1WR2 A;  3A56 A;  4LSX A;  1CKM A;  3OSP A;  3BZC A;  5IYD H;  4YJ2 F;  1L0W A;  3T13 A;  1JQY D;  5KFK A;  1J9O A;  4J9S A;  5AFW A;  3QG1 A;  5JEA J;  1SLJ A;  4N8F A;  2UUA H;  5FPO A;  3C2P A;  3K5H A;  2L5T A;  3TQT A;  1B8A A;  5HUR A;  5M5X B;  1TT2 A;  3PQI A;  3RGZ A;  1TWC H;  2ATW A;  1PH8 A;  3HOV G;  1TWG H;  4A4I A;  3RD4 A;  3QJY A;  1UNN C;  2K05 A;  1DOK A;  2ZDH A;  1L0X B;  4EBC A;  3L2P A;  4IRC A;  2JA8 G;  3CP0 A;  4EQN A;  4LFA L;  3KXY T;  3GTL A;  3MXG A;  5IOC A;  2R92 H;  3OUZ A;  1BQQ T;  4R8U A;  1QIL A;  3TP7 A;  3L4J A;  4G57 A;  4MHE A;  3NQT A;  4O1N A;  2WE6 A;  2QYZ A;  3HG9 A;  3PUZ A;  3OWF A;  1ZHS A;  5DLQ E;  5I6W A;  3HRZ C;  4OXP A;  3SHL A;  2PO4 A;  3ONA B;  4HNU A;  5KEE A;  1PYW D;  2K50 A;  3JRX A;  4BY7 G;  3Q23 A;  1X3G A;  5KFE A;  1TWC B;  5C5L A;  4IZO A;  1TWG B;  1IKL A;  4Y8V B;  2WAC A;  4DR7 H;  2F0V A;  2PCF B;  1GGO A;  3TQ1 A;  4MTE A;  3NTI A;  2UXD Q;  3BJU A;  4KN4 C;  3RV3 A;  2JA8 B;  2R92 B;  3IRB A;  4IFD G;  1MKH A;  1SRU A;  1HR0 W;  4RGT A;  2B3G A;  2EY2 A;  4HSP A;  4JI4 L;  1LV9 A;  3CPW A;  2AQ4 A;  2BR0 A;  1I94 L;  3KAJ A;  2UU9 Q;  3AYH B;  3HS0 C;  2VS1 A;  4BA1 I;  1XJV A;  4GNX C;  1QVF A;  3AEV A;  1YNN D;  3VPC A;  3GII A;  2J6U A;  4BY7 B;  1PH2 A;  3GTG H;  1BJT A;  4KMU C;  2PN1 A;  3VA7 A;  3HKS A;  3HOX G;  4BXX G;  1LT6 D;  4DV5 Q;  2A6H C;  2EE1 A;  3M4Y A;  2J0T D;  2QDB A;  3I90 A;  3NEN A;  2CHB D;  2VB3 X;  3DEO A;  3H0G G;  4DAY B;  1STH A;  1T3N A;  3G48 A;  1E4E A;  3N41 B;  4LH7 A;  4XDX A;  4HMJ A;  4MV6 A;  4RB0 A;  4RB3 C;  5I2Y A;  2I87 A;  2P5Z X;  1XNQ H;  4N8X 1;  4LMY A;  1B44 D;  1CZG A;  3H4D A;  2UUA Q;  4NXM H;  1NNX A;  1MD2 D;  3GTM H;  3GTG B;  3QIA A;  2OQ0 A;  1G6Z A;  4DV1 H;  4DUZ L;  2ICI A;  4DFA A;  3H3V I;  5J2T F;  1I4H A;  4RGN A;  5KYL A;  1D5M C;  3FHW A;  5FO7 B;  4FS2 A;  4DV7 H;  1XYI A;  2WFW A;  1LO5 D;  1RCV D;  4I7A A;  1SYG A;  3B6Y A;  3E6Z X;  4RHS A;  2K75 A;  1ASY A;  1B53 A;  3PR5 B;  3FPU B;  2V59 A;  3UDF A;  4J9L A;  1CQF A;  4KLK A;  3OTO L;  3J80 W;  5I2X A;  1PH3 A;  1GHK A;  2YTV A;  3L3O C;  4UAI A;  2R7D A;  4UPA A;  4BY1 G;  2SEB D;  2BA0 A;  1G29 1;  3K5L A;  3GTM B;  2I5L X;  4APM A;  3U4V A;  1T94 A;  4UCT A;  1WTO A;  2ENB A;  5M3M G;  2FK1 A;  4JV0 A;  2K1B A;  1VQ6 A;  1B6R A;  4J9M A;  3GTP A;  4UCR A;  4OWX B;  3SXH A;  4DR7 Q;  3WO0 A;  3C3L A;  4Q45 A;  1J8I A;  3DUZ A;  4ECQ A;  5HY6 A;  4DL6 A;  2ZXR A;  2R85 A;  1CQV A;  1S40 A;  5KG5 A;  2E2H H;  4XYM B;  1I6U A;  2IHF A;  2DZD A;  1TY0 A;  4DK0 A;  4AIM A;  2R93 G;  3MJF A;  4HAE A;  1X3F A;  4P72 A;  2OH2 A;  4ED0 A;  1IBK L;  2ZJP A;  1N34 L;  4P2C B;  1SDF A;  2JSO A;  3DEP A;  3GV3 A;  2FLL A;  5EJW A;  2C2R A;  1VQI A;  4WFN 3;  5CC4 A;  3CVZ A;  2BQU A;  5KIX A;  4AH6 A;  2RF4 A;  1K8M A;  4NXN L;  5BN3 A;  1E4F T;  3KLW A;  3I70 A;  1L2F A;  3R5H A;  3J81 E;  3PZP A;  3PW4 A;  1TVX A;  2E2H B;  2LS0 1;  1D1I A;  3NHH A;  2PPB C;  3TII A;  2J6T A;  5IWA L;  3GQB A;  2E75 C;  4YY3 L;  5GAG C;  1GYF A;  2SOB A;  5E3F A;  5KFO A;  3V96 A;  2XTI A;  4LFC Q;  1Y1W B;  3SK4 A;  4IUT A;  3MWY W;  4YWM A;  2QEX A;  1QUQ A;  5HGT A;  2CW7 A;  2BDN A;  1XNQ Q;  1KAB A;  3KF8 A;  5FLX E;  4NXM Q;  2O5J C;  4B9W A;  1HQM C;  1MSH A;  2J7Z A;  3GTQ H;  4ECY A;  4FS1 A;  2F3I A;  2RQX A;  5KFM A;  4DV1 Q;  2KEC A;  1Z2O X;  3HKZ G;  5EBC A;  4X64 L;  4BBR H;  1HR0 L;  4XT3 B;  3H20 A;  2EJG C;  2CVR A;  2K33 A;  4DR6 H;  3PCO B;  2WDT A;  1SND A;  2DLN A;  2DIK A;  5JJZ A;  4B3T L;  4CDE C;  3TBI B;  1OXS C;  4DV7 Q;  1K3R A;  2Q8T A;  4KHV A;  1CI3 M;  1E1O A;  4GLX A;  3NEL A;  3T5H A;  1KNE A;  4RAZ A;  3KF6 B;  3ZJY C;  1S0N A;  3V6J A;  1V43 A;  1V8Q A;  2Z4H A;  2KCM A;  3GIL A;  1WD1 A;  4O3Q A;  5KFZ A;  1IBL H;  4C2M H;  4CHT B;  2N88 A;  4O4L F;  2O5I C;  3NUC A;  3BVZ A;  2F0H A;  5CYU A;  3WOF A;  3TIN A;  1LTT D;  1YBY A;  3LNN A;  4UCS A;  4NP5 A;  2D0O A;  4GN3 B;  3GTQ B;  4FF4 A;  3IL8 A;  2XVS A;  3J80 c;  2UUB H;  2R8K A;  1JXL A;  2LY7 A;  4BBR B;  2NWG A;  1VQP A;  4N9P A;  2EQS A;  1K0R A;  1UWV A;  5EPK A;  4U6P A;  3A0J A;  2VUM G;  5M5W B;  4ULL A;  3HZX A;  1RYS A;  1B3A A;  2MHV A;  3M3Y H;  1NBW A;  5EZY F;  3EJI A;  1KJI A;  4YR3 A;  4JG2 A;  1VQM A;  1F2Z A;  1S5C D;  5IT9 W;  5COR A;  4GN5 A;  1QZG A;  4LF9 L;  2B63 H;  4WD3 A;  4C2M B;  4WBN F;  1N33 L;  3RMH A;  1YI2 A;  4DR2 L;  4B9X A;  1AUX A;  1Q12 A;  