4BXXG

Arrested rna polymerase ii-bye1 complex
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
171
structure length
171
Chain Sequence
MFFIKDLSLNITLHPSFFGPRMKQYLKTKLLEEVEGSCTGKFGYILCVLDYDNIDIQRGRILPTDGSAEFNVKYRAVVFKPFKGEVVDGTVVSCSQHGFEVQVGPMKVFVTKHLMPQDLTFNAGSNPPSYQSSEDVITIKSRIRVKIEGCISQVSSIHAIGSIKEDYLGAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of RNA Polymerase II Complexes with Bye1, a Chromatin-Binding Phf3/Dido1 Homologue
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
total genus 29
structure length 171
sequence length 171
ec nomenclature
pdb deposition date 2013-07-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00575 S1 S1 RNA binding domain
G PF03876 SHS2_Rpb7-N SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4bxxG02
3.30.1490.120 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 RNA polymerase Rpb7-like, N-terminal domain 4bxxG01
4HIOA 4A3BH 4YCWA 3BZCA 5JJIA 3I4OA 2IT1A 3S1RH 4BY1H 1WYDA 4DV1L 3CCLA 4DR2Q 5C0XJ 2D0OA 2GVBA 2HIVA 4RMFA 1PH5A 4OX9L 4DV2L 2K52A 4EX5A 1LYLA 2A19A 3UE1A 5M5XH 4IOCA 5C44G 1CSQA 1IBKL 4JBMA 3PV0A 3FP9A 1C0AA 4A3KH 3OYYA 5M3MH 5HY6A 1YZ6A 1EQQA 4BBSH 3I56A 4IOAA 2R6GA 4DV0Q 4GLXA 4A3EG 4MTNA 2IX1A 2VZAA 4X66Q 2NZHA 1UE6A 4GOPA 3GTGH 1PV4A 4GOPC 4A3FG 1KRTA 3RN2A 2JA6G 2YTYA 1XNRL 2MO0A 2NVXH 2Q2TA 1GVPA 2R7DA 4GKKQ 2VNUD 1N36Q 4IPGA 1CKMA 4LF6L 2CKZB 2C35B 2LXKA 4JBKA 2VQFQ 3TRZA 4A3LH 3H0GG 2E2JH 1FJGL 1E1OA 2FXQA 3HOXH 1VQFA 4A3DH 3RR5A 1AH9A 4OO1I 2VS1A 3KF6B 4DR6Q 2I0QA 1CSPA 2Q2IA 2N3SA 2AHOB 4OONA 3G48A 3F2BA 1Y1WH 1IBMQ 3S16H 3CXCA 1EIFA 2MO1A 3STBC 5BR8Q 3OTOL 4P71A 1X55A 4A3GH 1FVIA 1HR0Q 1QVFA 3HOZG 1X54A 3U4ZA 2VQEL 3K80C 1QZHA 4X65Q 4HJ5A 5IYCH 1IYJB 1Z47A 5IP9G 3K8AA 5C3EG 2ZTEA 2AWOA 1NTGA 2ZM6Q 3U4VA 2IY5B 1KXLA 1RIPA 3AFQA 5IT9c 2OQ0A 4YCUA 1VQ7A 1A0IA 1P8LA 1VQEA 3PF5A 1HJPA 3IRBA 4RG1A 5DLQE 5LMUL 1YEZA 4UY8C 2ZJQA 1YBYA 4B3ML 2R7ZG 4DPGA 5IYCG 2BA0A 3EBEA 4JI8L 4JYAQ 2KHIA 3HKSA 4DV6Q 4JOIA 3KJOA 4HJAA 2UU9L 3HKZE 1N33L 1EUJA 3K7AH 1NMGA 2NVQH 1E1TA 5M5YH 1YI2A 1VQDA 3FHWA 3CW2C 4C3HH 4X64L 3KOJA 1I3QH 1HR0W 4ALPA 2UUBL 1N8RC 1NJIC 1TWHH 1U5KA 4HIDA 1K0RA 4JI5Q 2JA7H 4X65L 3ICEA 1DGSA 4DV5Q 3PO2H 1GO3E 2DUDA 4L5SA 3S15H 4WJ4A 4A3KG 3JC66 4BY7G 2XGTA 1JB7A 5FLMH 2E2HH 4JI4Q 2VUMH 1J6QA 2KENA 2DGYA 2YYZA 1AE2A 3KDFB 1VQAA 4GS3A 4OXPA 1YNXA 2I5MX 3HKZG 1Y1VG 3CF5A 4R4IA 3CC7A 2NZOA 1MJEA 1HNXL 4P75A 5C4JH 2VQFL 3PIPA 4A3BG 4AH6A 4QJFA 2HQLA 1A8VA 4PMWA 5FLMG 2WP8J 1N36L 3RLFA 1VQ5A 3CPFA 4Y7NH 3E9HA 4HJ9A 3NBHB 3I4MG 1KAWA 4IPCA 3PO2G 3CMEA 3SGIA 3AQQA 2K5NA 4YCVA 4DV0L 1EFWA 5ELNA 2K5HA 1OXXK 3FKIG 4BXXG 2JK8A 3PIOA 1Q86C 4BA1I 4AYBG 3M9BA 3ULLA 1M1KC 4DUZL 2OTLA 1IBLL 1X56A 2PQAB 2IHEA 4A3GG 4GN3B 3J7A5 4JV5L 2ZJRA 1VQKA 1SE8A 3I4NH 1WCMH 1D8LA 4TQUS 1YHAA 1VQLA 1OXTA 4DV1Q 2NN6G 1JT8A 4KHZA 1VQCA 4JI7Q 3PUWA 5JEAG 3GTJH 1K73C 3J80i 3G4SA 1XMOL 1BBUA 2UUCL 5IY0A 1N32L 2JE6I 1K8GA 3GTOH 2K50A 1X9NA 1VS0A 1XPUA 4YY3L 1X3EA 3K81C 3CD6A 1N32Q 3I7FA 2KCMA 3D31A 2EQSA 2JQOA 4APVA 1SFOH 1TWGH 1S3OA 1Y1WG 2R7ZH 2UUAL 1YVCA 3GO5A 1UEBA 4LWCA 1PH1A 2MQHA 5IP7H 5E7NA 5M3FG 5FJ8G 4JI1L 4P73A 4A3IG 2PNHA 4JYAL 1I5FA 2B29A 4DR1L 3CCUA 1EQRA 1QZGA 1XNQQ 1WCMG 4A3DG 3KLWA 1PH9A 4A3LG 4LF4L 3U58A 4LF8L 5GROA 2UXDQ 4HIMA 3CQZH 3CC4A 1JMCA 2F3IA 4A3JH 4LUOA 4L5TA 1G51A 2QGQA 4B3SL 2XTIA 4IFDJ 4A3FH 1Q1BA 2PI2A 2YTXA 4DR3L 1A63A 2H5XA 1TWAH 5HGQA 1N34Q 2WB1G 4DR5Q 5LMNL 1R9TH 4DUYQ 5IYDG 1KRSA 4LFBQ 3BZKA 2JEAI 1HNXQ 2WFWA 4AQYQ 5M3MG 3RNUA 3CPWA 4A3IH 4YWKA 4DV6L 3U50C 5GAHC 2UU9Q 1OXUA 1YHBA 5IP7G 1I50H 4AQYL 4BY1G 1C9OA 3ULJA 3H3VI 4DAMA 3J81j 3DLLA 1MJCA 4B3RL 1JJCB 4BBSG 2ALYB 4DV5L 4JI6L 3HOYG 1E22A 2F52A 2JA5G 1HNWQ 4GNXA 1L0WA 4YY3Q 4DV7Q 3PUZA 2I5LX 4PG3A 4IO9A 3NEMA 1PH7A 3HOVH 3S17H 3J80c 3ZJYC 4JI6Q 3H15A 3UE0A 1PH8A 2Z6KA 5IYBH 1VQ4A 1X3FA 1SROA 2RHSB 1KQSA 1B7YB 4DK3C 3PO3G 4IPDA 1N33Q 3Q8DA 1D7QA 2UXDL 3B6YA 1IBML 3KJPA 2ID0A 4DKAC 4LNQA 4QY7A 3CMAA 3AYHB 1L1OC 2ES2A 2CQOA 2E8GA 1K9MC 4A93H 1I94Q 4JI1Q 2JA9A 2PMZE 4QL5A 4GNXC 4UP9A 1FJGQ 4IFDI 1NBWA 2K75A 3UDGA 1XPOA 2HHHQ 1Z9FA 2ZM6L 4R4OA 4OWWB 4DR5L 2CCZA 1VQ6A 1CKNA 4NB3A 1XPRA 4C3IH 1GKHA 4EQ5A 1HNZQ 1A62A 3A5UA 4DV4L 1PH3A 3KFUA 1XNRQ 3S1NH 3HOVG 1V9PA 5IE8A 5GAEC 4JI7L 4O2DA 2WAQG 4JI2Q 2VY3A 2RF4A 4IJLA 1HZ9A 1YJ9A 2JA8H 1G291 1HZCA 2JJQA 2HIXA 4KLKA 4P74A 1EOVA 4QIWE 4GKJQ 5C4XH 2JA6H 1UE7A 1C7YA 1OXSC 1JJGA 3CP0A 1QVCA 1TWCH 1M90C 1TXYA 1IBLQ 2NVTH 2N8NA 3HOWH 1PHJA 1E24A 4OX9Q 4GKJL 3GTQH 2F4VQ 1IXRA 1CKOA 1B70B 3HOYH 4JOIC 4A4IA 4JI2L 1KC8C 4BA2I 1NY4A 3T1HL 3PSIA 2YU9H 5FJ8H 4OWXB 1WI5A 2Y0SE 4R4QA 1HNZL 4GOPB 1WJJA 2GN5A 3G71A 2UUCQ 4X64Q 3HOUG 1QUQB 1RL2A 4LFCL 3TEHB 1H95A 2Q2HA 2HHHL 2R7FA 3L2PA 2VUMG 2PQAA 3ULPA 4J15A 4PZ8A 1IBKQ 2RHQB 2HT1A 1I94L 2OTJA 1X3GA 2E5LQ 3KF6A 4R4CA 4DUZQ 2JA7G 3UDFA 1VQGA 2K5VA 3S2DH 4YWMA 4X62Q 2VW9A 4PZ6A 4A3MH 5JJKA 3JAMi 1ASYA 1VQ8A 1IZ6A 1CUKA 5AJ3Q 1Q7YC 4IFDG 5IWAQ 3GD7A 2R93G 2Y0SG 3TS0A 3J81c 3EIVA 3UDXA 2A8VA 1SMXA 4UP7A 1SLJA 4JI5L 5FLXc 2QEXA 4LF7Q 3UDIA 2R92H 3CC2A 2UUBQ 1BBWA 4DR4L 1P16A 4DR7L 2R93H 1WOCA 4HJ7A 2N49A 4B3RQ 2JEBI 3CCEA 1HR0L 3A74A 1PA6A 1KIXA 3S14H 2KBNA 3PCOB 4PZ7A 3F2CA 1OXVA 5C0XG 1YITA 4JC0A 5M3FH 4KI0A 4HJ8A 1PH6A 4NXML 1W3SA 4GN4B 5M5WH 4DR6L 4QQBX 4YWLA 4DK6C 2JA5H 1L1OA 1XNQL 1NE3A 5IP9H 1K83H 2L15A 3RLOA 2E2IH 4POGA 3TREA 1VQNA 2UXBL 1HH2P 2Z0SA 2GVAA 1HZAA 4NXMQ 4LFBL 4BXXH 4DUYL 2OCEA 2IX0A 2BA1A 3I55A 5LMNQ 3GTLH 3GDEA 1N34L 3M7NA 3DM3A 5EAYA 3BU2A 4L5RC 1SN8A 4POFA 4YHHL 3I4MH 1VQIA 3E9IA 1JE5A 3L7ZC 3W1BA 4C2MH 3CCVA 1YIJA 1FGUA 1Q8KA 3PUVA 2ZJPA 4B3SQ 3I4NG 2CFMA 3H3VH 4X6AH 4MZ9A 3F1ZA 5AJ3L 1SRUA 4IPHA 1G6PA 2MFIA 3HOWG 4JI8Q 4BBRH 2D62A 3STBD 3HFZB 1JJ2A 1Y1VH 4DNIA 1PFSA 1Q46A 2CWAA 3TQYA 5LMUQ 1PH2A 4JCVE 2B3GA 2PI2E 1Y14B 3WWVA 1S72A 4UPAA 5C0XI 5J3BA 4NXNL 4BY7H 2UUAQ 3JAMc 4GKKL 4B3TQ 4JI3Q 2ZTCA 1Q82C 1E7ZA 4GNXB 4LUVA 5LMNW 3TS2A 4XIGS 3CAMA 4LFCQ 3S24A 2YV5A 3RZDH 3K0XA 1WFQA 1J5EL 3A0JA 4JBWA 4ME3A 4O0AA 4A76A 2N78A 3F8TA 2BH8A 3CCSA 1XTDA 3OW2A 1L2FA 1VCIA 1XMOQ 2RCNA 1KD1C 2K14A 2WAQE 2NN6I 3L0OA 3GTMH 2UXCL 1S40A 2Z6KC 4BBRG 4NXNQ 1ASZA 2AWNA 2R92G 3GTKH 2KHJA 4JV5Q 4OO1G 4LFAL 4DV2Q 1O7IA 3M4QA 4JI0L 4JI0Q 5K36G 3PF4A 1XMQL 1KHIA 4TVAB 4A3CG 2Q2UA 4LF6Q 4GN5A 2VL6A 4A75A 4R4TA 5JEAJ 1KL9A 4MNOA 1X6OA 2D0PA 1PVOA 3PGZA 2KCTA 4KHPL 1NMFA 2AMCB 4B3MQ 2WB1E 3HOZH 3I2ZA 1EWIA 1VQ9A 3NENA 2OWOA 5JJLA 4GLVB 3ER0A 2I5HA 2IHFA 1N9WA 4JI3L 4B3TL 1UE1A 5ELOA 3BJUA 4UP8A 4QGUA 3RZOH 4LF9L 1SR3A 4LFAQ 1T9HA 3H0GH 2QA4A 3AEVA 3CCRA 4DR2L 5IYDH 5GQOA 2OQKA 1U0LA 1PYSB 2A1AA 3AFPA 1YHQA 1I6HH 4JI4L 1VQPA 3S2HH 1B8AA 5C44H 3VDYA 2YTVA 1W2BA 2UXCQ 4K0KL 3KF8B 2NVYH 3FKIH 4JG2A 4LW1A 1Q1EA 1J5EQ 1LUZA 3MEFA 2MNAA 1QUQA 4DV3L 3RN5A 3CCMA 4A3MG 4DV7L 1K8AC 4LF5Q 4IJHA 1V1QA 4DR7Q 3PUXA 2V1CC 1PH4A 4GLAC 3HOXG 3D0FA 4A3EH 1YJNA 5IWAL 2ATWA 4Y52H 4K0KQ 4R1JA 1YJWA 1VQJA 2CWPA 3MXNB 1E3PA 1OTCA 2BH2A 1LTLA 3M85A 3G6EA 2UXBQ 3GTPH 4XTCS 3W5OA 1HNWL 5H1SE 1Q81C 1GM5A 3RLNA 5GAGC 3HOUH 1EYGA 3J81i 4HIKA 2B63H 3PUYA 1BKBA 4DAYB 4AYBE 3M4OH 4A3JG 4JBJA 3S1QH 1V43A 5GADC 2K4KA 1AE3A 3F2DA 3K7UC 4AIMA 1Q12A 4DV3Q 1VQOA 2LSSA 3T1YQ 4P72A 4DR3Q 3KYHC 4YHHQ 3T1YL 2VQEQ 1MKHA 1LM0A 2EXDA 4DR4Q 4KHPQ 3CCQA 4FDBA 5BR8L 1X65A 3OTOQ 3PO3H 3T1HQ 2ZTDA 4LUZA 5C3EH 4WJ3M 4DV4Q 5C4XG 1FL0A 2F4VL 1L1OB 4X62L 4LF8Q 4LF4Q 2JA8G 1XMQQ 1VQBA 4A93G 2AKWB 3KDFA 3A5ZB 1K3RA 4DR1Q 1VQMA 2E5LL 4NPSA 4LF9Q 1IL2A 3LGJA 1EIYB 1QVGA 4H02A 2B63G 2ASBA 2LXJA 3EN2A 3W1GA 1CKNB 4OWTB 1MIUA 3E0EA 1UE5A 5IYBG 3M3YH 1XJVA 3M4PA 1VQHA 4LF5L 3CCJA 1TWFH 4A3CH 1PYBA 1GD7A 1BVSA 4LF7L 1UWVA 3NELA 1HZBA 4L5QA 4X66L 2EIFA 4C3JH 3S1MH 3ERSX 3J7ZC
chains in the Genus database with same CATH superfamily
4A3BH 4YCWA 4R8IA 1GXDC 4DR2Q 2D0OA 3I3CA 1IBMH 2PPBC 2K7VA 2G5DA 1A3TA 2VUMA 4LH6A 4CDFC 4EBDA 4JBMA 2EDGA 5JVG3 4A3KH 5KFNA 4FXKC 3S2DB 2VQFH 2TMPA 3PZPA 5HY6A 1YZ6A 4PV1C 2PYKA 3A54A 1U4RA 1KTKA 4MTNA 2IX1A 2EXZA 4GOPA 3GTGH 3GIMA 2JA6G 2YTYA 2Q2TA 5KFWA 3M9MB 2FB9A 1N36Q 4HSPA 4NXMH 3J81W 2CKZB 4HR7A 3NQIA 2C35B 2PQEA 1ZYRD 1FJGL 1E1OA 4EEQA 2FXQA 4RUAA 1VQFA 3N6RA 3OMCA 1HUMA 3QWNA 5IYZF 1VMPA 5LL6S 2CH4W 1CSPA 2OT2A 3BVZA 2N3SA 5KYIA 3G48A 2DJFC 3EFXD 1NSNS 4P71A 1X55A 3BG3A 2BDOA 3FDTA 5C5JA 4CDEC 2PN1A 5D1OA 4CC6A 4X65Q 3A8IE 2NYZD 2RDIA 1STHA 5CC4A 1X3QA 3IG0A 2ZJTA 2AWOA 3RZDB 2W6PA 1W93A 5KG4A 2XCPA 1KXLA 1AUVA 2NU8B 3L3OC 4O3RA 4NW2A 5DAUA 1JWSD 3H0GB 3C2PA 3PF5A 5FLXW 1HJPA 5LMUL 1ML0D 4OO1H 2XWBB 2R7ZG 2R7ZA 3HKSA 4DV6Q 2UU9L 3I4LA 2G9HD 3L9AX 5BMVF 1EUJA 1S5CD 3K7AH 4RB0A 1Q90A 5M5YH 1VQDA 3FHWA 2E2HB 1RDPD 2E74C 3CW2C 4MAMA 1J5EH 4DF7A 3KOJA 1I3QH 2UUBL 4ALPA 2PCFB 1HNWL 3ICEA 1K0RA 2JA7H 2E75C 3PO2H 4A2AA 4L5SA 2UXCH 4DR3H 2CW0D 1AFPA 4BY7G 5FD5A 2C2RA 1EYZA 3GTLB 1J6QA 2KENA 3KDFB 4OXPA 4GS3A 3EJIA 5NUCA 4IWXA 3BDOA 1B33N 3CC7A 2ASJA 1MJEA 4MA5A 5KG2A 1HNXL 2VQFL 4AQYH 1WD0A 2HQLA 5CV7A 4EVOA 1EOTA 2EOTA 2WP8J 1FNUA 3CPFA 4JPBW 3S14B 3JAML 2Z4IA 4F87A 4IPCA 3PO2G 5DGBA 4Y7NB 4RGMA 3SGIA 2B2VC 2F0GA 2B2UC 2K5NA 1S03G 2GA4B 3FKIG 1Z2OX 3HZXA 1Q86C 3FKIA 4BA1I 2F0VA 2PQAB 2EY1A 1JOOA 5CV9A 1C3OA 2ZJRA 5DGAA 1WCMH 3QJYA 4ECWA 1OXTA 4KY7A 1SCUB 3WNZA 4ZI7F 2IJ0A 3J80i 3NBHA 1BBUA 4C5CA 4H44C 2JE6I 1F2ZA 1TWAB 4QW8A 1XPUA 4K2LA 2I80A 3K5NA 1F9QA 4APVA 1EY9A 1Y69U 2EY2A 1Y1WG 1KJ9A 2UUAL 5F9NA 3A8JE 3I73A 1PH1A 3V6HA 4X3KA 5CMDA 4IALA 4P73A 4XQQA 4JYAL 2W6OA 1F9PA 5M5WB 4DR1L 3T13A 1EQRA 3CCUA 5ELEA 3URYA 2C2EA 2JA7B 3U58A 5E4XA 2LS01 2ENBA 2UXDQ 2EY6A 1V1OA 3CQZH 4UCSA 2B39A 5D1OB 4O3NA 5KNDA 3F2UA 3FRPB 3HG9A 4IURA 4ECSA 1Q1BA 4O2AF 5KKNB 3S1MB 5DG7A 1D1IA 3RUZA 4JI1H 2FK2A 3TN2A 1R9TH 5D14A 1U4PA 4LFBQ 2A69C 3SK8A 4WD3A 3RNUA 1TIID 4DV6L 3U50C 2UU9Q 4MV8A 2R7ZB 4PDBA 5IP7G 1SYXB 5KNBA 4OHJA 3LMLA 1PZID 4PQXA 1KDAA 1IW7C 1D5MC 2C2DA 3NWSA 3H3VI 4ECTA 3SK5A 3VYRA 1HNXH 3HOYG 1CHPD 4YY3Q 4J9SA 4PG3A 2YS6A 4N8FA 1DOKA 3S17B 4JI6Q 3ZJYC 3OHAA 3PO3G 1EYAA 2XSCA 1NNXA 4BY7B 1N33Q 4ECVA 5G3LF 2UXDL 4KJOA 3RF2A 1WVLA 1ET6A 2JSOA 5LL6X 4O4HF 4LNQA 1JCKB 1I4RA 4ZAIA 3Q8PB 4DV0H 4A93H 1IBKH 3T5JA 1I6UA 3SDZA 2PMZE 4JUZA 4BY1B 1R4PB 2K75A 2O2LD 2HHHQ 1QG7A 3N41B 1CKNA 4YB8B 1KDCA 1M4VA 2KVMA 2JA5B 1SNCA 4C3IH 1DV1A 2AQ4A 5EWGA 2JYOA 4J9LA 3A5UA 4DV4L 2W8LA 3KFUA 1DJRD 3RGZA 4RH6A 1PRTB 1NAPA 3OUUA 2HGSA 5C1OA 2NB0A 2A5HA 4ED8A 2DN8A 2BCOA 4KD4A 1HZ9A 2JA8H 1HZCA 5C4XH 2JA6H 4FVMA 5EJWA 1IBLQ 3NUCA 2N8NA 4O42A 1PHJA 4C3JB 1I4XA 1HUNA 3HOYH 5KFIA 4JOIC 5DG8A 5IGCA 4TV8F 5KFCA 1AUXA 1F9SA 3PSIA 1M0TA 2NU6B 4ZHQF 3QG1A 5DQHA 2UVUA 1O80A 4IHJF 1WI5A 2Y0SE 3RGXA 1SMYD 4GOPB 2ASLA 3HOUG 3CU7A 3TEHB 1Y1WB 1DCZA 4MTDA 2B2YC 1RODA 4IUQA 1G91A 2V58A 3ULPA 4UCUA 2R7MA 1IBKQ 1K1QA 3BVMA 2QCPX 2RHQB 3SEBA 4G7OC 2JA7G 2KEDA 3MC0B 1VQGA 2K5VA 5J2UF 1HTLD 4CKCA 2F0TA 3E6ZX 4PZ6A 1VQ8A 1IZ6A 5AJ3Q 1LV9A 2R93A 4U7CA 2DPIA 2R93G 3N43B 2SDFA 1SXTA 3EROA 5FLXc 4IR9A 4JI5L 2D9UA 1P16A 1WTVA 2N49A 4XYQA 3K59A 4ABNA 1QJOA 2DNEA 1XNRH 5DNFA 2ZXOA 3T5LA 3GV8B 4G7ZC 4JC0A 4MN3A 4KI0A 4B9XA 5M5XB 2R8KA 3KLRA 5G3LD 3J80L 4O4LF 