4BXXG

Arrested rna polymerase ii-bye1 complex
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
171
structure length
171
Chain Sequence
b'MFFIKDLSLNITLHPSFFGPRMKQYLKTKLLEEVEGSCTGKFGYILCVLDYDNIDIQRGRILPTDGSAEFNVKYRAVVFKPFKGEVVDGTVVSCSQHGFEVQVGPMKVFVTKHLMPQDLTFNAGSNPPSYQSSEDVITIKSRIRVKIEGCISQVSSIHAIGSIKEDYLGAI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
publication title Structures of RNA Polymerase II Complexes with Bye1, a Chromatin-Binding Phf3/Dido1 Homologue
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
total genus 29
structure length 171
sequence length 171
ec nomenclature
pdb deposition date 2013-07-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00575 S1 S1 RNA binding domain
G PF03876 SHS2_Rpb7-N SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4bxxG02
3.30.1490.120 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 RNA polymerase Rpb7-like, N-terminal domain 4bxxG01
3DLLA 2JA7G 2A1AA 4P75A 3AYHB 4JI2Q 3RN5A 4BA1I 1VQFA 1R9TH 4X62Q 3GTPH 4YWKA 4X66Q 3NELA 2FXQA 5H1SE 2WB1G 2R6GA 4DV3Q 1N34L 1SR3A 4JBKA 1Q1EA 4O0AA 1U5KA 4DR1Q 5J3BA 4HIKA 2H5XA 2ASBA 2E2IH 3S2DH 2YTXA 5HGQA 4L5SA 1E22A 4A3GG 5LMUQ 3I4MH 2IHEA 4PMWA 1PH5A 4JI0L 2KCTA 1I50H 5GAGC 1PH9A 4YHHQ 3U50C 3HKZE 3CCMA 2PNHA 4DR3Q 1HNZQ 1Q12A 3S1NH 3BZKA 2E2JH 2WB1E 3CQZH 4JC0A 3PUVA 3MXNB 1A62A 1Y1WH 4P73A 1G51A 2ATWA 1LUZA 3F2CA 4DV6L 1HZAA 4C3HH 3L2PA 3MEFA 3S24A 2GVAA 4HJ8A 1JMCA 1NBWA 2RF4A 3NBHB 1AE3A 5C0XJ 1XNQQ 3S14H 4AH6A 4HJAA 4A3KG 3TQYA 3I4NG 2ZJPA 1B8AA 1SROA 5C4XH 4NXNL 2VW9A 3RNUA 3HOZH 1FGUA 4X66L 3GDEA 4ME3A 4BY1G 3CC7A 1KL9A 1GD7A 2PI2E 3L7ZC 4MNOA 2Z6KA 4DV3L 3KFUA 2A19A 3WWVA 2UUCL 4JYAQ 3PUWA 1VQEA 2XTIA 2N3SA 4DR1L 4LFCQ 1N36L 5GAEC 2AMCB 2I5LX 3J81i 4PZ7A 1E1TA 4B3RL 2AHOB 2B63G 3AFQA 3JAMi 1N33Q 1K8AC 3ICEA 4YCUA 4DUZQ 2ALYB 2HIXA 4OWTB 1C7YA 1KRSA 3IRBA 1N9WA 5DLQE 3KF8B 2CCZA 4A3BH 4A3DG 1CUKA 2GN5A 4RMFA 3M4QA 4DR3L 1KRTA 3TEHB 1PH3A 1HNZL 3OW2A 4R4TA 4POGA 4JCVE 5FLMH 4BBSH 4R4CA 3D0FA 4Y7NH 2ES2A 1XNRQ 2F4VL 2IY5B 1NJIC 1JE5A 2K5VA 1PA6A 5M3FG 2JA8H 2Q2HA 4NXML 3PO3G 2HIVA 1LM0A 1IXRA 3EBEA 2HT1A 4LFAL 4JI1L 3T1YQ 1X65A 5HY6A 3CXCA 2JA5H 1BBWA 1WJJA 4A3EG 4B3TQ 4LFBQ 1HNWL 2PI2A 1L1OA 2PMZE 1A8VA 1EIFA 3W5OA 3AEVA 3PCOB 2GVBA 1S72A 2AWOA 1L2FA 1E24A 2JEBI 2DGYA 3SGIA 5C44G 4HIDA 3GTLH 2R93H 1YHBA 1JT8A 1IBMQ 4TVAB 1A0IA 5JJLA 5M5XH 4HIMA 4DAYB 4A4IA 4LFCL 3W1GA 5IYBH 3KYHC 3CMAA 4EX5A 1IBLL 1VQGA 5GAHC 4DUYQ 4A3JH 1SFOH 2VL6A 1VQDA 2BA1A 2D0PA 4P71A 3PIOA 1KD1C 3RZDH 4OO1G 5M5YH 2ID0A 2Z6KC 4DUZL 1LYLA 4L5TA 4YY3Q 1GM5A 4GNXA 1KXLA 1VQ7A 1TWAH 2UUAL 2UUBQ 1PH2A 3G71A 4DR5Q 2CWPA 1UE6A 2JJQA 4YCVA 1EQQA 4NB3A 1B70B 2ZTCA 5JEAJ 4DAMA 4JI3Q 3J80i 3EN2A 3TS0A 4JV5Q 2I5MX 1XNRL 1UE5A 4JI7Q 4IJLA 1XPRA 1KHIA 4OO1I 4LF7L 5C0XI 5K36G 3H3VI 3GO5A 2IT1A 3KDFA 4KI0A 4LF9Q 4BXXG 2UXCL 3PSIA 1HZ9A 1WOCA 3T1YL 1VQ4A 5BR8L 1W2BA 2MO0A 4HIOA 3JC66 2B3GA 4UP9A 5M3FH 3T1HQ 2MFIA 4DR2L 2UU9Q 4IOCA 4A3LG 1PH7A 2R92G 1FVIA 1SLJA 4DR4Q 3K7AH 2R7FA 4AYBE 1HR0Q 3B6YA 1YZ6A 1N8RC 4BBRG 1IYJB 2RHSB 1L1OC 5IP7H 4DV2Q 2R7ZG 3GTQH 3ERSX 1IBKQ 2BH2A 3HKZG 4DV7L 1SRUA 4PG3A 1CSPA 1WYDA 3CMEA 4B3SQ 4GS3A 1Q7YC 4Y52H 1VQAA 2K14A 4DK6C 4YY3L 2CKZB 1XMQQ 5AJ3Q 1C9OA 1YIJA 1LTLA 2E5LL 3HOVG 4POFA 3NEMA 4GNXB 3HOXG 1CKOA 2OTJA 2MQHA 4JI3L 2YTYA 5E7NA 4A3FH 4JI4L 3E0EA 4JV5L 1K83H 4A93G 2HHHQ 4KHZA 4JI6Q 1HZBA 1FJGL 1E3PA 4GNXC 4IFDI 3BU2A 1V43A 4DK3C 5JJKA 1RL2A 2F52A 3STBD 3S17H 3F8TA 5IT9c 4GN5A 5IYCG 4LF8L 3M85A 1YVCA 2Y0SE 4C3JH 4K0KQ 2K4KA 1Q86C 3CCEA 4OWWB 3LGJA 1Y1VH 3KDFB 4XIGS 1G291 1GVPA 2JA6G 3OTOL 3T1HL 4JI8Q 5FJ8H 2KBNA 5IP9H 1Q81C 4DV0Q 4GOPA 2DUDA 2EXDA 5ELOA 4UP8A 2VQEL 2I0QA 2C35B 3CCJA 3TREA 3PUYA 1YJWA 3UDGA 4DV2L 1IL2A 4OXPA 4JI2L 2PQAA 1VQLA 1XTDA 4X62L 1IBKL 4DR6Q 1XJVA 2JQOA 3KOJA 1X3FA 1Q1BA 1I5FA 1TWHH 1WCMH 4IPDA 4DNIA 1ASYA 2BA0A 4UY8C 2JA7H 3A5ZB 3CCUA 1XMQL 3GTMH 1OXVA 3HOYG 3M4OH 3M9BA 3S1RH 1XMOQ 2VNUD 1XPUA 3HOWG 1MKHA 3PF5A 1X55A 1UWVA 1K3RA 3CP0A 5LMUL 1VQ9A 4GKKQ 3E9HA 1EUJA 1JB7A 3J7A5 5GADC 1YHQA 1EQRA 1UE7A 4C3IH 3PV0A 4GN4B 4QL5A 5IWAQ 4YHHL 4AQYQ 1RIPA 1V1QA 3KJOA 2UXBQ 4A3GH 5C3EG 1OXXK 5LMNQ 1JJCB 3W1BA 1K9MC 4K0KL 4R4QA 1FL0A 1J5EQ 4RG1A 1Q82C 4EQ5A 2L15A 1S40A 2JK8A 2Q2TA 2VZAA 1X54A 4L5QA 4JOIA 1OTCA 1YBYA 4APVA 2IHFA 3BZCA 3I7FA 1VQ6A 2VUMG 1VS0A 1K0RA 1QUQB 4JI5Q 1VQIA 2A8VA 2OCEA 1PH6A 4IPHA 2LXJA 1XNQL 2D62A 3GTJH 4DV4Q 2NVQH 4KHPQ 1T9HA 3GTKH 4GOPB 2IX0A 1N32Q 1OXSC 3M4PA 2VQFQ 1PHJA 2WAQE 4UP7A 3I4OA 3GTGH 4O2DA 2ZTEA 2PQAB 4GOPC 4DR6L 1MJEA 1HH2P 3FKIG 4A3KH 4R4IA 4L5RC 4X64Q 1L0WA 4DV5Q 3I4NH 3G6EA 2CQOA 1OXUA 3RLNA 3F2BA 3ULLA 4JYAL 3CCSA 3CPWA 2YYZA 2EQSA 4BY1H 4AIMA 4LNQA 1KIXA 4MZ9A 2OWOA 5M3MG 2LXKA 4GKKL 1N33L 1BBUA 4R1JA 4C2MH 5C0XG 4A3MG 2CWAA 3RZOH 4LF5Q 5IWAL 4AQYL 2JA9A 1NE3A 5GQOA 3ULJA 5M5WH 3RN2A 2XGTA 2B63H 4A76A 1AE2A 1X9NA 1Q46A 4QJFA 2K5HA 3CCRA 4AYBG 1VQHA 4BY7G 3AQQA 4A3DH 2QGQA 1QZGA 1EOVA 3HKSA 1UE1A 3K8AA 2ZJRA 2ZJQA 5C3EH 3KLWA 4FDBA 2F3IA 1C0AA 2N8NA 3CC2A 3UE1A 5GROA 1NY4A 1JJGA 4DV4L 1QZHA 4GKJQ 1O7IA 1MJCA 1X56A 4PZ8A 4R4OA 4B3TL 4LFBL 1N34Q 2YTVA 3PO3H 1TXYA 2KCMA 3EIVA 4JOIC 1UEBA 2VQFL 4LW1A 5ELNA 3J81c 3UE0A 4JBWA 3L0OA 4A3EH 4XTCS 1IBML 3JAMc 4HJ9A 1DGSA 4LF4Q 1QVFA 1CKNA 2KENA 5EAYA 5C44H 1Y1WG 2N49A 1P8LA 4DV1Q 4DUYL 3UDIA 1SE8A 4IFDG 2Y0SG 1HR0W 2AWNA 3I2ZA 3S2HH 3CD6A 3G48A 3I55A 4QY7A 3TRZA 3U58A 4LF5L 4IJHA 3PGZA 2UUBL 4DR5L 1JJ2A 1S3OA 2VY3A 4DV6Q 3CCLA 3HOZG 5C4XG 2EIFA 3OYYA 1D7QA 2V1CC 1KAWA 2RCNA 4A3MH 1TWCH 3H3VH 3M7NA 4JI7L 2Q2IA 1X3EA 3U4ZA 3GD7A 3CCQA 1EIYB 1SN8A 2QA4A 3CF5A 1E7ZA 4NXNQ 2K52A 2R7DA 4IPCA 2NVYH 3D31A 4LF9L 4QIWE 4BY7H 2WP8J 4GKJL 3ULPA 3VDYA 2YV5A 4GN3B 3CW2C 3F1ZA 2UUCQ 2UU9L 4OX9Q 1QUQA 4UPAA 3K7UC 1N36Q 1YHAA 3HFZB 4BXXH 4A3BG 4DR4L 1KQSA 5JEAG 3H0GG 1HR0L 4JBJA 5FLXc 4B3RQ 4H02A 2QEXA 4LF4L 1D8LA 1PYSB 2BH8A 2NN6G 3U4VA 1NTGA 3M3YH 2R92H 4A3LH 3FP9A 5FLMG 4BBSG 2UXDQ 3H15A 1CKNB 4DV1L 1VQCA 1VQ8A 3S15H 4B3SL 3J80c 4IO9A 1HZCA 4GLXA 2JA8G 1Q8KA 1PYBA 4BBRH 2Z0SA 2R7ZH 1BVSA 1Z47A 2F4VQ 5AJ3L 4A3CG 3S1QH 2JA5G 4JBMA 3E9IA 2NN6I 4GLAC 4P74A 4NXMQ 3PUXA 1X3GA 4A3IG 2R93G 4LFAQ 2HQLA 4JI1Q 1I94Q 3KF6A 2HHHL 4JI6L 3HOVH 1VQMA 3FHWA 3K81C 2NZOA 3HOXH 3G4SA 1PV4A 4X65Q 1HNWQ 1QVGA 3UDXA 3HOUG 1K8GA 2WAQG 2K5NA 5IYBG 2MO1A 1SMXA 3CC4A 3AFPA 2WFWA 4B3MQ 1K73C 2NVXH 4A93H 4LUZA 4A3JG 1I3QH 3CAMA 1YITA 3PIPA 1A63A 2CFMA 4MTNA 3A0JA 3A5UA 5IYCH 4OX9L 2N78A 4JI8L 4IOAA 5LMNW 4LWCA 4TQUS 1HJPA 1EYGA 1E1OA 4YCWA 3ZJYC 4DV0L 1IBLQ 2OTLA 1YJNA 1M90C 2JEAI 4LUVA 3CCVA 2JA6H 4OWXB 4LF6Q 2K75A 1G6PA 4YWLA 1GKHA 2UUAQ 3RLOA 1PH1A 2UXDL 1J6QA 1AH9A 3RLFA 3H0GH 2E2HH 1EFWA 4IPGA 1VQ5A 2ZM6Q 1KC8C 2MNAA 1HNXQ 2E8GA 3Q8DA 5IE8A 3PO2G 1VCIA 1XMOL 3F2DA 1I6HH 3STBC 3UDFA 4LF7Q 4IFDJ 5IYDG 2NVTH 4KLKA 1PH8A 4NPSA 2UXCQ 1VQJA 2ZTDA 2I5HA 1I94L 3HOYH 5BR8Q 4A3CH 3A74A 4HJ7A 1GO3E 3HOWH 4X65L 1VQBA 3KF6B 4DR2Q 1U0LA 4A3IH 4DR7Q 2UXBL 1TWFH 5IP7G 3KJPA 5LMNL 4PZ6A 5IY0A 2D0OA 4A75A 1J5EL 4B3ML 3BJUA 2LSSA 1CSQA 1WI5A 2K50A 4JG2A 1VQKA 2NZHA 1B7YB 1NMGA 3HOUH 1NMFA 4DKAC 1P16A 4BA2I 2B29A 4DPGA 1W3SA 4JI5L 4DV7Q 1YNXA 2AKWB 3PF4A 4KHPL 3ER0A 2YU9H 2OQKA 1N32L 4LF6L 4P72A 4A3FG 1V9PA 3I4MG 1IZ6A 4OONA 2VUMH 2E5LQ 2Q2UA 3NENA 3K80C 1MIUA 1VQNA 1YEZA 3K0XA 1Y14B 1Z9FA 2ZM6L 4ALPA 4X64L 4JI4Q 4DV5L 1HNXL 4JI0Q 1FJGQ 4WJ3M 3J81j 2JE6I 4HJ5A 1Y1VG 1X6OA 4GLVB 3RR5A 1BKBA 1PH4A 1TWGH 3FKIH 3DM3A 3PUZA 4LF8Q 1PFSA 5IP9G 5FJ8G 5C4JH 2KHIA 3TS2A 1EWIA 3CPFA 4J15A 4YWMA 1OXTA 3S1MH 4QQBX 1CKMA 4WJ4A 1XPOA 3PO2H 2KHJA 3S16H 4LUOA 1YI2A 3OTOQ 3GTOH 5IYDH 4DR7L 3I56A 1VQOA 2RHQB 5M3MH 1L1OB 1WFQA 2VS1A 1QVCA 3J7ZC 1ASZA 5JJIA 4QGUA 1YJ9A 2IX1A 2OQ0A 2VQEQ 1H95A 4X6AH 1VQPA 1PVOA 1M1KC 1WCMG