3JRW A;  1LTL A;  3UE0 A;  3QWN A;  1TWF H;  1MZB A;  4AYB E;  2R7N A;  1TXY A;  2A73 B;  3M4I A;  4DXG A;  1EIY B;  1ZYR C;  3A5Z B;  3DHQ A;  3S15 H;  3FKI A;  1ESR A;  3TEH B;  4ZQI A;  2FK2 A;  2D5D A;  3KHL A;  3LGJ A;  3H09 A;  4HJ9 A;  3Q8P B;  3J80 L;  4LMQ D;  1PA6 A;  1M0T A;  1YVC A;  4GOP A;  3I4M G;  3NTK A;  2XCP A;  4JI2 H;  2OCE A;  4F4X A;  2B63 B;  2ZTE A;  1VQF A;  1RJP A;  1PV4 A;  4LFB H;  2F0D A;  2RSN A;  4J15 A;  2ZM6 L;  1UE5 A;  3STB D;  1MI2 A;  5C5J A;  2DJF C;  1FGB D;  4FYD A;  1JWS D;  4QB4 A;  1TWF B;  3K5O A;  2F0G A;  5E7N A;  3T51 B;  3TP6 A;  4L63 B;  2FLP A;  2R7Z A;  2YZG A;  1SXT A;  1HZC A;  4YB8 B;  1SNM A;  2K32 A;  2VB2 X;  2VXW A;  3BG5 A;  1VQD A;  4DR6 Q;  3PV0 A;  2JEB I;  1EY6 A;  1YNX A;  3MXU A;  3NBI A;  3ZYY X;  1JC7 A;  1TS3 A;  5J1Z A;  1I3Q H;  1EY0 A;  5GQO A;  1CKO A;  1ZET A;  2WV6 D;  2B2T A;  1HQR D;  5D3I B;  2KHS A;  5FO9 B;  1IBL Q;  4X65 H;  1EL0 A;  4LF7 H;  1BO0 A;  4DGZ A;  4OEM B;  2WII B;  3EBE A;  4JOI A;  4KY5 A;  5C4H A;  2FK3 A;  3PVX A;  1IL2 A;  1RF2 D;  4DK3 C;  1FNW A;  4DV3 L;  3T16 A;  1MBY A;  2UUB Q;  5C4X H;  5DG9 A;  2NVY H;  4A3D G;  2F0O A;  1NY4 A;  4AYB B;  5ISR A;  4CC6 A;  1S68 A;  4ECX A;  1LTB D;  3QO2 A;  1I3Q B;  3JAM W;  4F4Y A;  2ZDQ A;  3NQI A;  3H91 A;  3VR5 A;  1V4Y A;  4LAA A;  2CWA A;  3ND9 A;  3S1R H;  4GNX B;  5I9P A;  1RYR A;  1LM0 A;  2NTS A;  4WJ4 A;  4DR3 H;  3I4O A;  1GKH A;  4C3H G;  3BA8 A;  1YZ6 A;  5LMU L;  1F9R A;  1X55 A;  2ASD A;  5C4X B;  4JV1 A;  2ICE C;  2NVY B;  4MTK A;  1JX4 A;  4LFA H;  2B8F A;  3TRZ A;  1DIK A;  3KBX A;  5DGB A;  1FL0 A;  1XNR L;  2R8G A;  2KOL A;  1HUM A;  3G8C A;  1EQT A;  4FP5 D;  3I4N B;  5J39 A;  2ZJR A;  3S1R B;  1UE1 A;  4JI2 Q;  4ILW A;  1JE4 A;  3HEJ A;  2XD4 A;  3VYU A;  2JJQ A;  3RBD A;  4LFB Q;  1WJJ A;  3J80 i;  3RLO A;  4A3F G;  2SDF A;  3BYY B;  1AUV A;  1HCZ A;  3KJP A;  4QJF A;  1IKM A;  4G4K A;  5JVG 3;  2W6Q A;  2M05 A;  2W9B A;  4PG3 A;  4GS3 A;  4JI6 L;  4C5B A;  3OW2 A;  4PMC A;  2RGV A;  3GIJ A;  3K59 A;  5DLG A;  4JI0 H;  3KTM A;  5IT9 L;  4NMZ A;  4QWA A;  2D2C C;  1I4R A;  2HT1 A;  2HUG A;  3C1F A;  4OWT B;  4A3C G;  2QIL A;  4JI4 H;  2EVB A;  3OOC A;  1QG7 A;  1Y14 B;  2B2U A;  2A6H D;  2DNC A;  1OXU A;  2VPQ A;  1PFM A;  1VQK A;  2YL2 A;  3KBG A;  2FB9 A;  2HVQ A;  2V4Q A;  4DV6 L;  2RGR A;  1TWC A;  5AJ3 Q;  4X65 Q;  1DM0 B;  1N48 A;  2QCP X;  3MXN B;  1SE3 A;  3R8B A;  4LF7 Q;  2A8V A;  3BA9 A;  4MV9 A;  3T4A C;  5KG2 A;  2FIN B;  4DV0 H;  1KTK A;  3SGI A;  3S14 H;  4UP7 A;  1U0L A;  1I7L A;  3C46 A;  4EQ5 A;  1C48 A;  2L15 A;  2QA4 A;  2VY3 A;  4DL5 A;  1YNN C;  2HHH H;  4FF1 A;  3UI2 A;  2GVB A;  3FDT A;  2Y0S E;  2ZTD A;  4KTA A;  2HIV A;  1B3Q A;  3BU2 A;  4DR3 Q;  4RUA A;  1K8G A;  2IX1 A;  1WTR A;  2PI2 A;  3CU7 A;  4MNO A;  5JVL A;  3M4O H;  4KKS A;  5IGC A;  3S14 B;  3FPP A;  4A93 H;  2VQF H;  1ILP A;  2M2L A;  1JR0 D;  4LFA Q;  4A3M G;  4A75 A;  4JBK A;  1VDZ A;  1A3U A;  4I7Z C;  5M3F H;  3NWS A;  4IR9 A;  4DNI A;  1FYC A;  1SYD A;  2NN6 G;  1BR9 A;  2NVX H;  3ND8 A;  3UDG A;  3GTG A;  1O80 A;  3MAQ A;  1K83 A;  4UP9 A;  3FMA A;  2B2V A;  4JV5 H;  1K1S A;  2WB1 A;  4FXG C;  4OIJ A;  2PZT A;  3SK6 A;  1BVS A;  2Z6K C;  3P7J A;  4JYA L;  3PUV A;  1ENA A;  2IJ0 A;  2EJF C;  3K58 A;  3HOW G;  1BCP B;  4A3I G;  3M4O B;  4KKU A;  1SEB D;  5NUC A;  2W7P A;  3DWQ A;  3JAM L;  4G3I A;  4A93 B;  1XMO H;  1X3Q A;  3HBL A;  4YWK A;  3Q2O A;  4EG0 A;  4GN4 B;  1KNA A;  5JVD F;  4H13 C;  3J7Z C;  4QW8 A;  1KDC A;  4CDC C;  3JZI A;  5M3F B;  1LTG D;  1RJR A;  2E8G A;  3T5J A;  2R8I A;  2NVX B;  3GTK A;  4JI4 Q;  5C44 H;  2JXM B;  1H9S B;  3GTM A;  3SI8 A;  3F8T A;  4LK1 C;  3J7A 5;  1XPR A;  4AQY H;  5TSS A;  3PIO A;  3PO2 H;  1IBK H;  1C8C A;  4KY6 A;  1Q8I A;  4IPG A;  2IPK D;  3V6K A;  2Y0S B;  4IO9 A;  3J7Y W;  4ZLT F;  1OXV A;  1NCV A;  4NXN H;  4DV0 Q;  4MA5 A;  3CME A;  4X6A H;  2PMZ E;  1UEB A;  2G9H D;  1F2L A;  4HNT A;  4R1J A;  2CKZ B;  4CBV A;  1YHA A;  5CAE B;  3WNZ A;  5IWA H;  1MJE A;  3HOZ H;  4DR5 L;  4UY8 C;  4LF4 H;  5C44 B;  1LUZ A;  2XRQ D;  4OIK A;  2F1M A;  4IOC A;  2AKW B;  2HHH Q;  2VQE L;  4Q44 A;  1GUG A;  3PO2 B;  4ETS A;  5CV9 A;  3CRL C;  1HNW L;  1EY7 A;  1I7N A;  2FE3 A;  4JI3 H;  2WAQ E;  2ID0 A;  1A9X A;  4QF4 A;  2E2H A;  1KLG D;  2JP1 A;  4MN3 A;  4JI8 H;  1JIH A;  2E5L H;  4IZ8 A;  1B9N A;  3D4W A;  2VQF Q;  3GV7 B;  4IUN A;  4QCL A;  3HOZ B;  