2Z9HA 3RLOA 1HH2P 2Z0SA 3HB9A 5KFPA 4LFBL 3HXLA 1NR4A 5L1IA 4F4YA 4DUYL 3D8GA 2BA1A 3HBLA 5KFAA 1SNQA 3N8DA 1JWMD 2YZGA 1SN8A 4POFA 2EYLA 5A35A 4HYKA 2EYJA 3L7ZC 1FR3A 4C2MH 3CCVA 3V4ZA 2L1BA 4DV7H 2CFMA 2F0JA 3H3VH 2J9GA 3F1ZA 2L5TA 1SRUA 4IPHA 4U68A 2MFIA 3G6JB 4FNFA 4RGOS 4TQSA 3GTLA 5KG0A 2CWAA 3TQYA 4RCOA 1PH2A 3NPPA 1STYA 3VR3A 1WTWA 5ELFA 4UPAA 5I9PA 5EQ0A 4BY7H 4PMBA 1IKLA 2JA5A 4B3TQ 1LTRD 3BQ0A 2SCUB 4GNXB 5CR3A 4LFCQ 5EPLA 3S24A 4K14A 2NUCA 4I55F 4JBWA 3KBGA 4O0AA 4A76A 3F8TA 3CCSA 1XTDA 2XIGA 4QMGA 1VCIA 2RCNA 4RHSA 1KD1C 1S0OA 2WAQE 1M7JA 4ECZA 1Y1VA 4BBRG 1UAPA 2SOBA 1ASZA 2AWNA 1TR5A 4JV5Q 3K58A 1I7LA 3FMAA 4OO1G 3M4QA 1WTRA 4IRCA 4C3JG 3PF4A 3QZ8A 1XMQL 3P75A 5KRUA 4LF6Q 3D4WA 2VL6A 5KFDA 1N56A 1KL9A 4MNOA 5KFOA 1JC7A 4KHPL 4FF4A 4KHVA 1EWIA 4IZ8A 3VYSA 4DU9A 2OWOA 4GLVB 2XNAC 1KJQA 1N9WA 3BJUA 5BN4A 1QILA 4QGUA 1WTOA 1V4YA 3GV5B 3GTJA 2VA3A 1WTQA 1M6VA 1CE8A 2XCLA 1UNNC 2BE5C 2X69A 3CCRA 5BPFA 5LA6F 5GQOA 2OQKA 1PYSB 4JI4L 2ZDQA 1B8AA 4R8NA 5C44H 2YTVA 2UXCQ 2XRSD 3V96A 3IN5A 3QOJA 2XGQA 4E4TA 2O03A 3PMFA 2W9CB 2F0UA 3S2HB 1J5EQ 3RN5A 3MEFA 4DV3L 2K03A 4A3MG 3CCMA 4LF6H 4DV7L 1IYUA 4L6TB 3OIQA 2QKIC 5FD6A 4GLAC 3J7YW 3JZIA 4O3OA 1FJGH 4Y52H 3K3VA 4R1JA 3PW5A 1I7NA 4EYHB 4RAUC 2CWPA 2HJWA 1E3PA 2BH2A 3GIKA 3G6EA 1GSHA 4XTCS 5H1SE 5JPMC 3X3NA 1TWGA 3SVMA 3I90A 3J81i 4HIKA 2B63H 2K05A 3KUPA 3PUYA 2ASDA 4DAYB 3K5MA 4AYBE 2PNRC 3GTOA 3GTGA 4MV1A 3H40A 1WR2A 3K7UC 1WTPA 1L2ZA 2WB1A 3DEPA 1RJRA 2BDNA 3ND9A 3PVXA 4P2CB 3H91A 5IGDA 2HVSA 2FPPB 2F03A 5KT7A 1F9RA 1PTOC 1CK1A 1FL0A 3N6XA 1V1PA 2NWGA 4X62L 1F2LA 1LTTD 3HKZB 2PMZA 1G8ZD 1F2MA 4H02A 4X3SA 1RF2D 1B50A 1MIUA 3E0EA 1DOLA 3GP7A 3M4PA 1TWFH 4KJNA 3GTQB 1PYBA 1BVSA 4LF7L 2FJZA 4QIWB 3BVGA 5COYA 4C2MB 1EY8A 2HD3A 3M7GA 3LP8A 3BZCA 5JJIA 1DD2A 1TQOA 1I4GA 5A2QW 4BBRB 1ONLA 4BY1H 3OOCA 2R92A 3TP8A 3CCLA 2HIVA 1SE2A 4A93B 1B2TA 2PZUA 5GONF 5FLXE 4EX5A 1Y8NB 4DR2H 2A19A 4EGQA 4A3GB 4HCEA 2R87A 1KJ8A 3CVZA 1QNKA 3OYYA 3V05A 3MWYW 1ZQ7A 3JSLA 3RV4A 1EQQA 4ZUIA 2V59A 4YQWA 4BBSH 3I56A 4IOAA 4JI5H 5I2YA 3PQIA 5J1ZA 4DV0Q 2VZAA 1UE6A 4GOPC 4A3FG 3OHBA 3DEOA 2Y0SA 2MO0A 2CZGA 4ED7A 3GTMB 2FK3A 4QWBA 1EQVA 2P0AA 4YAJB 2A73B 1CKMA 2SNSA 4LF6L 2FLNA 4JBKA 5KFYA 4ZLTF 1CZGA 1RTOA 3HOXH 2CW8A 4A3DH 1RCVD 4KKSA 2VS1A 4OO1I 2VPQA 5DLGA 3NXWA 5C6AA 1R9TB 3SE0A 2FKLA 2UVRA 1VAJA 1V51A 2X6GA 3K6OA 4RAZA 1X54A 3U4ZA 3D4DA 2GPSA 5FKAC 1MBYA 4YAKB 2EY5A 1IYJB 4ME6A 3K8AA 5IOCA 1TKWB 1BO0A 3JSNA 2IY5B 1SNOA 1TS3A 4X62H 4EQNA 5IT9c 1VQ7A 5K36H 2FP4B 4UY8C 4KY5A 3BA8A 2F4IA 3KAKA 1PZKD 2F0KA 2JN4A 4DPGA 2C9OA 3EBEA 5IYCG 4JI8L 1OWTA 2KHIA 2C22A 4HJAA 3KJOA 1IHZA 1KLGD 2RVLA 4K5VA 1N33L 5EPJA 4A3BB 2MP1A 4X3TA 2NVQH 1E1TA 4HTHA 3HOZB 3S1NB 1RD9D 1GSAA 2VOBA 3I72A 2RGVA 1NJIC 4J8QA 4DV5Q 5C3EB 1ZETA 2YZMA 2EVBA 2F0QA 2XGTA 4JI4Q 1V1PB 4KY6A 3GQBA 1II3A 4LF7H 2B2UA 5C3XA 2TSSA 1VQAA 4MV3A 5HGTA 2W9BA 1N33H 2I5MX 5T1GA 3HKZG 4NLGA 1E2WA 3N52A 4R4IA 4B3RH 2B63A 4P75A 3PIPA 5JH7F 1LLRD 1A8VA 1TS5A 4JV5H 1GHJA 4Y7NH 3E9HA 4QIWA 4YBZB 3I4MG 1KAWA 2HDLA 5KFRA 1BQQT 4ZOLF 2J6SA 3U9SA 5KT3A 3NWTA 4ZKCB 4YCVA 1E2ZA 2EYPA 2DWCA 2K5HA 1J8IA 4J0MA 1LACA 4BXXG 4F4XA 3NE5B 4N9PA 2ICEC 4AYBG 3M9BA 1BOSA 4DL4A 4DUZL 3G7LA 2OTLA 2K5DA 4GN3B 4A3GG 1EZ1A 5I6YA 1VQKA 3I4NH 2IMWP 5KFBA 1S97A 4CJ2C 1JLLB 1JT8A 1VDZA 1VQCA 3PUWA 3GTJH 2ZM6H 3G4SA 1O78A 2B2TC 1XMOL 4Q8EA 1CFMA 1HXYD 4RB1A 1K8GA 5C3WA 2K50A 5E4WC 3GILA 5L1KA 4YY3L 3D6CA 3RAQA 3CD6A 1D5ZC 3P7JA 3I7FA 2EQSA 4MHEA 1S3OA 2E2IA 3MR5A 3GO5A 5IT9L 1BR9A 4FXDA 4IN3A 5FPOA 5IP7H 1SYEA 5M3FG 2BQ3A 3KHRA 4JI1L 1EU4A 1U9RA 2PNHA 5KFUA 2B29A 4JI2H 2EJMA 2XCAA 1R9TA 3KLWA 3NQTA 1VBGA 4A3LG 1PFMA 4HIMA 4DV6H 4PNYA 3CC4A 3RB4A 2F3IA 4LUOA 4ZCKA 3AMUA 3F8NA 1U4MA 3LWEA 2XTIA 1DV2A 4ECXA 4DN4M 2QK4A 2PI2A 1JICA 1U4LA 4IUTA 4DR3L 2L11A 3FDSA 1GYFA 5KYLA 2H5XA 1TWAH 3Q8SB 5HGQA 1I94H 5IYDG 1KRSA 1S5ED 2L0CA 2WFWA 4CKBA 5M3MG 1BNZA 5L1LA 1KEEA 4B3TH 3CPWA 1LT4D 4JK1C 1H9KA 1OXUA 1YHBA 3S9WA 3DWPA 2HVQA 4HCSA 3NTIA 3O13A 3GV7B 3PW0A 4DAMA 4B3RL 2FPIB 1JJCB 2EYFA 4BBSG 2ALYB 4DAYA 4DV5L 4JI6L 3S16B 4K0KH 1E22A 3GTGB 3I70A 1HNWQ 2GPWA 1L0WA 4DV7Q 1GUOA 1PH7A 2C28A 4IO9A 1V8QA 3HOVB 4DR5H 1EY7A 1N36H 3H15A 3UE0A 3QB3A 5IYBH 1T94A 1X3FA 2RHSB 5JJZA 4FO2A 5EZYF 1D7QA 4OL7A 1AP0A 2W9BB 2XIWA 4DKAC 1SE3A 4QY7A 4BS9A 3CMAA 2NVTB 1EWCA 3TMEA 2ES2A 1K9MC 1N34H 2JA9A 4GNXC 2XD4A 4DL7A 3WO1A 1EYDA 2WTFA 1JORA 5LHY1 2CCZA 1IL8A 4NB3A 5LL6b 1TWHB 3KXYT 3ITPA 1UC9A 1B9NA 1XNRQ 3VYTA 3RMHA 3RUPA 4QF4A 3G8CA 3HRZC 2WAQG 5KIXA 2VY3A 2W9AA 4IJLA 1PXUA 4KKTA 1YJ9A 3PW2A 1G291 1H9RA 2AQ3B 2HIXA 2JJQA 3UI2A 4AYBB 3C46A 1PMRA 1EL0A 1UE7A 3H3VC 1QOHA 2R92B 1JJGA 2NVTH 1QVCA 5KT2A 3OWFA 4HEDA 2W71A 1O7LA 4ZUJA 3MFGA 3V4SA 5T14A 2WIIB 1T5EA 1IXRA 1CKOA 4JYAH 5CORA 4JI2L 1PYWD 1HQMC 4BA2I 1NY4A 3T1HL 3KLSX 2F0WA 4QWCA 1A9XA 1UC8A 4IRKA 2F0OA 2E2IB 2CH4A 2GN5A 1E4FT 1ZHQA 3OIPA 3VYUA 3GIPA 2Q2HA 5ELCA 2R7FA 4DR4H 4ED3A 4UCOA 2QDLA 2VUMG 2PQAA 4J15A 3MFHA 4Q0YA 1I94L 2IPKD 4FBTA 4YJ3F 2E5LQ 3KF6A 2L4NA 4DUZQ 5F2DA 5CGKA 4ZYSA 3MR3A 4JV2A 4YWMA 4X62Q 1PZJD 4A3MH 5JJKA 2NZ1D 3JAMi 3K0YA 3MR6A 3C3LA 1PRTC 5JOBA 3GD7A 2KECA 5CBAE 2DLNA 2JA6A 1SMXA 4UP7A 4U673 3UDIA 4DR7L 1PK8A 3GIQA 1BBWA 3IKJA 3MXUA 1WOCA 5IGEA 4HJ7A 4GC7A 4IUUA 1DM0B 3A74A 1PA6A 1PTOD 2YU9B 2CVRA 1KIXA 4J9NA 2KBNA 1BCPF 3PCOB 4PZ7A 1PH6A 1W3SA 3AU7A 2V4QA 2K32A 4YWLA 1L1OA 3WO0A 3GIIA 1DXMA 1K83H 5C4ZA 2L15A 3OSNA 4POGA 4CDDC 3TREA 3RAXA 2UXDH 3IAYA 5LMNQ 1GUWA 2A74C 3GDEA 3M7NA 4BBSB 3DM3A 4L5RC 4FBUA 3IL8A 4ID6A 4YHHL 1VQIA 1KNAA 2MCTA 3E9IA 2V5AA 3TP7A 3JAME 4DL3A 4Y8VB 4UHVA 1TS4A 4JW0A 1HHVA 4ZK9B 3J7AV 1S4ZA 1EYCA 4MZ9A 1Q3LA 1B9MA 1M0WA 4OIJA 4BBRH 2XRQD 4XT1B 1QNUA 1JJ2A 3HFZB 1Y1VH 4H0LC 5LMUQ 4JCVE 4X3UA 3MWEA 2PI2E 1Y14B 3WWVA 5J3BA 3Q24A 5KT4A 3BDLA 3PR4A 2CW0C 4GKKL 2ZTCA 1E7ZA 3TS2A 2Z6BA 3CAMA 4LMQD 3W2DA 1WFQA 3BZDB 5CBEE 4X64H 2NTSA 4B3ML 2N78A 3I4NB 1L2FA 2R85A 2UXCL 4U6PA 4H13C 1RYRA 4NXNQ 1I4QA 2R92G 3GTKH 3KHHA 4DAPA 4IFDH 4XYOA 4DV2Q 1O7IA 1IOVA 5EWEA 3Q0AA 1VBHA 5C44B 4A3CG 1CM9A 1T3NA 4HMIA 2C5CA 4X66H 2MJ8A 4R4TA 5JEAJ 1CA5A 2A6EC 2K1BA 1X6OA 4A3EB 1KLUD 1PVOA 2KCTA 1ICFB 1F77A 3Q2OA 2NVYB 5HURA 1AN7A 2KSWA 2K33A 3HOZH 3Q8QB 1VQ9A 3NENA 1B6RA 3N42B 4RKBA 2EYMA 2R8IA 2IBKA 1UE1A 2WKDA 4LH7A 5ELOA 1XDNA 4UP8A 4J9QA 1SR3A 4LFAQ 1PDQA 2BR0A 4ECRA 1K8MA 4RCNA 5KFQA 3G6XA 5IYDH 5KG3A 2OH2A 3AFPA 2J6TA 3S2HH 4M9UA 3VDYA 3VR6A 3J81L 1W2BA 1G2TA 3V6JA 2NBFA 2NVQB 1GUNA 2NVYH 3FKIH 1CI3M 4B9WA 1LT6D 3P20A 1LUZA 1NUCA 4EG0A 3RIZA 4LF9H 1M8AA 5JUMA 2ZXRA 3QIAA 4K5XA 3DF7A 1W96A 1E4GT 1YJWA 2IL8A 4EFBA 4Q44A 1OTCA 3M85A 4TV9F 1GM5A 4RNOA 4HN7A 2HCIA 3RLNA 3HOUH 3TIGA 4XYMB 4Q43A 3NK9A 3T51B 1W6JA 1BKBA 4DFAA 3BQ1A 4S3SA 3S1QH 5D3IB 4JBJA 3KHLA 1V43A 1MD2D 3K5LA 5GADC 2F0PA 2K01A 1H9MA 4M8AA 1VQOA 3T1YQ 3T1YL 4NXNH 4DR3Q 3KK7A 1XX8A 2DJGC 1SEBD 1FGBD 4R8UB 3TBIB 3CCQA 3PW7A 4FDBA 3HOXB 2VB2X 3T1HQ 2W6MA 4LUZA 3R5HA 5C4XG 1LTBD 3J81E 3BS1A 2F4VL 4ED2A 2JA8G 2KCCA 2C00A 3L4JA 3SHLA 3A5ZB 1K3RA 1I4PA 2X6LA 2Q8TA 1VQMA 2HUGA 4LF9Q 3LGJA 2B63G 1VF7A 1CQVA 3EN2A 1UEAB 3W1GA 1B6SA 4JVZA 4LSAA 5HV6A 5IYBG 3M3YH 1XJVA 2H4OA 5LYJF 5DQGA 4LF5L 4OEMB 1TWFB 1GUTA 3CCJA 1GD7A 5ELDA 1UWVA 3NELA 1HZBA 4X66L 3S1MH 1EUCB 1D5XC 3MA2B 4LFCH 2FLPA 4X65H 3OMGA 4HIOA 1IOWA 4FS1A 3RV3A 2IT1A 3S1RH 1STEA 1WYDA 1K83B 5C0XJ 3BA9A 2GVBA 4RMFA 4HNUA 1SYFA 4OX9L 3RFCA 2K52A 4MIUA 4UCRA 3NP8A 3H4DA 4IOCA 2Z8LA 4XT3B 3V2TA 5C44G 4JI4H 1BXTA 3FP9A 1C0AA 3DHQA 4TKOB 4MA0A 4A3EG 4RKLA 4X66Q 4OIKA 1O7YA 4O3PA 4QWDA 5DEHA 2LY7A 1HRJA 2NVXH 4DV2H 2R7DA 2D5DA 3FVQA 4GKKQ 2VQEH 4FF1A 2R8GA 1O75A 4IUNA 5KG1A 4DA2A 2VQFQ 3H0GG 2IWHA 4A3IB 4DNTB 3Q23A 2F0IA 3TP6A 3RR5A 1AH9A 1BUVT 4TSSA 3KF6B 4DR6Q 3G6VA 2I0QA 1RK5A 1AN8A 4CHTB 1SYGA 4OONA 1IBMQ 5BN5A 2MO1A 3STBC 5BR8Q 1FVIA 1HR0Q 1QVFA 2VQEL 3K80C 1QZHA 4YP3A 2IW3A 2JA6B 1N32H 5ELBA 2V4DA 4NDXA 4RUCA 1AW7A 5IYCH 4FM9A 4N8X1 5IP9G 2VXWA 5EPKA 2ZTEA 5KFVA 4KV6A 1NTGA 3U4VA 1LTID 1AZQA 1W6KA 1C30A 4MV7A 1ET9A 3MEHA 5C0XH 1RIPA 3AFQA 2HHHH 2I8CA 2OQ0A 1HTPA 1A0IA 3KHGA 2ZJQA 1YBYA 2ATLA 2R3ZA 4JYAQ 3J80W 4O2BF 4JOIA 1ULZA 2NU9B 5FPRA 2VPSA 5KEEA 3S1RB 2RBMA 4QB4A 1JE4A 2PW7A 5LMNH 3DWQA 2VQDA 3C1EA 1PFNA 1TWHH 1U5KA 4JI5Q 2YZNA 1SDFA 1DGSA 3PO2B 3JAMW 4WBNF 1N48A 3S15H 2F0MA 2E2HH 1JB7A 5FLMH 3QFFA 1HR0H 5C4XB 1A3VA 2JA8B 2N55A 1YNXA 5C1PA 1JDBB 4DR6H 4QUFA 2NZOA 2EE1A 2K5QA 4DV1H 3NGDA 3TQ1A 2Z1CA 3GTOB 2NUAB 5L1JA 4AH6A 4DUZH 3IFTA 4KD3A 5FLMG 1N36L 1TWFA 4HJ9A 4LSXA 2UVWA 4HNVA 3NBHB 5EKKA 4IRDA 3CMEA 2A68C 2J6UA 4DV0L 1EFWA 5F9LA 2WAQA 3MR2A 3PIOA 3D3RA 3ULLA 1M1KC 1QE6A 4RGNA 1X56A 1SAPA 2AU0A 3A55A 3R93A 1KABA 3J7A5 4TQRA 1SE8A 1BF4A 1D8LA 1RKNA 4TQUS 3RJ0A 2JEJA 4XDXA 2JA7A 1S5FD 2MHVA 3A7AB 3OW7A 4KHZA 4FS2A 4JI7Q 5JEAG 1K73C 2UUCL 5IY0A 5J22A 3GTOH 1VS0A 1B1ZA 1DYQA 3K81C 1N32Q 1CQJB 4B3MH 2JQOA 2R7ZH 5D3DA 1TWGH 3FKIB 4IUPA 1YVCA 4OGQC 4LWCA 3KTMA 4NP5A 4C1NI 5CB4F 5C5LA 3M4IA 2W6ZA 4A3IG 5CA0F 2DIKA 2XC9A 5C4HA 1QZGA 1X3PA 3S15B 4JI8H 1AZPA 3BAAA 4IQZA 2DZDA 4EGVA 5GROA 1BJTA 4BWSC 3NHHA 2SNMA 2YS7A 1CS0A 1LT3D 4L5TA 3N40P 1G51A 4B3SL 4IFDJ 2Y0SB 3CQZB 3AB9A 4DXFA 4A3FH 1FNWA 4DL6A 1SJED 1BNCA 3TIIA 2HVRA 1N34Q 4O3QA 4DR5Q 2YCHA 2LFNA 5LMNL 1LTAD 3PO3B 3MXNA 1HNWH 3BZKA 4DK1A 1JXLA 5E3FA 4AQYQ 3W3AA 3QZ7A 3R3OA 4HMJA 4JI3H 4GZYC 2PZTA 4HAEA 1GOZA 5I6WA 3MJFA 1I50H 4AQYL 4BY1G 3OWEB 1JB3A 1C9OA 3ULJA 1CA6A 3K5HA 2F0HA 2SEBD 4UAIA 3A7LA 3DLLA 3MHBA 4RU9A 3OPOA 2JA5G 2F52A 1SEIA 2M00A 1Z6HA 1EIHA 2I5LX 4IR1A 3NEMA 3HOVH 1LTGD 3M9NB 4HNTA 4XZ3B 2Z6KA 3CKIB 5T1IA 4I65A 1SROA 2EJFC 2QW7A 5K5PA 4IPDA 1GJXA 1EZ8A 2V9WA 1HFGA 1KC7A 1IBML 2B2VA 2DY7A 5FO7B 2AQ1B 1L1OC 1UNSA 2CQOA 1I94Q 5JQWA 3RD4A 1FJGQ 4QL5A 1S5DD 3K7AB 1K0SA 1QWYA 2WDTA 3UDGA 1XPOA 4XYLB 1Z9FA 2UUCH 5CV5A 1Z7TA 4DR5L 2UVVA 5IT9E 1LT5D 3HOYB 5IIFA 1GKHA 1DIKA 1LABA 5KFKA 3RTXA 2P5ZX 3S1NH 1CQIB 1EY6A 4RFBA 1V9PA 1Z2NX 3T1YH 1PFBA 1QB5D 2XWJB 4O2DA 4JI2Q 2RF4A 2WV6D 4P74A 4QIWE 1ILPA 4J9PA 1OXSC 3CP0A 1M90C 2WE6A 1PTOH 1TXYA 3NTKA 4Q0FA 2F3WA 2IX3A 1E2VA 2FFKB 4RWSC 4OX9Q 2GLTA 3PIP3 1EY0A 4JV0A 2V4RA 4DV4H 2F4VQ 4DGZA 1B70B 1STBA 4A4IA 3R5XA 4YR2A 2R93B 1J9OA 4F7XA 2YU9H 2F3VA 3TQTA 4R4QA 4O1NA 1HNZL 4V0BA 1WJJA 5IGBA 4WFN3 2UUCQ 4X64Q 1H95A 1QUQB 1RL2A 2N88A 3ORRA 1NR2A 2RSOA 1A2TA 2Z4HA 1FKAH 1XMQH 4PZ8A 2HT1A 4LK1C 1X3GA 1PLFA 4G57A 2EJGC 1ESRA 5IODA 1ENFA 2X0SA 4LFAH 3UDFA 4EGJA 3S2DH 2A6HD 2MPMA 4KHPH 1STGA 1ASYA 1STAA 3DUZA 1CUKA 4A2BA 1CHQD 4IFDG 5IWAQ 2Y0SG 5A2QL 5J39A 3UDXA 3TS0A 2IP4A 5CAEB 2R92H 4LF7Q 1WD1A 3CC2A 2R93H 1JKJB 1Y1WA 2FK1A 3HOUB 2M9VA 2WYOA 4B3RQ 3CCEA 2F0LA 4DV5H 1FYCA 2B2YA 1I6HB 1XTCD 4F50A 3F2CA 1OXVA 3EYYA 5C0XG 2IA6A 5D65A 4HJ8A 4NXML 4GN4B 5M5WH 4QQBX 3DWAA 4DK6C 4CGYB 4TRDA 3TZDA 1NE3A 1ILQA 5IP9H 1TY2A 3J7AF 1VQNA 2OXPA 1SNPA 1SNDA 2GVAA 2BQUA 1HZAA 4NXMQ 4DR7H 3QO2A 2OCEA 2IX0A 1TU2B 3I55A 2QDBA 1N34L 1VKZA 5EAYA 5JEAH 4APMA 1ESFA 4HSVA 1RK6A 3W1BA 1EEID 3E5SA 1YIJA 1FGUA 2R7KA 2HDMA 5K2MA 5DLFA 4X6AH 3HS0C 5A2QE 5JVDF 2F0DA 1MI2A 4JI8Q 1S10A 1SBBB 5LP6F 3STBD 