chains in the Genus database with same CATH superfamily
3DLLA 2R7KA 3GTPH 1EYDA 4X62Q 1V51A 1ZYRC 4YIJA 4FS2A 4ECUA 1N34L 3F8NA 3MWDA 4O0AA 1PTOB 2ASBA 2E2IH 2IW3A 1BR9A 5DM73 3PN1A 1E22A 5LP6F 5LMUQ 3I4MH 1SYFA 3RZOB 1PH5A 4UFZA 4JI0L 1I50H 1M0WA 2ZJTA 4DV5H 1HNXH 1TWCA 1F9QA 3CCMA 4J8QA 1Q12A 1GHKA 1B53A 2F0GA 4CHTB 2L4NA 2WB1E 3CQZH 2DZDA 3T5LA 4LF7H 4JC0A 2I87A 1BNZA 2O5IC 1G51A 2ATWA 1HUNA 1KAAA 4ZLTF 2HVSA 1JC7A 4KN7C 3HBLA 3NBHB 4TRDA 5C0XJ 1XNQQ 4DR7H 3S14H 4K5XA 5M3FB 4AH6A 1C3OA 3PO3B 2CQAA 3I4NG 2AUJD 3HRZC 3KBGA 4K2KA 2ZJPA 2YZMA 5DLGA 4KK7A 4NXNL 2VW9A 3GLKA 4A3EB 3OHXC 4Q0YA 4BY1G 3GIIA 4DL2A 2Z6KA 3T5HA 3WWVA 2UUCL 3PW5A 4JYAQ 3PUWA 3RFCA 4LFCQ 2N3SA 1WTHA 3VR2A 2JA7A 5KG0A 3HKZA 2B63G 1HA6A 1K8AC 2RKSA 2DJGC 2HIXA 4OWTB 3K5NA 3BQ0A 3T13A 3P1HA 3IRBA 4A3DG 4JPBW 3R5XA 1CUKA 2ASJA 1GLVA 5E4WC 3TEHB 1J9OA 2HCCA 4XYOA 3OW2A 2W6QA 1FYCA 2EY2A 5FLMH 2R7NA 2F4VL 1JLLB 2HDMA 2IY5B 3N44B 1Q3LA 1JE5A 2K5VA 1MGSA 1QE6A 4CJ1B 1VF5C 1IXRA 2IJ0A 2ALZA 4JI1L 1T36A 1X65A 2WIIB 3CXCA 2JA5H 4RZRA 3HGBA 3MC0B 2AUKA 1XYIA 2PMZE 3NE5B 3W5OA 3GTJA 3D6CA 3PCOB 2GVBA 3K5OA 1RTOA 3GTLH 2JEBI 3SGIA 5C44G 2FLPA 2PYKA 1W6KA 4MV3A 2R8IA 3GTGA 2R92B 2BQ3A 5JJLA 3K5IA 1I4PA 4DAYB 4LFCL 4DV3H 3CMAA 4EX5A 1VQGA 4A3JH 2EY5A 5KFFA 2V5AA 1VQDA 2D0PA 3PMFA 4I55F 2K5WA 5M5YH 4OO1G 4O4IF 4MTDA 3K59A 5LYJF 1MZBA 5JJZA 1TWAH 4B3RH 2IWHA 1JICA 4FM9A 1MHWC 3E0JA 3RB0A 4NB3A 1JWSD 4G7HC 3EN2A 4ME5A 4F4YA 3CU7A 2I5MX 1BO0A 2E2DC 3ERQA 4CDEC 5EJWA 2B2VA 3T51B 4I65A 4A93B 3MVVA 2NVXB 5K36G 3GO5A 5KFUA 1WOCA 1VQ4A 5BR8L 4FYDA 3T16A 2XSCA 1SNCA 2MFIA 2A74C 2X69A 4DN4M 1M7JA 4OHJA 5JVLA 4CGYB 1AN7A 3BABA 3BDCA 4ZKBB 1EL0A 3K0YA 1T3NA 3RGZA 3GTKB 4DR4Q 1ICWA 1PRTB 1K8MA 2ASLA 1YZ6A 4BBRG 1IYJB 1L1OC 2R7ZG 3AU7A 4OIKA 2F0PA 2BH2A 4QW9A 5D1PA 5K2MA 1PFNA 3I12A 1IBLH 3GQBA 2BE5D 1ZQ7A 1PYWD 4DNRB 5AJ3Q 5CAEB 5IYZF 1B9MA 1N33H 4O3RA 3HOXG 3KHLA 2QW7A 4JK1C 2AU0A 2BOSA 2R87A 4O3PA 5E7NA 4H44C 2XRQD 4C1NK 4A3FH 4JI4L 1K0SA 3GIDA 2HHHQ 4IFDI 1E3PA 1Q90A 1TWFB 3BU2A 1V43A 5KRUA 5JJKA 1RL2A 3STBD 3F8TA 4GN5A 4ECZA 3BYTB 2FK3A 2CVRA 4C3JH 4U6PA 1IL8A 1Q86C 4OWWB 3KDFB 2DY8A 2NVYA 3OTOL 3T1YH 5FJ8H 4DA2A 4TV8F 3FPPA 5EBCA 3J7AF 4K2LA 1SNQA 2AQ3B 5G3LD 4GOPA 1EWHA 4DR2H 4UP8A 2VQEL 5KYLA 3PUYA 1YJWA 3Q8SB 1XXGA 3UDGA 4EYHB 2VA2A 1XDNA 4OXPA 1IOWA 2F0NA 3DXJC 1HTPA 5FO9B 3BJYA 5FLXE 4DNIA 2BA0A 2JA7H 4DV7H 2AQ4A 3CCUA 3GTMH 1OXVA 3M4OH 5FD5A 1I6VC 5C4JB 1HFGA 3S1MB 3J80E 5EWFA 1K3BC 1KNEA 1UWVA 1X55A 4FNFA 1GJXA 3E5NA 4DR5H 4R8UA 1T5EA 3BQ2A 4J9OA 4JI3H 1EQRA 1UE7A 1I6UA 4GN4B 1VBGA 3RAXA 1RIPA 1V1QA 2F0IA 2SNMA 4IZ8A 4JI7H 1RF2D 1VMPA 2L15A 4ECWA 2JK8A 2MHVA 4OIJA 3LP8A 5JPMC 2FLLA 3WO0A 1VQ6A 1STNA 4YBZB 1QUQB 3PQIA 1VQIA 3A54A 2OCEA 1PH6A 4IPHA 2UU9H 2D62A 3GTJH 1S5CD 4Q5VA 3Q8QB 1UEAB 1AUVA 3OSPA 1PHJA 3E6ZX 4UP7A 1SEIA 3I4OA 3GTGH 4EVOA 4ETSA 2J0TD 3I4LA 1KDBA 4RUAA 5BPHA 4A3KH 1DV2A 3N8DA 3H4BA 2SDFA 1IBKH 1JKJB 2ENBA 2A6HC 1EY5A 3F2BA 1OXUA 1RODA 2A73B 3CCSA 1VMCA 2YYZA 4LNQA 3QOLA 2LXKA 1EY9A 1C8CA 1Y1WB 1BBUA 4R1JA 2F0VA 4A3MG 4RB3C 4C3HB 3HP3A 1ET6A 5KFTA 5EPLA 4UCUA 1CHQD 3NQTA 4N9PA 1AE2A 3RB6A 1Q46A 4QJFA 2K5HA 1ILPA 5CYUA 3TZUA 2UVRA 4BY7G 1RJTA 2QGQA 3BYYB 3BG5A 2IP4A 1UE1A 4FDBA 3PIP3 2VB3X 4HMIA 2EPBA 2F0JA 2WAQA 3GV7B 2PZWA 4GKJQ 1T94A 1MJCA 4PZ8A 4B3TL 4LFBL 1TXYA 1JOKA 4BWGB 3NGDA 3TQ1A 2YU9A 3D4RA 4MA0A 2AQ1B 4EG0A 3UE0A 1II3A 2VUMA 2VUGA 4Z9CB 5A2QW 3JAMc 1DGSA 5DG7A 2PW7A 4A3BB 3R5FA 4S3SA 4LJZC 1TS3A 5ISRA 2FK2A 1K28A 4DUYL 3UDIA 4JYAH 4BBSB 1LTGD 3I2ZA 3S2HH 5EKIA 4Y7NB 4Q45A 3G48A 2B2YA 3TRZA 1XWEA 3U58A 5ELFA 2UUBL 2JA8B 1JJ2A 4KKUA 1S3OA 3ZYYX 3OHAA 1HPCA 4TSSA 3H91A 3GTOA 1M4VA 1UC8A 1KAWA 4KY7A 3H3VH 3IL8A 4A3IB 2KECA 1X3EA 2HGSA 4ECSA 3GQCA 2R93B 4YR2A 1KLUD 2QA4A 5K5PA 1GUNA 1HFNA 2F0QA 3TDQA 2K52A 2NVYH 3D31A 2F03A 3I72A 1S0NA 2O03A 4DGZA 3GTQA 2WACA 3HOUB 4GKJL 3U9TA 2G9HD 3RF2A 5JH7F 4AYBA 1R9TA 2YV5A 2FLNA 3CW2C 4K5VA 4OX9Q 3PW2A 5EGTA 4KHPH 1JE4A 1YHAA 4BXXH 1N32H 3GIPA 3FMCA 3RZDB 3H0GG 1HR0L 4MV7A 5KFGA 3KK7A 2N88A 1OWTA 5JVDF 4A3LH 1G6ZA 3FP9A 5FLMG 2UXDQ 4FS1A 1CKNB 1AN8A 3OUUA 3M9MB 2VB2X 1SJHD 4C1NI 1PYBA 2L55A 2Z0SA 1Z7TA 2P0AA 5D8DA 4Q8FA 3MFYA 1Z47A 1TWGB 2XGPA 2HVRA 2JA5G 5J2TF 1Y1VA 4F88A 4P74A 4NXMQ 3PUXA 4O1NA 4YP3A 3S16B 2WE6A 1I94Q 1E4EB 1YNNC 3FHWA 2DIKA 1PV4A 1PZID 4X65Q 1BCPC 1QVGA 3DEOA 4LMQD 2MO1A 2K01A 1I4QA 3AFPA 1K73C 4A3JG 3CAMA 3PIPA 2F0DA 4QUFA 3GV5B 1S5DD 4L63B 5IYCH 4OX9L 4JI8L 1GYFA 4LWCA 1HJPA 4YCWA 5A35A 5IODA 2OTLA 2R8JA 2JEAI 2R82A 2QYZA 2JA6H 1J8IA 1DONA 2UXDL 3TP5A 1EU3A 5LOVF 1B6SA 3OSNA 2Q8TA 2W7OA 3RBDA 2MNAA 4DV1H 2VA3A 1HNXQ 3PR4A 3JAMW 1SXTA 5IE8A 4I7HA 4K5WA 1XMOL 3VYSA 3F2DA 1I6HH 3UDFA 4LF7Q 2FP4B 4MTEA 5LL6S 5IYDG 4ED3A 5I2XA 1B9NA 2JSOA 2ZTDA 2I5HA 1I94L 3HOYH 1KBLA 1B33N 2LS01 4HJ7A 3BA8A 5CBAE 5FPRA 4X65L 2EXZA 4DR7Q 1LT6D 3KJPA 5IY0A 1S10A 2LSSA 1WTOA 1W93A 3OUZA 2EYMA 1SYEA 3K57A 3MFGA 2L12A 4IRKA 2L11A 1TWHB 1YNXA 5I6WA 3DEPA 3JSNA 4ZHQF 1TY2A 2YU9H 4A3FG 2VUMH 2Q2UA 3KLRA 1SYDA 1YEZA 1VQNA 1IYUA 4RHSA 4ALPA 4DV5L 4ABNA 4C3JG 3MXPA 1HNXL 3TIGA 2MCTA 4HJ5A 4GLVB 3R2TA 1BKBA 5KG4A 3CRKC 3MXGA 4LF8Q 5FJ8G 4NW2A 1SYGA 3RD4A 3G8CA 1CKMA 2GA4B 3PO2H 1YI2A 2FINB 3GTOH 4O3QA 4DR7L 4CC6A 3I56A 4OL7A 4FBUA 1DJRD 2RHQB 3NBHA 1L1OB 1WFQA 2NVQB 5JJIA 4IWXA 1FGBD 4CKEA 2OQ0A 4ID6A 2EDGA 1PTOF 2BDOA 2JA7G 4P75A 3R93A 2O2LD 1BXRA 4IAJA 4BA1I 2HQEA 1R9TH 1WSCA 5KFYA 2FXQA 5M5XB 5KYIA 1ZETA 2R6GA 4DV3Q 2CW8A 4JBKA 5FLXL 1PFMA 3PIO3 4QWBA 1U5KA 4C5CA 4BY1B 1SFOB 1MBYA 3VR3A 3S2DH 3OSOA 2YTXA 3P7JA 4LF6H 1Z2PX 2ZDHA 3N43B 4IR1A 1CA6A 1F9PA 2IHEA 4PMWA 3J80L 1PH9A 5M5WB 4RWSC 3RTXA 2B63B 4V0BA 4P2CB 3R2IA 1EIHA 3N42B 2SEBD 1K8OA 4A3DB 1KLGD 3PUVA 5BN5A 2W57A 4XXEA 2MPMA 4P73A 1D1KA 5KFJA 2UXCH 2J4XA 1K1SA 1HZAA 3L2PA 2VPSA 3GV8B 3TP7A 2AGOA 4ODGA 4QIWA 2L0CA 5DQHA 4A3KG 3JZIA 3KBXA 2F0HA 1CK1A 5C4XH 5C4ZA 3HOZH 2GLTA 1KEEA 5KG6A 2X0SA 3MA2B 3GDEA 3EROA 4ME3A 2R92A 1LV9A 1ZKOA 1KL9A 3VYUA 2G9DA 3L7ZC 4DV3L 5C44B 2JYOA 2A19A 3KFUA 5T14A 3QO2A 2XTIA 1VBHA 5AFWA 3W3AA 1FNWA 1N36L 1WCMA 2PVPA 3VMMA 5GAEC 4NMZA 3J81i 3VR4A 1D6EC 2UVWA 3E5SA 4PZ7A 