3C1E A;  3S16 H;  3GV8 B;  5L1J A;  1Q46 A;  5KFG A;  1BDO A;  3CCM A;  4KJN A;  4Q0F A;  5JEA G;  5EDW A;  3CC2 A;  1EYD A;  1B50 A;  3TQY A;  4JV5 Q;  4RGO S;  2I8C A;  5L1I A;  4EQP A;  2Q2U A;  1SE4 A;  2EPB A;  3Q0A A;  4ECV A;  3J80 E;  3HOU H;  1GUT A;  4Y52 H;  1AN8 A;  3CQZ A;  5H1S E;  1UNS A;  3I7F A;  1XMO Q;  5C0X H;  2JA7 A;  2WTF A;  3FKI G;  3OWE B;  5G3L F;  1W2B A;  3S16 B;  4UCO A;  1U4M A;  4IHJ F;  2PMZ B;  4JUZ A;  3JAM i;  4R7R A;  1VS0 A;  4LF9 H;  3W2D A;  5KFD A;  2UVV A;  2OLS A;  3M7N A;  1Z2P X;  2FP4 B;  3V4Z A;  2X6G A;  5ELE A;  1EY4 A;  1ESF A;  1O7I A;  4IJH A;  4AQY Q;  1M7J A;  1IBK Q;  2X6L A;  2PQA B;  3HOU B;  1AFP A;  4X66 L;  2K5D A;  2PYK A;  1I50 H;  2HDM A;  2JA5 G;  2R3Z A;  4NXN Q;  2WAQ B;  4HJ5 A;  3J7A V;  4GLA C;  5JJL A;  2N8N A;  1I4Q A;  1R9T H;  1KRS A;  5IWA Q;  4A3K G;  4YY3 Q;  5IYB H;  3N6X A;  4ED8 A;  1EUJ A;  4LF4 Q;  1L1O B;  1SSO A;  2ZM6 H;  1Q90 A;  2CH4 A;  3KAL A;  2B39 A;  1I4X A;  3CCR A;  1FD7 D;  2G9D A;  4XYQ A;  5I4D A;  4XQQ A;  1DOM A;  5I9O A;  1VQC A;  4JI3 Q;  3DLL A;  4HQ6 A;  3G71 A;  5ELB A;  4JK1 C;  1I50 B;  2AHO B;  4KK7 A;  4F50 A;  2K03 A;  3GTO H;  4JI8 Q;  4UP8 A;  1IL8 A;  2QK4 A;  4PMB A;  1R9T B;  5JPM C;  4LSA A;  3OSO A;  3R5F A;  5D14 A;  2NUA B;  3BJY A;  1KQS A;  1EWC A;  4DA2 A;  1IYJ B;  1CKN B;  1TWF A;  4LW1 A;  1EHI A;  1K3B C;  1FKA H;  2UXB L;  3KOJ A;  2PQE A;  4ECT A;  3RUP A;  4DN4 M;  4ALP A;  1TA8 A;  2NZO A;  4RB2 C;  1WTW A;  1LTR D;  1WTP A;  2C28 A;  1GD7 A;  3BAB A;  1EZ1 A;  3I56 A;  3QB3 A;  3S17 H;  3TZU A;  5GRO A;  5IY0 A;  3GTO B;  1QCB D;  2H4O A;  5C3E G;  1OXX K;  3H94 A;  1T5E A;  2A5H A;  5D3D A;  2K5Q A;  2FMM A;  3VMM A;  3A8J E;  4G7O C;  2FLN A;  1C0A A;  1DON A;  4YAJ B;  3UQ8 A;  1EY8 A;  1L2Z A;  5KFA A;  4KV6 A;  1V1P B;  4LF9 Q;  1R4P B;  1VQL A;  2R7M A;  5LHY 1;  1N33 Q;  2CQO A;  2B2W C;  1P8L A;  4DR2 Q;  5KG3 A;  1Q8K A;  3PF4 A;  1XX8 A;  2VR1 A;  4JBW A;  5EBD A;  2W71 A;  5IT9 E;  2WYO A;  4ZI7 F;  4A76 A;  2EYJ A;  5LMU H;  3G6V A;  1VQ5 A;  5EPJ A;  1JT8 A;  4XZ3 B;  4V0B A;  3S17 B;  1I3Q A;  2L9H A;  5D1O B;  5DG8 A;  4ECS A;  3S9W A;  3HOV H;  4RU9 A;  5K36 G;  2F0U A;  2KQ3 A;  3AMU A;  3GTJ H;  1TII D;  4DPG A;  2X69 A;  1XNR H;  1C7Y A;  4GNX A;  2JA8 H;  1AZQ A;  4UHV A;  2F0L A;  1B2T A;  1ZHQ A;  2KCN A;  3F2U A;  2C22 A;  1Y1V G;  1RTN A;  1IHZ A;  2ZM6 Q;  5LMN W;  4IOA A;  3L7Z C;  5J22 A;  3LWB A;  5JOB A;  2YZM A;  2B29 A;  1SMX A;  4ZUJ A;  3TSS A;  5IGE A;  1W96 A;  4KHP H;  4JI6 H;  2F0I A;  4R4C A;  2KCC A;  4BY7 H;  3MZ5 A;  3WOE A;  4ED6 A;  1S03 G;  1IZ6 A;  1QJO A;  4ED3 A;  1MIU A;  3HOV B;  1YIT A;  2E2I H;  5IGB A;  5KFW A;  1S0O A;  3GTJ B;  1VQB A;  3G6J B;  2JQO A;  1ROD A;  4L6T B;  2NTT A;  4M1U B;  3QR8 A;  4IFD H;  3RFC A;  1IBM H;  1HH2 P;  3CXC A;  1V1O A;  4DR1 L;  1B9M A;  1A63 A;  2IBK A;  4C3I G;  3CCL A;  3BVM A;  1M8A A;  5IP7 G;  1SYC A;  1CZW A;  1SAP A;  4FU0 A;  3RR5 A;  3V05 A;  2XN9 C;  1PDQ A;  3W5O A;  2E2I B;  1BKB A;  3K5M A;  1EYA A;  3HOX H;  2R6F A;  4BXX H;  3UDI A;  1I5F A;  4ZK9 B;  4DK6 C;  2ZXO A;  5E4X A;  2K7V A;  1DXM A;  2RBM A;  4O2A F;  2DJG C;  1SYB A;  5KFL A;  1SCU B;  2D0P A;  2RA4 A;  3H0G H;  4HED A;  4QIW E;  4RH6 A;  3K57 A;  3RGX A;  4IRK A;  4QGU A;  4LFC H;  3MXN A;  4O3R A;  2R7F A;  5CR3 A;  1WI5 A;  1SFO H;  1WVL A;  5EKK A;  3MHB A;  2WB1 G;  4WJW A;  3HOY G;  5IYC G;  4B3S H;  5EWE A;  5LMU Q;  3SK5 A;  3KFU A;  1M4V A;  2YTY A;  3HOX B;  4POG A;  1HNZ H;  4KJO A;  2FXQ A;  3PIO 3;  4G7Z C;  4QY7 A;  2HJW A;  2UUC L;  5KFH A;  4Q8E A;  1XNR Q;  4FDB A;  5A2Q W;  3H0G B;  1TWH H;  1OXT A;  3NWT A;  4DNR B;  1Q3L A;  4X3K A;  1SNP A;  3K81 C;  1N36 L;  2E74 C;  1SFO B;  4IWX A;  1H9R A;  4NLG A;  2HD3 A;  4JYA H;  3G6Y A;  3I12 A;  4LH6 A;  3U9T A;  2I07 B;  4MIU A;  2JA6 A;  4OO1 G;  1VBG A;  4KHP Q;  4JI6 Q;  2X0S A;  1PH5 A;  4K0K L;  3MWE A;  5M3M H;  2PNR C;  1JWU D;  1K8O A;  5KFB A;  2E5L L;  2XIW A;  1LTS D;  2XGT A;  4YHH L;  1DGS A;  2EYP A;  3RB6 A;  4F8M A;  4DAV A;  5C1P A;  4FNF A;  3PO3 G;  5KFF A;  2FJZ A;  1TWH B;  4K6L A;  1S5B D;  3RNU A;  2W8K A;  1IBM Q;  4DAM A;  2JEJ A;  3VPD A;  2W9A A;  4EBD A;  1Y1W H;  4DV6 Q;  2OF1 A;  4QIW B;  5CV4 A;  4EFB A;  2DPJ A;  3DMU A;  4BY1 B;  2B2Y C;  2R93 H;  3BQ1 A;  3HKZ E;  2ALY B;  4HIM A;  2ES2 A;  5M3M B;  1DOL A;  1U4L A;  4O42 A;  3RN5 A;  1A3V A;  5DLF A;  