1JQYD 4DNIA 1Q46A 4ECQA 1ENCA 3Q6SA 4EYIB 5C0XI 4J9KA 2JEFA 4YHHH 3MVVA 4NXNL 3JAMc 1UUPA 5BN3A 2RCFA 1S9FA 1B53A 4MV9A 1S68A 5LMNW 4QWAA 4XIGS 2YV5A 2F0EA 3K0XA 1KNEA 3ETJA 4UCTA 2B8GA 4ME3A 2BH8A 4UFZA 5AFWA 1JOQA 2NN6I 5FO9B 4MV4A 1S40A 4EEYA 1IYVA 1JIHA 4F88A 3T5KA 2LKVA 1KJIA 2KHJA 3BJYA 4DR1H 4FP5D 4HR7B 4MTEA 3T5HA 4JI0Q 4JI0L 4LF8H 3J80E 2PVPA 1KHIA 4TVAB 1XNQH 1B44D 5KGUA 2AGOA 3K5IA 1IKMA 3P1HA 1WTXA 2W7PA 4K5WA 1HCZA 2ZT9C 1I3QB 1NMFA 2WB1E 1I50B 3I2ZA 3M4OB 5BPHA 3ER0A 2I5HA 1KDBA 2IHFA 4JI3L 3PN1A 2HCCA 3RZOH 2PW5A 4UCVA 5KNCA 2QYZA 3H0GH 4LMYA 4I7ZC 4K2KA 5DM73 4KN7C 3AEVA 3H09A 1TWCB 4DR2L 1KJJA 1XWEA 1YHQA 1I6HH 1TWGB 2EYHA 1VQPA 5KG5A 2R7NA 4F4WA 5I9OA 4K0KL 3TDQA 3Q1KA 5DQIA 2YRWA 1XMOH 3KAJA 2R7LA 2MNAA 3M4OH 2R84A 3CQZA 4DR7Q 4IJHA 1V1QA 2I07B 2V1CC 3PUXA 4ILWA 3ND8A 2ATWA 3R23A 5IWAL 4K6DA 4K0KQ 3GTJB 3N44B 1K1SA 4XQJA 2UUAH 3MXNB 5FK9C 4C1NK 1D6EC 1ZKOA 4FF2A 2RSNA 1A15A 3GTPH 1G6ZA 1Q81C 5GAGC 4Z9CB 2KUMA 2AGQA 2JXMB 4ZRZA 1Y8OB 1HA6A 2Q8IB 2W9CA 4ETSA 1EY5A 1MHWC 3LX0A 2K4KA 4KKUA 1AE3A 5IWAH 4AIMA 1Q12A 4DV3Q 4B3SH 1VF5C 2KA7A 2LSSA 2RDHA 3KYHC 4P72A 4YHHQ 4L63B 4A3MB 4FYDA 4C3IG 2PBZA 1TVXA 2EXDA 4KHPQ 3GTQA 5H80A 5BR8L 1X65A 4YIJA 2KQ3A 5EBDA 4A3KB 4RGTA 3TP5A 4ODGA 5C3EH 4WJ3M 1K8OA 2MUYA 3SK4A 2UU9H 2RDGA 1L1OB 1EQTA 4Q5VA 3BYTB 1XMQQ 4A93G 4DL5A 2DNCA 2O5IC 1E4EA 2W70A 4NKLA 1XNQL 3C0FB 2FHTA 1IL2A 3K3PA 1K3BC 1EIYB 1QVGA 2AQ2B 4I50F 4I4TF 2ASBA 2W8KA 2EPBA 1MSGA 4BWGB 5JPNC 4G7HC 2L12A 1BBXC 3T1HH 3LWUA 1ZXTA 3IFDA 3ZYYX 3VA7A 3PR5B 5KG6A 4A3CH 1DZ1A 4L5QA 2KCNA 2W6QA 2F4VH 3ERSX 4DV4Q 4ECYA 3J7ZC 1TWAA 2G9DA 3I4OA 1O7ZA 4DV1L 3R2TA 4YJ2F 1PH5A 4DV2L 1GSOA 1LYLA 5EKIA 1QCBD 1STNA 1RJPA 3UE1A 5M5XH 1ICWA 1SE4A 1CSQA 1IBKL 2E2DC 3PV0A 2L9HA 1SSOA 3VR2A 4KMUC 3VR4A 3T56B 5M3MH 5L9XA 2R61A 2QEJC 1I3QA 2R6GA 4GLXA 2XGPA 2NZHA 5JAVA 4CJ0B 1PV4A 4RAYA 2JEGA 2WACA 1KRTA 3RN2A 3TINA 5ISRA 4V190 1XNRL 3LNNA 1WSCA 4B08A 3BDCA 1GVPA 1AEXA 5HBRB 2VNUD 3WDNA 4IPGA 5KFTA 1EY4A 2KEEA 2LXKA 3UFXB 2A69D 3TRZA 3VMMA 1GGOA 1GUSA 3DXJC 4A3LH 2E2JH 2VA2A 2VB3X 5D1PA 4A3DB 4GKJH 5CV8A 4G4KA 2B2WA 1B3AA 5CV4A 3OHXC 3K5OA 2B2TA 2XVSA 2R82A 2Q2IA 3BABA 2AHOB 3KBXA 3SK6A 1KAAA 3KLSA 5C5MA 3F2BA 3CXCA 1Y1WH 2RKSA 1EIFA 3OTOL 2B2WC 3S16H 3QOLA 4A3GH 4IZOA 2KJXA 1C8CA 3HOZG 2RA4A 4A3FB 3E3XA 5M9OA 2NU7B 3GTMA 4HJ5A 1SJHD 3FPUB 1Z47A 3DM1A 1HNZH 3I91A 5C3EG 3NSWA 1TY0A 4OELB 2ZM6Q 2A68D 2ICIA 4PMCA 4YCUA 1P8LA 1HFNA 5D8DA 4TUYF 1VQEA 3SE7A 2H1EA 3IRBA 4ED0A 4RG1A 3D4RA 5DLQE 1YEZA 1RJTA 3MZ5A 2CW7A 2KHSA 4ZQ3A 1K28A 2RDFA 3SR1A 2NVXB 2BA0A 1SFOA 1X32A 4WJWA 1WH2A 3HKZE 2R86A 1NMGA 5LOVF 2Q8RE 1YI2A 2FMAA 4C3HH 4X64L 4RB2C 1HR0W 1N8RC 4C3IB 3MXGA 4HIDA 5KT5A 4NMZA 4X65L 3WOFA 1GO3E 2DUDA 1FD7D 4WJ4A 3T4AC 4K6LA 3MXPA 4RHRA 4A3KG 3JC66 1WTHA 2VUMH 2DGYA 2YYZA 1AE2A 3CRKC 4IUVA 1E4EB 4RZQA 3H20A 3BQ2A 1D1KA 1Y1VG 3CF5A 1JDEA 2WINB 4E6IA 2VR1A 1T36A 3OUZA 3MFYA 5C4JH 4A3BG 1HA5A 4QJFA 3RBEA 5LXTF 4PMWA 2FMMA 1VQ5A 5KFMA 3RLFA 3M3YB 1E0BA 1YNNC 2FE3A 2NTTA 2OEOA 1SYCA 3X3MA 5JVLA 3AQQA 4L8JA 2QF7A 4EFEA 4MTKA 5ELNA 2YRXA 1OXXK 2XN9C 2R6FA 2JK8A 4YY3H 1LO5D 2OLSA 3EVQA 1IBLL 2IHEA 4XX0B 4JV5L 1B3QA 1C48A 1YHAA 1VQLA 5EOYA 4DV1Q 2NN6G 3ONAB 4C3HG 2J7ZA 3PW4A 4LJZC 5IGGA 5IT9W 1N32L 3I4MB 2FINB 2K04A 1X9NA 3GIDA 2F0SA 1X3EA 3WOEA 1HQRD 2KCMA 1I4HA 3D31A 1A6XA 1I50A 1SFOH 4DL2A 4MV6A 3RBDA 1ENAA 1IBLH 5I2XA 1K83A 1JR0D 1UEBA 1PRTD 4L1KA 2MQHA 3SI8A 3ETHA 5E7NA 5LMUH 2I46A 5FJ8G 5M3MB 1YNJD 3U9OA 3I12A 1I5FA 4A3DG 1XNQQ 1WCMG 3JRWA 3V6KA 1PH9A 4LF4L 4LF8L 2E76C 1WCMA 3R5FA 4JI0H 1DONA 1TWCA 1JMCA 4A3JH 2QGQA 5CYUA 5KFZA 1PTOF 2I87A 2YTXA 2A6HC 4JV1A 3EPIA 3CRLC 2WB1G 3FMCA 4DUYQ 1B04A 3T53B 2JEAI 5M3FB 1HNXQ 4LF4H 4DXGA 1CT1D 4A3IH 3ERQA 4YWKA 4DK0A 5FLXL 5GAHC 1SFOB 2BQRA 1MGSA 4CDCC 2F0NA 2LMCB 4K8JA 4FF3A 4FU0A 4WORA 3R8BA 2R8JA 3J81j 2OF1A 2K5WA 3H6MA 1MJCA 3RB3A 4DAVA 3R2IA 1PX2A 2ZDHA 3RB0A 1PRTF 3MAQA 3U9TA 4ZKBB 2M2LA 4GNXA 2D2CC 1A63A 3PUZA 4RNMA 4O4IF 3S17H 3J80c 1BGWA 4I7HA 1PH8A 1S0MA 4IAJA 1VQ4A 5KG7A 1KQSA 1B7YB 1GUGA 4DK3C 5KFXA 3Q8RB 3Q8DA 3B6YA 3KJPA 2ID0A 2UXBH 1TS2A 4XQNA 1RJQA 4LFBH 3HOWB 4WRDA 3AYHB 1Y1VB 1CQFA 1CZWA 2E8GA 4C5AA 4JI1Q 2YW2A 2AUKA 4UP9A 4CKEA 4IFDI 5KT6A 1NBWA 3NTHA 3GLKA 4HQ6A 4CBVA 3H94A 1EEFD 3H4BA 2ZM6L 4OWWB 4R4OA 1VQ6A 4QCLA 4ED6A 4M1UB 3G6YA 3LWBA 2FMCA 1XPRA 5CV6A 1MZBA 4YR3A 4EQ5A 1H9SA 1HNZQ 1A62A 1PH3A 3HOVG 1S0NA 5IE8A 1ZEQX 5GAEC 1JWUD 5M5YB 2FPGB 5DG9A 4JI7L 2RQXA 2M05A 4RNNA 5KX5F 4QW9A 1SNMA 4KLKA 3JRXA 4GKJQ 1EOVA 1EHIA 5KFLA 2VUMB 2ALZA 1NCVA 3BYYB 1C7YA 1SMYC 4EQOA 1TT2A 1TWCH 3HOWH 1RHPA 1I6VC 2F1MA 4J9RA 1RYSA 1R4QB 1E24A 3CHBD 4GKJL 1SYBA 2CQYA 3GTQH 1EIGA 4C3HB 4RB3C 1TWHA 3KALA 4H7BA 1KC8C 2PZWA 4CJ1B 3A56A 5FJ8H 2O5JC 4F4ZA 4OWXB 3K57A 1B4OA 1EFID 3T16A 3G71A 4O3SA 2WAQB 4LFCL 2W6NA 4AYBA 2PO4A 3MTSA 3M9OB 2HHHL 2VUGA 3L2PA 1S5BD 2YU9A 1YNND 2OTJA 3E5NA 4G3IA 4R4CA 4ME5A 1WCMB 1BCPC 5EGTA 4EBCA 4OX9H 3GV6A 5I4DA 4KN4C 2VW9A 3ORQA 4ZQIA 3I8ZA 1Y8PB 3VPDA 3FEWX 3MWMA 2AUJD 1Q7YC 1OO9B 3EA6A 2UUBH 3J81c 3EIVA 2A8VA 3D6WA 4R7RA 1SLJA 2QEXA 3KF8A 4DR4L 4ECUA 2UUBQ 1RTNA 1D2BA 1TAEA 2WB1B 5DM63 1LTSD 2JEBI 1HR0L 2E2JB 3HP3A 2A6ED 3S14H 2KOLA 3H0GA 1KBLA 2L55A 1YITA 5M3FH 3HGBA 4DR6L 3GV3A 1XYIA 2J4XA 1Z2PX 4RA8A 2JA5H 3EPGA 2E2IH 2UXBL 1H9JA 1DOMA 2B8FA 2PMZB 3HKZA 2R8HA 2NVXA 4BXXH 2ZDGA 2K6AA 4J9OA 4C56C 3GTLH 5IGFA 1EWHA 4A3JB 3BU2A 3A8KE 3L4KA 3I4MH 1JE5A 1Q8KA 3PUVA 2ZJPA 4B3SQ 3I4NG 4DV3H 4DLKA 4KTAA 5KFJA 2HQEA 2BE5D 3NBIA 4C2MA 5KFHA 5AJ3L 4Q45A 1F2YA 1G6PA 3GQCA 3GIJA 3PIO3 3HOWG 1HPCA 2D62A 4JI7H 1BCPB 1PFSA 1GHKA 3GTKB 5FOBB 2B3GA 1S72A 2W7OA 1C4QA 1TA8A 2ZXPA 2UUAQ 5E1FA 4JI3Q 1Q82C 1H9SB 4LUVA 3SXHA 1Q8IA 4EQPA 3GTPB 4Q8FA 3RZDH 1J5EL 3A0JA 4N9TA 2W57A 1JX4A 3OW2A 1XMOQ 4J1MA 2K14A 1ZHSA 3L0OA 3GTMH 2BOSA 5C4JB 3J7AK 4M7EA 2Z6KC 3S1QB 4ULLA 4LFAL 4QWEA 5K36G 3E0JA 3C1FA 2Q2UA 5TSSA 4GN5A 2EZVA 3TSSA 4A75A 1T5XD 5EDWA 1EUDB 2FLLA 5KFGA 2D0PA 3PGZA 2CQAA 2AMCB 4B3MQ 4EBEA 1XXGA 2DY8A 1BXRA 4RZRA 5JJLA 4LAAA 5KFFA 4B3TL 3M4YA 3TZUA 3HEJA 4R9WA 5JVH3 5CA1F 4QUCA 4LF9L 2DPJA 1T9HA 1ZYRC 2QA4A 5FO8B 1BDOA 1BCPD 2QILA 2F0FA 2YYAA 1PTOB 4DUYH 1U0LA 2A1AA 3OSPA 4IWYA 5KFEA 4ED1A 2RGRA 2YL2A 3KF8B 4GC6A 2NVYA 5J2TF 4JG2A 4LW1A 1Q1EA 4FXGC 3MWDA 3EQLC 1K8AC 1QUQA 4LF5Q 1PH4A 5C8YF 3UQ8A 3HOXG 3D0FA 4A3EH 3VR5A 1YJNA 1L0YB 4R8UA 2EYOA 1A3UA 1L0XB 4CC5A 3RZOB 4KK7A 5EWFA 4YR0A 3MFIA 5EKLA 2RDJA 3RB6A 1VQJA 5BR8H 1LTLA 2UXBQ 1EU3A 3DMUA 4I7AA 3W5OA 3OTOH 4XXEA 1IW7D 1EYGA 1G2SA 2J0TD 2AGPA 2B63B 4J6HA 5EBCA 4A3JG 3VA5A 1EZ6A 2E5LH 2O4XA 3F2DA 3BG5A 2CHBD 4UDUC 1GLVA 1JOKA 3QR8A 2E2HA 2VQEQ 1YNJC 1MKHA 4GKKH 1LM0A 4DR4Q 3OTOQ 3PO3H 1SYDA 4C5BA 4LF5H 2ZTDA 3OSOA 4DNRB 3VPBA 4J9MA 1A2UA 3GTKA 2WKCA 4LF8Q 4LF4Q 1VQBA 2AKWB 3KDFA 2MGSA 4DR1Q 2E5LL 4NPSA 1FNVA 1CTMA 3FPPA 4PWQA 2LXJA 2K28A 5KFSA 1CKNB 2FJ2A 4OWTB 3VPCA 3GTPA 2JP1A 1UE5A 2JEIA 4F8MA 1VQHA 2NN6H 5L37A 3Q22A 5I47A 4JI6H 1MSHA 4C3JH 2EIFA 4K8IA 1VMCA
chains in the Genus database with same CATH topology
4HIOA 4A3BH 4YCWA 3BZCA 5JJIA 3I4OA 2IT1A 3S1RH 4BY1H 1WYDA 4DV1L 3CCLA 4DR2Q 5C0XJ 2D0OA 2GVBA 2HIVA 4RMFA 1PH5A 4OX9L 4DV2L 2K52A 4EX5A 1LYLA 2A19A 3UE1A 5M5XH 4IOCA 5C44G 1CSQA 1IBKL 4JBMA 3PV0A 3FP9A 1C0AA 4A3KH 3OYYA 5M3MH 5HY6A 1YZ6A 1EQQA 4BBSH 3I56A 4IOAA 2R6GA 4DV0Q 4GLXA 4A3EG 4MTNA 2IX1A 2VZAA 4X66Q 2NZHA 1UE6A 4GOPA 3GTGH 1PV4A 4GOPC 4A3FG 1KRTA 3RN2A 2JA6G 2YTYA 1XNRL 2MO0A 2NVXH 2Q2TA 1GVPA 2R7DA 4GKKQ 2VNUD 1N36Q 4IPGA 1CKMA 4LF6L 2CKZB 2C35B 2LXKA 4JBKA 2VQFQ 3TRZA 4A3LH 3H0GG 2E2JH 1FJGL 1E1OA 2FXQA 3HOXH 1VQFA 4A3DH 3RR5A 1AH9A 4OO1I 2VS1A 3KF6B 4DR6Q 2I0QA 1CSPA 2Q2IA 2N3SA 2AHOB 4OONA 3G48A 3F2BA 1Y1WH 1IBMQ 3S16H 3CXCA 1EIFA 2MO1A 3STBC 5BR8Q 3OTOL 4P71A 1X55A 4A3GH 1FVIA 1HR0Q 1QVFA 3HOZG 1X54A 3U4ZA 2VQEL 3K80C 1QZHA 4X65Q 4HJ5A 5IYCH 1IYJB 1Z47A 5IP9G 3K8AA 5C3EG 2ZTEA 2AWOA 1NTGA 2ZM6Q 3U4VA 2IY5B 1KXLA 1RIPA 3AFQA 5IT9c 2OQ0A 4YCUA 1VQ7A 1A0IA 1P8LA 1VQEA 3PF5A 1HJPA 3IRBA 4RG1A 5DLQE 5LMUL 1YEZA 4UY8C 2ZJQA 1YBYA 4B3ML 2R7ZG 4DPGA 5IYCG 2BA0A 3EBEA 4JI8L 4JYAQ 2KHIA 3HKSA 4DV6Q 4JOIA 3KJOA 4HJAA 2UU9L 3HKZE 1N33L 1EUJA 3K7AH 1NMGA 2NVQH 1E1TA 5M5YH 1YI2A 1VQDA 3FHWA 3CW2C 4C3HH 4X64L 3KOJA 1I3QH 1HR0W 4ALPA 2UUBL 1N8RC 1NJIC 1TWHH 1U5KA 4HIDA 1K0RA 4JI5Q 2JA7H 4X65L 3ICEA 1DGSA 4DV5Q 3PO2H 1GO3E 2DUDA 4L5SA 3S15H 4WJ4A 4A3KG 3JC66 4BY7G 2XGTA 1JB7A 5FLMH 2E2HH 4JI4Q 2VUMH 1J6QA 2KENA 2DGYA 2YYZA 1AE2A 3KDFB 1VQAA 4GS3A 4OXPA 1YNXA 2I5MX 3HKZG 1Y1VG 3CF5A 4R4IA 3CC7A 2NZOA 1MJEA 1HNXL 4P75A 5C4JH 2VQFL 3PIPA 4A3BG 4AH6A 4QJFA 2HQLA 1A8VA 4PMWA 5FLMG 2WP8J 1N36L 3RLFA 1VQ5A 3CPFA 4Y7NH 3E9HA 4HJ9A 3NBHB 3I4MG 1KAWA 4IPCA 3PO2G 3CMEA 3SGIA 3AQQA 2K5NA 4YCVA 4DV0L 1EFWA 5ELNA 2K5HA 1OXXK 3FKIG 4BXXG 2JK8A 3PIOA 1Q86C 4BA1I 4AYBG 3M9BA 3ULLA 1M1KC 4DUZL 2OTLA 1IBLL 1X56A 2PQAB 2IHEA 4A3GG 4GN3B 3J7A5 4JV5L 2ZJRA 1VQKA 1SE8A 3I4NH 1WCMH 1D8LA 4TQUS 1YHAA 1VQLA 1OXTA 4DV1Q 2NN6G 1JT8A 4KHZA 1VQCA 4JI7Q 3PUWA 5JEAG 3GTJH 1K73C 3J80i 3G4SA 1XMOL 1BBUA 2UUCL 5IY0A 1N32L 2JE6I 1K8GA 3GTOH 2K50A 1X9NA 1VS0A 1XPUA 4YY3L 1X3EA 3K81C 3CD6A 1N32Q 3I7FA 2KCMA 3D31A 2EQSA 2JQOA 4APVA 1SFOH 1TWGH 1S3OA 1Y1WG 2R7ZH 2UUAL 1YVCA 3GO5A 1UEBA 4LWCA 1PH1A 2MQHA 5IP7H 5E7NA 5M3FG 5FJ8G 4JI1L 4P73A 4A3IG 2PNHA 4JYAL 1I5FA 2B29A 4DR1L 3CCUA 1EQRA 1QZGA 1XNQQ 1WCMG 4A3DG 3KLWA 1PH9A 4A3LG 4LF4L 3U58A 4LF8L 5GROA 2UXDQ 4HIMA 3CQZH 3CC4A 1JMCA 2F3IA 4A3JH 4LUOA 4L5TA 1G51A 2QGQA 4B3SL 2XTIA 4IFDJ 4A3FH 1Q1BA 2PI2A 2YTXA 4DR3L 1A63A 2H5XA 1TWAH 5HGQA 1N34Q 2WB1G 4DR5Q 5LMNL 1R9TH 4DUYQ 5IYDG 1KRSA 4LFBQ 3BZKA 2JEAI 1HNXQ 2WFWA 4AQYQ 5M3MG 3RNUA 3CPWA 4A3IH 4YWKA 4DV6L 3U50C 5GAHC 2UU9Q 1OXUA 1YHBA 5IP7G 1I50H 4AQYL 4BY1G 1C9OA 3ULJA 3H3VI 4DAMA 3J81j 3DLLA 1MJCA 4B3RL 1JJCB 4BBSG 2ALYB 4DV5L 4JI6L 3HOYG 1E22A 2F52A 2JA5G 1HNWQ 4GNXA 1L0WA 4YY3Q 4DV7Q 3PUZA 2I5LX 4PG3A 4IO9A 3NEMA 1PH7A 3HOVH 3S17H 3J80c 3ZJYC 4JI6Q 3H15A 3UE0A 1PH8A 2Z6KA 5IYBH 1VQ4A 1X3FA 1SROA 2RHSB 1KQSA 1B7YB 4DK3C 3PO3G 4IPDA 1N33Q 3Q8DA 1D7QA 2UXDL 3B6YA 1IBML 3KJPA 2ID0A 4DKAC 4LNQA 4QY7A 3CMAA 3AYHB 1L1OC 2ES2A 2CQOA 2E8GA 1K9MC 4A93H 1I94Q 4JI1Q 2JA9A 2PMZE 4QL5A 4GNXC 4UP9A 1FJGQ 4IFDI 1NBWA 2K75A 3UDGA 1XPOA 2HHHQ 1Z9FA 2ZM6L 4R4OA 4OWWB 4DR5L 2CCZA 1VQ6A 1CKNA 4NB3A 1XPRA 4C3IH 1GKHA 4EQ5A 1HNZQ 1A62A 3A5UA 4DV4L 1PH3A 3KFUA 1XNRQ 3S1NH 3HOVG 1V9PA 5IE8A 5GAEC 4JI7L 4O2DA 2WAQG 4JI2Q 2VY3A 2RF4A 4IJLA 1HZ9A 1YJ9A 2JA8H 1G291 1HZCA 2JJQA 2HIXA 4KLKA 4P74A 1EOVA 4QIWE 4GKJQ 5C4XH 2JA6H 1UE7A 1C7YA 1OXSC 1JJGA 3CP0A 1QVCA 1TWCH 1M90C 1TXYA 1IBLQ 2NVTH 2N8NA 3HOWH 1PHJA 1E24A 4OX9Q 4GKJL 3GTQH 2F4VQ 1IXRA 1CKOA 1B70B 3HOYH 4JOIC 4A4IA 4JI2L 1KC8C 4BA2I 1NY4A 3T1HL 3PSIA 2YU9H 5FJ8H 4OWXB 1WI5A 2Y0SE 4R4QA 1HNZL 4GOPB 1WJJA 2GN5A 3G71A 2UUCQ 4X64Q 3HOUG 1QUQB 1RL2A 4LFCL 3TEHB 1H95A 2Q2HA 2HHHL 2R7FA 3L2PA 2VUMG 2PQAA 3ULPA 4J15A 4PZ8A 1IBKQ 2RHQB 2HT1A 1I94L 2OTJA 1X3GA 2E5LQ 3KF6A 4R4CA 4DUZQ 2JA7G 3UDFA 1VQGA 2K5VA 3S2DH 4YWMA 4X62Q 2VW9A 4PZ6A 4A3MH 5JJKA 3JAMi 1ASYA 1VQ8A 1IZ6A 1CUKA 5AJ3Q 1Q7YC 