1E1TA 4B3RL 2AHOB 2R61A 3AFQA 1N33Q 2D5DA 4F7XA 4YCUA 1JXLA 2KA7A 4QWCA 1KRSA 3KF8B 1WTXA 4DK1A 5JEAH 3QIAA 4RMFA 3BS1A 2J9GA 2NN6H 4R4TA 1TT2A 2BQUA 3WO1A 3D0FA 4IUTA 2YL2A 4FU0A 2OLSA 1PXUA 3HG9A 5HBRB 1S0MA 2HIVA 2I46A 4IN3A 2OEOA 2HT1A 4LFAL 1TA8A 1CI3M 3T1YQ 5HY6A 4ZCKA 4UCSA 1LTRD 5KG7A 2F1MA 1HNWL 2PI2A 4XDXA 3QZ8A 2A68C 1EIFA 5D1OB 3PW7A 3GTKA 4F4WA 1EEID 4HIDA 1E24A 1CQIB 3OIQA 4ZAIA 4XYMB 1UAPA 2P5ZX 4JI2H 3M3YB 2V59A 3A56A 3GIJA 2ASDA 5DGBA 5EWGA 3S15B 1PX2A 4JV0A 1KTKA 1IBLL 1PTOH 3DM1A 4BBRB 2R7ZB 3PIOA 2EOTA 1PLFA 3L9AX 5NUCA 2Z6KC 3S1QB 5CV4A 2VR1A 4TQSA 2UUAL 1PH2A 2LY7A 2CWPA 4YCVA 4DR5Q 1EQQA 1B70B 2ZTCA 4JI3Q 1M8AA 3KXYT 1Y69U 4YHHH 4RGMA 3HOXB 4DR3H 1UE5A 4JI7Q 1RJPA 2PZTA 4TQRA 2FKLA 2YZGA 2B2UC 5JOBA 1S68A 1CTMA 5L1KA 1PFBA 2F0OA 1I3QB 3KDFA 2R86A 4BXXG 1PRTF 1HZ9A 2M2LA 3T1YL 4WJWA 1E4FT 5IGCA 3JC66 2B3GA 4UP9A 5M3FH 2UU9Q 4DR2L 4IOCA 4A3LG 5GONF 2ZDGA 2GPSA 4RUCA 4DLKA 3TINA 2XCPA 4AYBE 2E74C 3OMGA 4X3SA 1VAJA 3NTIA 3EA6A 2CZGA 3B6YA 1N8RC 1QOHA 2F0EA 2Z6BA 5IP7H 3LNNA 4F50A 4Q0FA 3ERSX 4ZI7F 1IBKQ 3R8BA 3K3PA 4DV7L 4UCTA 4PG3A 1KJ9A 1H9JA 4GS3A 3JAME 5EPJA 4RNMA 3RAQA 1YNJC 4Y52H 1R4QB 3C1FA 2CKZB 1F77A 2Z9HA 5EZYF 4G3IA 1C9OA 1YIJA 1LTLA 2E5LL 2NVTB 2B2TA 3NEMA 4HAEA 4GNXB 4ZKCB 4FBTA 1X32A 3MWYW 5COYA 4JI3L 5KEEA 4C2MB 5CMDA 4FXKC 3VA7A 4J9NA 4JI6Q 4RH6A 1WTWA 1BUVT 2F52A 3S17H 2R6FA 5IT9c 5IYCG 4Q44A 2PMZB 2K4KA 2A69D 1L0XB 2K28A 3ETJA 3Q0AA 3Q8RB 1G291 1GVPA 2JA6G 1KC7A 3R23A 5IP9H 2KBNA 2AGPA 5ELBA 3VA5A 1E2WA 2EXDA 5FK9C 5ELOA 2WINB 2FPIB 1IL2A 1NCVA 4QWEA 5JVG3 1IBMH 2XRSD 2ICEC 4X62L 1IBKL 4WORA 1XJVA 1CZWA 1Q1BA 1WCMH 2QEJC 5CC4A 2YS7A 3A5ZB 3OOCA 4WD3A 4ZUIA 2EYLA 3HOYG 3OW7A 4XQJA 1XPUA 1EZ8A 2WKCA 1MKHA 1TY0A 1PMRA 1BCPB 4APMA 3T53B 2WTFA 1K3RA 3EPIA 5LMUL 3URYA 3E9HA 1QJOA 2C28A 1BDOA 4EQOA 1R4PB 1SAPA 4NKLA 2RSOA 4IWYA 5JAVA 2UXBQ 3QWNA 5CA0F 5C3EG 4L8JA 4A3MB 3A8IE 4R4QA 1K9MC 4MV4A 1J5EQ 1A2TA 4U7CA 3RB4A 4TV9F 4EBDA 4LF8H 1S40A 3SVMA 1K1QA 5D3IB 2SNSA 3GTPB 5CA1F 4LF9H 1B3QA 3H3VC 1E2VA 1G2SA 4JOIA 4BY7B 1SBBB 2VUMG 1LTTD 1VS0A 4H0LC 3WDNA 3MFIA 1XNQL 4KHPQ 1GSHA 1T9HA 3GTKH 1N32Q 2DJFC 5C5JA 3I91A 4QCLA 3Q8PB 2RA4A 2E2IB 1PK8A 3QOJA 4FXDA 4J9SA 4FF4A 4DV2H 2I07B 2DNEA 2PQAB 4GOPC 3NWSA 1MJEA 1JWMD 4L5RC 4YQWA 2R8KA 1L0WA 1S0OA 2E2HA 3G6EA 4B3SH 2CQOA 4PV1C 4JYAL 3ULLA 5M9OA 1EZ6A 1XMQH 4O4LF 4AIMA 1STEA 2OWOA 5C3XA 1A6XA 5KFIA 4DL7A 4J0MA 3F2UA 2JA9A 1ESFA 3GV3A 5GQOA 3ULJA 1XX8A 1VKZA 2XGTA 2RCFA 1BGWA 2YW2A 2D2CC 4QWDA 3ND9A 3S14B 1UUPA 4AYBG 5DLFA 1VQHA 1L0YB 3AQQA 4RAUC 4K0KH 3HKSA 1LO5D 3NP8A 2YCHA 4RZQA 3MFHA 3KLWA 2JEFA 2F3IA 4LAAA 2J6TA 1C0AA 4MN3A 3CC2A 3BZDB 5IT9W 2XIWA 5GROA 1JJGA 4R4OA 4DV0H 1CQJB 3EIVA 3PZPA 2AGQA 4JBWA 2L1BA 3L0OA 2C00A 4DL5A 2IL8A 4KV6A 4DR6H 1CKNA 1NNXA 2RDFA 5CORA 3H0GB 3BVZA 4DV1Q 2A6ED 3GP7A 2NU6B 3RB3A 1SE8A 5T1GA 2AWNA 1TWGA 3DWAA 4DFAA 1EHIA 3FKIA 3UFXB 5KFOA 3I55A 2JP1A 1D5MC 4ECYA 4RB1A 2VY3A 4DV6Q 3PW0A 2Z8LA 3HOZG 5C4XG 2EIFA 3HS0C 4K8JA 2JA5B 1D7QA 1E4EA 2F0SA 2V1CC 1TWCH 5LMNH 1IHZA 1GUGA 5D3DA 1SYCA 3GTLB 1JQYD 2RBMA 3CF5A 3I73A 3V4ZA 1TAEA 1RK5A 2NTSA 1EY8A 4IUQA 1JR0D 4QIWE 2NWGA 3P75A 2IX3A 3VDYA 5KNDA 2O5JC 4JI5H 2HUGA 1HA5A 4UPAA 4Y8VB 4A3JB 3HFZB 2HD3A 4Q8EA 1H9RA 4DR4L 5M5YB 2W9AA 5JEAG 4H02A 3IAYA 1PYSB 1GHJA 1TWAB 2BH8A 2NN6G 2C2EA 3H15A 1MI2A 4RB2C 1I4GA 3H40A 4DV1L 1FNUA 2EVBA 4KKTA 5FD6A 1HHVA 4HQ6A 2VQDA 1BVSA 3I70A 2D9UA 1U4LA 5AJ3L 4A3CG 4F4ZA 4O2BF 1IW7D 4GLAC 4IFDH 1X3GA 3SHLA 4LF5H 2DNCA 3ETHA 2BDNA 2Y0SA 5KFCA 3MWMA 2HHHL 5E1FA 3HOVH 4RCOA 2UVUA 4E6IA 3G4SA 2M9VA 1STGA 5EQ0A 5C5MA 3UDXA 5JQWA 1K8GA 2K5NA 1NR4A 1SMXA 4DAPA 4KY5A 1O7YA 1SMYD 4LUZA 1WD1A 1JDEA 5FO8B 2CFMA 2ATLA 3A5UA 2EY1A 2K1BA 2N78A 2EYFA 4TQUS 1N34H 2QILA 3K58A 4R8NA 1M90C 4RAZA 2ZXPA 1EUDB 4LF6Q 3A8JE 2K75A 2BE5C 2OXPA 4K6DA 4B9XA 2DY7A 3RLOA 4LF4H 4FVMA 1CT1D 1EEFD 4A3FB 2E2HH 2J6UA 3EVQA 4DK0A 5BN3A 2E8GA 3Q8DA 3S1NB 3N41B 4C3JB 3STBC 5IGBA 5H80A 1EWCA 2E2JB 3SK6A 2UXCQ 3RGXA 1PTOD 3A74A 3RMHA 4ED1A 3HOWH 4L6TB 1VQBA 3KF6B 3L4KA 4A3IH 4HR7A 5IP7G 4JI6H 2W9CA 4PZ6A 3UQ8A 4JV1A 5F2DA 3SE7A 2D0OA 5CGKA 2KVMA 5IGGA 4CDFC 1JORA 1DOKA 4JG2A 4NXNH 5IGFA 4YR3A 1MSGA 1B7YB 3S9WA 1N48A 4J9MA 3HOUH 2C9OA 3D4WA 1SEBD 3M7GA 4DKAC 4WBNF 2B29A 4IZOA 4WRDA 4DPGA 1A9XA 4QUCA 2UUCH 4Q43A 1CQFA 4KY6A 2JA7B 3GTMB 3ER0A 2V58A 2K04A 2Z1CA 4LF6L 3M4OB 1SFOA 3I4MG 1IZ6A 3JAML 1SSOA 2B39A 3A7LA 5EOYA 3K80C 5L1IA 5C3WA 3WOFA 4FF1A 2B63A 4N8FA 1FJGQ 4DF7A 4R8IA 1F2LA 1EYZA 3RR5A 1TWGH 1C48A 1RCVD 3FKIH 2J7ZA 1JIHA 2F4VH 3N52A 1PFSA 3IFDA 5IP9G 1BXTA 1EWIA 1FD7D 4YWMA 5KFKA 1LTBD 1FR3A 2Q8IB 3S16H 1S5BD 4JI1H 1ET9A 4ED2A 3MHBA 1VQOA 5M3MH 3J7ZC 3GTJB 4BWSC 2B2WC 2C2DA 3DF7A 1E4GT 5C0XH 1O78A 2UXBH 4X6AH 2DLNA 2KSWA 1J5EH 1WCMG 3K3VA 3GTGB 1RJRA 1AP0A 3AYHB 4JI2Q 3RN5A 1VQFA 4GC7A 3H6MA 4YWKA 4A3KB 3NELA 5ELDA 5CB4F 2MP1A 5KG2A 1F2YA 1SR3A 2W7PA 1Q1EA 1F9RA 4HIKA 2CHBD 1WTRA 4G7ZC 3QR8A 5KFRA 4RGTA 4B9WA 2M05A 5KT3A 2KCTA 4C5BA 4XZ3B 1Q8IA 2ZM6H 3G6XA 4YHHQ 4RKBA 3OHBA 1K83A 3PVXA 1CHPD 3HKZE 4DR3Q 3TMEA 3RUZA 3BZKA 1BBXC 1M0TA 3MXNB 3SE0A 1EOTA 1EUCB 1LUZA 2XWJB 1S5ED 5IT9E 5BR8H 3MEFA 3S24A 1KNAA 4HSPA 2RF4A 1JMCA 1AE3A 5DQIA 2DPIA 3HEJA 4EGVA 3QFFA 2K7VA 2R85A 1D5ZC 3NHHA 2HDLA 3MZ5A 1B8AA 3K7AB 4UCRA 5CV8A 4I4TF 5CR3A 3H94A 3CC7A 1GD7A 5DG9A 1MD2D 2RGRA 1MSHA 1SJED 1UNSA 2AMCB 1CE8A 1LTID 2XGQA 5J39A 1GUWA 3ICEA 2RDHA 4BS9A 1C7YA 1SYBA 2WB1A 3H09A 4R7RA 4O3NA 4HYKA 1LLRD 1N9WA 2RSNA 1PRTD 2ZXOA 3M4QA 4DR3L 4HSVA 4LSAA 2KCCA 4POGA 4JCVE 4X3TA 1QB5D 4R4CA 2ES2A 4ED6A 1PA6A 1I3QA 2Q2HA 2NVYB 4NXML 2RDGA 1LM0A 3OTOH 2QF7A 3D6WA 4DV6H 3D8GA 3ORRA 1WJJA 5FOBB 1S97A 2G5DA 1A8VA 3AEVA 3V4SA 1L2FA 1A3UA 2NUCA 3X3NA 1YHBA 2FMMA 2ZXRA 1ICFB 4KTAA 1JT8A 1IBMQ 4TVAB 4X66H 1A0IA 5M5XH 2K6AA 5IYBH 1STBA 1AFPA 2OH2A 1EU4A 3M9NB 5GAHC 1SFOH 3I90A 2VL6A 4DR1H 2BA1A 4P71A 4EGJA 2V4RA 2KCNA 4L5TA 2PO4A 1GM5A 4GNXA 5KNCA 2XC9A 2L5TA 4R8UB 1UE6A 1W6JA 2JJQA 4C2MA 4DAMA 2F4IA 3J80i 4IURA 5EBDA 3FDSA 3KTMA 5L9XA 4EEYA 4RCNA 1HNZH 4IJLA 1XPRA 5JPNC 1V1PB 4OO1I 2J6SA 2EYJA 4ZRZA 4LF7L 1LT5D 4MV1A 4LF9Q 3SK5A 3PSIA 2NZ1D 2B8FA 3MR6A 2KHSA 2JA6B 1SE2A 1LT4D 2R7FA 2A5HA 1PDQA 4DV2Q 2RHSB 1WH2A 1DYQA 4DU9A 3GTQH 3EYYA 2KEDA 1QWYA 3HKZG 2NB0A 1CSPA 1WYDA 4B3SQ 2CW0D 3I4NB 2FMAA 3SXHA 3VYRA 2N55A 2NU9B 4IHJF 3GIMA 1S03G 2K14A 5C4HA 4DK6C 1NAPA 4KJNA 1XMQQ 4YAKB 3PR5B 4GC6A 1I6HB 2JEGA 3HOVG 1B2TA 4POFA 4DUZH 1CKOA 2W6MA 2MQHA 3C2PA 3HOYB 2NYZD 4XT3B 1SDFA 1K83H 4ILWA 2FE3A 1HZBA 2K5QA 2W8KA 3R3OA 4HN7A 4H13C 2R7LA 1IYVA 1XNRH 5IGDA 4LF8L 4K0KQ 2ICIA 2Y0SE 2F0UA 3HZXA 1B50A 3GTPA 3LGJA 1Y1VH 5C3EB 1PZJD 3QZ7A 4J9KA 3QG1A 4B3TH 4LFBH 5IOCA 2KOLA 4DV0Q 2YU9B 4RAYA 4MA5A 2EZVA 4RGOS 2C35B 3CCJA 1NUCA 2E2IA 3TREA 2VUMB 1KDCA 4DV2L 5KT7A 4CDDC 4MHEA 2RDIA 4A2BA 1ILQA 2PQAA 5CV5A 1BF4A 1VQLA 5A2QE 4RNOA 4DR6Q 4G7OC 2FMCA 1TS5A 2JQOA 1X3FA 4M1UB 1ASYA 4IPDA 3SDZA 4DAYA 4QMGA 1XMQL 3GIKA 