3TS2 A;  2YU9 A;  2N78 A;  2GLT A;  3D31 A;  2NVX A;  4OX9 L;  2F0W A;  2V5A A;  2CWP A;  3TZD A;  3BQ0 A;  4DR5 H;  3T1H L;  2CZG A;  1TWA A;  5LMN L;  3S1Q B;  1SNC A;  1PH7 A;  5D65 A;  1ML0 D;  4O3S A;  1B33 N;  1PTO H;  4APV A;  2R87 A;  2VQE H;  3W3A A;  4EEQ A;  4JI5 H;  1X32 A;  1HTL D;  3CRK C;  1HNW H;  5I6Y A;  2W6Z A;  2R93 B;  2NU6 B;  1DZ1 A;  4ZKB B;  1G8Z D;  1Z7T A;  4EQO A;  2IX3 A;  4B3S Q;  1ZQ7 A;  4LF8 L;  4K8J A;  4NKL A;  3EIV A;  3OUU A;  2WP8 J;  3C0F B;  1HNZ Q;  1KHI A;  3KAK A;  1BCP C;  5M5W H;  1LT3 D;  5T1G A;  2AGO A;  2JA7 G;  3SE7 A;  2NBF A;  1PTO B;  2YV5 A;  1CS0 A;  4L5Q A;  2IP4 A;  5L1K A;  2KHI A;  3PUW A;  1HUN A;  1D6E C;  1D5Z C;  3MTS A;  2PVP A;  2R84 A;  5KG7 A;  4JYA Q;  5CBE E;  1JB3 A;  5CA0 F;  1VQE A;  3R23 A;  4RZQ A;  3OIP A;  3TRE A;  3DWA A;  4J0M A;  1ICF B;  4N9T A;  5JPN C;  3PW2 A;  4H02 A;  2EOT A;  4A3B G;  1STN A;  5FD6 A;  1CM9 A;  4ZYS A;  3IN5 A;  3HKZ B;  3M7G A;  5LL6 X;  4JI1 L;  2LXJ A;  1GUO A;  2VA2 A;  2VUM H;  4YP3 A;  4ABN A;  4QWB A;  2UXC L;  2RCN A;  3ETJ A;  4GC6 A;  5DG7 A;  4FBU A;  5J3B A;  1YJ9 A;  1JE5 A;  2ZJT A;  5EKI A;  4MV3 A;  2HCC A;  2ZTC A;  3RB4 A;  3PW5 A;  2AWN A;  5FKA C;  1FNV A;  4X66 H;  4HSV A;  4DL2 A;  5A2Q L;  4HCS A;  1FNU A;  1PTO D;  5JQW A;  2EXD A;  2K4K A;  3D8G A;  3URY A;  1EY5 A;  2VUM B;  3OHX C;  4DR5 Q;  2YZN A;  3TN2 A;  1TS4 A;  4LF5 L;  3T5L A;  1KAW A;  2L11 A;  1ILQ A;  3I4M H;  4CC5 A;  1MSG A;  1VQG A;  4NB3 A;  4MV8 A;  1E3P A;  4IQZ A;  3S2D H;  2VQE Q;  4JI5 Q;  1WCM A;  1OWT A;  1PZI D;  5IGD A;  1UE6 A;  3PSI A;  1H9J A;  3W1G A;  1HNW Q;  2FJ2 A;  2VOB A;  3M9O B;  1KL9 A;  4GKJ L;  3GQC A;  3I73 A;  3ULJ A;  1KIX A;  1KLU D;  4JV2 A;  4DL3 A;  1PZK D;  2A69 D;  1J6Q A;  3KDF A;  2GPW A;  2RHQ B;  1K9M C;  3G6E A;  4U68 A;  1OTC A;  2CQY A;  2VL6 A;  4MTD A;  3N42 B;  4J9O A;  3WWV A;  5BR8 L;  1HA5 A;  1QOH A;  4PNY A;  2IHE A;  3I4M B;  2JK8 A;  3G4S A;  4FXK C;  2E2J H;  1P16 A;  1AE2 A;  2LMC B;  3S2D B;  2UXB H;  4LUV A;  1AP0 A;  2JA9 A;  3VYR A;  1JCK B;  4OHJ A;  3UE1 A;  1CA5 A;  1EIG A;  1VAJ A;  2AUK A;  1E2W A;  3N52 A;  4HR7 B;  4RWS C;  5KFU A;  4O3O A;  4ZAI A;  5KFX A;  2XGP A;  2QDL A;  1RD9 D;  2NU7 B;  3U58 A;  2HQL A;  3X3M A;  3MFH A;  1XTD A;  1S10 A;  3R3O A;  2LXK A;  4A3D H;  1YJN A;  3PN1 A;  4ZHQ F;  1BOS A;  2Z8L A;  5EQ0 A;  2PBZ A;  2E2J B;  3I4N H;  4MV4 A;  2UU9 L;  3PUY A;  4MA0 A;  3M9N B;  2V58 A;  5LYJ F;  2JEG A;  3GIK A;  2BDO A;  3LWU A;  3GTO A;  1L1O C;  4ME3 A;  1SEI A;  2YS6 A;  4OL7 A;  5IT9 c;  4MV1 A;  2RVL A;  4C3J G;  4X66 Q;  4C3H H;  3I8Z A;  2A68 D;  1ET6 A;  3Q8Q B;  1G2T A;  2N49 A;  2HCI A;  4A3D B;  4QL5 A;  1Z47 A;  1EFI D;  1GUW A;  3G7L A;  5KFC A;  2C00 A;  1VF5 C;  3ER0 A;  4UDU C;  2IT1 A;  1KJQ A;  2KA7 A;  1JDB B;  3I91 A;  5EAY A;  4R8U B;  1E24 A;  1MGS A;  3RZD H;  3RUZ A;  4HJ8 A;  3K5I A;  4ECR A;  1LTA D;  2R82 A;  4MTN A;  5KT5 A;  5D1O A;  3K7A B;  1Z9F A;  4A3F H;  2OTL A;  2R7K A;  4XT1 B;  4C3H B;  1MHW C;  2R8J A;  2AGP A;  2BQR A;  4PZ7 A;  4LUO A;  4JBJ A;  3X3N A;  2K04 A;  5C6A A;  1E2Z A;  1BBU A;  2L4N A;  2N55 A;  3EFX D;  2BH2 A;  1LLR D;  5EGT A;  3K0X A;  4TRD A;  1EYC A;  4A3C H;  1Q1E A;  1VQN A;  1I94 H;  1NMF A;  3RZD B;  5KT4 A;  2UXB Q;  1TWG A;  2I80 A;  4BBS G;  1E1T A;  4ZQ3 A;  1DCZ A;  3F2D A;  4A3F B;  1WTX A;  1E4G T;  3N8D A;  2D9U A;  3RB0 A;  3GTJ A;  5M9O A;  2R92 A;  3A74 A;  2L0C A;  1SYE A;  2MNA A;  5K2M A;  4DR7 L;  4TV9 F;  3JC6 6;  1CSQ A;  4EYH B;  2Z6K A;  5KNB A;  2ZT9 C;  4O2D A;  1EOT A;  1S4Z A;  3TP8 A;  5DQG A;  1W6J A;  2XNA C;  3U50 C;  4GC7 A;  5DAU A;  5E1F A;  4FXD A;  1RKN A;  1B6S A;  4A3J G;  2F52 A;  2J6S A;  1PX2 A;  3KLR A;  1E4E B;  1S5D D;  1I6V C;  3RB3 A;  2E2I A;  3JAM c;  3J81 W;  1HZ9 A;  3S24 A;  1CA6 A;  4A3E G;  4KD3 A;  4HIK A;  4DUZ H;  2OXP A;  2HVS A;  4Q8F A;  2JA6 G;  2NVQ H;  4DAY A;  1HA6 A;  4C5C A;  2FMA A;  4IR1 A;  1CUK A;  2EY1 A;  4MZ9 A;  3ULL A;  3CF5 A;  2IX0 A;  2UUC H;  3OHB A;  1EEI D;  1JWM D;  3KHR A;  1KEE A;  2CH4 W;  5FJ8 G;  3GTP H;  1ZEQ X;  4A3M H;  3L0O A;  3M4P A;  5FLX W;  3MA2 B;  3IAY A;  3BYT B;  3OTO H;  5GAH C;  4RCN A;  2ASB A;  2NN6 H;  3CCU A;  3VR3 A;  4EEY A;  5E4W C;  5T14 A;  1B7Y B;  3MVV A;  2W7O A;  2K5N A;  4RNM A;  1EU3 A;  3CCV A;  3O13 A;  4DV1 L;  1Y8P B;  5FLM G;  2NVQ B;  3K5N A;  2EYH A;  4XYO A;  1TY2 A;  4XIG S;  5CV7 A;  