4IFDG 5IWAQ 3GD7A 2R93G 2Y0SG 3TS0A 3J81c 3EIVA 3UDXA 2A8VA 1SMXA 4UP7A 1SLJA 4JI5L 5FLXc 2QEXA 4LF7Q 3UDIA 2R92H 3CC2A 2UUBQ 1BBWA 4DR4L 1P16A 4DR7L 2R93H 1WOCA 4HJ7A 2N49A 4B3RQ 2JEBI 3CCEA 1HR0L 3A74A 1PA6A 1KIXA 3S14H 2KBNA 3PCOB 4PZ7A 3F2CA 1OXVA 5C0XG 1YITA 4JC0A 5M3FH 4KI0A 4HJ8A 1PH6A 4NXML 1W3SA 4GN4B 5M5WH 4DR6L 4QQBX 4YWLA 4DK6C 2JA5H 1L1OA 1XNQL 1NE3A 5IP9H 1K83H 2L15A 3RLOA 2E2IH 4POGA 3TREA 1VQNA 2UXBL 1HH2P 2Z0SA 2GVAA 1HZAA 4NXMQ 4LFBL 4BXXH 4DUYL 2OCEA 2IX0A 2BA1A 3I55A 5LMNQ 3GTLH 3GDEA 1N34L 3M7NA 3DM3A 5EAYA 3BU2A 4L5RC 1SN8A 4POFA 4YHHL 3I4MH 1VQIA 3E9IA 1JE5A 3L7ZC 3W1BA 4C2MH 3CCVA 1YIJA 1FGUA 1Q8KA 3PUVA 2ZJPA 4B3SQ 3I4NG 2CFMA 3H3VH 4X6AH 4MZ9A 3F1ZA 5AJ3L 1SRUA 4IPHA 1G6PA 2MFIA 3HOWG 4JI8Q 4BBRH 2D62A 3STBD 3HFZB 1JJ2A 1Y1VH 4DNIA 1PFSA 1Q46A 2CWAA 3TQYA 5LMUQ 1PH2A 4JCVE 2B3GA 2PI2E 1Y14B 3WWVA 1S72A 4UPAA 5C0XI 5J3BA 4NXNL 4BY7H 2UUAQ 3JAMc 4GKKL 4B3TQ 4JI3Q 2ZTCA 1Q82C 1E7ZA 4GNXB 4LUVA 5LMNW 3TS2A 4XIGS 3CAMA 4LFCQ 3S24A 2YV5A 3RZDH 3K0XA 1WFQA 1J5EL 3A0JA 4JBWA 4ME3A 4O0AA 4A76A 2N78A 3F8TA 2BH8A 3CCSA 1XTDA 3OW2A 1L2FA 1VCIA 1XMOQ 2RCNA 1KD1C 2K14A 2WAQE 2NN6I 3L0OA 3GTMH 2UXCL 1S40A 2Z6KC 4BBRG 4NXNQ 1ASZA 2AWNA 2R92G 3GTKH 2KHJA 4JV5Q 4OO1G 4LFAL 4DV2Q 1O7IA 3M4QA 4JI0L 4JI0Q 5K36G 3PF4A 1XMQL 1KHIA 4TVAB 4A3CG 2Q2UA 4LF6Q 4GN5A 2VL6A 4A75A 4R4TA 5JEAJ 1KL9A 4MNOA 1X6OA 2D0PA 1PVOA 3PGZA 2KCTA 4KHPL 1NMFA 2AMCB 4B3MQ 2WB1E 3HOZH 3I2ZA 1EWIA 1VQ9A 3NENA 2OWOA 5JJLA 4GLVB 3ER0A 2I5HA 2IHFA 1N9WA 4JI3L 4B3TL 1UE1A 5ELOA 3BJUA 4UP8A 4QGUA 3RZOH 4LF9L 1SR3A 4LFAQ 1T9HA 3H0GH 2QA4A 3AEVA 3CCRA 4DR2L 5IYDH 5GQOA 2OQKA 1U0LA 1PYSB 2A1AA 3AFPA 1YHQA 1I6HH 4JI4L 1VQPA 3S2HH 1B8AA 5C44H 3VDYA 2YTVA 1W2BA 2UXCQ 4K0KL 3KF8B 2NVYH 3FKIH 4JG2A 4LW1A 1Q1EA 1J5EQ 1LUZA 3MEFA 2MNAA 1QUQA 4DV3L 3RN5A 3CCMA 4A3MG 4DV7L 1K8AC 4LF5Q 4IJHA 1V1QA 4DR7Q 3PUXA 2V1CC 1PH4A 4GLAC 3HOXG 3D0FA 4A3EH 1YJNA 5IWAL 2ATWA 4Y52H 4K0KQ 4R1JA 1YJWA 1VQJA 2CWPA 3MXNB 1E3PA 1OTCA 2BH2A 1LTLA 3M85A 3G6EA 2UXBQ 3GTPH 4XTCS 3W5OA 1HNWL 5H1SE 1Q81C 1GM5A 3RLNA 5GAGC 3HOUH 1EYGA 3J81i 4HIKA 2B63H 3PUYA 1BKBA 4DAYB 4AYBE 3M4OH 4A3JG 4JBJA 3S1QH 1V43A 5GADC 2K4KA 1AE3A 3F2DA 3K7UC 4AIMA 1Q12A 4DV3Q 1VQOA 2LSSA 3T1YQ 4P72A 4DR3Q 3KYHC 4YHHQ 3T1YL 2VQEQ 1MKHA 1LM0A 2EXDA 4DR4Q 4KHPQ 3CCQA 4FDBA 5BR8L 1X65A 3OTOQ 3PO3H 3T1HQ 2ZTDA 4LUZA 5C3EH 4WJ3M 4DV4Q 5C4XG 1FL0A 2F4VL 1L1OB 4X62L 4LF8Q 4LF4Q 2JA8G 1XMQQ 1VQBA 4A93G 2AKWB 3KDFA 3A5ZB 1K3RA 4DR1Q 1VQMA 2E5LL 4NPSA 4LF9Q 1IL2A 3LGJA 1EIYB 1QVGA 4H02A 2B63G 2ASBA 2LXJA 3EN2A 3W1GA 1CKNB 4OWTB 1MIUA 3E0EA 1UE5A 5IYBG 3M3YH 1XJVA 3M4PA 1VQHA 4LF5L 3CCJA 1TWFH 4A3CH 1PYBA 1GD7A 1BVSA 4LF7L 1UWVA 3NELA 1HZBA 4L5QA 4X66L 2EIFA 4C3JH 3S1MH 3ERSX 3J7ZC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HIO A;  4A3B H;  4YCW A;  3BZC A;  5JJI A;  3I4O A;  2IT1 A;  3S1R H;  4BY1 H;  1WYD A;  4DV1 L;  3CCL A;  4DR2 Q;  5C0X J;  2D0O A;  2GVB A;  2HIV A;  4RMF A;  1PH5 A;  4OX9 L;  4DV2 L;  2K52 A;  4EX5 A;  1LYL A;  2A19 A;  3UE1 A;  5M5X H;  4IOC A;  5C44 G;  1CSQ A;  1IBK L;  4JBM A;  3PV0 A;  3FP9 A;  1C0A A;  4A3K H;  3OYY A;  5M3M H;  5HY6 A;  1YZ6 A;  1EQQ A;  4BBS H;  3I56 A;  4IOA A;  2R6G A;  4DV0 Q;  4GLX A;  4A3E G;  4MTN A;  2IX1 A;  2VZA A;  4X66 Q;  2NZH A;  1UE6 A;  4GOP A;  3GTG H;  1PV4 A;  4GOP C;  4A3F G;  1KRT A;  3RN2 A;  2JA6 G;  2YTY A;  1XNR L;  2MO0 A;  2NVX H;  2Q2T A;  1GVP A;  2R7D A;  4GKK Q;  2VNU D;  1N36 Q;  4IPG A;  1CKM A;  4LF6 L;  2CKZ B;  2C35 B;  2LXK A;  4JBK A;  2VQF Q;  3TRZ A;  4A3L H;  3H0G G;  2E2J H;  1FJG L;  1E1O A;  2FXQ A;  3HOX H;  1VQF A;  4A3D H;  3RR5 A;  1AH9 A;  4OO1 I;  2VS1 A;  3KF6 B;  4DR6 Q;  2I0Q A;  1CSP A;  2Q2I A;  2N3S A;  2AHO B;  4OON A;  3G48 A;  3F2B A;  1Y1W H;  1IBM Q;  3S16 H;  3CXC A;  1EIF A;  2MO1 A;  3STB C;  5BR8 Q;  3OTO L;  4P71 A;  1X55 A;  4A3G H;  1FVI A;  1HR0 Q;  1QVF A;  3HOZ G;  1X54 A;  3U4Z A;  2VQE L;  3K80 C;  1QZH A;  4X65 Q;  4HJ5 A;  5IYC H;  1IYJ B;  1Z47 A;  5IP9 G;  3K8A A;  5C3E G;  2ZTE A;  2AWO A;  1NTG A;  2ZM6 Q;  3U4V A;  2IY5 B;  1KXL A;  1RIP A;  3AFQ A;  5IT9 c;  2OQ0 A;  4YCU A;  1VQ7 A;  1A0I A;  1P8L A;  1VQE A;  3PF5 A;  1HJP A;  3IRB A;  4RG1 A;  5DLQ E;  5LMU L;  1YEZ A;  4UY8 C;  2ZJQ A;  1YBY A;  4B3M L;  2R7Z G;  4DPG A;  5IYC G;  2BA0 A;  3EBE A;  4JI8 L;  4JYA Q;  2KHI A;  3HKS A;  4DV6 Q;  4JOI A;  3KJO A;  4HJA A;  2UU9 L;  3HKZ E;  1N33 L;  1EUJ A;  3K7A H;  1NMG A;  2NVQ H;  1E1T A;  5M5Y H;  1YI2 A;  1VQD A;  3FHW A;  3CW2 C;  4C3H H;  4X64 L;  3KOJ A;  1I3Q H;  1HR0 W;  4ALP A;  2UUB L;  1N8R C;  1NJI C;  1TWH H;  1U5K A;  4HID A;  1K0R A;  4JI5 Q;  2JA7 H;  4X65 L;  3ICE A;  1DGS A;  4DV5 Q;  3PO2 H;  1GO3 E;  2DUD A;  4L5S A;  3S15 H;  4WJ4 A;  4A3K G;  3JC6 6;  4BY7 G;  2XGT A;  1JB7 A;  5FLM H;  2E2H H;  4JI4 Q;  2VUM H;  1J6Q A;  2KEN A;  2DGY A;  2YYZ A;  1AE2 A;  3KDF B;  1VQA A;  4GS3 A;  4OXP A;  1YNX A;  2I5M X;  3HKZ G;  1Y1V G;  3CF5 A;  4R4I A;  3CC7 A;  2NZO A;  1MJE A;  1HNX L;  4P75 A;  5C4J H;  2VQF L;  3PIP A;  4A3B G;  4AH6 A;  4QJF A;  2HQL A;  1A8V A;  4PMW A;  5FLM G;  2WP8 J;  1N36 L;  3RLF A;  1VQ5 A;  3CPF A;  4Y7N H;  3E9H A;  4HJ9 A;  3NBH B;  3I4M G;  1KAW A;  4IPC A;  3PO2 G;  3CME A;  3SGI A;  3AQQ A;  2K5N A;  4YCV A;  4DV0 L;  1EFW A;  5ELN A;  2K5H A;  1OXX K;  3FKI G;  4BXX G;  2JK8 A;  3PIO A;  1Q86 C;  4BA1 I;  4AYB G;  3M9B A;  3ULL A;  1M1K C;  4DUZ L;  2OTL A;  1IBL L;  1X56 A;  2PQA B;  2IHE A;  4A3G G;  4GN3 B;  3J7A 5;  4JV5 L;  2ZJR A;  1VQK A;  1SE8 A;  3I4N H;  1WCM H;  1D8L A;  4TQU S;  1YHA A;  1VQL A;  1OXT A;  4DV1 Q;  2NN6 G;  1JT8 A;  4KHZ A;  1VQC A;  4JI7 Q;  3PUW A;  5JEA G;  3GTJ H;  1K73 C;  3J80 i;  3G4S A;  1XMO L;  1BBU A;  2UUC L;  5IY0 A;  1N32 L;  2JE6 I;  1K8G A;  3GTO H;  2K50 A;  1X9N A;  1VS0 A;  1XPU A;  4YY3 L;  1X3E A;  3K81 C;  3CD6 A;  1N32 Q;  3I7F A;  2KCM A;  3D31 A;  2EQS A;  2JQO A;  4APV A;  1SFO H;  1TWG H;  1S3O A;  1Y1W G;  2R7Z H;  2UUA L;  1YVC A;  3GO5 A;  1UEB A;  4LWC A;  1PH1 A;  2MQH A;  5IP7 H;  5E7N A;  5M3F G;  5FJ8 G;  4JI1 L;  4P73 A;  4A3I G;  2PNH A;  4JYA L;  1I5F A;  2B29 A;  4DR1 L;  3CCU A;  1EQR A;  1QZG A;  1XNQ Q;  1WCM G;  4A3D G;  3KLW A;  1PH9 A;  4A3L G;  4LF4 L;  3U58 A;  4LF8 L;  5GRO A;  2UXD Q;  4HIM A;  3CQZ H;  3CC4 A;  1JMC A;  2F3I A;  4A3J H;  4LUO A;  4L5T A;  1G51 A;  2QGQ A;  4B3S L;  2XTI A;  4IFD J;  4A3F H;  1Q1B A;  2PI2 A;  2YTX A;  4DR3 L;  1A63 A;  2H5X A;  1TWA H;  5HGQ A;  1N34 Q;  2WB1 G;  4DR5 Q;  5LMN L;  1R9T H;  4DUY Q;  5IYD G;  1KRS A;  4LFB Q;  3BZK A;  2JEA I;  1HNX Q;  2WFW A;  4AQY Q;  5M3M G;  3RNU A;  3CPW A;  4A3I H;  4YWK A;  4DV6 L;  3U50 C;  5GAH C;  2UU9 Q;  1OXU A;  1YHB A;  5IP7 G;  1I50 H;  4AQY L;  4BY1 G;  1C9O A;  3ULJ A;  3H3V I;  4DAM A;  3J81 j;  3DLL A;  1MJC A;  4B3R L;  1JJC B;  4BBS G;  2ALY B;  4DV5 L;  4JI6 L;  3HOY G;  1E22 A;  2F52 A;  2JA5 G;  1HNW Q;  4GNX A;  1L0W A;  4YY3 Q;  4DV7 Q;  3PUZ A;  2I5L X;  4PG3 A;  4IO9 A;  3NEM A;  1PH7 A;  3HOV H;  3S17 H;  3J80 c;  3ZJY C;  4JI6 Q;  3H15 A;  3UE0 A;  1PH8 A;  2Z6K A;  5IYB H;  1VQ4 A;  1X3F A;  1SRO A;  2RHS B;  1KQS A;  1B7Y B;  4DK3 C;  3PO3 G;  4IPD A;  1N33 Q;  3Q8D A;  1D7Q A;  2UXD L;  3B6Y A;  1IBM L;  3KJP A;  2ID0 A;  4DKA C;  4LNQ A;  4QY7 A;  3CMA A;  3AYH B;  1L1O C;  2ES2 A;  2CQO A;  2E8G A;  1K9M C;  4A93 H;  1I94 Q;  4JI1 Q;  2JA9 A;  2PMZ E;  4QL5 A;  4GNX C;  4UP9 A;  1FJG Q;  4IFD I;  1NBW A;  2K75 A;  3UDG A;  1XPO A;  2HHH Q;  1Z9F A;  2ZM6 L;  4R4O A;  4OWW B;  4DR5 L;  2CCZ A;  1VQ6 A;  1CKN A;  4NB3 A;  1XPR A;  4C3I H;  1GKH A;  4EQ5 A;  1HNZ Q;  1A62 A;  3A5U A;  4DV4 L;  1PH3 A;  3KFU A;  1XNR Q;  3S1N H;  3HOV G;  1V9P A;  5IE8 A;  5GAE C;  4JI7 L;  4O2D A;  2WAQ G;  4JI2 Q;  2VY3 A;  2RF4 A;  4IJL A;  1HZ9 A;  1YJ9 A;  2JA8 H;  1G29 1;  1HZC A;  2JJQ A;  2HIX A;  4KLK A;  4P74 A;  1EOV A;  4QIW E;  4GKJ Q;  5C4X H;  2JA6 H;  1UE7 A;  1C7Y A;  1OXS C;  1JJG A;  3CP0 A;  1QVC A;  1TWC H;  1M90 C;  1TXY A;  1IBL Q;  2NVT H;  2N8N A;  3HOW H;  1PHJ A;  1E24 A;  4OX9 Q;  4GKJ L;  3GTQ H;  2F4V Q;  1IXR A;  1CKO A;  1B70 B;  3HOY H;  4JOI C;  4A4I A;  4JI2 L;  1KC8 C;  4BA2 I;  1NY4 A;  3T1H L;  3PSI A;  2YU9 H;  5FJ8 H;  4OWX B;  1WI5 A;  2Y0S E;  4R4Q A;  1HNZ L;  4GOP B;  1WJJ A;  2GN5 A;  3G71 A;  2UUC Q;  4X64 Q;  3HOU G;  1QUQ B;  1RL2 A;  4LFC L;  3TEH B;  1H95 A;  2Q2H A;  2HHH L;  2R7F A;  3L2P A;  2VUM G;  2PQA A;  3ULP A;  4J15 A;  4PZ8 A;  1IBK Q;  2RHQ B;  2HT1 A;  1I94 L;  2OTJ A;  1X3G A;  2E5L Q;  3KF6 A;  4R4C A;  4DUZ Q;  2JA7 G;  3UDF A;  1VQG A;  2K5V A;  3S2D H;  4YWM A;  4X62 Q;  2VW9 A;  4PZ6 A;  4A3M H;  5JJK A;  3JAM i;  1ASY A;  1VQ8 A;  1IZ6 A;  1CUK A;  5AJ3 Q;  1Q7Y C;  4IFD G;  5IWA Q;  3GD7 A;  2R93 G;  2Y0S G;  3TS0 A;  3J81 c;  3EIV A;  3UDX A;  2A8V A;  1SMX A;  4UP7 A;  1SLJ A;  4JI5 L;  5FLX c;  2QEX A;  4LF7 Q;  3UDI A;  2R92 H;  3CC2 A;  2UUB Q;  1BBW A;  4DR4 L;  1P16 A;  4DR7 L;  2R93 H;  1WOC A;  4HJ7 A;  2N49 A;  4B3R Q;  2JEB I;  3CCE A;  1HR0 L;  3A74 A;  1PA6 A;  1KIX A;  3S14 H;  2KBN A;  3PCO B;  4PZ7 A;  3F2C A;  1OXV A;  5C0X G;  1YIT A;  4JC0 A;  5M3F H;  4KI0 A;  4HJ8 A;  1PH6 A;  4NXM L;  1W3S A;  4GN4 B;  5M5W H;  4DR6 L;  4QQB X;  4YWL A;  4DK6 C;  2JA5 H;  1L1O A;  1XNQ L;  1NE3 A;  5IP9 H;  1K83 H;  2L15 A;  3RLO A;  2E2I H;  4POG A;  3TRE A;  1VQN A;  2UXB L;  1HH2 P;  2Z0S A;  2GVA A;  1HZA A;  4NXM Q;  4LFB L;  4BXX H;  4DUY L;  2OCE A;  2IX0 A;  2BA1 A;  3I55 A;  5LMN Q;  3GTL H;  3GDE A;  1N34 L;  3M7N A;  3DM3 A;  5EAY A;  3BU2 A;  4L5R C;  1SN8 A;  4POF A;  4YHH L;  3I4M H;  1VQI A;  3E9I A;  1JE5 A;  3L7Z C;  3W1B A;  4C2M H;  3CCV A;  1YIJ A;  1FGU A;  1Q8K A;  3PUV A;  2ZJP A;  4B3S Q;  3I4N G;  2CFM A;  3H3V H;  4X6A H;  4MZ9 A;  3F1Z A;  5AJ3 L;  1SRU A;  4IPH A;  1G6P A;  2MFI A;  3HOW G;  4JI8 Q;  4BBR H;  2D62 A;  3STB D;  3HFZ B;  1JJ2 A;  1Y1V H;  4DNI A;  1PFS A;  1Q46 A;  2CWA A;  3TQY A;  5LMU Q;  1PH2 A;  4JCV E;  2B3G A;  2PI2 E;  1Y14 B;  3WWV A;  1S72 A;  4UPA A;  5C0X I;  5J3B A;  4NXN L;  4BY7 H;  2UUA Q;  3JAM c;  4GKK L;  4B3T Q;  4JI3 Q;  2ZTC A;  1Q82 C;  1E7Z A;  4GNX B;  4LUV A;  5LMN W;  3TS2 A;  4XIG S;  3CAM A;  4LFC Q;  3S24 A;  2YV5 A;  3RZD H;  3K0X A;  1WFQ A;  1J5E L;  3A0J A;  4JBW A;  4ME3 A;  4O0A A;  4A76 A;  2N78 A;  3F8T A;  2BH8 A;  3CCS A;  1XTD A;  3OW2 A;  1L2F A;  1VCI A;  1XMO Q;  2RCN A;  1KD1 C;  2K14 A;  2WAQ E;  2NN6 I;  3L0O A;  3GTM H;  2UXC L;  1S40 A;  2Z6K C;  4BBR G;  4NXN Q;  1ASZ A;  2AWN A;  2R92 G;  3GTK H;  2KHJ A;  4JV5 Q;  4OO1 G;  4LFA L;  4DV2 Q;  1O7I A;  3M4Q A;  4JI0 L;  4JI0 Q;  5K36 G;  3PF4 A;  1XMQ L;  1KHI A;  4TVA B;  4A3C G;  2Q2U A;  4LF6 Q;  4GN5 A;  2VL6 A;  4A75 A;  4R4T A;  5JEA J;  1KL9 A;  4MNO A;  1X6O A;  2D0P A;  1PVO A;  3PGZ A;  2KCT A;  4KHP L;  1NMF A;  2AMC B;  4B3M Q;  2WB1 E;  3HOZ H;  3I2Z A;  1EWI A;  1VQ9 A;  3NEN A;  2OWO A;  5JJL A;  