1ZHQA 2M00A 3M9BA 3S1RH 2FJZA 3HOWG 3J7YW 4YY3H 2O4XA 4O3OA 5I9PA 2C2RA 2GPWA 1KJQA 1QNKA 3CP0A 1T5XD 2EE1A 3J7A5 2PN1A 1GUTA 5GADC 1YHQA 5KG5A 4C3IH 3PV0A 5D65A 5I6YA 4QL5A 4U673 5IWAQ 4JV5H 2B2TC 2OF1A 4A3GH 1FJGH 1EYAA 1OXXK 5LMNQ 3MTSA 3W1BA 4K0KL 1FL0A 4IUNA 1Z2OX 5TSSA 2X6LA 1Q82C 1RDPD 4EQ5A 1HQMC 3T56B 1W96A 2NVXA 3AMUA 4AYBB 4X3KA 3BZCA 2K05A 1G91A 1KJ8A 1ONLA 1K0RA 1SE4A 4JI5Q 4MV9A 3T1HH 2LXJA 1GGOA 1DXMA 4ED8A 3X3MA 2F3VA 1OXSC 3LWEA 3S2DB 1CZGA 2WAQE 5BMVF 5KFDA 2ZTEA 2HCIA 4DR6L 4F87A 1ZYRD 5KFXA 1GUOA 1HH2P 3FKIG 2Z4IA 4X64Q 2DWCA 4J9RA 3H0GA 1STYA 1I4XA 3BQ1A 2YS6A 2MJ8A 3ONAB 3G6VA 3V2TA 1D1IA 3CPWA 4L1KA 4NDXA 3OMCA 5CV6A 2WDTA 2JEIA 4MZ9A 5M3MG 1N33L 4C2MH 5C0XG 5LL6X 3RZOH 1ENAA 4LF5Q 1DD2A 3WNZA 5IWAL 2W9BB 4XQNA 4LH6A 4KD3A 1RTNA 4A76A 1X9NA 3MR2A 3CCRA 4EFBA 1TWFA 1DCZA 4MTKA 5J22A 2K03A 5I2YA 1EOVA 2L9HA 3HOZB 5C4XB 3VPCA 3SK8A 2ZJQA 5HURA 1LABA 2N8NA 3TP8A 2WYOA 4JI8H 3UE1A 1A15A 1NY4A 5KT4A 1QZHA 1O7IA 1QILA 1X56A 1N34Q 4RHRA 4MIUA 3VR5A 3PO3H 2KCMA 4JOIC 4OGQC 1H9MA 4LW1A 5ELNA 3J81c 1TWAA 4A3EH 4XTCS 4XYQA 3CHBD 4LF4Q 2YRXA 5FLXW 5EAYA 2N49A 2CH4A 1ENCA 1P8LA 3U9OA 2Y0SG 1L2ZA 1XMOH 3CD6A 4EYIB 2WKDA 4LF5L 4GKKH 4DR5L 1QCBD 2E76C 3CCLA 4AQYH 3OYYA 5IT9L 3ORQA 2E75C 2RCNA 4A3MH 2HJWA 3M7NA 4JI7L 2K32A 1B6RA 4ED0A 1GSOA 3GD7A 3CCQA 1EIYB 1SN8A 4FP5D 4RFBA 1E7ZA 4NXNQ 4BY7H 1HTLD 2PZUA 3EFXD 1X3QA 3MR3A 4LMYA 4DXGA 3F1ZA 2UUCQ 2UU9L 1JOOA 4DV4H 1LTSD 1QUQA 2B2VC 3K7UC 3SI8A 4R9WA 1FNVA 1S5FD 3BDLA 2W6NA 1KQSA 4K14A 2VQFH 3RBEA 1O7LA 4LF4L 5C8YF 4HMJA 1NTGA 2R92H 5KFMA 1SCUB 5KNBA 3KUPA 1VQCA 3A7AB 1HZCA 4GLXA 2XCAA 3K6OA 3OWFA 3Q23A 2F4VQ 3TQTA 3E9IA 2R8GA 2CH4W 5E4XA 1Y1WA 2RQXA 2HQLA 4JI1Q 5IGEA 4IALA 3KF6A 2IA6A 4JI6L 1VQMA 3K81C 4TKOB 3RJ0A 5FKAC 2C5CA 5KFEA 1EYCA 3V6KA 2WAQG 1EY0A 4LK1C 2PBZA 3C0FB 5IYBG 4IQZA 2WFWA 4A93H 2NVXH 3V05A 1HRJA 2LMCB 4NLGA 1JOQA 1A63A 1WTQA 3V96A 4GZYC 1H9SB 4IOAA 5LMNW 1EYGA 5KIXA 3GTMA 3ZJYC 2ZT9C 1TKWB 3A55A 4PWQA 4LUVA 3RV3A 3CCVA 4OWXB 1G6PA 3NTHA 1HUMA 5F9LA 1GKHA 1ZHSA 4A2AA 1AH9A 5EWEA 5L1LA 2B2UA 3RLFA 5IIFA 1EZ1A 5T1IA 3H0GH 3IFTA 3I4MB 3J7AK 1EFWA 4IPGA 3M9OB 3J81W 2ZM6Q 1KC8C 1I50B 2QK4A 3S17B 1C4QA 4MV6A 5LHY1 3PO2G 1VCIA 3CQZB 4KLKA 4TUYF 1PH8A 1DIKA 4NPSA 4EFEA 1VQJA 4NP5A 1GUSA 2A69C 5BR8Q 1VDZA 5BPFA 4O3SA 1KABA 4ECVA 1GO3E 4DL3A 4QIWB 1U0LA 2W6ZA 1V4YA 1EY4A 2UXBL 1TWFH 5KGUA 1J5EL 3BJUA 2W70A 1WI5A 1F2MA 3LX0A 2R93A 4FF2A 3AB9A 1WTPA 1NMFA 5IWAH 1P16A 3TN2A 1B4OA 1WCMB 3TIIA 2AKWB 4KHPL 1N36H 4HTHA 4ZYSA 2OQKA 1N32L 1ULZA 4P72A 4M8AA 3VR6A 4OONA 2KJXA 2F3WA 2NTTA 4J6HA 1F2ZA 3NENA 4UHVA 5KT6A 3NTKA 1B44D 3K0XA 2HVQA 4CJ2C 1Y14B 1O75A 2ZM6L 1SNOA 5KFHA 4IR9A 4JI4Q 2FHTA 5ELEA 5DNFA 1G2TA 1EY6A 1Y1VG 1PH4A 2YRWA 1CA5A 3PW4A 3D4DA 3PUZA 3N6RA 4IUPA 5C4JH 3MXNA 3CPFA 3S1MH 1OXTA 4M9UA 1XPOA 2XNAC 3IKJA 4XX0B 4LFAH 3TZDA 4K8IA 3OTOQ 1C30A 5IYDH 4EEQA 2VS1A 1QVCA 1HNWH 1B1ZA 2IX1A 2VQEQ 4RA8A 1H95A 1BJTA 1VQPA 1PVOA 3KLSA 4B3MH 1M1KC 3H4DA 2A1AA 3T5KA 3NWTA 4DAVA 4X66Q 5H1SE 2FFKB 4OEMB 4LSXA 5A2QL 2NUAB 2WB1G 4RB0A 3VPBA 4N9TA 4RKLA 2NBFA 4DR1Q 5J3BA 3QB3A 2H5XA 1V8QA 4ULLA 2UVVA 4C3IG 4CKCA 5HGQA 4L5SA 4HNUA 4ECXA 2UUAH 4A3GG 2A6HD 4J9QA 3O13A 4UDUC 2F0TA 4FXGC 3SK4A 5GAGC 4JVZA 4X64H 3FPUB 2FPPB 3M4YA 3U50C 3VPDA 2PNHA 1HNZQ 4PQXA 2K33A 3S1NH 2IBKA 1F9SA 2E2JH 4PDBA 1SYXB 3G6YA 1QNUA 4HEDA 5DM63 1I4HA 1A62A 2F0WA 1Y1WH 3NXWA 3F2CA 4DV6L 4CJ0B 4C3HH 1B3AA 3JRXA 1TS2A 2GVAA 4HJ8A 5CV9A 1NBWA 1U4RA 2EY6A 1GSAA 5BN4A 3RV4A 2B2YC 1HXYD 4HJAA 3KHHA 3TQYA 3UI2A 3RNUA 1SROA 1UNNC 1FGUA 2AQ2B 4X66L 4KKSA 3IG0A 2CQYA 2FJ2A 2PI2E 4MNOA 2QKIC 4FF3A 3BDOA 2RGVA 1VQEA 4DR1L 1TWHA 2BQRA 3OIPA 5FPOA 2I5LX 1SE3A 2A6EC 2SOBA 2E5LH 1CM9A 3JAMi 3G7LA 1DOMA 4DL4A 5DAUA 4DUZQ 2ALYB 1I4RA 5DLQE 2CCZA 4A3BH 4WFN3 2GN5A 4JI0H 4RGNA 1KRTA 1PH3A 1HNZL 3HXLA 4UAIA 2EJFC 1TWCB 1B04A 1TIID 2VOBA 1V1PA 1DM0B 4BBSH 4ZK9B 1XNRQ 4Y7NH 2KUMA 3U9SA 1RD9D 3BAAA 4YB8B 3Q2OA 1NJIC 4J9PA 4UCVA 1EQTA 5M3FG 5L1JA 2JA8H 1CQVA 5FO7B 2I8CA 4ECRA 3PO3G 3EBEA 2PNRC 3RIZA 1BBWA 4A3EG 4B3TQ 4HCSA 4LFBQ 3SEBA 1KJJA 3Q1KA 1L1OA 3BG3A 1WTVA 1S72A 2AWOA 3LMLA 2R93H 2JA6A 2DGYA 2FK1A 3E3XA 4B08A 1U9RA 4X62H 4HIMA 1EIGA 4O4HF 4A4IA 3W1GA 3KYHC 2R7MA 2W6PA 1HQRD 4K6LA 4DUYQ 3TBIB 1OO9B 4N8X1 1KD1C 1CS0A 3NK9A 3NUCA 3RZDH 2ID0A 4DUZL 1LYLA 3HKZB 4YY3Q 1KXLA 1G8ZD 1GXDC 1VQ7A 2UUBQ 1S9FA 3G71A 5LMUH 1IW7C 5JEAJ 3NQIA 2XIGA 1DOLA 2XD4A 3HOVB 2MGSA 3EJIA 1TVXA 3TS0A 4JV5Q 1LT3D 4IUUA 1XNRL 3L3OC 3I3CA 1KHIA 5C5LA 3LWUA 1JCKB 5C0XI 3H3VI 2IT1A 4KI0A 5D14A 2UXCL 2TSSA 1SMYC 5LA6F 1YNND 3K5LA 1W2BA 2MO0A 4HIOA 5KFNA 1JB3A 3G6JB 1BCPD 3ND8A 3T1HQ 1XNQH 3TSSA 3C46A 5KG1A 1PH7A 2R92G 2QCPX 1LTAD 1FVIA 4G57A 1SLJA 3BVMA 4PMCA 3K7AH 3KHGA 1HR0Q 1IOVA 3BVGA 4ZOLF 5EKKA 1HCZA 2E2HB 4O2AF 3J81E 1SRUA 3CMEA 4LFCH 2FB9A 5JVH3 4PNYA 1Q7YC 5I4DA 2V9WA 5F9NA 1ENFA 1VQAA 4J9LA 4YY3L 3DMUA 1SNDA 2WV6D 1A2UA 5KT2A 2Z4HA 2QDLA 2W8LA 2OTJA 1SNMA 2XWBB 1RKNA 2YTYA 3MEHA 5DQGA 1UC9A 4RNNA 3E0EA 4JV5L 3FVQA 1PTOC 4A93G 3HOWB 3KF8A 4KHZA 1FJGL 3KLSX 4GNXC 1AUXA 1KDAA 2F0KA 4DK3C 3CVZA 4H7BA 3M85A 1YVCA 2XCLA 3CCEA 5ELCA 4XIGS 1I7NA 3HB9A 3T1HL 4I50F 4JI8Q 2V4DA 2KEEA 1Q81C 2I80A 2DUDA 2F0LA 2I0QA 2XN9C 4DNTB 5D1OA 2EYHA 2MUYA 3DUZA 4QF4A 1XTCD 4JI2L 1EY7A 5KFSA 1XTDA 5C6AA 4YAJB 3V6HA 2Q8RE 3KOJA 4EGQA 5KFAA 2XVSA 2SCUB 1I5FA 1TWHH 3LWBA 4UY8C 3CKIB 1BNCA 4ZUJA 3FKIB 2VNUD 1XMOQ 3H20A 2R7ZA 3S2HB 3PF5A 1VQ9A 3NSWA 4GKKQ 5CBEE 2YYAA 4HNTA 1EUJA 1JB7A 2W9BA 4IRDA 5DG8A 4E4TA 4JI4H 5M3MB 4YHHL 4AQYQ 3KJOA 2R3ZA 3Q24A 1D2BA 1JJCB 1WD0A 3FMAA 3GV6A 3P20A 4RG1A 2C22A 1WVLA 2BCOA 2Q2TA 2VZAA 1X54A 3IN5A 4L5QA 2H4OA 1OTCA 1YBYA 5L37A 4APVA 2IHFA 3I7FA 4KMUC 2A8VA 2NVQH 2PQEA 4DXFA 4DV4Q 4GOPB 4KJOA 2IX0A 4DR4H 3M4PA 2VQEH 5EKLA 2VQFQ 4X3UA 3TP6A 1IKLA 2EJGC 4ECTA 1SNPA 4I7ZC 2JEJA 4O2DA 4KHVA 4ME6A 5KFVA 5KFPA 4R4IA 4DV5Q 3I4NH 3EPGA 5G3LF 3RLNA 1IKMA 1Z2NX 3RUPA 4QW8A 5E3FA 5J2UF 4QWAA 2EQSA 4BY1H 4C5AA 5KFQA 1KIXA 2B2WA 1E0BA 4GKKL 3BA9A 1N56A 3C1EA 2CWAA 4MV8A 2Y0SB 1X3PA 3FDTA 2EYOA 4AQYL 1NE3A 4CC5A 2EYPA 5M5WH 3RN2A 2HHHH 2B63H 1AW7A 5I47A 3FRPB 5KG3A 5LXTF 3K5MA 4I7AA 4A3DH 1QZGA 1EQVA 1DZ1A 3K8AA 2ZJRA 3C3LA 5C3EH 2NU7B 1EFID 4DL6A 2PMZA 3MAQA 1AEXA 1KJIA 2CW7A 3ITPA 4QB4A 1GOZA 3T4AC 2YZNA 3K5HA 1ESRA 1ZEQX 4DV4L 4OELB 1Y8OB 3DWPA 4ZQIA 2YTVA 1CFMA 3QJYA 2VQFL 1UEBA 2F0FA 4PMBA 3JSLA 2DPJA 1IBML 4YR0A 4U68A 4HJ9A 1H9KA 1QVFA 4EBEA 1TR5A 1STAA 2KQ3A 2ZDQA 2KENA 5C44H 1U4MA 2V4QA 1Y1WG 1PRTC 4YJ3F 1AZQA 4IFDG 4FO2A 1HR0W 1O7ZA 4C3HG 3VYTA 4CBVA 5KT5A 4QY7A 1V1OA 1JWUD 1TS4A 3FEWX 2VPQA 4IJHA 3PGZA 3KAJA 3MJFA 3MWEA 2LFNA 4MAMA 3W2DA 2OT2A 4OO1H 4HR7B 3GILA 4M7EA 2JXMB 3D3RA 2W9CB 2H1EA 1TU2B 3I8ZA 3KALA 5DEHA 5EPKA 2Q2IA 3U4ZA 4JW0A 1ZXTA 2R7DA 4IPCA 4CDCC 4LF9L 1PZKD 2WP8J 3ULPA 2DN8A 2WAQB 1H9SA 5C1PA 4GN3B 2A68D 4EBCA 5K36H 3L4JA 1N36Q 1RK6A 2LKVA 5CV7A 3SR1A 4ZQ3A 2RVLA 4F4XA 4J1MA 4A3BG 4B3RQ 4JBJA 5FLXc 1M6VA 