3A5U A;  5CBA E;  4A3I H;  1BCP F;  3HOW H;  4DR4 L;  5KFI A;  3NGD A;  1E7Z A;  3BDL A;  5LL6 b;  4A3L G;  4PV1 C;  3GTP B;  5F9L A;  1C30 A;  1GVP A;  5CV6 A;  4A3M B;  1SFO A;  1VMP A;  5IE8 A;  3CCS A;  1CSP A;  1VQ8 A;  3GIQ A;  4R4O A;  1RJQ A;  4FBT A;  2NUC A;  1Q81 C;  1I94 Q;  4L5R C;  5CB4 F;  3NBH B;  3T56 B;  4RG1 A;  4K2L A;  3GV5 B;  4X3U A;  3EPI A;  1N34 H;  2DWC A;  1WSC A;  1E0B A;  1RL2 A;  1UEA B;  1X65 A;  1RIP A;  3K6O A;  5KG1 A;  3HOW B;  3K8A A;  2FMC A;  2Q2I A;  1D2B A;  2MPM A;  3KK7 A;  1VMC A;  4ZCK A;  4A3I B;  2YRW A;  4E4T A;  4JBM A;  4JC0 A;  4RAY A;  1EEF D;  1U9R A;  4BA2 I;  5DGA A;  4TSS A;  1WFQ A;  1C9O A;  5LMN H;  2LFN A;  3M9B A;  4YY3 H;  4JPB W;  3J81 j;  1OO9 B;  4HYK A;  4GKK L;  5JUM A;  4O2B F;  2EIF A;  3AQQ A;  3P75 A;  2K52 A;  1BCP D;  1Q7Y C;  4B3R L;  1JOO A;  2VZA A;  4DV4 L;  1HTP A;  4I50 F;  1RHP A;  1RJT A;  2DUD A;  3I72 A;  1QUQ B;  3JSL A;  4EGJ A;  2BE5 D;  4EVO A;  2RHS B;  4DUZ Q;  4RHR A;  4X64 H;  1ET9 A;  1HR0 H;  3KF8 B;  1Q82 C;  1BGW A;  3FP9 A;  1ICW A;  4B3T H;  2Z0S A;  4U67 3;  2UUC Q;  3PUX A;  1EUD B;  3GLK A;  1Y1W A;  3EA6 A;  2R93 A;  1EOV A;  5C5M A;  1B04 A;  1ZKO A;  1GOZ A;  2QGQ A;  3OTO Q;  1N36 Q;  1AH9 A;  1KJ8 A;  4LJZ C;  5FPR A;  5JEA H;  3VYT A;  2KED A;  4ID6 A;  2BA1 A;  2R86 A;  3BZK A;  2V9W A;  1D5X C;  1XWE A;  2FPP B;  1B4O A;  4CDF C;  4Q5V A;  4M8A A;  3ERO A;  4X62 L;  2AQ2 B;  2E5L Q;  2W9C B;  4JI1 H;  4YHH Q;  2OTJ A;  2VNU D;  1R4Q B;  3KF6 A;  3CCE A;  3S2H H;  1BF4 A;  1CE8 A;  3E5S A;  5DQI A;  3E0E A;  3CCQ A;  1KBL A;  5JAV A;  5DQH A;  2TSS A;  4XYL B;  4F4W A;  3J81 L;  4UCU A;  3SEB A;  1JOQ A;  3AFQ A;  1IBL L;  3GTQ A;  1N33 H;  4DR2 H;  1G6P A;  2PZU A;  2XGQ A;  4JI7 L;  3MR5 A;  4HIO A;  5KFN A;  1WCM G;  1K73 C;  1N34 Q;  2UUB L;  1TKW B;  3D0F A;  1BBX C;  2R7Z G;  1Y8O B;  2NZH A;  5FLX L;  1SYF A;  1FJG L;  4PMW A;  1PVO A;  4O3P A;  4DK1 A;  4LUZ A;  2JA5 H;  3S2H B;  5IP9 G;  3MWM A;  2WIN B;  2KVM A;  1CHQ D;  4C2M A;  3FKI B;  5LMN Q;  3H3V H;  1VQH A;  4IJL A;  5CGK A;  1GSA A;  4A3K H;  3MFI A;  1LYL A;  2FHT A;  4GOP B;  2K14 A;  3SK8 A;  4RFB A;  2E76 C;  1M6V A;  1XTC D;  1PTO C;  1CQJ B;  4GKJ H;  2C5C A;  1SN8 A;  4TKO B;  4UFZ A;  5KT3 A;  1TU2 B;  1PRT B;  4OWW B;  3OW7 A;  4J6H A;  1PHJ A;  4QQB X;  2VUM A;  3TS0 A;  3S1N H;  1LAC A;  3RBE A;  4DUY L;  1W3S A;  2J4X A;  2B2W A;  4X64 Q;  1HNX L;  4POF A;  1HR0 Q;  2JA5 B;  4A3G G;  4B3T Q;  2B63 A;  5BR8 H;  4HMI A;  4IUQ A;  1HHV A;  2CFM A;  3SVM A;  4YCU A;  3T1Y L;  4A3K B;  4JI2 L;  4O3N A;  2HGS A;  5EOY A;  4PQX A;  3FRP B;  4CKC A;  1EY9 A;  4TUY F;  2A69 C;  3H6M A;  1S97 A;  1WTH A;  2G5D A;  1Y69 U;  2VW9 A;  2ZXP A;  1PFS A;  2XCA A;  1PK8 A;  3D4D A;  2GPS A;  2ALZ A;  3S1N B;  3KHH A;  4DV3 H;  2EYO A;  1Z2N X;  1S0M A;  4L1K A;  4JI1 Q;  3DWP A;  1NMG A;  1AEX A;  2XWB B;  1IOW A;  1LT5 D;  5C3E H;  4YCV A;  3V6H A;  2TMP A;  4JCV E;  4IN3 A;  2RDG A;  1PRT D;  1EIH A;  1PH9 A;  3A8I E;  3KYH C;  4X65 L;  3ERQ A;  3GIM A;  4ECU A;  3NPP A;  4Z9C B;  2YYA A;  2F0P A;  3J81 i;  3QZ7 A;  4AYB A;  4I55 F;  5C3W A;  1EIF A;  1XPU A;  1ASZ A;  3T53 B;  3K0Y A;  3F1Z A;  5KRU A;  1I4P A;  4RKB A;  2FFK B;  4F87 A;  1YHB A;  3DM1 A;  4QW9 A;  3FEW X;  2OEO A;  5IYD G;  5C3E B;  5K36 H;  2EYM A;  4K5X A;  3Q6S A;  3GDE A;  2Z1C A;  4LF5 Q;  1JLL B;  2C2E A;  4R4T A;  4DV2 L;  4X3T A;  4IPH A;  5CA1 F;  1CK1 A;  5KFS A;  2AQ1 B;  1GJX A;  4IUP A;  2CW8 A;  1Y1V H;  2A68 C;  3RLN A;  4R8I A;  4U7C A;  4DR3 L;  4HN7 A;  4MAM A;  1GXD C;  1S72 A;  2LSS A;  1BNZ A;  2JYO A;  2NVY A;  3BDO A;  3GP7 A;  4GKJ Q;  3OPO A;  1VKZ A;  2PI2 E;  2DY8 A;  3NSW A;  1WD0 A;  2GA4 B;  5IYZ F;  3R5X A;  2MO0 A;  3FVQ A;  2R92 G;  4J9K A;  2PNH A;  5C0X J;  2W9B B;  2CW0 D;  4ZUI A;  1STA A;  2B8G A;  5BR8 Q;  5L37 A;  5CV8 A;  2L12 A;  1XPO A;  3QZ8 A;  1JKJ B;  4I7H A;  3CKI B;  4YCW A;  1F9P A;  4QWE A;  1JIC A;  1LTI D;  4B08 A;  4DV6 H;  3P20 A;  1Y1V B;  3HFZ B;  1EWI A;  4RUC A;  2WB1 E;  1GHJ A;  1IXR A;  2OT2 A;  2KCT A;  3NEM A;  1NAP A;  4RMF A;  4Q43 A;  3PMF A;  1X3E A;  4C3I H;  1BXR A;  2W8L A;  2F03 A;  2F0S A;  2FPG B;  1N32 L;  3VR6 A;  3HGB A;  5IP7 H;  4DV3 Q;  4CDD C;  4BWG B;  4JI0 L;  2XIG A;  2F0N A;  4RAU C;  1O7L A;  3U9O A;  3DF7 A;  3NP8 A;  1F9S A;  2NYZ D;  1I6H H;  5LA6 F;  4DL4 A;  3OSN A;  1JOR A;  1W6K A;  2RDF A;  4IAJ A;  4DAP A;  