4GLV B;  3ER0 A;  2I5H A;  2IHF A;  1N9W A;  4JI3 L;  4B3T L;  1UE1 A;  5ELO A;  3BJU A;  4UP8 A;  4QGU A;  3RZO H;  4LF9 L;  1SR3 A;  4LFA Q;  1T9H A;  3H0G H;  2QA4 A;  3AEV A;  3CCR A;  4DR2 L;  5IYD H;  5GQO A;  2OQK A;  1U0L A;  1PYS B;  2A1A A;  3AFP A;  1YHQ A;  1I6H H;  4JI4 L;  1VQP A;  3S2H H;  1B8A A;  5C44 H;  3VDY A;  2YTV A;  1W2B A;  2UXC Q;  4K0K L;  3KF8 B;  2NVY H;  3FKI H;  4JG2 A;  4LW1 A;  1Q1E A;  1J5E Q;  1LUZ A;  3MEF A;  2MNA A;  1QUQ A;  4DV3 L;  3RN5 A;  3CCM A;  4A3M G;  4DV7 L;  1K8A C;  4LF5 Q;  4IJH A;  1V1Q A;  4DR7 Q;  3PUX A;  2V1C C;  1PH4 A;  4GLA C;  3HOX G;  3D0F A;  4A3E H;  1YJN A;  5IWA L;  2ATW A;  4Y52 H;  4K0K Q;  4R1J A;  1YJW A;  1VQJ A;  2CWP A;  3MXN B;  1E3P A;  1OTC A;  2BH2 A;  1LTL A;  3M85 A;  3G6E A;  2UXB Q;  3GTP H;  4XTC S;  3W5O A;  1HNW L;  5H1S E;  1Q81 C;  1GM5 A;  3RLN A;  5GAG C;  3HOU H;  1EYG A;  3J81 i;  4HIK A;  2B63 H;  3PUY A;  1BKB A;  4DAY B;  4AYB E;  3M4O H;  4A3J G;  4JBJ A;  3S1Q H;  1V43 A;  5GAD C;  2K4K A;  1AE3 A;  3F2D A;  3K7U C;  4AIM A;  1Q12 A;  4DV3 Q;  1VQO A;  2LSS A;  3T1Y Q;  4P72 A;  4DR3 Q;  3KYH C;  4YHH Q;  3T1Y L;  2VQE Q;  1MKH A;  1LM0 A;  2EXD A;  4DR4 Q;  4KHP Q;  3CCQ A;  4FDB A;  5BR8 L;  1X65 A;  3OTO Q;  3PO3 H;  3T1H Q;  2ZTD A;  4LUZ A;  5C3E H;  4WJ3 M;  4DV4 Q;  5C4X G;  1FL0 A;  2F4V L;  1L1O B;  4X62 L;  4LF8 Q;  4LF4 Q;  2JA8 G;  1XMQ Q;  1VQB A;  4A93 G;  2AKW B;  3KDF A;  3A5Z B;  1K3R A;  4DR1 Q;  1VQM A;  2E5L L;  4NPS A;  4LF9 Q;  1IL2 A;  3LGJ A;  1EIY B;  1QVG A;  4H02 A;  2B63 G;  2ASB A;  2LXJ A;  3EN2 A;  3W1G A;  1CKN B;  4OWT B;  1MIU A;  3E0E A;  1UE5 A;  5IYB G;  3M3Y H;  1XJV A;  3M4P A;  1VQH A;  4LF5 L;  3CCJ A;  1TWF H;  4A3C H;  1PYB A;  1GD7 A;  1BVS A;  4LF7 L;  1UWV A;  3NEL A;  1HZB A;  4L5Q A;  4X66 L;  2EIF A;  4C3J H;  3S1M H;  3ERS X;  3J7Z C; 
#chains in the Genus database with same CATH topology
 4A3B H;  4YCW A;  4R8I A;  1GXD C;  4DR2 Q;  2D0O A;  3I3C A;  1IBM H;  2PPB C;  2K7V A;  2G5D A;  1A3T A;  2VUM A;  4LH6 A;  4CDF C;  4EBD A;  4JBM A;  2EDG A;  5JVG 3;  4A3K H;  5KFN A;  4FXK C;  3S2D B;  2VQF H;  2TMP A;  3PZP A;  5HY6 A;  1YZ6 A;  4PV1 C;  2PYK A;  3A54 A;  1U4R A;  1KTK A;  4MTN A;  2IX1 A;  2EXZ A;  4GOP A;  3GTG H;  3GIM A;  2JA6 G;  2YTY A;  2Q2T A;  5KFW A;  3M9M B;  2FB9 A;  1N36 Q;  4HSP A;  4NXM H;  3J81 W;  2CKZ B;  4HR7 A;  3NQI A;  2C35 B;  2PQE A;  1ZYR D;  1FJG L;  1E1O A;  4EEQ A;  2FXQ A;  4RUA A;  1VQF A;  3N6R A;  3OMC A;  1HUM A;  3QWN A;  5IYZ F;  1VMP A;  5LL6 S;  2CH4 W;  1CSP A;  2OT2 A;  3BVZ A;  2N3S A;  5KYI A;  3G48 A;  2DJF C;  3EFX D;  1NSN S;  4P71 A;  1X55 A;  3BG3 A;  2BDO A;  3FDT A;  5C5J A;  4CDE C;  2PN1 A;  5D1O A;  4CC6 A;  4X65 Q;  3A8I E;  2NYZ D;  2RDI A;  1STH A;  5CC4 A;  1X3Q A;  3IG0 A;  2ZJT A;  2AWO A;  3RZD B;  2W6P A;  1W93 A;  5KG4 A;  2XCP A;  1KXL A;  1AUV A;  2NU8 B;  3L3O C;  4O3R A;  4NW2 A;  5DAU A;  1JWS D;  3H0G B;  3C2P A;  3PF5 A;  5FLX W;  1HJP A;  5LMU L;  1ML0 D;  4OO1 H;  2XWB B;  2R7Z G;  2R7Z A;  3HKS A;  4DV6 Q;  2UU9 L;  3I4L A;  2G9H D;  3L9A X;  5BMV F;  1EUJ A;  1S5C D;  3K7A H;  4RB0 A;  1Q90 A;  5M5Y H;  1VQD A;  3FHW A;  2E2H B;  1RDP D;  2E74 C;  3CW2 C;  4MAM A;  1J5E H;  4DF7 A;  3KOJ A;  1I3Q H;  2UUB L;  4ALP A;  2PCF B;  1HNW L;  3ICE A;  1K0R A;  2JA7 H;  2E75 C;  3PO2 H;  4A2A A;  4L5S A;  2UXC H;  4DR3 H;  2CW0 D;  1AFP A;  4BY7 G;  5FD5 A;  2C2R A;  1EYZ A;  3GTL B;  1J6Q A;  2KEN A;  3KDF B;  4OXP A;  4GS3 A;  3EJI A;  5NUC A;  4IWX A;  3BDO A;  1B33 N;  3CC7 A;  2ASJ A;  1MJE A;  4MA5 A;  5KG2 A;  1HNX L;  2VQF L;  4AQY H;  1WD0 A;  2HQL A;  5CV7 A;  4EVO A;  1EOT A;  2EOT A;  2WP8 J;  1FNU A;  3CPF A;  4JPB W;  3S14 B;  3JAM L;  2Z4I A;  4F87 A;  4IPC A;  3PO2 G;  5DGB A;  4Y7N B;  4RGM A;  3SGI A;  2B2V C;  2F0G A;  2B2U C;  2K5N A;  1S03 G;  2GA4 B;  3FKI G;  1Z2O X;  3HZX A;  1Q86 C;  3FKI A;  4BA1 I;  2F0V A;  2PQA B;  2EY1 A;  1JOO A;  5CV9 A;  1C3O A;  2ZJR A;  5DGA A;  1WCM H;  3QJY A;  4ECW A;  1OXT A;  4KY7 A;  1SCU B;  3WNZ A;  4ZI7 F;  2IJ0 A;  3J80 i;  3NBH A;  1BBU A;  4C5C A;  4H44 C;  2JE6 I;  1F2Z A;  1TWA B;  4QW8 A;  1XPU A;  4K2L A;  2I80 A;  3K5N A;  1F9Q A;  4APV A;  1EY9 A;  1Y69 U;  2EY2 A;  1Y1W G;  1KJ9 A;  2UUA L;  5F9N A;  3A8J E;  3I73 A;  1PH1 A;  3V6H A;  4X3K A;  5CMD A;  4IAL A;  4P73 A;  4XQQ A;  4JYA L;  2W6O A;  1F9P A;  5M5W B;  4DR1 L;  3T13 A;  1EQR A;  3CCU A;  5ELE A;  3URY A;  2C2E A;  2JA7 B;  3U58 A;  5E4X A;  2LS0 1;  2ENB A;  2UXD Q;  2EY6 A;  1V1O A;  3CQZ H;  4UCS A;  2B39 A;  5D1O B;  4O3N A;  5KND A;  3F2U A;  3FRP B;  3HG9 A;  4IUR A;  4ECS A;  1Q1B A;  4O2A F;  5KKN B;  3S1M B;  5DG7 A;  1D1I A;  3RUZ A;  4JI1 H;  2FK2 A;  3TN2 A;  1R9T H;  5D14 A;  1U4P A;  4LFB Q;  2A69 C;  3SK8 A;  4WD3 A;  3RNU A;  1TII D;  4DV6 L;  3U50 C;  2UU9 Q;  4MV8 A;  2R7Z B;  4PDB A;  5IP7 G;  1SYX B;  5KNB A;  4OHJ A;  3LML A;  1PZI D;  4PQX A;  1KDA A;  1IW7 C;  1D5M C;  2C2D A;  3NWS A;  3H3V I;  4ECT A;  3SK5 A;  3VYR A;  1HNX H;  3HOY G;  1CHP D;  4YY3 Q;  4J9S A;  4PG3 A;  2YS6 A;  4N8F A;  1DOK A;  3S17 B;  4JI6 Q;  3ZJY C;  3OHA A;  3PO3 G;  1EYA A;  2XSC A;  1NNX A;  4BY7 B;  1N33 Q;  4ECV A;  5G3L F;  2UXD L;  4KJO A;  3RF2 A;  1WVL A;  1ET6 A;  2JSO A;  5LL6 X;  4O4H F;  4LNQ A;  1JCK B;  1I4R A;  4ZAI A;  3Q8P B;  4DV0 H;  4A93 H;  1IBK H;  3T5J A;  1I6U A;  3SDZ A;  2PMZ E;  4JUZ A;  4BY1 B;  1R4P B;  2K75 A;  2O2L D;  2HHH Q;  1QG7 A;  3N41 B;  1CKN A;  4YB8 B;  1KDC A;  1M4V A;  2KVM A;  2JA5 B;  1SNC A;  4C3I H;  1DV1 A;  2AQ4 A;  5EWG A;  2JYO A;  4J9L A;  3A5U A;  4DV4 L;  2W8L A;  3KFU A;  1DJR D;  3RGZ A;  4RH6 A;  1PRT B;  1NAP A;  3OUU A;  2HGS A;  5C1O A;  2NB0 A;  2A5H A;  4ED8 A;  2DN8 A;  2BCO A;  4KD4 A;  1HZ9 A;  2JA8 H;  1HZC A;  5C4X H;  2JA6 H;  4FVM A;  5EJW A;  1IBL Q;  3NUC A;  2N8N A;  4O42 A;  1PHJ A;  4C3J B;  1I4X A;  1HUN A;  3HOY H;  5KFI A;  4JOI C;  5DG8 A;  5IGC A;  4TV8 F;  5KFC A;  1AUX A;  1F9S A;  3PSI A;  1M0T A;  2NU6 B;  4ZHQ F;  3QG1 A;  5DQH A;  2UVU A;  1O80 A;  4IHJ F;  1WI5 A;  2Y0S E;  3RGX A;  1SMY D;  4GOP B;  2ASL A;  3HOU G;  3CU7 A;  3TEH B;  1Y1W B;  1DCZ A;  4MTD A;  2B2Y C;  1ROD A;  4IUQ A;  1G91 A;  2V58 A;  3ULP A;  4UCU A;  2R7M A;  1IBK Q;  1K1Q A;  3BVM A;  2QCP X;  2RHQ B;  3SEB A;  4G7O C;  2JA7 G;  2KED A;  3MC0 B;  1VQG A;  2K5V A;  5J2U F;  1HTL D;  4CKC A;  2F0T A;  3E6Z X;  4PZ6 A;  1VQ8 A;  1IZ6 A;  5AJ3 Q;  1LV9 A;  2R93 A;  4U7C A;  2DPI A;  2R93 G;  3N43 B;  2SDF A;  1SXT A;  3ERO A;  5FLX c;  4IR9 A;  4JI5 L;  2D9U A;  1P16 A;  1WTV A;  2N49 A;  4XYQ A;  3K59 A;  4ABN A;  1QJO A;  2DNE A;  1XNR H;  5DNF A;  2ZXO A;  3T5L A;  3GV8 B;  4G7Z C;  4JC0 A;  4MN3 A;  4KI0 A;  4B9X A;  5M5X B;  2R8K A;  3KLR A;  5G3L D;  3J80 L;  4O4L F;  2Z9H A;  3RLO A;  1HH2 P;  2Z0S A;  3HB9 A;  5KFP A;  4LFB L;  3HXL A;  1NR4 A;  5L1I A;  4F4Y A;  4DUY L;  3D8G A;  2BA1 A;  3HBL A;  5KFA A;  1SNQ A;  3N8D A;  1JWM D;  2YZG A;  1SN8 A;  4POF A;  2EYL A;  5A35 A;  4HYK A;  2EYJ A;  3L7Z C;  1FR3 A;  4C2M H;  3CCV A;  3V4Z A;  2L1B A;  4DV7 H;  2CFM A;  2F0J A;  3H3V H;  2J9G A;  3F1Z A;  2L5T A;  1SRU A;  4IPH A;  4U68 A;  2MFI A;  3G6J B;  4FNF A;  4RGO S;  4TQS A;  3GTL A;  5KG0 A;  2CWA A;  3TQY A;  4RCO A;  1PH2 A;  3NPP A;  1STY A;  3VR3 A;  1WTW A;  5ELF A;  4UPA A;  5I9P A;  5EQ0 A;  4BY7 H;  4PMB A;  1IKL A;  2JA5 A;  4B3T Q;  1LTR D;  3BQ0 A;  2SCU B;  4GNX B;  5CR3 A;  4LFC Q;  5EPL A;  3S24 A;  4K14 A;  2NUC A;  4I55 F;  4JBW A;  3KBG A;  4O0A A;  4A76 A;  3F8T A;  3CCS A;  1XTD A;  2XIG A;  4QMG A;  1VCI A;  2RCN A;  4RHS A;  1KD1 C;  1S0O A;  2WAQ E;  1M7J A;  4ECZ A;  1Y1V A;  4BBR G;  1UAP A;  2SOB A;  1ASZ A;  2AWN A;  1TR5 A;  4JV5 Q;  3K58 A;  1I7L A;  3FMA A;  4OO1 G;  3M4Q A;  1WTR A;  4IRC A;  4C3J G;  3PF4 A;  3QZ8 A;  1XMQ L;  3P75 A;  5KRU A;  4LF6 Q;  3D4W A;  2VL6 A;  5KFD A;  1N56 A;  1KL9 A;  4MNO A;  5KFO A;  1JC7 A;  4KHP L;  4FF4 A;  4KHV A;  1EWI A;  4IZ8 A;  3VYS A;  4DU9 A;  2OWO A;  4GLV B;  2XNA C;  1KJQ A;  1N9W A;  3BJU A;  5BN4 A;  1QIL A;  4QGU A;  1WTO A;  1V4Y A;  3GV5 B;  3GTJ A;  2VA3 A;  1WTQ A;  1M6V A;  1CE8 A;  2XCL A;  1UNN C;  2BE5 C;  2X69 A;  3CCR A;  5BPF A;  5LA6 F;  5GQO A;  2OQK A;  1PYS B;  4JI4 L;  2ZDQ A;  1B8A A;  4R8N A;  5C44 H;  2YTV A;  2UXC Q;  2XRS D;  3V96 A;  3IN5 A;  3QOJ A;  2XGQ A;  4E4T A;  2O03 A;  3PMF A;  2W9C B;  2F0U A;  3S2H B;  1J5E Q;  3RN5 A;  3MEF A;  4DV3 L;  2K03 A;  4A3M G;  3CCM A;  4LF6 H;  4DV7 L;  1IYU A;  4L6T B;  3OIQ A;  2QKI C;  5FD6 A;  4GLA C;  3J7Y W;  3JZI A;  4O3O A;  1FJG H;  4Y52 H;  3K3V A;  4R1J A;  3PW5 A;  1I7N A;  4EYH B;  4RAU C;  2CWP A;  2HJW A;  1E3P A;  2BH2 A;  3GIK A;  3G6E A;  1GSH A;  4XTC S;  5H1S E;  5JPM C;  3X3N A;  1TWG A;  3SVM A;  3I90 A;  3J81 i;  4HIK A;  2B63 H;  2K05 A;  3KUP A;  3PUY A;  2ASD A;  4DAY B;  3K5M A;  4AYB E;  2PNR C;  3GTO A;  3GTG A;  4MV1 A;  3H40 A;  1WR2 A;  3K7U C;  1WTP A;  1L2Z A;  2WB1 A;  3DEP A;  1RJR A;  2BDN A;  3ND9 A;  3PVX A;  4P2C B;  3H91 A;  5IGD A;  2HVS A;  2FPP B;  2F03 A;  5KT7 A;  1F9R A;  1PTO C;  1CK1 A;  1FL0 A;  3N6X A;  1V1P A;  2NWG A;  4X62 L;  1F2L A;  1LTT D;  3HKZ B;  2PMZ A;  1G8Z D;  1F2M A;  4H02 A;  4X3S A;  1RF2 D;  1B50 A;  1MIU A;  3E0E A;  1DOL A;  3GP7 A;  3M4P A;  1TWF H;  4KJN A;  3GTQ B;  1PYB A;  1BVS A;  4LF7 L;  2FJZ A;  4QIW B;  3BVG A;  5COY A;  4C2M B;  1EY8 A;  2HD3 A;  3M7G A;  3LP8 A;  3BZC A;  5JJI A;  1DD2 A;  1TQO A;  1I4G A;  5A2Q W;  4BBR B;  1ONL A;  4BY1 H;  3OOC A;  2R92 A;  3TP8 A;  3CCL A;  2HIV A;  1SE2 A;  4A93 B;  1B2T A;  2PZU A;  5GON F;  5FLX E;  4EX5 A;  1Y8N B;  4DR2 H;  2A19 A;  4EGQ A;  4A3G B;  4HCE A;  2R87 A;  1KJ8 A;  3CVZ A;  1QNK A;  3OYY A;  3V05 A;  3MWY W;  1ZQ7 A;  3JSL A;  3RV4 A;  1EQQ A;  4ZUI A;  2V59 A;  4YQW A;  4BBS H;  3I56 A;  4IOA A;  4JI5 H;  5I2Y A;  3PQI A;  5J1Z A;  4DV0 Q;  2VZA A;  1UE6 A;  4GOP C;  4A3F G;  3OHB A;  3DEO A;  2Y0S A;  2MO0 A;  2CZG A;  4ED7 A;  3GTM B;  2FK3 A;  4QWB A;  1EQV A;  2P0A A;  4YAJ B;  2A73 B;  1CKM A;  2SNS A;  4LF6 L;  2FLN A;  4JBK A;  5KFY A;  4ZLT F;  1CZG A;  1RTO A;  3HOX H;  2CW8 A;  4A3D H;  1RCV D;  4KKS A;  2VS1 A;  4OO1 I;  2VPQ A;  5DLG A;  3NXW A;  5C6A A;  1R9T B;  3SE0 A;  2FKL A;  2UVR A;  1VAJ A;  1V51 A;  2X6G A;  3K6O A;  4RAZ A;  1X54 A;  3U4Z A;  3D4D A;  2GPS A;  5FKA C;  1MBY A;  4YAK B;  2EY5 A;  1IYJ B;  4ME6 A;  3K8A A;  5IOC A;  1TKW B;  1BO0 A;  3JSN A;  2IY5 B;  1SNO A;  1TS3 A;  4X62 H;  4EQN A;  5IT9 c;  1VQ7 A;  5K36 H;  2FP4 B;  4UY8 C;  4KY5 A;  3BA8 A;  2F4I A;  3KAK A;  1PZK D;  2F0K A;  2JN4 A;  4DPG A;  2C9O A;  3EBE A;  5IYC G;  4JI8 L;  1OWT A;  2KHI A;  2C22 A;  4HJA A;  3KJO A;  1IHZ A;  1KLG D;  2RVL A;  4K5V A;  1N33 L;  5EPJ A;  4A3B B;  2MP1 A;  4X3T A;  2NVQ H;  1E1T A;  4HTH A;  3HOZ B;  3S1N B;  1RD9 D;  1GSA A;  2VOB A;  3I72 A;  2RGV