2QEXA 1D8LA 3U4VA 4EQPA 2JN4A 3M3YH 5HGTA 3DWQA 4BBSG 2RDJA 3NBIA 1NR2A 1VQ8A 1BCPF 5J1ZA 3S15H 1I50A 4B3SL 4CKBA 3J80c 4IO9A 2JA8G 2FPGB 3GIQA 5JUMA 1Q8KA 4BBRH 3KHRA 3OPOA 4DUYH 2R7ZH 2IMWP 4O42A 3S1QH 4JBMA 1E2ZA 3CQZA 2F0MA 2NN6I 2BR0A 2QDBA 2B8GA 4A3IG 2UUBH 2R93G 1QG7A 4LFAQ 3PO2B 4G4KA 5HV6A 1JDBB 1S4ZA 3GTOB 3MXUA 4UCOA 2NZOA 3HOXH 4V190 1HNWQ 3HOUG 4EQNA 3Q6SA 1WR2A 3CC4A 4XT1B 4B3MQ 4KD4A 1I3QH 1YITA 4MTNA 5KX5F 3GTQB 3A0JA 1R9TB 1DV1A 3MR5A 1ML0D 4GKJH 3N6XA 1E1OA 1IBLQ 4DV0L 1YJNA 2X6GA 4HNVA 2CW0C 1STHA 4YWLA 3Q22A 3J7AV 3OWEB 1PH1A 2UUAQ 1HR0H 1J6QA 1TQOA 4XYLB 1Z6HA 4ECQA 1K83B 1VQ5A 1NSNS 3NPPA 1YNJD 3M4IA 2NU8B 1A3TA 5C1OA 1I7LA 1RJQA 1AZPA 1D5XC 4IFDJ 3N40P 2NVTH 4C56C 1Y1VB 1U4PA 3CRLC 4A3CH 4JUZA 3JRWA 3T5JA 4DR2Q 2JA5A 5LMNL 2EJMA 4A75A 4B3ML 5LL6b 1CSQA 2K50A 3GTLA 1BOSA 1VQKA 2NZHA 1NMGA 2VXWA 5DGAA 5KFZA 1A3VA 4BA2I 1RYRA 1W3SA 1RHPA 1FKAH 4JI5L 4DV7Q 4OX9H 3PF4A 5KFBA 4XQQA 3J81L 2TMPA 1Y8PB 1V9PA 3S1RB 4ED7A 2E5LQ 2WB1B 1MIUA 2W71A 2IPKD 2UXDH 5KKNB 1Z9FA 2PPBC 4X64L 1LACA 4C3IB 2W6OA 3A8KE 4JI0Q 4WJ3M 4RU9A 2K5DA 3J81j 2JE6I 1X6OA 4A3GB 4IUVA 1O80A 1BQQT 3R5HA 2PW5A 4F8MA 3DM3A 5EDWA 4JV2A 5KFWA 2KHIA 3TS2A 4J15A 1VF7A 1Y8NB 4HCEA 4WJ4A 3DHQA 4QQBX 2R84A 4YJ2F 3J80W 3WOEA 4NXMH 2KHJA 1RYSA 4LUOA 1JX4A 2PCFB 1I94H 1ASZA 4LH7A 2R8HA 3KAKA 5I9OA 4X65H 4IRCA 3EQLC 4QGUA 1YJ9A 3V6JA 5KFLA 4KN4C
chains in the Genus database with same CATH topology
3DLLA 2JA7G 2A1AA 4P75A 3AYHB 4JI2Q 3RN5A 4BA1I 1VQFA 1R9TH 4X62Q 3GTPH 4YWKA 4X66Q 3NELA 2FXQA 5H1SE 2WB1G 2R6GA 4DV3Q 1N34L 1SR3A 4JBKA 1Q1EA 4O0AA 1U5KA 4DR1Q 5J3BA 4HIKA 2H5XA 2ASBA 2E2IH 3S2DH 2YTXA 5HGQA 4L5SA 1E22A 4A3GG 5LMUQ 3I4MH 2IHEA 4PMWA 1PH5A 4JI0L 2KCTA 1I50H 5GAGC 1PH9A 4YHHQ 3U50C 3HKZE 3CCMA 2PNHA 4DR3Q 1HNZQ 1Q12A 3S1NH 3BZKA 2E2JH 2WB1E 3CQZH 4JC0A 3PUVA 3MXNB 1A62A 1Y1WH 4P73A 1G51A 2ATWA 1LUZA 3F2CA 4DV6L 1HZAA 4C3HH 3L2PA 3MEFA 3S24A 2GVAA 4HJ8A 1JMCA 1NBWA 2RF4A 3NBHB 1AE3A 5C0XJ 1XNQQ 3S14H 4AH6A 4HJAA 4A3KG 3TQYA 3I4NG 2ZJPA 1B8AA 1SROA 5C4XH 4NXNL 2VW9A 3RNUA 3HOZH 1FGUA 4X66L 3GDEA 4ME3A 4BY1G 3CC7A 1KL9A 1GD7A 2PI2E 3L7ZC 4MNOA 2Z6KA 4DV3L 3KFUA 2A19A 3WWVA 2UUCL 4JYAQ 3PUWA 1VQEA 2XTIA 2N3SA 4DR1L 4LFCQ 1N36L 5GAEC 2AMCB 2I5LX 3J81i 4PZ7A 1E1TA 4B3RL 2AHOB 2B63G 3AFQA 3JAMi 1N33Q 1K8AC 3ICEA 4YCUA 4DUZQ 2ALYB 2HIXA 4OWTB 1C7YA 1KRSA 3IRBA 1N9WA 5DLQE 3KF8B 2CCZA 4A3BH 4A3DG 1CUKA 2GN5A 4RMFA 3M4QA 4DR3L 1KRTA 3TEHB 1PH3A 1HNZL 3OW2A 4R4TA 4POGA 4JCVE 5FLMH 4BBSH 4R4CA 3D0FA 4Y7NH 2ES2A 1XNRQ 2F4VL 2IY5B 1NJIC 1JE5A 2K5VA 1PA6A 5M3FG 2JA8H 2Q2HA 4NXML 3PO3G 2HIVA 1LM0A 1IXRA 3EBEA 2HT1A 4LFAL 4JI1L 3T1YQ 1X65A 5HY6A 3CXCA 2JA5H 1BBWA 1WJJA 4A3EG 4B3TQ 4LFBQ 1HNWL 2PI2A 1L1OA 2PMZE 1A8VA 1EIFA 3W5OA 3AEVA 3PCOB 2GVBA 1S72A 2AWOA 1L2FA 1E24A 2JEBI 2DGYA 3SGIA 5C44G 4HIDA 3GTLH 2R93H 1YHBA 1JT8A 1IBMQ 4TVAB 1A0IA 5JJLA 5M5XH 4HIMA 4DAYB 4A4IA 4LFCL 3W1GA 5IYBH 3KYHC 3CMAA 4EX5A 1IBLL 1VQGA 5GAHC 4DUYQ 4A3JH 1SFOH 2VL6A 1VQDA 2BA1A 2D0PA 4P71A 3PIOA 1KD1C 3RZDH 4OO1G 5M5YH 2ID0A 2Z6KC 4DUZL 1LYLA 4L5TA 4YY3Q 1GM5A 4GNXA 1KXLA 1VQ7A 1TWAH 2UUAL 2UUBQ 1PH2A 3G71A 4DR5Q 2CWPA 1UE6A 2JJQA 4YCVA 1EQQA 4NB3A 1B70B 2ZTCA 5JEAJ 4DAMA 4JI3Q 3J80i 3EN2A 3TS0A 4JV5Q 2I5MX 1XNRL 1UE5A 4JI7Q 4IJLA 1XPRA 1KHIA 4OO1I 4LF7L 5C0XI 5K36G 3H3VI 3GO5A 2IT1A 3KDFA 4KI0A 4LF9Q 4BXXG 2UXCL 3PSIA 1HZ9A 1WOCA 3T1YL 1VQ4A 5BR8L 1W2BA 2MO0A 4HIOA 3JC66 2B3GA 4UP9A 5M3FH 3T1HQ 2MFIA 4DR2L 2UU9Q 4IOCA 4A3LG 1PH7A 2R92G 1FVIA 1SLJA 4DR4Q 3K7AH 2R7FA 4AYBE 1HR0Q 3B6YA 1YZ6A 1N8RC 4BBRG 1IYJB 2RHSB 1L1OC 5IP7H 4DV2Q 2R7ZG 3GTQH 3ERSX 1IBKQ 2BH2A 3HKZG 4DV7L 1SRUA 4PG3A 1CSPA 1WYDA 3CMEA 4B3SQ 4GS3A 1Q7YC 4Y52H 1VQAA 2K14A 4DK6C 4YY3L 2CKZB 1XMQQ 5AJ3Q 1C9OA 1YIJA 1LTLA 2E5LL 3HOVG 4POFA 3NEMA 4GNXB 3HOXG 1CKOA 2OTJA 2MQHA 4JI3L 2YTYA 5E7NA 4A3FH 4JI4L 3E0EA 4JV5L 1K83H 4A93G 2HHHQ 4KHZA 4JI6Q 1HZBA 1FJGL 1E3PA 4GNXC 4IFDI 3BU2A 1V43A 4DK3C 5JJKA 1RL2A 2F52A 3STBD 3S17H 3F8TA 5IT9c 4GN5A 5IYCG 4LF8L 3M85A 1YVCA 2Y0SE 4C3JH 4K0KQ 2K4KA 1Q86C 3CCEA 4OWWB 3LGJA 1Y1VH 3KDFB 4XIGS 1G291 1GVPA 2JA6G 3OTOL 3T1HL 4JI8Q 5FJ8H 2KBNA 5IP9H 1Q81C 4DV0Q 4GOPA 2DUDA 2EXDA 5ELOA 4UP8A 2VQEL 2I0QA 2C35B 3CCJA 3TREA 3PUYA 1YJWA 3UDGA 4DV2L 1IL2A 4OXPA 4JI2L 2PQAA 1VQLA 1XTDA 4X62L 1IBKL 4DR6Q 1XJVA 2JQOA 3KOJA 1X3FA 1Q1BA 1I5FA 1TWHH 1WCMH 4IPDA 4DNIA 1ASYA 2BA0A 4UY8C 2JA7H 3A5ZB 3CCUA 1XMQL 3GTMH 1OXVA 3HOYG 3M4OH 3M9BA 3S1RH 1XMOQ 2VNUD 1XPUA 3HOWG 1MKHA 3PF5A 1X55A 1UWVA 1K3RA 3CP0A 5LMUL 1VQ9A 4GKKQ 3E9HA 1EUJA 1JB7A 3J7A5 5GADC 1YHQA 1EQRA 1UE7A 4C3IH 3PV0A 4GN4B 4QL5A 5IWAQ 4YHHL 4AQYQ 1RIPA 1V1QA 3KJOA 2UXBQ 4A3GH 5C3EG 1OXXK 5LMNQ 1JJCB 3W1BA 1K9MC 4K0KL 4R4QA 1FL0A 1J5EQ 4RG1A 1Q82C 4EQ5A 2L15A 1S40A 2JK8A 2Q2TA 2VZAA 1X54A 4L5QA 4JOIA 1OTCA 1YBYA 4APVA 2IHFA 3BZCA 3I7FA 1VQ6A 2VUMG 1VS0A 1K0RA 1QUQB 4JI5Q 1VQIA 2A8VA 2OCEA 1PH6A 4IPHA 2LXJA 1XNQL 2D62A 3GTJH 4DV4Q 2NVQH 4KHPQ 1T9HA 3GTKH 4GOPB 2IX0A 1N32Q 1OXSC 3M4PA 2VQFQ 1PHJA 2WAQE 4UP7A 3I4OA 3GTGH 4O2DA 2ZTEA 2PQAB 4GOPC 4DR6L 1MJEA 1HH2P 3FKIG 4A3KH 4R4IA 4L5RC 4X64Q 1L0WA 4DV5Q 3I4NH 3G6EA 2CQOA 1OXUA 3RLNA 3F2BA 3ULLA 4JYAL 3CCSA 3CPWA 2YYZA 2EQSA 4BY1H 4AIMA 4LNQA 1KIXA 4MZ9A 2OWOA 5M3MG 2LXKA 4GKKL 1N33L 1BBUA 4R1JA 4C2MH 5C0XG 4A3MG 2CWAA 3RZOH 4LF5Q 5IWAL 4AQYL 2JA9A 1NE3A 5GQOA 3ULJA 5M5WH 3RN2A 2XGTA 2B63H 4A76A 1AE2A 1X9NA 1Q46A 4QJFA 2K5HA 3CCRA 4AYBG 1VQHA 4BY7G 3AQQA 4A3DH 2QGQA 1QZGA 1EOVA 3HKSA 1UE1A 3K8AA 2ZJRA 2ZJQA 5C3EH 3KLWA 4FDBA 2F3IA 1C0AA 2N8NA 3CC2A 3UE1A 5GROA 1NY4A 1JJGA 4DV4L 1QZHA 4GKJQ 1O7IA 1MJCA 1X56A 4PZ8A 4R4OA 4B3TL 4LFBL 1N34Q 2YTVA 3PO3H 1TXYA 2KCMA 3EIVA 4JOIC 1UEBA 2VQFL 4LW1A 5ELNA 3J81c 3UE0A 4JBWA 3L0OA 4A3EH 4XTCS 1IBML 3JAMc 4HJ9A 1DGSA 4LF4Q 1QVFA 1CKNA 2KENA 5EAYA 5C44H 1Y1WG 2N49A 1P8LA 4DV1Q 4DUYL 3UDIA 1SE8A 4IFDG 2Y0SG 1HR0W 2AWNA 3I2ZA 3S2HH 3CD6A 3G48A 3I55A 4QY7A 3TRZA 3U58A 4LF5L 4IJHA 3PGZA 2UUBL 4DR5L 1JJ2A 1S3OA 2VY3A 4DV6Q 3CCLA 3HOZG 5C4XG 2EIFA 3OYYA 1D7QA 2V1CC 1KAWA 2RCNA 4A3MH 1TWCH 3H3VH 3M7NA 4JI7L 2Q2IA 1X3EA 3U4ZA 3GD7A 3CCQA 1EIYB 1SN8A 2QA4A 3CF5A 1E7ZA 4NXNQ 2K52A 2R7DA 4IPCA 2NVYH 3D31A 4LF9L 4QIWE 4BY7H 2WP8J 4GKJL 3ULPA 3VDYA 2YV5A 4GN3B 3CW2C 3F1ZA 2UUCQ 2UU9L 4OX9Q 1QUQA 4UPAA 3K7UC 1N36Q 1YHAA 3HFZB 4BXXH 4A3BG 4DR4L 1KQSA 5JEAG 3H0GG 1HR0L 4JBJA 5FLXc 4B3RQ 4H02A 2QEXA 4LF4L 1D8LA 1PYSB 2BH8A 2NN6G 3U4VA 1NTGA 3M3YH 2R92H 4A3LH 3FP9A 5FLMG 4BBSG 2UXDQ 3H15A 1CKNB 4DV1L 1VQCA 1VQ8A 3S15H 4B3SL 3J80c 4IO9A 1HZCA 4GLXA 2JA8G 1Q8KA 1PYBA 4BBRH 2Z0SA 2R7ZH 1BVSA 1Z47A 2F4VQ 5AJ3L 4A3CG 3S1QH 2JA5G 4JBMA 3E9IA 2NN6I 4GLAC 4P74A 4NXMQ 3PUXA 1X3GA 4A3IG 2R93G 4LFAQ 2HQLA 4JI1Q 1I94Q 3KF6A 2HHHL 4JI6L 3HOVH 1VQMA 3FHWA 3K81C 2NZOA 3HOXH 3G4SA 1PV4A 4X65Q 1HNWQ 1QVGA 3UDXA 3HOUG 1K8GA 2WAQG 2K5NA 5IYBG 2MO1A 1SMXA 3CC4A 3AFPA 2WFWA 4B3MQ 1K73C 2NVXH 4A93H 4LUZA 4A3JG 1I3QH 3CAMA 1YITA 3PIPA 1A63A 2CFMA 4MTNA 3A0JA 3A5UA 5IYCH 4OX9L 