3ORQ A;  1K8A C;  2F3V A;  1EU4 A;  1H9M A;  5IGF A;  2IWH A;  3JAM E;  3CC7 A;  2W6N A;  3E0J A;  3V2T A;  5C0X I;  4C3I B;  4YBZ B;  3J7A F;  4XXE A;  1CTM A;  1UUP A;  5KND A;  2MGS A;  1PH4 A;  4ED7 A;  4DV0 L;  3GIP A;  3HOY H;  4EYI B;  4CGY B;  5IYC H;  2VUG A;  1STB A;  2XWJ B;  4ZRZ A;  2B2Y A;  1I6H B;  1A3T A;  4H44 C;  1HFN A;  3RF2 A;  2JEI A;  2A6E D;  1II3 A;  4I65 A;  1J5E L;  2HHH L;  2ATL A;  1FGU A;  5FD5 A;  2Z4I A;  1DJR D;  1RK5 A;  2IY5 B;  5CV5 A;  1KJJ A;  2F3W A;  3GTK H;  2O4X A;  2F0F A;  5DM7 3;  4C56 C;  1K28 A;  4DU9 A;  2F0T A;  3IKJ A;  4BY1 H;  2WB1 B;  5C3X A;  4OO1 H;  3HOY B;  4Q0Y A;  3F2C A;  4E6I A;  4DR4 H;  1JJ2 A;  2VQF L;  4B3M L;  3HXL A;  2HIX A;  4GLV B;  1V1Q A;  3DM3 A;  1RTO A;  4J8Q A;  1I4G A;  1X56 A;  2MQH A;  5LL6 S;  1NSN S;  5ELN A;  4G7H C;  2DGY A;  3PO3 H;  2V1C C;  2OWO A;  3S1Q H;  3E9H A;  1VQ4 A;  4ZKC B;  4IAL A;  1W93 A;  5KYI A;  3LWE A;  5IOD A;  3GTK B;  4DXF A;  4JV5 L;  2DN8 A;  1NR2 A;  1Q1B A;  1XMQ L;  2R7L A;  2W6M A;  3LP8 A;  2K5V A;  1A8V A;  1XMO L;  5LP6 F;  3N6R A;  1BUV T;  5LOV F;  1H9S A;  3GV6 A;  4CJ1 B;  1DD2 A;  5IIF A;  2M00 A;  3NBH A;  5FOB B;  3PO3 B;  4GKK H;  3D4R A;  4H7B A;  1Y1W G;  1SMY D;  4FF2 A;  1YHQ A;  1VCI A;  3J7A K;  4TQR A;  3PF5 A;  2M9V A;  2UVW A;  2Y0S A;  2OQK A;  4PZ8 A;  4TQU S;  4B3R H;  4AQY L;  3Q8D A;  1YIJ A;  4DV4 H;  3VDY A;  5ELF A;  5L9X A;  2MCT A;  5HV6 A;  3PIP A;  1IW7 D;  1GUN A;  1EWH A;  1M0W A;  1TR5 A;  1G2S A;  3R2I A;  2KJX A;  1KC7 A;  5KT2 A;  1Y8N B;  3CQZ H;  4IFD J;  4LF4 L;  1O7Z A;  1QB5 D;  2JA7 H;  3MFY A;  1S5E D;  5BN4 A;  3Q8S B;  2BE5 C;  1IYU A;  1H9K A;  1PTO F;  5HGQ A;  1HRJ A;  3ITP A;  1XDN A;  1AE3 A;  1HZB A;  3ICE A;  4KY7 A;  3N44 B;  4DKA C;  4O4H F;  4F4Z A;  4JI3 L;  2F4V L;  4KN7 C;  4BBR G;  2E2D C;  4X3S A;  2MFI A;  3TDQ A;  3NK9 A;  1K1Q A;  1O78 A;  4X62 H;  5BPF A;  4YR0 A;  2QKI C;  3KUP A;  4JI8 L;  3QFF A;  4DR4 Q;  2EZV A;  3D6W A;  5K5P A;  4A3B H;  2RDH A;  1CHP D;  4QMG A;  3CQZ B;  4S3S A;  4LF6 L;  1SE8 A;  3IFT A;  3N40 P;  4PZ6 A;  5KT6 A;  1SJE D;  2BCO A;  3D3R A;  3NTH A;  2JA7 B;  1S9F A;  1VQ9 A;  4LNQ A;  1YNJ C;  4A2B A;  4ED1 A;  4JI7 H;  2KBN A;  3TIG A;  4F7X A;  3K7U C;  2MO1 A;  1KJ9 A;  2NZ1 D;  2KHJ A;  2W9C A;  1SBB B;  2EJM A;  4L5T A;  4IFD I;  4XQN A;  1A2T A;  5C4J H;  1F9Q A;  1FJG H;  5JJI A;  3VR4 A;  2I0Q A;  3I55 A;  2PMZ A;  1HZA A;  4A3B B;  3GID A;  2K01 A;  2W6P A;  4K6D A;  4EX5 A;  2BOS A;  5KFY A;  1PMR A;  2B63 G;  4QWC A;  1KXL A;  2CCZ A;  4MV7 A;  4GKK Q;  1DYQ A;  1LT4 D;  5D1P A;  1QVC A;  2YTX A;  4JVZ A;  1WH2 A;  2PQA A;  3AU7 A;  5ELO A;  4B3R Q;  2H1E A;  1YEZ A;  1Q86 C;  1PH1 A;  5IGG A;  4DV4 Q;  1EQV A;  1G91 A;  5C1O A;  2WAQ A;  3E5N A;  3MR2 A;  1PFN A;  2RDI A;  3QOL A;  3Q24 A;  4DUY H;  5C4J B;  3RJ0 A;  1HNX H;  1ONL A;  1Z6H A;  4TVA B;  4J9P A;  4KHZ A;  4ED2 A;  1UE7 A;  1N56 A;  3M3Y B;  1L1O A;  4RNO A;  4P74 A;  3H40 A;  2Z6B A;  4R4I A;  3PW0 A;  4QUF A;  1AN7 A;  3WO1 A;  4RZR A;  3T1Y H;  4QUC A;  3PW7 A;  4IUR A;  5C4Z A;  4DF7 A;  2YW2 A;  1PFB A;  3OYY A;  3CC4 A;  4HJ7 A;  1CFM A;  1HPC A;  3T5K A;  1I50 A;  4RA8 A;  5KFQ A;  3Q8R B;  1V9P A;  2JA5 A; 
#chains in the Genus database with same CATH homology
 1IYJ B;  1CKN B;  4P73 A;  2BA0 A;  1G29 1;  4LW1 A;  1GVP A;  2I5L X;  4AYB G;  3U4V A;  4X62 Q;  5IE8 A;  2C35 B;  3CCS A;  1QVG A;  5M3M G;  2UXB L;  3KOJ A;  1CSP A;  2UXD L;  1VQ8 A;  4ALP A;  1VQ6 A;  1CKN A;  1K83 H;  4R4O A;  4OWX B;  4DR7 Q;  2NZO A;  3KJO A;  1EFW A;  1Q81 C;  1I94 Q;  4L5R C;  5HY6 A;  3NBH B;  1GD7 A;  4RG1 A;  4HID A;  1S40 A;  4OO1 I;  3CPF A;  3I56 A;  3GTL H;  3S17 H;  2E2H H;  5GRO A;  5IY0 A;  1A0I A;  1RL2 A;  5C3E G;  1OXX K;  2IHF A;  1U5K A;  1X65 A;  1RIP A;  4JI7 Q;  1SR3 A;  3K8A A;  2Q2I A;  3AFP A;  3K7A H;  4GOP C;  4AIM A;  4JC0 A;  4JBM A;  1C0A A;  4BA2 I;  2R93 G;  4P72 A;  1X3F A;  5C4X G;  1WFQ A;  1IBK L;  1C9O A;  1NE3 A;  2ZJP A;  4LF9 Q;  1VQL A;  4DV5 L;  1N34 L;  3M9B A;  4C3J H;  1N33 Q;  2CQO A;  1P8L A;  1FJG Q;  3J81 j;  4DR2 Q;  1Q8K A;  3PF4 A;  1VQI A;  4GKK L;  4AH6 A;  2RF4 A;  4JBW A;  4NXN L;  2EIF A;  3AQQ A;  3KLW A;  4A76 A;  3I4N G;  2K52 A;  4WJ3 M;  1Q7Y C;  1L2F A;  4B3R L;  2VZA A;  1VQ5 A;  1JT8 A;  4DV4 L;  3HOV H;  2DUD A;  5IWA L;  5K36 G;  1QUQ B;  4YY3 L;  5GAG C;  3GTJ H;  2RHS B;  4DPG A;  2XTI A;  4DUZ Q;  1C7Y A;  