A;  1NJI C;  4J8Q A;  4DV5 Q;  5C3E B;  1ZET A;  2YZM A;  2EVB A;  2F0Q A;  2XGT A;  4JI4 Q;  1V1P B;  4KY6 A;  3GQB A;  1II3 A;  4LF7 H;  2B2U A;  5C3X A;  2TSS A;  1VQA A;  4MV3 A;  5HGT A;  2W9B A;  1N33 H;  2I5M X;  5T1G A;  3HKZ G;  4NLG A;  1E2W A;  3N52 A;  4R4I A;  4B3R H;  2B63 A;  4P75 A;  3PIP A;  5JH7 F;  1LLR D;  1A8V A;  1TS5 A;  4JV5 H;  1GHJ A;  4Y7N H;  3E9H A;  4QIW A;  4YBZ B;  3I4M G;  1KAW A;  2HDL A;  5KFR A;  1BQQ T;  4ZOL F;  2J6S A;  3U9S A;  5KT3 A;  3NWT A;  4ZKC B;  4YCV A;  1E2Z A;  2EYP A;  2DWC A;  2K5H A;  1J8I A;  4J0M A;  1LAC A;  4BXX G;  4F4X A;  3NE5 B;  4N9P A;  2ICE C;  4AYB G;  3M9B A;  1BOS A;  4DL4 A;  4DUZ L;  3G7L A;  2OTL A;  2K5D A;  4GN3 B;  4A3G G;  1EZ1 A;  5I6Y A;  1VQK A;  3I4N H;  2IMW P;  5KFB A;  1S97 A;  4CJ2 C;  1JLL B;  1JT8 A;  1VDZ A;  1VQC A;  3PUW A;  3GTJ H;  2ZM6 H;  3G4S A;  1O78 A;  2B2T C;  1XMO L;  4Q8E A;  1CFM A;  1HXY D;  4RB1 A;  1K8G A;  5C3W A;  2K50 A;  5E4W C;  3GIL A;  5L1K A;  4YY3 L;  3D6C A;  3RAQ A;  3CD6 A;  1D5Z C;  3P7J A;  3I7F A;  2EQS A;  4MHE A;  1S3O A;  2E2I A;  3MR5 A;  3GO5 A;  5IT9 L;  1BR9 A;  4FXD A;  4IN3 A;  5FPO A;  5IP7 H;  1SYE A;  5M3F G;  2BQ3 A;  3KHR A;  4JI1 L;  1EU4 A;  1U9R A;  2PNH A;  5KFU A;  2B29 A;  4JI2 H;  2EJM A;  2XCA A;  1R9T A;  3KLW A;  3NQT A;  1VBG A;  4A3L G;  1PFM A;  4HIM A;  4DV6 H;  4PNY A;  3CC4 A;  3RB4 A;  2F3I A;  4LUO A;  4ZCK A;  3AMU A;  3F8N A;  1U4M A;  3LWE A;  2XTI A;  1DV2 A;  4ECX A;  4DN4 M;  2QK4 A;  2PI2 A;  1JIC A;  1U4L A;  4IUT A;  4DR3 L;  2L11 A;  3FDS A;  1GYF A;  5KYL A;  2H5X A;  1TWA H;  3Q8S B;  5HGQ A;  1I94 H;  5IYD G;  1KRS A;  1S5E D;  2L0C A;  2WFW A;  4CKB A;  5M3M G;  1BNZ A;  5L1L A;  1KEE A;  4B3T H;  3CPW A;  1LT4 D;  4JK1 C;  1H9K A;  1OXU A;  1YHB A;  3S9W A;  3DWP A;  2HVQ A;  4HCS A;  3NTI A;  3O13 A;  3GV7 B;  3PW0 A;  4DAM A;  4B3R L;  2FPI B;  1JJC B;  2EYF A;  4BBS G;  2ALY B;  4DAY A;  4DV5 L;  4JI6 L;  3S16 B;  4K0K H;  1E22 A;  3GTG B;  3I70 A;  1HNW Q;  2GPW A;  1L0W A;  4DV7 Q;  1GUO A;  1PH7 A;  2C28 A;  4IO9 A;  1V8Q A;  3HOV B;  4DR5 H;  1EY7 A;  1N36 H;  3H15 A;  3UE0 A;  3QB3 A;  5IYB H;  1T94 A;  1X3F A;  2RHS B;  5JJZ A;  4FO2 A;  5EZY F;  1D7Q A;  4OL7 A;  1AP0 A;  2W9B B;  2XIW A;  4DKA C;  1SE3 A;  4QY7 A;  4BS9 A;  3CMA A;  2NVT B;  1EWC A;  3TME A;  2ES2 A;  1K9M C;  1N34 H;  2JA9 A;  4GNX C;  2XD4 A;  4DL7 A;  3WO1 A;  1EYD A;  2WTF A;  1JOR A;  5LHY 1;  2CCZ A;  1IL8 A;  4NB3 A;  5LL6 b;  1TWH B;  3KXY T;  3ITP A;  1UC9 A;  1B9N A;  1XNR Q;  3VYT A;  3RMH A;  3RUP A;  4QF4 A;  3G8C A;  3HRZ C;  2WAQ G;  5KIX A;  2VY3 A;  2W9A A;  4IJL A;  1PXU A;  4KKT A;  1YJ9 A;  3PW2 A;  1G29 1;  1H9R A;  2AQ3 B;  2HIX A;  2JJQ A;  3UI2 A;  4AYB B;  3C46 A;  1PMR A;  1EL0 A;  1UE7 A;  3H3V C;  1QOH A;  2R92 B;  1JJG A;  2NVT H;  1QVC A;  5KT2 A;  3OWF A;  4HED A;  2W71 A;  1O7L A;  4ZUJ A;  3MFG A;  3V4S A;  5T14 A;  2WII B;  1T5E A;  1IXR A;  1CKO A;  4JYA H;  5COR A;  4JI2 L;  1PYW D;  1HQM C;  4BA2 I;  1NY4 A;  3T1H L;  3KLS X;  2F0W A;  4QWC A;  1A9X A;  1UC8 A;  4IRK A;  2F0O A;  2E2I B;  2CH4 A;  2GN5 A;  1E4F T;  1ZHQ A;  3OIP A;  3VYU A;  3GIP A;  2Q2H A;  5ELC A;  2R7F A;  4DR4 H;  4ED3 A;  4UCO A;  2QDL A;  2VUM G;  2PQA A;  4J15 A;  3MFH A;  4Q0Y A;  1I94 L;  2IPK D;  4FBT A;  4YJ3 F;  2E5L Q;  3KF6 A;  2L4N A;  4DUZ Q;  5F2D A;  5CGK A;  4ZYS A;  3MR3 A;  4JV2 A;  4YWM A;  4X62 Q;  1PZJ D;  4A3M H;  5JJK A;  2NZ1 D;  3JAM i;  3K0Y A;  3MR6 A;  3C3L A;  1PRT C;  5JOB A;  3GD7 A;  2KEC A;  5CBA E;  2DLN A;  2JA6 A;  1SMX A;  4UP7 A;  4U67 3;  3UDI A;  4DR7 L;  1PK8 A;  3GIQ A;  1BBW A;  3IKJ A;  3MXU A;  1WOC A;  5IGE A;  4HJ7 A;  4GC7 A;  4IUU A;  1DM0 B;  3A74 A;  1PA6 A;  1PTO D;  2YU9 B;  2CVR A;  1KIX A;  4J9N A;  2KBN A;  1BCP F;  3PCO B;  4PZ7 A;  1PH6 A;  1W3S A;  3AU7 A;  2V4Q A;  2K32 A;  4YWL A;  1L1O A;  3WO0 A;  3GII A;  1DXM A;  1K83 H;  5C4Z A;  2L15 A;  3OSN A;  4POG A;  4CDD C;  3TRE A;  3RAX A;  2UXD H;  3IAY A;  5LMN Q;  1GUW A;  2A74 C;  3GDE A;  3M7N A;  4BBS B;  3DM3 A;  4L5R C;  4FBU A;  3IL8 A;  4ID6 A;  4YHH L;  1VQI A;  1KNA A;  2MCT A;  3E9I A;  2V5A A;  3TP7 A;  3JAM E;  4DL3 A;  4Y8V B;  4UHV A;  1TS4 A;  4JW0 A;  1HHV A;  4ZK9 B;  3J7A V;  1S4Z A;  1EYC A;  4MZ9 A;  1Q3L A;  1B9M A;  1M0W A;  4OIJ A;  4BBR H;  2XRQ D;  4XT1 B;  1QNU A;  1JJ2 A;  3HFZ B;  1Y1V H;  4H0L C;  5LMU Q;  4JCV E;  4X3U A;  3MWE A;  2PI2 E;  1Y14 B;  3WWV A;  5J3B A;  3Q24 A;  5KT4 A;  3BDL A;  3PR4 A;  2CW0 C;  4GKK L;  2ZTC A;  1E7Z A;  3TS2 A;  2Z6B A;  3CAM A;  4LMQ D;  3W2D A;  1WFQ A;  3BZD B;  5CBE E;  4X64 H;  2NTS A;  4B3M L;  2N78 A;  3I4N B;  1L2F A;  2R85 A;  2UXC L;  4U6P A;  4H13 C;  1RYR A;  4NXN Q;  1I4Q A;  2R92 G;  3GTK H;  3KHH A;  4DAP A;  4IFD H;  4XYO A;  4DV2 Q;  1O7I A;  1IOV A;  5EWE A;  3Q0A A;  1VBH A;  5C44 B;  4A3C G;  1CM9 A;  1T3N A;  4HMI A;  2C5C A;  4X66 H;  2MJ8 A;  4R4T A;  5JEA J;  1CA5 A;  2A6E C;  2K1B A;  1X6O A;  4A3E B;  1KLU D;  1PVO A;  2KCT A;  1ICF B;  1F77 A;  3Q2O A;  2NVY B;  5HUR A;  1AN7 A;  2KSW A;  2K33 A;  3HOZ H;  3Q8Q B;  1VQ9 A;  3NEN A;  1B6R A;  3N42 B;  4RKB A;  2EYM A;  2R8I A;  2IBK A;  1UE1 A;  2WKD A;  4LH7 A;  5ELO A;  1XDN A;  4UP8 A;  4J9Q A;  1SR3 A;  4LFA Q;  1PDQ A;  2BR0 A;  4ECR A;  1K8M A;  4RCN A;  5KFQ A;  3G6X A;  5IYD H;  5KG3 A;  2OH2 A;  3AFP A;  2J6T A;  3S2H H;  4M9U A;  3VDY A;  3VR6 A;  3J81 L;  1W2B A;  1G2T A;  3V6J A;  2NBF A;  2NVQ B;  1GUN A;  2NVY H;  3FKI H;  1CI3 M;  4B9W A;  1LT6 D;  3P20 A;  1LUZ A;  1NUC A;  4EG0 A;  3RIZ A;  4LF9 H;  1M8A A;  5JUM A;  2ZXR A;  3QIA A;  4K5X A;  3DF7 A;  1W96 A;  1E4G T;  1YJW A;  2IL8 A;  4EFB A;  4Q44 A;  1OTC A;  3M85 A;  4TV9 F;  1GM5 A;  4RNO A;  4HN7 A;  2HCI A;  3RLN A;  3HOU H;  3TIG A;  4XYM B;  4Q43 A;  3NK9 A;  3T51 B;  1W6J A;  1BKB A;  4DFA A;  3BQ1 A;  4S3S A;  3S1Q H;  5D3I B;  4JBJ A;  3KHL A;  1V43 A;  1MD2 D;  3K5L A;  5GAD C;  2F0P A;  2K01 A;  1H9M A;  4M8A A;  1VQO A;  3T1Y Q;  3T1Y L;  4NXN H;  4DR3 Q;  3KK7 A;  1XX8 A;  2DJG C;  1SEB D;  1FGB D;  4R8U B;  3TBI B;  3CCQ A;  3PW7 A;  4FDB A;  3HOX B;  2VB2 X;  3T1H Q;  2W6M A;  4LUZ A;  3R5H A;  5C4X G;  1LTB D;  3J81 E;  3BS1 A;  2F4V L;  4ED2 A;  2JA8 G;  2KCC A;  2C00 A;  3L4J A;  3SHL A;  3A5Z B;  1K3R A;  1I4P A;  2X6L A;  2Q8T A;  1VQM A;  2HUG A;  4LF9 Q;  3LGJ A;  2B63 G;  1VF7 A;  1CQV A;  3EN2 A;  1UEA B;  3W1G A;  1B6S A;  4JVZ A;  4LSA A;  5HV6 A;  5IYB G;  3M3Y H;  1XJV A;  2H4O A;  5LYJ F;  5DQG A;  4LF5 L;  4OEM B;  1TWF B;  1GUT A;  3CCJ A;  1GD7 A;  5ELD A;  1UWV A;  3NEL A;  1HZB A;  4X66 L;  3S1M H;  1EUC B;  1D5X C;  3MA2 B;  4LFC H;  2FLP A;  4X65 H;  3OMG A;  4HIO A;  1IOW A;  4FS1 A;  3RV3 A;  2IT1 A;  3S1R H;  1STE A;  1WYD A;  1K83 B;  5C0X J;  3BA9 A;  2GVB A;  4RMF A;  4HNU A;  1SYF A;  4OX9 L;  3RFC A;  2K52 A;  4MIU A;  4UCR A;  3NP8 A;  3H4D A;  4IOC A;  2Z8L A;  4XT3 B;  3V2T A;  5C44 G;  4JI4 H;  1BXT A;  3FP9 A;  1C0A A;  3DHQ A;  4TKO B;  4MA0 A;  4A3E G;  4RKL A;  4X66 Q;  4OIK A;  1O7Y A;  4O3P A;  4QWD A;  5DEH A;  2LY7 A;  1HRJ A;  2NVX H;  4DV2 H;  2R7D A;  2D5D A;  3FVQ A;  4GKK Q;  2VQE H;  4FF1 A;  2R8G A;  1O75 A;  4IUN A;  5KG1 A;  4DA2 A;  2VQF Q;  3H0G G;  2IWH A;  4A3I B;  4DNT B;  3Q23 A;  2F0I A;  3TP6 A;  3RR5 A;  1AH9 A;  1BUV T;  4TSS A;  3KF6 B;  4DR6 Q;  3G6V A;  2I0Q A;  1RK5 A;  1AN8 A;  4CHT B;  1SYG A;  4OON A;  1IBM Q;  5BN5 A;  2MO1 A;  3STB C;  5BR8 Q;  1FVI A;  1HR0 Q;  1QVF A;  2VQE L;  3K80 C;  1QZH A;  4YP3 A;  2IW3 A;  2JA6 B;  1N32 H;  5ELB A;  2V4D A;  4NDX A;  4RUC A;  1AW7 A;  5IYC H;  4FM9 A;  4N8X 1;  5IP9 G;  2VXW A;  5EPK A;  2ZTE A;  5KFV A;  4KV6 A;  1NTG A;  3U4V A;  1LTI D;  1AZQ A;  1W6K A;  1C30 A;  4MV7 A;  1ET9 A;  3MEH A;  5C0X H;  1RIP A;  3AFQ A;  2HHH H;  2I8C A;  2OQ0 A;  1HTP A;  1A0I A;  3KHG A;  2ZJQ A;  1YBY A;  2ATL A;  2R3Z A;  4JYA Q;  3J80 W;  4O2B F;  4JOI A;  1ULZ A;  2NU9 B;  5FPR A;  2VPS A;  5KEE A;  3S1R B;  2RBM A;  4QB4 A;  1JE4 A;  2PW7 A;  5LMN H;  3DWQ A;  2VQD A;  3C1E A;  1PFN A;  1TWH H;  1U5K A;  4JI5 Q;  2YZN A;  1SDF A;  1DGS A;  3PO2 B;  3JAM W;  4WBN F;  1N48 A;  3S15 H;  2F0M A;  2E2H H;  1JB7 A;  5FLM H;  3QFF A;  1HR0 H;  5C4X B;  1A3V A;  2JA8 B;  2N55 A;  1YNX A;  5C1P A;  1JDB B;  4DR6 H;  4QUF A;  2NZO A;  2EE1 A;  2K5Q A;  4DV1 H;  3NGD A;  3TQ1 A;  2Z1C A;  3GTO B;  2NUA B;  5L1J A;  4AH6 A;  4DUZ H;  3IFT A;  4KD3 A;  5FLM G;  1N36 L;  1TWF A;  4HJ9 A;  4LSX A;  2UVW A;  4HNV A;  3NBH B;  5EKK A;  4IRD A;  3CME A;  2A68 C;  2J6U A;  4DV0 L;  1EFW A;  5F9L A;  2WAQ A;  3MR2 A;  3PIO A;  3D3R A;  3ULL A;  1M1K C;  1QE6 A;  4RGN A;  1X56 A;  1SAP A;  2AU0 A;  3A55 A;  3R93 A;  1KAB A;  3J7A 5;  4TQR A;  1SE8 A;  1BF4 A;  1D8L A;  1RKN A;  4TQU S;  3RJ0 A;  2JEJ A;  4XDX A;  2JA7 A;  1S5F D;  2MHV A;  3A7A B;  3OW7 A;  4KHZ A;  4FS2 A;  4JI7 Q;  5JEA G;  1K73 C;  2UUC L;  5IY0 A;  5J22 A;  3GTO H;  1VS0 A;  1B1Z A;  1DYQ A;  3K81 C;  1N32 Q;  1CQJ B;  4B3M H;  2JQO A;  2R7Z H;  5D3D A;  1TWG H;  3FKI B;  4IUP A;  1YVC A;  4OGQ C;  4LWC A;  3KTM A;  4NP5 A;  4C1N I;  5CB4 F;  5C5L A;  3M4I A;  2W6Z A;  4A3I G;  5CA0 F;  2DIK A;  2XC9 A;  5C4H A;  1QZG A;  1X3P A;  3S15 B;  4JI8 H;  1AZP A;  3BAA A;  4IQZ A;  2DZD A;  4EGV A;  5GRO A;  1BJT A;  4BWS C;  3NHH A;  2SNM A;  2YS7 A;  1CS0 A;  1LT3 D;  4L5T A;  3N40 P;  1G51 A;  4B3S L;  4IFD J;  2Y0S B;  3CQZ B;  3AB9 A;  4DXF A;  4A3F H;  1FNW A;  4DL6 A;  1SJE D;  1BNC A;  3TII A;  2HVR A;  1N34 Q;  4O3Q A;  4DR5 Q;  2YCH A;  2LFN A;  5LMN L;  1LTA D;  3PO3 B;  3MXN A;  1HNW H;  3BZK A;  4DK1 A;  1JXL A;  5E3F A;  4AQY Q;  3W3A A;  3QZ7 A;  3R3O A;  4HMJ A;  4JI3 H;  4GZY C;  2PZT A;  4HAE A;  1GOZ A;  5I6W A;  3MJF A;  1I50 H;  4AQY L;  4BY1 G;  3OWE B;  1JB3 A;  1C9O A;  3ULJ A;  1CA6 A;  3K5H A;  2F0H A;  2SEB D;  4UAI A;  3A7L A;  3DLL A;  3MHB A;  4RU9 A;  3OPO A;  2JA5 G;  2F52 A;  1SEI A;  2M00 A;  1Z6H A;  1EIH A;  2I5L X;  4IR1 A;  3NEM A;  3HOV H;  1LTG D;  3M9N B;  4HNT A;  4XZ3 B;  2Z6K A;  3CKI B;  5T1I A;  4I65 A;  1SRO A;  2EJF C;  2QW7 A;  5K5P A;  4IPD A;  1GJX A;  1EZ8 A;  2V9W A;  1HFG A;  1KC7 A;  1IBM L;  2B2V A;  2DY7 A;  5FO7 B;  2AQ1 B;  1L1O C;  1UNS A;  2CQO A;  1I94 Q;  5JQW A;  3RD4 A;  1FJG Q;  4QL5 A;  1S5D D;  3K7A B;  1K0S A;  1QWY A;  2WDT A;  3UDG A;  1XPO A;  4XYL B;  1Z9F A;  2UUC H;  5CV5 A;  1Z7T A;  4DR5 L;  2UVV A;  5IT9 E;  1LT5 D;  3HOY B;  5IIF A;  1GKH A;  1DIK A;  1LAB A;  5KFK A;  3RTX A;  2P5Z X;  3S1N H;  1CQI B;  1EY6 A;  4RFB A;  1V9P A;  1Z2N X;  3T1Y H;  1PFB A;  1QB5 D;  2XWJ B;  4O2D A;  4JI2 Q;  2RF4 A;  2WV6 D;  4P74 A;  4QIW E;  1ILP A;  4J9P A;  1OXS C;  3CP0 A;  1M90 C;  2WE6 A;  1PTO H;  1TXY A;  3NTK A;  4Q0F A;  2F3W A;  2IX3 A;  1E2V A;  2FFK B;  4RWS C;  4OX9 Q;  2GLT A;  3PIP 3;  1EY0 A;  4JV0 A;  2V4R A;  4DV4 H;  2F4V Q;  4DGZ A;  1B70 B;  1STB A;  4A4I A;  