2N78A 4JI8L 4IOAA 5LMNW 4LWCA 4TQUS 1HJPA 1EYGA 1E1OA 4YCWA 3ZJYC 4DV0L 1IBLQ 2OTLA 1YJNA 1M90C 2JEAI 4LUVA 3CCVA 2JA6H 4OWXB 4LF6Q 2K75A 1G6PA 4YWLA 1GKHA 2UUAQ 3RLOA 1PH1A 2UXDL 1J6QA 1AH9A 3RLFA 3H0GH 2E2HH 1EFWA 4IPGA 1VQ5A 2ZM6Q 1KC8C 2MNAA 1HNXQ 2E8GA 3Q8DA 5IE8A 3PO2G 1VCIA 1XMOL 3F2DA 1I6HH 3STBC 3UDFA 4LF7Q 4IFDJ 5IYDG 2NVTH 4KLKA 1PH8A 4NPSA 2UXCQ 1VQJA 2ZTDA 2I5HA 1I94L 3HOYH 5BR8Q 4A3CH 3A74A 4HJ7A 1GO3E 3HOWH 4X65L 1VQBA 3KF6B 4DR2Q 1U0LA 4A3IH 4DR7Q 2UXBL 1TWFH 5IP7G 3KJPA 5LMNL 4PZ6A 5IY0A 2D0OA 4A75A 1J5EL 4B3ML 3BJUA 2LSSA 1CSQA 1WI5A 2K50A 4JG2A 1VQKA 2NZHA 1B7YB 1NMGA 3HOUH 1NMFA 4DKAC 1P16A 4BA2I 2B29A 4DPGA 1W3SA 4JI5L 4DV7Q 1YNXA 2AKWB 3PF4A 4KHPL 3ER0A 2YU9H 2OQKA 1N32L 4LF6L 4P72A 4A3FG 1V9PA 3I4MG 1IZ6A 4OONA 2VUMH 2E5LQ 2Q2UA 3NENA 3K80C 1MIUA 1VQNA 1YEZA 3K0XA 1Y14B 1Z9FA 2ZM6L 4ALPA 4X64L 4JI4Q 4DV5L 1HNXL 4JI0Q 1FJGQ 4WJ3M 3J81j 2JE6I 4HJ5A 1Y1VG 1X6OA 4GLVB 3RR5A 1BKBA 1PH4A 1TWGH 3FKIH 3DM3A 3PUZA 4LF8Q 1PFSA 5IP9G 5FJ8G 5C4JH 2KHIA 3TS2A 1EWIA 3CPFA 4J15A 4YWMA 1OXTA 3S1MH 4QQBX 1CKMA 4WJ4A 1XPOA 3PO2H 2KHJA 3S16H 4LUOA 1YI2A 3OTOQ 3GTOH 5IYDH 4DR7L 3I56A 1VQOA 2RHQB 5M3MH 1L1OB 1WFQA 2VS1A 1QVCA 3J7ZC 1ASZA 5JJIA 4QGUA 1YJ9A 2IX1A 2OQ0A 2VQEQ 1H95A 4X6AH 1VQPA 1PVOA 1M1KC 1WCMG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DLL A;  2JA7 G;  2A1A A;  4P75 A;  3AYH B;  4JI2 Q;  3RN5 A;  4BA1 I;  1VQF A;  1R9T H;  4X62 Q;  3GTP H;  4YWK A;  4X66 Q;  3NEL A;  2FXQ A;  5H1S E;  2WB1 G;  2R6G A;  4DV3 Q;  1N34 L;  1SR3 A;  4JBK A;  1Q1E A;  4O0A A;  1U5K A;  4DR1 Q;  5J3B A;  4HIK A;  2H5X A;  2ASB A;  2E2I H;  3S2D H;  2YTX A;  5HGQ A;  4L5S A;  1E22 A;  4A3G G;  5LMU Q;  3I4M H;  2IHE A;  4PMW A;  1PH5 A;  4JI0 L;  2KCT A;  1I50 H;  5GAG C;  1PH9 A;  4YHH Q;  3U50 C;  3HKZ E;  3CCM A;  2PNH A;  4DR3 Q;  1HNZ Q;  1Q12 A;  3S1N H;  3BZK A;  2E2J H;  2WB1 E;  3CQZ H;  4JC0 A;  3PUV A;  3MXN B;  1A62 A;  1Y1W H;  4P73 A;  1G51 A;  2ATW A;  1LUZ A;  3F2C A;  4DV6 L;  1HZA A;  4C3H H;  3L2P A;  3MEF A;  3S24 A;  2GVA A;  4HJ8 A;  1JMC A;  1NBW A;  2RF4 A;  3NBH B;  1AE3 A;  5C0X J;  1XNQ Q;  3S14 H;  4AH6 A;  4HJA A;  4A3K G;  3TQY A;  3I4N G;  2ZJP A;  1B8A A;  1SRO A;  5C4X H;  4NXN L;  2VW9 A;  3RNU A;  3HOZ H;  1FGU A;  4X66 L;  3GDE A;  4ME3 A;  4BY1 G;  3CC7 A;  1KL9 A;  1GD7 A;  2PI2 E;  3L7Z C;  4MNO A;  2Z6K A;  4DV3 L;  3KFU A;  2A19 A;  3WWV A;  2UUC L;  4JYA Q;  3PUW A;  1VQE A;  2XTI A;  2N3S A;  4DR1 L;  4LFC Q;  1N36 L;  5GAE C;  2AMC B;  2I5L X;  3J81 i;  4PZ7 A;  1E1T A;  4B3R L;  2AHO B;  2B63 G;  3AFQ A;  3JAM i;  1N33 Q;  1K8A C;  3ICE A;  4YCU A;  4DUZ Q;  2ALY B;  2HIX A;  4OWT B;  1C7Y A;  1KRS A;  3IRB A;  1N9W A;  5DLQ E;  3KF8 B;  2CCZ A;  4A3B H;  4A3D G;  1CUK A;  2GN5 A;  4RMF A;  3M4Q A;  4DR3 L;  1KRT A;  3TEH B;  1PH3 A;  1HNZ L;  3OW2 A;  4R4T A;  4POG A;  4JCV E;  5FLM H;  4BBS H;  4R4C A;  3D0F A;  4Y7N H;  2ES2 A;  1XNR Q;  2F4V L;  2IY5 B;  1NJI C;  1JE5 A;  2K5V A;  1PA6 A;  5M3F G;  2JA8 H;  2Q2H A;  4NXM L;  3PO3 G;  2HIV A;  1LM0 A;  1IXR A;  3EBE A;  2HT1 A;  4LFA L;  4JI1 L;  3T1Y Q;  1X65 A;  5HY6 A;  3CXC A;  2JA5 H;  1BBW A;  1WJJ A;  4A3E G;  4B3T Q;  4LFB Q;  1HNW L;  2PI2 A;  1L1O A;  2PMZ E;  1A8V A;  1EIF A;  3W5O A;  3AEV A;  3PCO B;  2GVB A;  1S72 A;  2AWO A;  1L2F A;  1E24 A;  2JEB I;  2DGY A;  3SGI A;  5C44 G;  4HID A;  3GTL H;  2R93 H;  1YHB A;  1JT8 A;  1IBM Q;  4TVA B;  1A0I A;  5JJL A;  5M5X H;  4HIM A;  4DAY B;  4A4I A;  4LFC L;  3W1G A;  5IYB H;  3KYH C;  3CMA A;  4EX5 A;  1IBL L;  1VQG A;  5GAH C;  4DUY Q;  4A3J H;  1SFO H;  2VL6 A;  1VQD A;  2BA1 A;  2D0P A;  4P71 A;  3PIO A;  1KD1 C;  3RZD H;  4OO1 G;  5M5Y H;  2ID0 A;  2Z6K C;  4DUZ L;  1LYL A;  4L5T A;  4YY3 Q;  1GM5 A;  4GNX A;  1KXL A;  1VQ7 A;  1TWA H;  2UUA L;  2UUB Q;  1PH2 A;  3G71 A;  4DR5 Q;  2CWP A;  1UE6 A;  2JJQ A;  4YCV A;  1EQQ A;  4NB3 A;  1B70 B;  2ZTC A;  5JEA J;  4DAM A;  4JI3 Q;  3J80 i;  3EN2 A;  3TS0 A;  4JV5 Q;  2I5M X;  1XNR L;  1UE5 A;  4JI7 Q;  4IJL A;  1XPR A;  1KHI A;  4OO1 I;  4LF7 L;  5C0X I;  5K36 G;  3H3V I;  3GO5 A;  2IT1 A;  3KDF A;  4KI0 A;  4LF9 Q;  4BXX G;  2UXC L;  3PSI A;  1HZ9 A;  1WOC A;  3T1Y L;  1VQ4 A;  5BR8 L;  1W2B A;  2MO0 A;  4HIO A;  3JC6 6;  2B3G A;  4UP9 A;  5M3F H;  3T1H Q;  2MFI A;  4DR2 L;  2UU9 Q;  4IOC A;  4A3L G;  1PH7 A;  2R92 G;  1FVI A;  1SLJ A;  4DR4 Q;  3K7A H;  2R7F A;  4AYB E;  1HR0 Q;  3B6Y A;  1YZ6 A;  1N8R C;  4BBR G;  1IYJ B;  2RHS B;  1L1O C;  5IP7 H;  4DV2 Q;  2R7Z G;  3GTQ H;  3ERS X;  1IBK Q;  2BH2 A;  3HKZ G;  4DV7 L;  1SRU A;  4PG3 A;  1CSP A;  1WYD A;  3CME A;  4B3S Q;  4GS3 A;  1Q7Y C;  4Y52 H;  1VQA A;  2K14 A;  4DK6 C;  4YY3 L;  2CKZ B;  1XMQ Q;  5AJ3 Q;  1C9O A;  1YIJ A;  1LTL A;  2E5L L;  3HOV G;  4POF A;  3NEM A;  4GNX B;  3HOX G;  1CKO A;  2OTJ A;  2MQH A;  4JI3 L;  2YTY A;  5E7N A;  4A3F H;  4JI4 L;  3E0E A;  4JV5 L;  1K83 H;  4A93 G;  2HHH Q;  4KHZ A;  4JI6 Q;  1HZB A;  1FJG L;  1E3P A;  4GNX C;  4IFD I;  3BU2 A;  1V43 A;  4DK3 C;  5JJK A;  1RL2 A;  2F52 A;  3STB D;  3S17 H;  3F8T A;  5IT9 c;  4GN5 A;  5IYC G;  4LF8 L;  3M85 A;  1YVC A;  2Y0S E;  4C3J H;  4K0K Q;  2K4K A;  1Q86 C;  3CCE A;  4OWW B;  3LGJ A;  1Y1V H;  3KDF B;  4XIG S;  1G29 1;  1GVP A;  2JA6 G;  3OTO L;  3T1H L;  4JI8 Q;  5FJ8 H;  2KBN A;  5IP9 H;  1Q81 C;  4DV0 Q;  4GOP A;  2DUD A;  2EXD A;  5ELO A;  4UP8 A;  2VQE L;  2I0Q A;  2C35 B;  3CCJ A;  3TRE A;  3PUY A;  1YJW A;  3UDG A;  4DV2 L;  1IL2 A;  4OXP A;  4JI2 L;  2PQA A;  1VQL A;  1XTD A;  4X62 L;  1IBK L;  4DR6 Q;  1XJV A;  2JQO A;  3KOJ A;  1X3F A;  1Q1B A;  1I5F A;  1TWH H;  1WCM H;  4IPD A;  4DNI A;  1ASY A;  2BA0 A;  4UY8 C;  2JA7 H;  3A5Z B;  3CCU A;  1XMQ L;  3GTM H;  1OXV A;  3HOY G;  3M4O H;  3M9B A;  3S1R H;  1XMO Q;  2VNU D;  1XPU A;  3HOW G;  1MKH A;  3PF5 A;  1X55 A;  1UWV A;  1K3R A;  3CP0 A;  5LMU L;  1VQ9 A;  4GKK Q;  3E9H A;  1EUJ A;  1JB7 A;  3J7A 5;  5GAD C;  1YHQ A;  1EQR A;  1UE7 A;  4C3I H;  3PV0 A;  4GN4 B;  4QL5 A;  5IWA Q;  4YHH L;  4AQY Q;  1RIP A;  1V1Q A;  3KJO A;  2UXB Q;  4A3G H;  5C3E G;  1OXX K;  5LMN Q;  1JJC B;  3W1B A;  1K9M C;  4K0K L;  4R4Q A;  1FL0 A;  1J5E Q;  4RG1 A;  1Q82 C;  4EQ5 A;  2L15 A;  1S40 A;  2JK8 A;  2Q2T A;  2VZA A;  1X54 A;  4L5Q A;  4JOI A;  1OTC A;  1YBY A;  4APV A;  2IHF A;  3BZC A;  3I7F A;  1VQ6 A;  2VUM G;  1VS0 A;  1K0R A;  1QUQ B;  4JI5 Q;  1VQI A;  2A8V A;  2OCE A;  1PH6 A;  4IPH A;  2LXJ A;  1XNQ L;  2D62 A;  3GTJ H;  4DV4 Q;  2NVQ H;  4KHP Q;  1T9H A;  3GTK H;  4GOP B;  2IX0 A;  1N32 Q;  1OXS C;  3M4P A;  2VQF Q;  1PHJ A;  2WAQ E;  4UP7 A;  3I4O A;  3GTG H;  4O2D A;  2ZTE A;  2PQA B;  4GOP C;  4DR6 L;  1MJE A;  1HH2 P;  3FKI G;  4A3K H;  4R4I A;  4L5R C;  4X64 Q;  1L0W A;  4DV5 Q;  3I4N H;  3G6E A;  2CQO A;  1OXU A;  3RLN A;  3F2B A;  3ULL A;  4JYA L;  3CCS A;  3CPW A;  2YYZ A;  2EQS A;  4BY1 H;  4AIM