4GNX A;  4LFC Q;  2UUA L;  2JA8 H;  2GVA A;  3KF8 B;  1Q82 C;  4YWM A;  2QEX A;  3FP9 A;  1QUQ A;  2Z0S A;  2Q2H A;  1JJC B;  1Y1V G;  3PUX A;  4DUY Q;  2UUC Q;  4P71 A;  1XNQ Q;  1HNX Q;  4NXM Q;  2ZM6 Q;  5LMN W;  3GTQ H;  3RZO H;  4IOA A;  2F3I A;  3L7Z C;  4DV1 Q;  2B29 A;  3HKZ G;  1EOV A;  1SMX A;  4BBR H;  4X64 L;  2QGQ A;  3CMA A;  3OTO Q;  1N36 Q;  1HR0 L;  1AH9 A;  3PCO B;  4JOI C;  4R4C A;  4B3T L;  4BY7 H;  3T1Y Q;  1IZ6 A;  1OXS C;  1K3R A;  2BA1 A;  1MIU A;  4DV7 Q;  1YIT A;  2E2I H;  1QZH A;  4GLX A;  1E1O A;  3NEL A;  3BZK A;  1VQB A;  3KF6 B;  3ZJY C;  2ZJQ A;  1G51 A;  1V43 A;  2KCM A;  4Y7N H;  2JQO A;  4X62 L;  4KHP L;  4C2M H;  1EQQ A;  2E5L Q;  4BBS H;  4YHH Q;  2OTJ A;  1HH2 P;  2VNU D;  3KF6 A;  3CCE A;  3CXC A;  1YBY A;  1E22 A;  4DR1 L;  3S2H H;  2K5H A;  2R6G A;  3E0E A;  3I2Z A;  2D0O A;  4GN3 B;  3CCQ A;  1A63 A;  3J80 c;  1WOC A;  3CD6 A;  3CCL A;  1VQP A;  2EQS A;  1K0R A;  3AFQ A;  1UWV A;  2BH8 A;  1EQR A;  1IBL L;  3ERS X;  5IP7 G;  1IBM L;  3A0J A;  2VUM G;  1G6P A;  4JI7 L;  3RR5 A;  3UDX A;  4HIO A;  3W5O A;  1BKB A;  3M3Y H;  1NBW A;  2Q2T A;  1WCM G;  4A3J H;  1K73 C;  1N34 Q;  3HOX H;  4JG2 A;  1VQM A;  3UDI A;  1I5F A;  3H15 A;  4BXX H;  4DK6 C;  2UUB L;  3D0F A;  4GN5 A;  1QZG A;  4LF9 L;  2B63 H;  2R7Z G;  1N33 L;  2NZH A;  2D0P A;  4O0A A;  3H0G H;  4QIW E;  4PMW A;  2H5X A;  4DR2 L;  1YI2 A;  1FJG L;  4LUZ A;  4QGU A;  1BBW A;  1PH6 A;  1Q12 A;  5IP9 G;  2JA5 H;  4A3E H;  2R7F A;  1LTL A;  1WI5 A;  3UE0 A;  1TWF H;  5LMN Q;  2JA6 H;  3H3V H;  1VQH A;  3PGZ A;  4AYB E;  1SFO H;  1KD1 C;  4IJL A;  1TXY A;  4A3K H;  1LYL A;  1EIY B;  3GO5 A;  2WB1 G;  3A5Z B;  4GOP B;  3S15 H;  3HOY G;  2K14 A;  3TEH B;  5IYC G;  5FJ8 H;  4DV2 Q;  5LMU Q;  3LGJ A;  4LFC L;  4HJ9 A;  3KFU A;  1PA6 A;  1SN8 A;  2YTY A;  4LWC A;  2I5H A;  1YVC A;  4GOP A;  4POG A;  4OWW B;  3I4M G;  2FXQ A;  1KRT A;  1PHJ A;  2OCE A;  1MJC A;  4QY7 A;  4QQB X;  2ZTE A;  3TS0 A;  2UUC L;  1VQF A;  1XNQ L;  4DUY L;  1W3S A;  1XNR Q;  4FDB A;  3S1N H;  1PV4 A;  4X64 Q;  2I5M X;  1HNX L;  4POF A;  4J15 A;  1HR0 Q;  2ZM6 L;  1UE5 A;  1TWH H;  3STB D;  4NXM L;  1OXT A;  4A3G G;  4B3S L;  4A93 G;  4B3T Q;  3M4Q A;  5FLM H;  3M85 A;  5E7N A;  3K81 C;  1N36 L;  2CFM A;  1JB7 A;  1HNZ L;  4YCU A;  1HZC A;  5M3F G;  3T1Y L;  2YYZ A;  4JI2 L;  4DV7 L;  4OO1 G;  4A3L H;  1VQD A;  2YU9 H;  4KHP Q;  4DR6 Q;  3PV0 A;  2JEB I;  4JI6 Q;  3E9I A;  1PH5 A;  1YNX A;  1B70 B;  4K0K L;  5M3M H;  1T9H A;  4DR1 Q;  2VW9 A;  5GAE C;  1PFS A;  1I3Q H;  1VQJ A;  2E5L L;  1TWA H;  5GQO A;  2XGT A;  4YHH L;  1DGS A;  1CKO A;  2Y0S G;  3PO3 G;  3RNU A;  1IBL Q;  1IBM Q;  4JI1 Q;  4DAM A;  3RN2 A;  1NMG A;  1N32 Q;  5C3E H;  4YCV A;  1PYB A;  4JCV E;  4DV6 Q;  1Y1W H;  3EBE A;  4JOI A;  3U4Z A;  1VQ7 A;  3RLF A;  4JI0 Q;  1IL2 A;  4DK3 C;  4DV3 L;  2UUB Q;  2R93 H;  2A1A A;  3CAM A;  5C4X H;  5C44 G;  1VQO A;  2NVY H;  4KI0 A;  1PH9 A;  3HKZ E;  1NY4 A;  4A3D G;  3KYH C;  4X65 L;  2ALY B;  4HIM A;  2ES2 A;  1D7Q A;  5M5Y H;  3RN5 A;  3TS2 A;  3PO2 G;  3EN2 A;  2N78 A;  3J81 i;  3D31 A;  4OX9 L;  1S3O A;  1EIF A;  2CWA A;  2CWP A;  3MEF A;  1ASZ A;  1XPU A;  3S1R H;  2JEA I;  4GNX B;  3T1H L;  3F1Z A;  5LMN L;  1PH7 A;  1YHB A;  1LM0 A;  3CCJ A;  4WJ4 A;  5IYD G;  4APV A;  1FVI A;  4L5S A;  3I4O A;  1GKH A;  3GDE A;  4LF5 Q;  4R4T A;  1YZ6 A;  3J81 c;  5LMU L;  4DV2 L;  3HOZ G;  1H95 A;  4IPH A;  1X55 A;  1NJI C;  1Y1V H;  3RLN A;  3TRZ A;  4DR3 L;  1J5E Q;  2AMC B;  4B3S Q;  1JJG A;  1FL0 A;  4LF8 L;  1XNR L;  1S72 A;  2LSS A;  3EIV A;  4JI5 L;  4GKJ Q;  2PI2 E;  2WP8 J;  1HNZ Q;  1KHI A;  2ZJR A;  4IPD A;  1UE1 A;  4JI2 Q;  5M5W H;  1M1K C;  5FLX c;  2MO0 A;  2JA7 G;  3W1B A;  2R92 G;  2JJQ A;  5GAD C;  4LFB Q;  1WJJ A;  3J80 i;  2PNH A;  3RLO A;  2YV5 A;  5C0X J;  4A3F G;  4L5Q A;  3KJP A;  2KEN A;  2KHI A;  3PUW A;  4QJF A;  4K0K Q;  1HJP A;  4XTC S;  5BR8 Q;  1XPO A;  1GO3 E;  3S1M H;  4B3M Q;  2AWO A;  4DR6 L;  4PG3 A;  4GS3 A;  4YCW A;  4JI6 L;  3OW2 A;  4JYA Q;  1VQE A;  3HFZ B;  3TRE A;  1EWI A;  3FKI H;  2WB1 E;  1IXR A;  2KCT A;  3NEM A;  4H02 A;  4RMF A;  2GN5 A;  2N3S A;  2HT1 A;  1X3E A;  4YWL A;  4C3I H;  4A3B G;  4OWT B;  4A3C G;  4JI1 L;  1Y14 B;  2LXJ A;  1N32 L;  1OXU A;  5IP7 H;  1VQK A;  2VUM H;  4DV3 Q;  1XMQ Q;  3HOU G;  4DV6 L;  5AJ3 Q;  4JI0 L;  2UXC L;  2RCN A;  4X65 Q;  1WCM H;  2NVT H;  3MXN B;  2WAQ G;  5J3B A;  5C0X G;  1YJ9 A;  1JE5 A;  