3R5X A;  4YR2 A;  2R93 B;  1J9O A;  4F7X A;  2YU9 H;  2F3V A;  3TQT A;  4R4Q A;  4O1N A;  1HNZ L;  4V0B A;  1WJJ A;  5IGB A;  4WFN 3;  2UUC Q;  4X64 Q;  1H95 A;  1QUQ B;  1RL2 A;  2N88 A;  3ORR A;  1NR2 A;  2RSO A;  1A2T A;  2Z4H A;  1FKA H;  1XMQ H;  4PZ8 A;  2HT1 A;  4LK1 C;  1X3G A;  1PLF A;  4G57 A;  2EJG C;  1ESR A;  5IOD A;  1ENF A;  2X0S A;  4LFA H;  3UDF A;  4EGJ A;  3S2D H;  2A6H D;  2MPM A;  4KHP H;  1STG A;  1ASY A;  1STA A;  3DUZ A;  1CUK A;  4A2B A;  1CHQ D;  4IFD G;  5IWA Q;  2Y0S G;  5A2Q L;  5J39 A;  3UDX A;  3TS0 A;  2IP4 A;  5CAE B;  2R92 H;  4LF7 Q;  1WD1 A;  3CC2 A;  2R93 H;  1JKJ B;  1Y1W A;  2FK1 A;  3HOU B;  2M9V A;  2WYO A;  4B3R Q;  3CCE A;  2F0L A;  4DV5 H;  1FYC A;  2B2Y A;  1I6H B;  1XTC D;  4F50 A;  3F2C A;  1OXV A;  3EYY A;  5C0X G;  2IA6 A;  5D65 A;  4HJ8 A;  4NXM L;  4GN4 B;  5M5W H;  4QQB X;  3DWA A;  4DK6 C;  4CGY B;  4TRD A;  3TZD A;  1NE3 A;  1ILQ A;  5IP9 H;  1TY2 A;  3J7A F;  1VQN A;  2OXP A;  1SNP A;  1SND A;  2GVA A;  2BQU A;  1HZA A;  4NXM Q;  4DR7 H;  3QO2 A;  2OCE A;  2IX0 A;  1TU2 B;  3I55 A;  2QDB A;  1N34 L;  1VKZ A;  5EAY A;  5JEA H;  4APM A;  1ESF A;  4HSV A;  1RK6 A;  3W1B A;  1EEI D;  3E5S A;  1YIJ A;  1FGU A;  2R7K A;  2HDM A;  5K2M A;  5DLF A;  4X6A H;  3HS0 C;  5A2Q E;  5JVD F;  2F0D A;  1MI2 A;  4JI8 Q;  1S10 A;  1SBB B;  5LP6 F;  3STB D;  1JQY D;  4DNI A;  1Q46 A;  4ECQ A;  1ENC A;  3Q6S A;  4EYI B;  5C0X I;  4J9K A;  2JEF A;  4YHH H;  3MVV A;  4NXN L;  3JAM c;  1UUP A;  5BN3 A;  2RCF A;  1S9F A;  1B53 A;  4MV9 A;  1S68 A;  5LMN W;  4QWA A;  4XIG S;  2YV5 A;  2F0E A;  3K0X A;  1KNE A;  3ETJ A;  4UCT A;  2B8G A;  4ME3 A;  2BH8 A;  4UFZ A;  5AFW A;  1JOQ A;  2NN6 I;  5FO9 B;  4MV4 A;  1S40 A;  4EEY A;  1IYV A;  1JIH A;  4F88 A;  3T5K A;  2LKV A;  1KJI A;  2KHJ A;  3BJY A;  4DR1 H;  4FP5 D;  4HR7 B;  4MTE A;  3T5H A;  4JI0 Q;  4JI0 L;  4LF8 H;  3J80 E;  2PVP A;  1KHI A;  4TVA B;  1XNQ H;  1B44 D;  5KGU A;  2AGO A;  3K5I A;  1IKM A;  3P1H A;  1WTX A;  2W7P A;  4K5W A;  1HCZ A;  2ZT9 C;  1I3Q B;  1NMF A;  2WB1 E;  1I50 B;  3I2Z A;  3M4O B;  5BPH A;  3ER0 A;  2I5H A;  1KDB A;  2IHF A;  4JI3 L;  3PN1 A;  2HCC A;  3RZO H;  2PW5 A;  4UCV A;  5KNC A;  2QYZ A;  3H0G H;  4LMY A;  4I7Z C;  4K2K A;  5DM7 3;  4KN7 C;  3AEV A;  3H09 A;  1TWC B;  4DR2 L;  1KJJ A;  1XWE A;  1YHQ A;  1I6H H;  1TWG B;  2EYH A;  1VQP A;  5KG5 A;  2R7N A;  4F4W A;  5I9O A;  4K0K L;  3TDQ A;  3Q1K A;  5DQI A;  2YRW A;  1XMO H;  3KAJ A;  2R7L A;  2MNA A;  3M4O H;  2R84 A;  3CQZ A;  4DR7 Q;  4IJH A;  1V1Q A;  2I07 B;  2V1C C;  3PUX A;  4ILW A;  3ND8 A;  2ATW A;  3R23 A;  5IWA L;  4K6D A;  4K0K Q;  3GTJ B;  3N44 B;  1K1S A;  4XQJ A;  2UUA H;  3MXN B;  5FK9 C;  4C1N K;  1D6E C;  1ZKO A;  4FF2 A;  2RSN A;  1A15 A;  3GTP H;  1G6Z A;  1Q81 C;  5GAG C;  4Z9C B;  2KUM A;  2AGQ A;  2JXM B;  4ZRZ A;  1Y8O B;  1HA6 A;  2Q8I B;  2W9C A;  4ETS A;  1EY5 A;  1MHW C;  3LX0 A;  2K4K A;  4KKU A;  1AE3 A;  5IWA H;  4AIM A;  1Q12 A;  4DV3 Q;  4B3S H;  1VF5 C;  2KA7 A;  2LSS A;  2RDH A;  3KYH C;  4P72 A;  4YHH Q;  4L63 B;  4A3M B;  4FYD A;  4C3I G;  2PBZ A;  1TVX A;  2EXD A;  4KHP Q;  3GTQ A;  5H80 A;  5BR8 L;  1X65 A;  4YIJ A;  2KQ3 A;  5EBD A;  4A3K B;  4RGT A;  3TP5 A;  4ODG A;  5C3E H;  4WJ3 M;  1K8O A;  2MUY A;  3SK4 A;  2UU9 H;  2RDG A;  1L1O B;  1EQT A;  4Q5V A;  3BYT B;  1XMQ Q;  4A93 G;  4DL5 A;  2DNC A;  2O5I C;  1E4E A;  2W70 A;  4NKL A;  1XNQ L;  3C0F B;  2FHT A;  1IL2 A;  3K3P A;  1K3B C;  1EIY B;  1QVG A;  2AQ2 B;  4I50 F;  4I4T F;  2ASB A;  2W8K A;  2EPB A;  1MSG A;  4BWG B;  5JPN C;  4G7H C;  2L12 A;  1BBX C;  3T1H H;  3LWU A;  1ZXT A;  3IFD A;  3ZYY X;  3VA7 A;  3PR5 B;  5KG6 A;  4A3C H;  1DZ1 A;  4L5Q A;  2KCN A;  2W6Q A;  2F4V H;  3ERS X;  4DV4 Q;  4ECY A;  3J7Z C;  1TWA A;  2G9D A;  3I4O A;  1O7Z A;  4DV1 L;  3R2T A;  4YJ2 F;  1PH5 A;  4DV2 L;  1GSO A;  1LYL A;  5EKI A;  1QCB D;  1STN A;  1RJP A;  3UE1 A;  5M5X H;  1ICW A;  1SE4 A;  1CSQ A;  1IBK L;  2E2D C;  3PV0 A;  2L9H A;  1SSO A;  3VR2 A;  4KMU C;  3VR4 A;  3T56 B;  5M3M H;  5L9X A;  2R61 A;  2QEJ C;  1I3Q A;  2R6G A;  4GLX A;  2XGP A;  2NZH A;  5JAV A;  4CJ0 B;  1PV4 A;  4RAY A;  2JEG A;  2WAC A;  1KRT A;  3RN2 A;  3TIN A;  5ISR A;  4V19 0;  1XNR L;  3LNN A;  1WSC A;  4B08 A;  3BDC A;  1GVP A;  1AEX A;  5HBR B;  2VNU D;  3WDN A;  4IPG A;  5KFT A;  1EY4 A;  2KEE A;  2LXK A;  3UFX B;  2A69 D;  3TRZ A;  3VMM A;  1GGO A;  1GUS A;  3DXJ C;  4A3L H;  2E2J H;  2VA2 A;  2VB3 X;  5D1P A;  4A3D B;  4GKJ H;  5CV8 A;  4G4K A;  2B2W A;  1B3A A;  5CV4 A;  3OHX C;  3K5O A;  2B2T A;  2XVS A;  2R82 A;  2Q2I A;  3BAB A;  2AHO B;  3KBX A;  3SK6 A;  1KAA A;  3KLS A;  5C5M A;  3F2B A;  3CXC A;  1Y1W H;  2RKS A;  1EIF A;  3OTO L;  2B2W C;  3S16 H;  3QOL A;  4A3G H;  4IZO A;  2KJX A;  1C8C A;  3HOZ G;  2RA4 A;  4A3F B;  3E3X A;  5M9O A;  2NU7 B;  3GTM A;  4HJ5 A;  1SJH D;  3FPU B;  1Z47 A;  3DM1 A;  1HNZ H;  3I91 A;  5C3E G;  3NSW A;  1TY0 A;  4OEL B;  2ZM6 Q;  2A68 D;  2ICI A;  4PMC A;  4YCU A;  1P8L A;  1HFN A;  5D8D A;  4TUY F;  1VQE A;  3SE7 A;  2H1E A;  3IRB A;  4ED0 A;  4RG1 A;  3D4R A;  5DLQ E;  1YEZ A;  1RJT A;  3MZ5 A;  2CW7 A;  2KHS A;  4ZQ3 A;  1K28 A;  2RDF A;  3SR1 A;  2NVX B;  2BA0 A;  1SFO A;  1X32 A;  4WJW A;  1WH2 A;  3HKZ E;  2R86 A;  1NMG A;  5LOV F;  2Q8R E;  1YI2 A;  2FMA A;  4C3H H;  4X64 L;  4RB2 C;  1HR0 W;  1N8R C;  4C3I B;  3MXG A;  4HID A;  5KT5 A;  4NMZ A;  4X65 L;  3WOF A;  1GO3 E;  2DUD A;  1FD7 D;  4WJ4 A;  3T4A C;  4K6L A;  3MXP A;  4RHR A;  4A3K G;  3JC6 6;  1WTH A;  2VUM H;  2DGY A;  2YYZ A;  1AE2 A;  3CRK C;  4IUV A;  1E4E B;  4RZQ A;  3H20 A;  3BQ2 A;  1D1K A;  1Y1V G;  3CF5 A;  1JDE A;  2WIN B;  4E6I A;  2VR1 A;  1T36 A;  3OUZ A;  3MFY A;  5C4J H;  4A3B G;  1HA5 A;  4QJF A;  3RBE A;  5LXT F;  4PMW A;  2FMM A;  1VQ5 A;  5KFM A;  3RLF A;  3M3Y B;  1E0B A;  1YNN C;  2FE3 A;  2NTT A;  2OEO A;  1SYC A;  3X3M A;  5JVL A;  3AQQ A;  4L8J A;  2QF7 A;  4EFE A;  4MTK A;  5ELN A;  2YRX A;  1OXX K;  2XN9 C;  2R6F A;  2JK8 A;  4YY3 H;  1LO5 D;  2OLS A;  3EVQ A;  1IBL L;  2IHE A;  4XX0 B;  4JV5 L;  1B3Q A;  1C48 A;  1YHA A;  1VQL A;  5EOY A;  4DV1 Q;  2NN6 G;  3ONA B;  4C3H G;  2J7Z A;  3PW4 A;  4LJZ C;  5IGG A;  5IT9 W;  1N32 L;  3I4M B;  2FIN B;  2K04 A;  1X9N A;  3GID A;  2F0S A;  1X3E A;  3WOE A;  1HQR D;  2KCM A;  1I4H A;  3D31 A;  1A6X A;  1I50 A;  1SFO H;  4DL2 A;  4MV6 A;  3RBD A;  1ENA A;  1IBL H;  5I2X A;  1K83 A;  1JR0 D;  1UEB A;  1PRT D;  4L1K A;  2MQH A;  3SI8 A;  3ETH A;  5E7N A;  5LMU H;  2I46 A;  5FJ8 G;  5M3M B;  1YNJ D;  3U9O A;  3I12 A;  1I5F A;  4A3D G;  1XNQ Q;  1WCM G;  3JRW A;  3V6K A;  1PH9 A;  4LF4 L;  4LF8 L;  2E76 C;  1WCM A;  3R5F A;  4JI0 H;  1DON A;  1TWC A;  1JMC A;  4A3J H;  2QGQ A;  5CYU A;  5KFZ A;  1PTO F;  2I87 A;  2YTX A;  2A6H C;  4JV1 A;  3EPI A;  3CRL C;  2WB1 G;  3FMC A;  4DUY Q;  1B04 A;  3T53 B;  2JEA I;  5M3F B;  1HNX Q;  4LF4 H;  4DXG A;  1CT1 D;  4A3I H;  3ERQ A;  4YWK A;  4DK0 A;  5FLX L;  5GAH C;  1SFO B;  2BQR A;  1MGS A;  4CDC C;  2F0N A;  2LMC B;  4K8J A;  4FF3 A;  4FU0 A;  4WOR A;  3R8B A;  2R8J A;  3J81 j;  2OF1 A;  2K5W A;  3H6M A;  1MJC A;  3RB3 A;  4DAV A;  3R2I A;  1PX2 A;  2ZDH A;  3RB0 A;  1PRT F;  3MAQ A;  3U9T A;  4ZKB B;  2M2L A;  4GNX A;  2D2C C;  1A63 A;  3PUZ A;  4RNM A;  4O4I F;  3S17 H;  3J80 c;  1BGW A;  4I7H A;  1PH8 A;  1S0M A;  4IAJ A;  1VQ4 A;  5KG7 A;  1KQS A;  1B7Y B;  1GUG A;  4DK3 C;  5KFX A;  3Q8R B;  3Q8D A;  3B6Y A;  3KJP A;  2ID0 A;  2UXB H;  1TS2 A;  4XQN A;  1RJQ A;  4LFB H;  3HOW B;  4WRD A;  3AYH B;  1Y1V B;  1CQF A;  1CZW A;  2E8G A;  4C5A A;  4JI1 Q;  2YW2 A;  2AUK A;  4UP9 A;  4CKE A;  4IFD I;  5KT6 A;  1NBW A;  3NTH A;  3GLK A;  4HQ6 A;  4CBV A;  3H94 A;  1EEF D;  3H4B A;  2ZM6 L;  4OWW B;  4R4O A;  1VQ6 A;  4QCL A;  4ED6 A;  4M1U B;  3G6Y A;  3LWB A;  2FMC A;  1XPR A;  5CV6 A;  1MZB A;  4YR3 A;  4EQ5 A;  1H9S A;  1HNZ Q;  1A62 A;  1PH3 A;  3HOV G;  1S0N A;  5IE8 A;  1ZEQ X;  5GAE C;  1JWU D;  5M5Y B;  2FPG B;  5DG9 A;  4JI7 L;  2RQX A;  2M05 A;  4RNN A;  5KX5 F;  4QW9 A;  1SNM A;  4KLK A;  3JRX A;  4GKJ Q;  1EOV A;  1EHI A;  5KFL A;  2VUM B;  2ALZ A;  1NCV A;  3BYY B;  1C7Y A;  1SMY C;  4EQO A;  1TT2 A;  1TWC H;  3HOW H;  1RHP A;  1I6V C;  2F1M A;  4J9R A;  1RYS A;  1R4Q B;  1E24 A;  3CHB D;  4GKJ L;  1SYB A;  2CQY A;  3GTQ H;  1EIG A;  4C3H B;  4RB3 C;  1TWH A;  3KAL A;  4H7B A;  1KC8 C;  2PZW A;  4CJ1 B;  3A56 A;  5FJ8 H;  2O5J C;  4F4Z A;  4OWX B;  3K57 A;  1B4O A;  1EFI D;  3T16 A;  3G71 A;  4O3S A;  2WAQ B;  4LFC L;  2W6N A;  4AYB A;  2PO4 A;  3MTS A;  3M9O B;  2HHH L;  2VUG A;  3L2P A;  1S5B D;  2YU9 A;  1YNN D;  2OTJ A;  3E5N A;  4G3I A;  4R4C A;  4ME5 A;  1WCM B;  1BCP C;  5EGT A;  4EBC A;  4OX9 H;  3GV6 A;  5I4D A;  4KN4 C;  2VW9 A;  3ORQ A;  4ZQI A;  3I8Z A;  1Y8P B;  3VPD A;  3FEW X;  3MWM A;  2AUJ D;  1Q7Y C;  1OO9 B;  3EA6 A;  2UUB H;  3J81 c;  3EIV A;  2A8V A;  3D6W A;  4R7R A;  1SLJ A;  2QEX A;  3KF8 A;  4DR4 L;  4ECU A;  2UUB Q;  1RTN A;  1D2B A;  1TAE A;  2WB1 B;  5DM6 3;  1LTS D;  2JEB I;  1HR0 L;  2E2J B;  3HP3 A;  2A6E D;  3S14 H;  2KOL A;  3H0G A;  1KBL A;  2L55 A;  1YIT A;  5M3F H;  3HGB A;  4DR6 L;  3GV3 A;  1XYI A;  2J4X A;  1Z2P X;  4RA8 A;  2JA5 H;  3EPG A;  2E2I H;  2UXB L;  1H9J A;  1DOM A;  2B8F A;  2PMZ B;  3HKZ A;  2R8H A;  2NVX A;  4BXX H;  2ZDG A;  2K6A A;  4J9O A;  4C56 C;  3GTL H;  5IGF A;  1EWH A;  4A3J B;  3BU2 A;  3A8K E;  3L4K A;  3I4M H;  1JE5 A;  1Q8K A;  3PUV A;  2ZJP A;  4B3S Q;  3I4N G;  4DV3 H;  4DLK A;  4KTA A;  5KFJ A;  2HQE A;  2BE5 D;  3NBI A;  4C2M A;  5KFH A;  5AJ3 L;  4Q45 A;  1F2Y A;  1G6P A;  3GQC A;  3GIJ A;  3PIO 3;  3HOW G;  1HPC A;  2D62 A;  4JI7 H;  1BCP B;  1PFS A;  1GHK A;  3GTK B;  5FOB B;  2B3G A;  1S72 A;  2W7O A;  1C4Q A;  1TA8 A;  2ZXP A;  2UUA Q;  5E1F A;  4JI3 Q;  1Q82 C;  1H9S B;  4LUV A;  3SXH A;  1Q8I A;  4EQP A;  3GTP B;  4Q8F A;  3RZD H;  1J5E L;  3A0J A;  4N9T A;  2W57 A;  1JX4 A;  3OW2 A;  1XMO Q;  4J1M A;  2K14 A;  1ZHS A;  3L0O A;  3GTM H;  2BOS A;  5C4J B;  3J7A K;  4M7E A;  2Z6K C;  3S1Q B;  4ULL A;  4LFA L;  4QWE A;  5K36 G;  3E0J A;  3C1F A;  2Q2U A;  5TSS A;  4GN5 A;  2EZV A;  3TSS A;  4A75 A;  1T5X D;  5EDW A;  1EUD B;  2FLL A;  5KFG A;  2D0P A;  3PGZ A;  2CQA A;  2AMC B;  4B3M Q;  4EBE A;  1XXG A;  2DY8 A;  1BXR A;  4RZR A;  5JJL A;  4LAA A;  5KFF A;  4B3T L;  3M4Y A;  3TZU A;  3HEJ A;  4R9W A;  5JVH 3;  5CA1 F;  4QUC A;  4LF9 L;  2DPJ A;  1T9H A;  1ZYR C;  2QA4 A;  5FO8 B;  1BDO A;  1BCP D;  2QIL A;  2F0F A;  2YYA A;  1PTO B;  4DUY H;  1U0L A;  2A1A A;  3OSP A;  4IWY A;  5KFE A;  4ED1 A;  2RGR A;  2YL2 A;  3KF8 B;  4GC6 A;  2NVY A;  5J2T F;  4JG2 A;  4LW1 A;  1Q1E A;  4FXG C;  3MWD A;  3EQL C;  1K8A C;  1QUQ A;  4LF5 Q;  1PH4 A;  5C8Y F;  3UQ8 A;  3HOX G;  3D0F A;  4A3E H;  3VR5 A;  1YJN A;  1L0Y B;  4R8U A;  2EYO A;  1A3U A;  1L0X B;  4CC5 A;  3RZO B;  4KK7 A;  5EWF A;  4YR0 A;  3MFI A;  5EKL A;  2RDJ A;  3RB6 A;  1VQJ A;  5BR8 H;  1LTL A;  2UXB Q;  1EU3 A;  3DMU A;  4I7A A;  3W5O A;  3OTO H;  4XXE A;  1IW7 D;  1EYG A;  1G2S A;  2J0T D;  2AGP A;  2B63 B;  4J6H A;  5EBC A;  4A3J G;  3VA5 A;  1EZ6 A;  2E5L H;  2O4X A;  3F2D A;  3BG5 A;  2CHB D;  4UDU C;  1GLV A;  1JOK A;  3QR8 A;  2E2H A;  2VQE Q;  1YNJ C;  1MKH A;  4GKK H;  1LM0 A;  4DR4 Q;  3OTO Q;  3PO3 H;  1SYD A;  4C5B A;  4LF5 H;  2ZTD A;  3OSO A;  4DNR B;  3VPB A;  4J9M A;  1A2U A;  3GTK A;  2WKC A;  4LF8 Q;  4LF4 Q;  1VQB A;  2AKW B;  3KDF A;  2MGS A;  4DR1 Q;  2E5L L;  4NPS A;  1FNV A;  1CTM A;  3FPP A;  4PWQ A;  2LXJ A;  2K28 A;  5KFS A;  1CKN B;  2FJ2 A;  4OWT B;  3VPC A;  3GTP A;  2JP1 A;  1UE5 A;  2JEI A;  4F8M A;  1VQH A;  2NN6 H;  5L37 A;  3Q22 A;  5I47 A;  4JI6 H;  1MSH A;  4C3J H;  2EIF A;  4K8I A;  1VMC A; 