A;  4LNQ A;  1KIX A;  4MZ9 A;  2OWO A;  5M3M G;  2LXK A;  4GKK L;  1N33 L;  1BBU A;  4R1J A;  4C2M H;  5C0X G;  4A3M G;  2CWA A;  3RZO H;  4LF5 Q;  5IWA L;  4AQY L;  2JA9 A;  1NE3 A;  5GQO A;  3ULJ A;  5M5W H;  3RN2 A;  2XGT A;  2B63 H;  4A76 A;  1AE2 A;  1X9N A;  1Q46 A;  4QJF A;  2K5H A;  3CCR A;  4AYB G;  1VQH A;  4BY7 G;  3AQQ A;  4A3D H;  2QGQ A;  1QZG A;  1EOV A;  3HKS A;  1UE1 A;  3K8A A;  2ZJR A;  2ZJQ A;  5C3E H;  3KLW A;  4FDB A;  2F3I A;  1C0A A;  2N8N A;  3CC2 A;  3UE1 A;  5GRO A;  1NY4 A;  1JJG A;  4DV4 L;  1QZH A;  4GKJ Q;  1O7I A;  1MJC A;  1X56 A;  4PZ8 A;  4R4O A;  4B3T L;  4LFB L;  1N34 Q;  2YTV A;  3PO3 H;  1TXY A;  2KCM A;  3EIV A;  4JOI C;  1UEB A;  2VQF L;  4LW1 A;  5ELN A;  3J81 c;  3UE0 A;  4JBW A;  3L0O A;  4A3E H;  4XTC S;  1IBM L;  3JAM c;  4HJ9 A;  1DGS A;  4LF4 Q;  1QVF A;  1CKN A;  2KEN A;  5EAY A;  5C44 H;  1Y1W G;  2N49 A;  1P8L A;  4DV1 Q;  4DUY L;  3UDI A;  1SE8 A;  4IFD G;  2Y0S G;  1HR0 W;  2AWN A;  3I2Z A;  3S2H H;  3CD6 A;  3G48 A;  3I55 A;  4QY7 A;  3TRZ A;  3U58 A;  4LF5 L;  4IJH A;  3PGZ A;  2UUB L;  4DR5 L;  1JJ2 A;  1S3O A;  2VY3 A;  4DV6 Q;  3CCL A;  3HOZ G;  5C4X G;  2EIF A;  3OYY A;  1D7Q A;  2V1C C;  1KAW A;  2RCN A;  4A3M H;  1TWC H;  3H3V H;  3M7N A;  4JI7 L;  2Q2I A;  1X3E A;  3U4Z A;  3GD7 A;  3CCQ A;  1EIY B;  1SN8 A;  2QA4 A;  3CF5 A;  1E7Z A;  4NXN Q;  2K52 A;  2R7D A;  4IPC A;  2NVY H;  3D31 A;  4LF9 L;  4QIW E;  4BY7 H;  2WP8 J;  4GKJ L;  3ULP A;  3VDY A;  2YV5 A;  4GN3 B;  3CW2 C;  3F1Z A;  2UUC Q;  2UU9 L;  4OX9 Q;  1QUQ A;  4UPA A;  3K7U C;  1N36 Q;  1YHA A;  3HFZ B;  4BXX H;  4A3B G;  4DR4 L;  1KQS A;  5JEA G;  3H0G G;  1HR0 L;  4JBJ A;  5FLX c;  4B3R Q;  4H02 A;  2QEX A;  4LF4 L;  1D8L A;  1PYS B;  2BH8 A;  2NN6 G;  3U4V A;  1NTG A;  3M3Y H;  2R92 H;  4A3L H;  3FP9 A;  5FLM G;  4BBS G;  2UXD Q;  3H15 A;  1CKN B;  4DV1 L;  1VQC A;  1VQ8 A;  3S15 H;  4B3S L;  3J80 c;  4IO9 A;  1HZC A;  4GLX A;  2JA8 G;  1Q8K A;  1PYB A;  4BBR H;  2Z0S A;  2R7Z H;  1BVS A;  1Z47 A;  2F4V Q;  5AJ3 L;  4A3C G;  3S1Q H;  2JA5 G;  4JBM A;  3E9I A;  2NN6 I;  4GLA C;  4P74 A;  4NXM Q;  3PUX A;  1X3G A;  4A3I G;  2R93 G;  4LFA Q;  2HQL A;  4JI1 Q;  1I94 Q;  3KF6 A;  2HHH L;  4JI6 L;  3HOV H;  1VQM A;  3FHW A;  3K81 C;  2NZO A;  3HOX H;  3G4S A;  1PV4 A;  4X65 Q;  1HNW Q;  1QVG A;  3UDX A;  3HOU G;  1K8G A;  2WAQ G;  2K5N A;  5IYB G;  2MO1 A;  1SMX A;  3CC4 A;  3AFP A;  2WFW A;  4B3M Q;  1K73 C;  2NVX H;  4A93 H;  4LUZ A;  4A3J G;  1I3Q H;  3CAM A;  1YIT A;  3PIP A;  1A63 A;  2CFM A;  4MTN A;  3A0J A;  3A5U A;  5IYC H;  4OX9 L;  2N78 A;  4JI8 L;  4IOA A;  5LMN W;  4LWC A;  4TQU S;  1HJP A;  1EYG A;  1E1O A;  4YCW A;  3ZJY C;  4DV0 L;  1IBL Q;  2OTL A;  1YJN A;  1M90 C;  2JEA I;  4LUV A;  3CCV A;  2JA6 H;  4OWX B;  4LF6 Q;  2K75 A;  1G6P A;  4YWL A;  1GKH A;  2UUA Q;  3RLO A;  1PH1 A;  2UXD L;  1J6Q A;  1AH9 A;  3RLF A;  3H0G H;  2E2H H;  1EFW A;  4IPG A;  1VQ5 A;  2ZM6 Q;  1KC8 C;  2MNA A;  1HNX Q;  2E8G A;  3Q8D A;  5IE8 A;  3PO2 G;  1VCI A;  1XMO L;  3F2D A;  1I6H H;  3STB C;  3UDF A;  4LF7 Q;  4IFD J;  5IYD G;  2NVT H;  4KLK A;  1PH8 A;  4NPS A;  2UXC Q;  1VQJ A;  2ZTD A;  2I5H A;  1I94 L;  3HOY H;  5BR8 Q;  4A3C H;  3A74 A;  4HJ7 A;  1GO3 E;  3HOW H;  4X65 L;  1VQB A;  3KF6 B;  4DR2 Q;  1U0L A;  4A3I H;  4DR7 Q;  2UXB L;  1TWF H;  5IP7 G;  3KJP A;  5LMN L;  4PZ6 A;  5IY0 A;  2D0O A;  4A75 A;  1J5E L;  4B3M L;  3BJU A;  2LSS A;  1CSQ A;  1WI5 A;  2K50 A;  4JG2 A;  1VQK A;  2NZH A;  1B7Y B;  1NMG A;  3HOU H;  1NMF A;  4DKA C;  1P16 A;  4BA2 I;  2B29 A;  4DPG A;  1W3S A;  4JI5 L;  4DV7 Q;  1YNX A;  2AKW B;  3PF4 A;  4KHP L;  3ER0 A;  2YU9 H;  2OQK A;  1N32 L;  4LF6 L;  4P72 A;  4A3F G;  1V9P A;  3I4M G;  1IZ6 A;  4OON A;  2VUM H;  2E5L Q;  2Q2U A;  3NEN A;  3K80 C;  1MIU A;  1VQN A;  1YEZ A;  3K0X A;  1Y14 B;  1Z9F A;  2ZM6 L;  4ALP A;  4X64 L;  4JI4 Q;  4DV5 L;  1HNX L;  4JI0 Q;  1FJG Q;  4WJ3 M;  3J81 j;  2JE6 I;  4HJ5 A;  1Y1V G;  1X6O A;  4GLV B;  3RR5 A;  1BKB A;  1PH4 A;  1TWG H;  3FKI H;  3DM3 A;  3PUZ A;  4LF8 Q;  1PFS A;  5IP9 G;  5FJ8 G;  5C4J H;  2KHI A;  3TS2 A;  1EWI A;  3CPF A;  4J15 A;  4YWM A;  1OXT A;  3S1M H;  4QQB X;  1CKM A;  4WJ4 A;  1XPO A;  3PO2 H;  2KHJ A;  3S16 H;  4LUO A;  1YI2 A;  3OTO Q;  3GTO H;  5IYD H;  4DR7 L;  3I56 A;  1VQO A;  2RHQ B;  5M3M H;  1L1O B;  1WFQ A;  2VS1 A;  1QVC A;  3J7Z C;  1ASZ A;  5JJI A;  4QGU A;  1YJ9 A;  2IX1 A;  2OQ0 A;  2VQE Q;  1H95 A;  4X6A H;  1VQP A;  1PVO A;  1M1K C;  1WCM G; 
#chains in the Genus database with same CATH topology
 3DLL A;  2R7K A;  3GTP H;  1EYD A;  4X62 Q;  1V51 A;  1ZYR C;  4YIJ A;  4FS2 A;  4ECU A;  1N34 L;  3F8N A;  3MWD A;  4O0A A;  1PTO B;  2ASB A;  2E2I H;  2IW3 A;  1BR9 A;  5DM7 3;  3PN1 A;  1E22 A;  5LP6 F;  5LMU Q;  3I4M H;  1SYF A;  3RZO B;  1PH5 A;  4UFZ A;  4JI0 L;  1I50 H;  1M0W A;  2ZJT A;  4DV5 H;  1HNX H;  1TWC A;  1F9Q A;  3CCM A;  4J8Q A;  1Q12 A;  1GHK A;  1B53 A;  2F0G A;  4CHT B;  2L4N A;  2WB1 E;  3CQZ H;  2DZD A;  3T5L A;  4LF7 H;  4JC0 A;  2I87 A;  1BNZ A;  2O5I C;  1G51 A;  2ATW A;  1HUN A;  1KAA A;  4ZLT F;  2HVS A;  1JC7 A;  4KN7 C;  3HBL A;  3NBH B;  4TRD A;  5C0X J;  1XNQ Q;  4DR7 H;  3S14 H;  4K5X A;  5M3F B;  4AH6 A;  1C3O A;  3PO3 B;  2CQA A;  3I4N G;  2AUJ D;  3HRZ C;  3KBG A;  4K2K A;  2ZJP A;  2YZM A;  5DLG A;  4KK7 A;  4NXN L;  2VW9 A;  3GLK A;  4A3E B;  3OHX C;  4Q0Y A;  4BY1 G;  3GII A;  4DL2 A;  2Z6K A;  3T5H A;  3WWV A;  2UUC L;  3PW5 A;  4JYA Q;  3PUW A;  3RFC A;  4LFC Q;  2N3S A;  1WTH A;  3VR2 A;  2JA7 A;  5KG0 A;  3HKZ A;  2B63 G;  1HA6 A;  1K8A C;  2RKS A;  2DJG C;  2HIX A;  4OWT B;  3K5N A;  3BQ0 A;  3T13 A;  3P1H A;  3IRB A;  4A3D G;  4JPB W;  3R5X A;  1CUK A;  2ASJ A;  1GLV A;  5E4W C;  3TEH B;  1J9O A;  2HCC A;  4XYO A;  3OW2 A;  2W6Q A;  1FYC A;  2EY2 A;  5FLM H;  2R7N A;  2F4V L;  1JLL B;  2HDM A;  2IY5 B;  3N44 B;  1Q3L A;  1JE5 A;  2K5V A;  1MGS A;  1QE6 A;  4CJ1 B;  1VF5 C;  1IXR A;  2IJ0 A;  2ALZ A;  4JI1 L;  1T36 A;  1X65 A;  2WII B;  3CXC A;  2JA5 H;  4RZR A;  3HGB A;  3MC0 B;  2AUK A;  1XYI A;  2PMZ E;  3NE5 B;  3W5O A;  3GTJ A;  3D6C A;  3PCO B;  2GVB A;  3K5O A;  1RTO A;  3GTL H;  2JEB I;  3SGI A;  5C44 G;  2FLP A;  2PYK A;  1W6K A;  4MV3 A;  2R8I A;  3GTG A;  2R92 B;  2BQ3 A;  5JJL A;  3K5I A;  1I4P A;  4DAY B;  4LFC L;  4DV3 H;  3CMA A;  4EX5 A;  1VQG A;  4A3J H;  2EY5 A;  5KFF A;  2V5A A;  1VQD A;  2D0P A;  3PMF A;  4I55 F;  2K5W A;  5M5Y H;  4OO1 G;  4O4I F;  4MTD A;  3K59 A;  5LYJ F;  1MZB A;  5JJZ A;  1TWA H;  4B3R H;  2IWH A;  1JIC A;  4FM9 A;  1MHW C;  3E0J A;  3RB0 A;  4NB3 A;  1JWS D;  4G7H C;  3EN2 A;  4ME5 A;  4F4Y A;  3CU7 A;  2I5M X;  1BO0 A;  2E2D C;  3ERQ A;  4CDE C;  5EJW A;  2B2V A;  3T51 B;  4I65 A;  4A93 B;  3MVV A;  2NVX B;  5K36 G;  3GO5 A;  5KFU A;  1WOC A;  1VQ4 A;  5BR8 L;  4FYD A;  3T16 A;  2XSC A;  1SNC A;  