1I6H H;  4LF7 Q;  2D62 A;  2R7Z H;  2A8V A;  4OX9 Q;  4IPC A;  2ZTC A;  3SGI A;  1A62 A;  4R4Q A;  2AWN A;  4UP7 A;  5IP9 H;  3T1H Q;  1K8A C;  3S14 H;  1U0L A;  1X54 A;  3CC7 A;  5C0X I;  4EQ5 A;  1EYG A;  2L15 A;  2QA4 A;  2EXD A;  2VY3 A;  2K4K A;  1PH4 A;  4DV0 L;  3HOY H;  5IYC H;  2GVB A;  2Y0S E;  2ZTD A;  4DR5 Q;  4LF5 L;  1SRO A;  1KAW A;  2HIV A;  3I4M H;  3BU2 A;  4DR3 Q;  1VQG A;  4NB3 A;  1K8G A;  1E3P A;  4LF8 Q;  2IX1 A;  3S2D H;  2VQE Q;  4JI5 Q;  2PI2 A;  4MNO A;  4P75 A;  1J5E L;  2HHH L;  3M4O H;  1N9W A;  1UE6 A;  1FGU A;  3PSI A;  3W1G A;  3KDF B;  5IYB G;  4NPS A;  4A3G H;  1HNW Q;  1KL9 A;  4A93 H;  4GKJ L;  2IY5 B;  3ULJ A;  4OON A;  4LFA Q;  1KIX A;  3GTK H;  4A3M G;  4A75 A;  1GM5 A;  4JBK A;  3ULP A;  1J6Q A;  1X6O A;  3KDF A;  2RHQ B;  5M3F H;  4BY1 H;  1K9M C;  3G6E A;  1OTC A;  4LFB L;  1PYS B;  2VL6 A;  4DNI A;  1VQA A;  2NN6 G;  2NVX H;  3F2C A;  3UDG A;  3WWV A;  3F2B A;  1KC8 C;  5BR8 L;  4UP9 A;  1NTG A;  4HJA A;  2IHE A;  2VQF L;  1JJ2 A;  4B3M L;  2F4V Q;  2JK8 A;  2HIX A;  4GLV B;  4JYA L;  1BVS A;  1V1Q A;  1WYD A;  2Z6K C;  3CW2 C;  3DM3 A;  3PUV A;  3G4S A;  1P16 A;  1AE2 A;  2A19 A;  2E2J H;  1X56 A;  2MQH A;  4LUV A;  2JA9 A;  5ELN A;  3HOW G;  3PO3 H;  2DGY A;  2JE6 I;  2NN6 I;  2V1C C;  3UE1 A;  3E9H A;  3STB C;  4A3I G;  2OWO A;  1VQ4 A;  3S1Q H;  4LF6 Q;  3K80 C;  4YWK A;  4GN4 B;  1JMC A;  4JV5 L;  3J7Z C;  3U58 A;  2UXC Q;  2HQL A;  1Q1B A;  1XMQ L;  2E8G A;  5AJ3 L;  1XTD A;  5JJK A;  2LXK A;  2K5V A;  5C44 H;  1A8V A;  4JI4 Q;  4A3D H;  1M90 C;  1YJN A;  1YJW A;  3F8T A;  1XMO L;  4LF7 L;  3J7A 5;  5M5X H;  1XPR A;  3GD7 A;  3PIO A;  3PO2 H;  1D8L A;  3I4N H;  4IPG A;  2UU9 L;  3PUY A;  1X9N A;  1N8R C;  4IO9 A;  1OXV A;  1Y1W G;  1YHQ A;  1VCI A;  1CKM A;  4DV0 Q;  3BZC A;  3PF5 A;  1L1O C;  4ME3 A;  5IYD H;  2OQK A;  5IT9 c;  3CME A;  2PMZ E;  1UEB A;  4PZ8 A;  4TQU S;  4X6A H;  1L0W A;  4AQY L;  3Q8D A;  4X66 Q;  1YIJ A;  4C3H H;  4R1J A;  2CKZ B;  1YHA A;  3VDY A;  1MJE A;  3HOZ H;  4DR5 L;  2N49 A;  4UY8 C;  5JEA J;  1SLJ A;  1LUZ A;  4QL5 A;  1Z47 A;  3PIP A;  4IOC A;  2AKW B;  2HHH Q;  1B8A A;  2VQE L;  3ER0 A;  2IT1 A;  1TWC H;  2ATW A;  1PH8 A;  3HOV G;  1TWG H;  4A4I A;  5EAY A;  1HNW L;  1PVO A;  1E24 A;  3CQZ H;  3RZD H;  2WAQ E;  3L2P A;  4HJ8 A;  3CP0 A;  2ID0 A;  4LF4 L;  4LFA L;  2JA8 G;  4IFD J;  4MTN A;  2JA7 H;  2R92 H;  1Z9F A;  4A3F H;  2OTL A;  5HGQ A;  1AE3 A;  2VQF Q;  1HZB A;  3ICE A;  3PUZ A;  4DKA C;  3S16 H;  5DLQ E;  4JI3 L;  4OXP A;  4PZ7 A;  4LUO A;  1Q46 A;  4BBR G;  2F4V L;  4JBJ A;  2MFI A;  1BBU A;  3CCM A;  2K50 A;  5JEA G;  4BY7 G;  2BH2 A;  4JI8 L;  4DR4 Q;  1X3G A;  3CC2 A;  3K0X A;  4A3B H;  3TQY A;  4JV5 Q;  4A3C H;  1Q1E A;  4LF6 L;  1VQN A;  1NMF A;  2Q2U A;  1SE8 A;  2UXB Q;  4PZ6 A;  2UXD Q;  3BJU A;  3HOU H;  4Y52 H;  4BBS G;  1E1T A;  3IRB A;  3F2D A;  1VQ9 A;  1MKH A;  4LNQ A;  4IFD G;  1SRU A;  5H1S E;  1HR0 W;  3I7F A;  1XMO Q;  2B3G A;  2KBN A;  3A74 A;  4JI4 L;  3FKI G;  2MNA A;  3K7U C;  2MO1 A;  3CPW A;  1W2B A;  4DR7 L;  1I94 L;  2KHJ A;  3JC6 6;  2UU9 Q;  1CSQ A;  3AYH B;  2VS1 A;  4BA1 I;  3JAM i;  2Z6K A;  4L5T A;  1VS0 A;  4O2D A;  4IFD I;  1XJV A;  5C4J H;  4GNX C;  1QVF A;  3AEV A;  3U50 C;  5JJI A;  2I0Q A;  3M7N A;  3I55 A;  1PH2 A;  3GTG H;  1HZA A;  4A3J G;  1O7I A;  4IJH A;  2F52 A;  3HKS A;  4EX5 A;  3HOX G;  4AQY Q;  1IBK Q;  4BXX G;  4DV5 Q;  2PQA B;  2B63 G;  1KXL A;  2CCZ A;  4X66 L;  3NEN A;  4GKK Q;  4DAY B;  3JAM c;  3H0G G;  1HZ9 A;  1QVC A;  2YTX A;  3G48 A;  3S24 A;  1I50 H;  2JA5 G;  4NXN Q;  4A3E G;  2PQA A;  4HIK A;  5ELO A;  4B3R Q;  4HJ5 A;  1YEZ A;  4GLA C;  1Q86 C;  2JA6 G;  2N8N A;  1PH1 A;  2NVQ H;  4DV4 Q;  5JJL A;  1CUK A;  1R9T H;  4MZ9 A;  3ULL A;  1KRS A;  5IWA Q;  4A3K G;  4YY3 Q;  5IYB H;  3CF5 A;  2IX0 A;  1EUJ A;  4LF4 Q;  1L1O B;  2UUA Q;  5FJ8 G;  3GTP H;  3GTM H;  4TVA B;  4A3M H;  2OQ0 A;  3L0O A;  1UE7 A;  3M4P A;  4KHZ A;  4DUZ L;  3CCR A;  3H3V I;  1L1O A;  5GAH C;  4P74 A;  4R4I A;  2ASB A;  3FHW A;  3CCU A;  1VQC A;  4JI3 Q;  3DLL A;  2WFW A;  3G71 A;  2AHO B;  3B6Y A;  1B7Y B;  2K75 A;  2K5N A;  1ASY A;  3CCV A;  3GTO H;  4JI8 Q;  3OYY A;  4UP8 A;  4HJ7 A;  3CC4 A;  4DV1 L;  5FLM G;  3UDF A;  4KLK A;  4XIG S;  3OTO L;  3A5U A;  3HOW H;  1V9P A;  4A3I H;  1PH3 A;  4DR4 L;  2YTV A;  1E7Z A;  2R7D A;  4UPA A;  1KQS A;  4BY1 G;  4A3L G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...