#chains in the Genus database with same CATH homology
 4HIO A;  4A3B H;  4YCW A;  3BZC A;  5JJI A;  3I4O A;  2IT1 A;  3S1R H;  4BY1 H;  1WYD A;  4DV1 L;  3CCL A;  4DR2 Q;  5C0X J;  2D0O A;  2GVB A;  2HIV A;  4RMF A;  1PH5 A;  4OX9 L;  4DV2 L;  2K52 A;  4EX5 A;  1LYL A;  2A19 A;  3UE1 A;  5M5X H;  4IOC A;  5C44 G;  1CSQ A;  1IBK L;  4JBM A;  3PV0 A;  3FP9 A;  1C0A A;  4A3K H;  3OYY A;  5M3M H;  5HY6 A;  1YZ6 A;  1EQQ A;  4BBS H;  3I56 A;  4IOA A;  2R6G A;  4DV0 Q;  4GLX A;  4A3E G;  4MTN A;  2IX1 A;  2VZA A;  4X66 Q;  2NZH A;  1UE6 A;  4GOP A;  3GTG H;  1PV4 A;  4GOP C;  4A3F G;  1KRT A;  3RN2 A;  2JA6 G;  2YTY A;  1XNR L;  2MO0 A;  2NVX H;  2Q2T A;  1GVP A;  2R7D A;  4GKK Q;  2VNU D;  1N36 Q;  4IPG A;  1CKM A;  4LF6 L;  2CKZ B;  2C35 B;  2LXK A;  4JBK A;  2VQF Q;  3TRZ A;  4A3L H;  3H0G G;  2E2J H;  1FJG L;  1E1O A;  2FXQ A;  3HOX H;  1VQF A;  4A3D H;  3RR5 A;  1AH9 A;  4OO1 I;  2VS1 A;  3KF6 B;  4DR6 Q;  2I0Q A;  1CSP A;  2Q2I A;  2N3S A;  2AHO B;  4OON A;  3G48 A;  3F2B A;  1Y1W H;  1IBM Q;  3S16 H;  3CXC A;  1EIF A;  2MO1 A;  3STB C;  5BR8 Q;  3OTO L;  4P71 A;  1X55 A;  4A3G H;  1FVI A;  1HR0 Q;  1QVF A;  3HOZ G;  1X54 A;  3U4Z A;  2VQE L;  3K80 C;  1QZH A;  4X65 Q;  4HJ5 A;  5IYC H;  1IYJ B;  1Z47 A;  5IP9 G;  3K8A A;  5C3E G;  2ZTE A;  2AWO A;  1NTG A;  2ZM6 Q;  3U4V A;  2IY5 B;  1KXL A;  1RIP A;  3AFQ A;  5IT9 c;  2OQ0 A;  4YCU A;  1VQ7 A;  1A0I A;  1P8L A;  1VQE A;  3PF5 A;  1HJP A;  3IRB A;  4RG1 A;  5DLQ E;  5LMU L;  1YEZ A;  4UY8 C;  2ZJQ A;  1YBY A;  4B3M L;  2R7Z G;  4DPG A;  5IYC G;  2BA0 A;  3EBE A;  4JI8 L;  4JYA Q;  2KHI A;  3HKS A;  4DV6 Q;  4JOI A;  3KJO A;  4HJA A;  2UU9 L;  3HKZ E;  1N33 L;  1EUJ A;  3K7A H;  1NMG A;  2NVQ H;  1E1T A;  5M5Y H;  1YI2 A;  1VQD A;  3FHW A;  3CW2 C;  4C3H H;  4X64 L;  3KOJ A;  1I3Q H;  1HR0 W;  4ALP A;  2UUB L;  1N8R C;  1NJI C;  1TWH H;  1U5K A;  4HID A;  1K0R A;  4JI5 Q;  2JA7 H;  4X65 L;  3ICE A;  1DGS A;  4DV5 Q;  3PO2 H;  1GO3 E;  2DUD A;  4L5S A;  3S15 H;  4WJ4 A;  4A3K G;  3JC6 6;  4BY7 G;  2XGT A;  1JB7 A;  5FLM H;  2E2H H;  4JI4 Q;  2VUM H;  1J6Q A;  2KEN A;  2DGY A;  2YYZ A;  1AE2 A;  3KDF B;  1VQA A;  4GS3 A;  4OXP A;  1YNX A;  2I5M X;  3HKZ G;  1Y1V G;  3CF5 A;  4R4I A;  3CC7 A;  2NZO A;  1MJE A;  1HNX L;  4P75 A;  5C4J H;  2VQF L;  3PIP A;  4A3B G;  4AH6 A;  4QJF A;  2HQL A;  1A8V A;  4PMW A;  5FLM G;  2WP8 J;  1N36 L;  3RLF A;  1VQ5 A;  3CPF A;  4Y7N H;  3E9H A;  4HJ9 A;  3NBH B;  3I4M G;  1KAW A;  4IPC A;  3PO2 G;  3CME A;  3SGI A;  3AQQ A;  2K5N A;  4YCV A;  4DV0 L;  1EFW A;  5ELN A;  2K5H A;  1OXX K;  3FKI G;  4BXX G;  2JK8 A;  3PIO A;  1Q86 C;  4BA1 I;  4AYB G;  3M9B A;  3ULL A;  1M1K C;  4DUZ L;  2OTL A;  1IBL L;  1X56 A;  2PQA B;  2IHE A;  4A3G G;  4GN3 B;  3J7A 5;  4JV5 L;  2ZJR A;  1VQK A;  1SE8 A;  3I4N H;  1WCM H;  1D8L A;  4TQU S;  1YHA A;  1VQL A;  1OXT A;  4DV1 Q;  2NN6 G;  1JT8 A;  4KHZ A;  1VQC A;  4JI7 Q;  3PUW A;  5JEA G;  3GTJ H;  1K73 C;  3J80 i;  3G4S A;  1XMO L;  1BBU A;  2UUC L;  5IY0 A;  1N32 L;  2JE6 I;  1K8G A;  3GTO H;  2K50 A;  1X9N A;  1VS0 A;  1XPU A;  4YY3 L;  1X3E A;  3K81 C;  3CD6 A;  1N32 Q;  3I7F A;  2KCM A;  3D31 A;  2EQS A;  2JQO A;  4APV A;  1SFO H;  1TWG H;  1S3O A;  1Y1W G;  2R7Z H;  2UUA L;  1YVC A;  3GO5 A;  1UEB A;  4LWC A;  1PH1 A;  2MQH A;  5IP7 H;  5E7N A;  5M3F G;  5FJ8 G;  4JI1 L;  4P73 A;  4A3I G;  2PNH A;  4JYA L;  1I5F A;  2B29 A;  4DR1 L;  3CCU A;  1EQR A;  1QZG A;  1XNQ Q;  1WCM G;  4A3D G;  3KLW A;  1PH9 A;  4A3L G;  4LF4 L;  3U58 A;  4LF8 L;  5GRO A;  2UXD Q;  4HIM A;  3CQZ H;  3CC4 A;  1JMC A;  2F3I A;  4A3J H;  4LUO A;  4L5T A;  1G51 A;  2QGQ A;  4B3S L;  2XTI A;  4IFD J;  4A3F H;  1Q1B A;  2PI2 A;  2YTX A;  4DR3 L;  1A63 A;  2H5X A;  1TWA H;  5HGQ A;  1N34 Q;  2WB1 G;  4DR5 Q;  5LMN L;  1R9T H;  4DUY Q;  5IYD G;  1KRS A;  4LFB Q;  3BZK A;  2JEA I;  1HNX Q;  2WFW A;  4AQY Q;  5M3M G;  3RNU A;  3CPW A;  4A3I H;  4YWK A;  4DV6 L;  3U50 C;  5GAH C;  2UU9 Q;  1OXU A;  1YHB A;  5IP7 G;  1I50 H;  4AQY L;  4BY1 G;  1C9O A;  3ULJ A;  3H3V I;  4DAM A;  3J81 j;  3DLL A;  1MJC A;  4B3R L;  1JJC B;  4BBS G;  2ALY B;  4DV5 L;  4JI6 L;  3HOY G;  1E22 A;  2F52 A;  2JA5 G;  1HNW Q;  4GNX A;  1L0W A;  4YY3 Q;  4DV7 Q;  3PUZ A;  2I5L X;  4PG3 A;  4IO9 A;  3NEM A;  1PH7 A;  3HOV H;  3S17 H;  3J80 c;  3ZJY C;  4JI6 Q;  3H15 A;  3UE0 A;  1PH8 A;  2Z6K A;  5IYB H;  1VQ4 A;  1X3F A;  1SRO A;  2RHS B;  1KQS A;  1B7Y B;  4DK3 C;  3PO3 G;  4IPD A;  1N33 Q;  3Q8D A;  1D7Q A;  2UXD L;  3B6Y A;  1IBM L;  3KJP A;  2ID0 A;  4DKA C;  4LNQ A;  4QY7 A;  3CMA A;  3AYH B;  1L1O C;  2ES2 A;  2CQO A;  2E8G A;  1K9M C;  4A93 H;  1I94 Q;  4JI1 Q;  2JA9 A;  2PMZ E;  4QL5 A;  4GNX C;  4UP9 A;  1FJG Q;  4IFD I;  1NBW A;  2K75 A;  3UDG A;  1XPO A;  2HHH Q;  1Z9F A;  2ZM6 L;  4R4O A;  4OWW B;  4DR5 L;  2CCZ A;  1VQ6 A;  1CKN A;  4NB3 A;  1XPR A;  4C3I H;  1GKH A;  4EQ5 A;  1HNZ Q;  1A62 A;  3A5U A;  4DV4 L;  1PH3 A;  3KFU A;  1XNR Q;  3S1N H;  3HOV G;  1V9P A;  5IE8 A;  5GAE C;  4JI7 L;  4O2D A;  2WAQ G;  4JI2 Q;  2VY3 A;  2RF4 A;  4IJL A;  1HZ9 A;  1YJ9 A;  2JA8 H;  1G29 1;  1HZC A;  2JJQ A;  2HIX A;  4KLK A;  4P74 A;  1EOV A;  4QIW E;  4GKJ Q;  5C4X H;  2JA6 H;  1UE7 A;  1C7Y A;  1OXS C;  1JJG A;  3CP0 A;  1QVC A;  1TWC H;  1M90 C;  1TXY A;  1IBL Q;  2NVT H;  2N8N A;  3HOW H;  1PHJ A;  1E24 A;  4OX9 Q;  4GKJ L;  3GTQ H;  2F4V Q;  1IXR A;  1CKO A;  1B70 B;  3HOY H;  4JOI C;  4A4I A;  4JI2 L;  1KC8 C;  4BA2 I;  1NY4 A;  3T1H L;  3PSI A;  2YU9 H;  5FJ8 H;  4OWX B;  1WI5 A;  2Y0S E;  4R4Q A;  1HNZ L;  4GOP B;  1WJJ A;  2GN5 A;  3G71 A;  2UUC Q;  4X64 Q;  3HOU G;  1QUQ B;  1RL2 A;  4LFC L;  3TEH B;  1H95 A;  2Q2H A;  2HHH L;  2R7F A;  3L2P A;  2VUM G;  2PQA A;  3ULP A;  4J15 A;  4PZ8 A;  1IBK Q;  2RHQ B;  2HT1 A;  1I94 L;  2OTJ A;  1X3G A;  2E5L Q;  3KF6 A;  4R4C A;  4DUZ Q;  2JA7 G;  3UDF A;  1VQG A;  2K5V A;  3S2D H;  4YWM A;  4X62 Q;  2VW9 A;  4PZ6 A;  4A3M H;  5JJK A;  3JAM i;  1ASY A;  1VQ8 A;  1IZ6 A;  1CUK A;  5AJ3 Q;  1Q7Y C;  4IFD G;  5IWA Q;  3GD7 A;  2R93 G;  2Y0S G;  3TS0 A;  3J81 c;  3EIV A;  3UDX A;  2A8V A;  1SMX A;  4UP7 A;  1SLJ A;  4JI5 L;  5FLX c;  2QEX A;  4LF7 Q;  3UDI A;  2R92 H;  3CC2 A;  2UUB Q;  1BBW A;  4DR4 L;  1P16 A;  4DR7 L;  2R93 H;  1WOC A;  4HJ7 A;  2N49 A;  4B3R Q;  2JEB I;  3CCE A;  1HR0 L;  3A74 A;  1PA6 A;  1KIX A;  3S14 H;  2KBN A;  3PCO B;  4PZ7 A;  3F2C A;  1OXV A;  5C0X G;  1YIT A;  4JC0 A;  5M3F H;  4KI0 A;  4HJ8 A;  1PH6 A;  4NXM L;  1W3S A;  4GN4 B;  5M5W H;  4DR6 L;  4QQB X;  4YWL A;  4DK6 C;  2JA5 H;  1L1O A;  1XNQ L;  1NE3 A;  5IP9 H;  1K83 H;  2L15 A;  3RLO A;  2E2I H;  4POG A;  3TRE A;  1VQN A;  2UXB L;  1HH2 P;  2Z0S A;  2GVA A;  1HZA A;  4NXM Q;  4LFB L;  4BXX H;  4DUY L;  2OCE A;  2IX0 A;  2BA1 A;  3I55 A;  5LMN Q;  3GTL H;  3GDE A;  1N34 L;  3M7N A;  3DM3 A;  5EAY A;  3BU2 A;  4L5R C;  1SN8 A;  4POF A;  4YHH L;  3I4M H;  1VQI A;  3E9I A;  1JE5 A;  3L7Z C;  3W1B A;  4C2M H;  3CCV A;  1YIJ A;  1FGU A;  1Q8K A;  3PUV A;  2ZJP A;  4B3S Q;  3I4N G;  2CFM A;  3H3V H;  4X6A H;  4MZ9 A;  3F1Z A;  5AJ3 L;  1SRU A;  4IPH A;  1G6P A;  2MFI A;  3HOW G;  4JI8 Q;  4BBR H;  2D62 A;  3STB D;  3HFZ B;  1JJ2 A;  1Y1V H;  4DNI A;  1PFS A;  1Q46 A;  2CWA A;  3TQY A;  5LMU Q;  1PH2 A;  4JCV E;  2B3G A;  2PI2 E;  1Y14 B;  3WWV A;  1S72 A;  4UPA A;  5C0X I;  5J3B A;  4NXN L;  4BY7 H;  2UUA Q;  3JAM c;  4GKK L;  4B3T Q;  4JI3 Q;  2ZTC A;  1Q82 C;  1E7Z A;  4GNX B;  4LUV A;  5LMN W;  3TS2 A;  4XIG S;  3CAM A;  4LFC Q;  3S24 A;  2YV5 A;  3RZD H;  3K0X A;  1WFQ A;  1J5E L;  3A0J A;  4JBW A;  4ME3 A;  4O0A A;  4A76 A;  2N78 A;  3F8T A;  2BH8 A;  3CCS A;  1XTD A;  3OW2 A;  1L2F A;  1VCI A;  1XMO Q;  2RCN A;  1KD1 C;  2K14 A;  2WAQ E;  2NN6 I;  3L0O A;  3GTM H;  2UXC L;  1S40 A;  2Z6K C;  4BBR G;  4NXN Q;  1ASZ A;  2AWN A;  2R92 G;  3GTK H;  2KHJ A;  4JV5 Q;  4OO1 G;  4LFA L;  4DV2 Q;  1O7I A;  3M4Q A;  4JI0 L;  4JI0 Q;  5K36 G;  3PF4 A;  1XMQ L;  1KHI A;  4TVA B;  4A3C G;  2Q2U A;  4LF6 Q;  4GN5 A;  2VL6 A;  4A75 A;  4R4T A;  5JEA J;  1KL9 A;  4MNO A;  1X6O A;  2D0P A;  1PVO A;  3PGZ A;  2KCT A;  4KHP L;  1NMF A;  2AMC B;  4B3M Q;  2WB1 E;  3HOZ H;  3I2Z A;  1EWI A;  1VQ9 A;  3NEN A;  2OWO A;  5JJL A;  4GLV B;  3ER0 A;  2I5H A;  2IHF A;  1N9W A;  4JI3 L;  4B3T L;  1UE1 A;  5ELO A;  3BJU A;  4UP8 A;  4QGU A;  3RZO H;  4LF9 L;  1SR3 A;  4LFA Q;  1T9H A;  3H0G H;  2QA4 A;  3AEV A;  3CCR A;  4DR2 L;  5IYD H;  5GQO A;  2OQK A;  1U0L A;  1PYS B;  2A1A A;  3AFP A;  1YHQ A;  1I6H H;  4JI4 L;  1VQP A;  3S2H H;  1B8A A;  5C44 H;  3VDY A;  2YTV A;  1W2B A;  2UXC Q;  4K0K L;  3KF8 B;  2NVY H;  3FKI H;  4JG2 A;  4LW1 A;  1Q1E A;  1J5E Q;  1LUZ A;  3MEF A;  2MNA A;  1QUQ A;  4DV3 L;  3RN5 A;  3CCM A;  4A3M G;  4DV7 L;  1K8A C;  4LF5 Q;  4IJH A;  1V1Q A;  4DR7 Q;  3PUX A;  2V1C C;  1PH4 A;  4GLA C;  3HOX G;  3D0F A;  4A3E H;  1YJN A;  5IWA L;  2ATW A;  4Y52 H;  4K0K Q;  4R1J A;  1YJW A;  1VQJ A;  2CWP A;  3MXN B;  1E3P A;  1OTC A;  2BH2 A;  1LTL A;  3M85 A;  3G6E A;  2UXB Q;  3GTP H;  4XTC S;  3W5O A;  1HNW L;  5H1S E;  1Q81 C;  1GM5 A;  3RLN A;  5GAG C;  3HOU H;  1EYG A;  3J81 i;  4HIK A;  2B63 H;  3PUY A;  1BKB A;  4DAY B;  4AYB E;  3M4O H;  4A3J G;  4JBJ A;  3S1Q H;  1V43 A;  5GAD C;  2K4K A;  1AE3 A;  3F2D A;  3K7U C;  4AIM A;  1Q12 A;  4DV3 Q;  1VQO A;  2LSS A;  3T1Y Q;  4P72 A;  4DR3 Q;  3KYH C;  4YHH Q;  3T1Y L;  2VQE Q;  1MKH A;  1LM0 A;  2EXD A;  4DR4 Q;  4KHP Q;  3CCQ A;  4FDB A;  5BR8 L;  1X65 A;  3OTO Q;  3PO3 H;  3T1H Q;  2ZTD A;  4LUZ A;  5C3E H;  4WJ3 M;  4DV4 Q;  5C4X G;  1FL0 A;  2F4V L;  1L1O B;  4X62 L;  4LF8 Q;  4LF4 Q;  2JA8 G;  1XMQ Q;  1VQB A;  4A93 G;  2AKW B;  3KDF A;  3A5Z B;  1K3R A;  4DR1 Q;  1VQM A;  2E5L L;  4NPS A;  4LF9 Q;  1IL2 A;  3LGJ A;  1EIY B;  1QVG A;  4H02 A;  2B63 G;  2ASB A;  2LXJ A;  3EN2 A;  3W1G A;  1CKN B;  4OWT B;  1MIU A;  3E0E A;  1UE5 A;  5IYB G;  3M3Y H;  1XJV A;  3M4P A;  1VQH A;  4LF5 L;  3CCJ A;  1TWF H;  4A3C H;  1PYB A;  1GD7 A;  1BVS A;  4LF7 L;  1UWV A;  3NEL A;  1HZB A;  4L5Q A;  4X66 L;  2EIF A;  4C3J H;  3S1M H;  3ERS X;  3J7Z C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...