2MFI A;  2A74 C;  2X69 A;  4DN4 M;  1M7J A;  4OHJ A;  5JVL A;  4CGY B;  1AN7 A;  3BAB A;  3BDC A;  4ZKB B;  1EL0 A;  3K0Y A;  1T3N A;  3RGZ A;  3GTK B;  4DR4 Q;  1ICW A;  1PRT B;  1K8M A;  2ASL A;  1YZ6 A;  4BBR G;  1IYJ B;  1L1O C;  2R7Z G;  3AU7 A;  4OIK A;  2F0P A;  2BH2 A;  4QW9 A;  5D1P A;  5K2M A;  1PFN A;  3I12 A;  1IBL H;  3GQB A;  2BE5 D;  1ZQ7 A;  1PYW D;  4DNR B;  5AJ3 Q;  5CAE B;  5IYZ F;  1B9M A;  1N33 H;  4O3R A;  3HOX G;  3KHL A;  2QW7 A;  4JK1 C;  2AU0 A;  2BOS A;  2R87 A;  4O3P A;  5E7N A;  4H44 C;  2XRQ D;  4C1N K;  4A3F H;  4JI4 L;  1K0S A;  3GID A;  2HHH Q;  4IFD I;  1E3P A;  1Q90 A;  1TWF B;  3BU2 A;  1V43 A;  5KRU A;  5JJK A;  1RL2 A;  3STB D;  3F8T A;  4GN5 A;  4ECZ A;  3BYT B;  2FK3 A;  2CVR A;  4C3J H;  4U6P A;  1IL8 A;  1Q86 C;  4OWW B;  3KDF B;  2DY8 A;  2NVY A;  3OTO L;  3T1Y H;  5FJ8 H;  4DA2 A;  4TV8 F;  3FPP A;  5EBC A;  3J7A F;  4K2L A;  1SNQ A;  2AQ3 B;  5G3L D;  4GOP A;  1EWH A;  4DR2 H;  4UP8 A;  2VQE L;  5KYL A;  3PUY A;  1YJW A;  3Q8S B;  1XXG A;  3UDG A;  4EYH B;  2VA2 A;  1XDN A;  4OXP A;  1IOW A;  2F0N A;  3DXJ C;  1HTP A;  5FO9 B;  3BJY A;  5FLX E;  4DNI A;  2BA0 A;  2JA7 H;  4DV7 H;  2AQ4 A;  3CCU A;  3GTM H;  1OXV A;  3M4O H;  5FD5 A;  1I6V C;  5C4J B;  1HFG A;  3S1M B;  3J80 E;  5EWF A;  1K3B C;  1KNE A;  1UWV A;  1X55 A;  4FNF A;  1GJX A;  3E5N A;  4DR5 H;  4R8U A;  1T5E A;  3BQ2 A;  4J9O A;  4JI3 H;  1EQR A;  1UE7 A;  1I6U A;  4GN4 B;  1VBG A;  3RAX A;  1RIP A;  1V1Q A;  2F0I A;  2SNM A;  4IZ8 A;  4JI7 H;  1RF2 D;  1VMP A;  2L15 A;  4ECW A;  2JK8 A;  2MHV A;  4OIJ A;  3LP8 A;  5JPM C;  2FLL A;  3WO0 A;  1VQ6 A;  1STN A;  4YBZ B;  1QUQ B;  3PQI A;  1VQI A;  3A54 A;  2OCE A;  1PH6 A;  4IPH A;  2UU9 H;  2D62 A;  3GTJ H;  1S5C D;  4Q5V A;  3Q8Q B;  1UEA B;  1AUV A;  3OSP A;  1PHJ A;  3E6Z X;  4UP7 A;  1SEI A;  3I4O A;  3GTG H;  4EVO A;  4ETS A;  2J0T D;  3I4L A;  1KDB A;  4RUA A;  5BPH A;  4A3K H;  1DV2 A;  3N8D A;  3H4B A;  2SDF A;  1IBK H;  1JKJ B;  2ENB A;  2A6H C;  1EY5 A;  3F2B A;  1OXU A;  1ROD A;  2A73 B;  3CCS A;  1VMC A;  2YYZ A;  4LNQ A;  3QOL A;  2LXK A;  1EY9 A;  1C8C A;  1Y1W B;  1BBU A;  4R1J A;  2F0V A;  4A3M G;  4RB3 C;  4C3H B;  3HP3 A;  1ET6 A;  5KFT A;  5EPL A;  4UCU A;  1CHQ D;  3NQT A;  4N9P A;  1AE2 A;  3RB6 A;  1Q46 A;  4QJF A;  2K5H A;  1ILP A;  5CYU A;  3TZU A;  2UVR A;  4BY7 G;  1RJT A;  2QGQ A;  3BYY B;  3BG5 A;  2IP4 A;  1UE1 A;  4FDB A;  3PIP 3;  2VB3 X;  4HMI A;  2EPB A;  2F0J A;  2WAQ A;  3GV7 B;  2PZW A;  4GKJ Q;  1T94 A;  1MJC A;  4PZ8 A;  4B3T L;  4LFB L;  1TXY A;  1JOK A;  4BWG B;  3NGD A;  3TQ1 A;  2YU9 A;  3D4R A;  4MA0 A;  2AQ1 B;  4EG0 A;  3UE0 A;  1II3 A;  2VUM A;  2VUG A;  4Z9C B;  5A2Q W;  3JAM c;  1DGS A;  5DG7 A;  2PW7 A;  4A3B B;  3R5F A;  4S3S A;  4LJZ C;  1TS3 A;  5ISR A;  2FK2 A;  1K28 A;  4DUY L;  3UDI A;  4JYA H;  4BBS B;  1LTG D;  3I2Z A;  3S2H H;  5EKI A;  4Y7N B;  4Q45 A;  3G48 A;  2B2Y A;  3TRZ A;  1XWE A;  3U58 A;  5ELF A;  2UUB L;  2JA8 B;  1JJ2 A;  4KKU A;  1S3O A;  3ZYY X;  3OHA A;  1HPC A;  4TSS A;  3H91 A;  3GTO A;  1M4V A;  1UC8 A;  1KAW A;  4KY7 A;  3H3V H;  3IL8 A;  4A3I B;  2KEC A;  1X3E A;  2HGS A;  4ECS A;  3GQC A;  2R93 B;  4YR2 A;  1KLU D;  2QA4 A;  5K5P A;  1GUN A;  1HFN A;  2F0Q A;  3TDQ A;  2K52 A;  2NVY H;  3D31 A;  2F03 A;  3I72 A;  1S0N A;  2O03 A;  4DGZ A;  3GTQ A;  2WAC A;  3HOU B;  4GKJ L;  3U9T A;  2G9H D;  3RF2 A;  5JH7 F;  4AYB A;  1R9T A;  2YV5 A;  2FLN A;  3CW2 C;  4K5V A;  4OX9 Q;  3PW2 A;  5EGT A;  4KHP H;  1JE4 A;  1YHA A;  4BXX H;  1N32 H;  3GIP A;  3FMC A;  3RZD B;  3H0G G;  1HR0 L;  4MV7 A;  5KFG A;  3KK7 A;  2N88 A;  1OWT A;  5JVD F;  4A3L H;  1G6Z A;  3FP9 A;  5FLM G;  2UXD Q;  4FS1 A;  1CKN B;  1AN8 A;  3OUU A;  3M9M B;  2VB2 X;  1SJH D;  4C1N I;  1PYB A;  2L55 A;  2Z0S A;  1Z7T A;  2P0A A;  5D8D A;  4Q8F A;  3MFY A;  1Z47 A;  1TWG B;  2XGP A;  2HVR A;  2JA5 G;  5J2T F;  1Y1V A;  4F88 A;  4P74 A;  4NXM Q;  3PUX A;  4O1N A;  4YP3 A;  3S16 B;  2WE6 A;  1I94 Q;  1E4E B;  1YNN C;  3FHW A;  2DIK A;  1PV4 A;  1PZI D;  4X65 Q;  1BCP C;  1QVG A;  3DEO A;  4LMQ D;  2MO1 A;  2K01 A;  1I4Q A;  3AFP A;  1K73 C;  4A3J G;  3CAM A;  3PIP A;  2F0D A;  4QUF A;  3GV5 B;  1S5D D;  4L63 B;  5IYC H;  4OX9 L;  4JI8 L;  1GYF A;  4LWC A;  1HJP A;  4YCW A;  5A35 A;  5IOD A;  2OTL A;  2R8J A;  2JEA I;  2R82 A;  2QYZ A;  2JA6 H;  1J8I A;  1DON A;  2UXD L;  3TP5 A;  1EU3 A;  5LOV F;  1B6S A;  3OSN A;  2Q8T A;  2W7O A;  3RBD A;  2MNA A;  4DV1 H;  2VA3 A;  1HNX Q;  3PR4 A;  3JAM W;  1SXT A;  5IE8 A;  4I7H A;  4K5W A;  1XMO L;  3VYS A;  3F2D A;  1I6H H;  3UDF A;  4LF7 Q;  2FP4 B;  4MTE A;  5LL6 S;  5IYD G;  4ED3 A;  5I2X A;  1B9N A;  2JSO A;  2ZTD A;  2I5H A;  1I94 L;  3HOY H;  1KBL A;  1B33 N;  2LS0 1;  4HJ7 A;  3BA8 A;  5CBA E;  5FPR A;  4X65 L;  2EXZ A;  4DR7 Q;  1LT6 D;  3KJP A;  5IY0 A;  1S10 A;  2LSS A;  1WTO A;  1W93 A;  3OUZ A;  2EYM A;  1SYE A;  3K57 A;  3MFG A;  2L12 A;  4IRK A;  2L11 A;  1TWH B;  1YNX A;  5I6W A;  3DEP A;  3JSN A;  4ZHQ F;  1TY2 A;  2YU9 H;  4A3F G;  2VUM H;  2Q2U A;  3KLR A;  1SYD A;  1YEZ A;  1VQN A;  1IYU A;  4RHS A;  4ALP A;  4DV5 L;  4ABN A;  4C3J G;  3MXP A;  1HNX L;  3TIG A;  2MCT A;  4HJ5 A;  4GLV B;  3R2T A;  1BKB A;  5KG4 A;  3CRK C;  3MXG A;  4LF8 Q;  5FJ8 G;  4NW2 A;  1SYG A;  3RD4 A;  3G8C A;  1CKM A;  2GA4 B;  3PO2 H;  1YI2 A;  2FIN B;  3GTO H;  4O3Q A;  4DR7 L;  4CC6 A;  3I56 A;  4OL7 A;  4FBU A;  1DJR D;  2RHQ B;  3NBH A;  1L1O B;  1WFQ A;  2NVQ B;  5JJI A;  4IWX A;  1FGB D;  4CKE A;  2OQ0 A;  4ID6 A;  2EDG A;  1PTO F;  2BDO A;  2JA7 G;  4P75 A;  3R93 A;  2O2L D;  1BXR A;  4IAJ A;  4BA1 I;  2HQE A;  1R9T H;  1WSC A;  5KFY A;  2FXQ A;  5M5X B;  5KYI A;  1ZET A;  2R6G A;  4DV3 Q;  2CW8 A;  4JBK A;  5FLX L;  1PFM A;  3PIO 3;  4QWB A;  1U5K A;  4C5C A;  4BY1 B;  1SFO B;  1MBY A;  3VR3 A;  3S2D H;  3OSO A;  2YTX A;  3P7J A;  4LF6 H;  1Z2P X;  2ZDH A;  3N43 B;  4IR1 A;  1CA6 A;  1F9P A;  2IHE A;  4PMW A;  3J80 L;  1PH9 A;  5M5W B;  4RWS C;  3RTX A;  2B63 B;  4V0B A;  4P2C B;  3R2I A;  1EIH A;  3N42 B;  2SEB D;  1K8O A;  4A3D B;  1KLG D;  3PUV A;  5BN5 A;  2W57 A;  4XXE A;  2MPM A;  4P73 A;  1D1K A;  5KFJ A;  2UXC H;  2J4X A;  1K1S A;  1HZA A;  3L2P A;  2VPS A;  3GV8 B;  3TP7 A;  2AGO A;  4ODG A;  4QIW A;  2L0C A;  5DQH A;  4A3K G;  3JZI A;  3KBX A;  2F0H A;  1CK1 A;  5C4X H;  5C4Z A;  3HOZ H;  2GLT A;  1KEE A;  5KG6 A;  2X0S A;  3MA2 B;  3GDE A;  3ERO A;  4ME3 A;  2R92 A;  1LV9 A;  1ZKO A;  1KL9 A;  3VYU A;  2G9D A;  3L7Z C;  4DV3 L;  5C44 B;  2JYO A;  2A19 A;  3KFU A;  5T14 A;  3QO2 A;  2XTI A;  1VBH A;  5AFW A;  3W3A A;  1FNW A;  1N36 L;  1WCM A;  2PVP A;  3VMM A;  5GAE C;  4NMZ A;  3J81 i;  3VR4 A;  1D6E C;  2UVW A;  3E5S A;  4PZ7 A;  1E1T A;  4B3R L;  2AHO B;  2R61 A;  3AFQ A;  1N33 Q;  2D5D A;  4F7X A;  4YCU A;  1JXL A;  2KA7 A;  4QWC A;  1KRS A;  3KF8 B;  1WTX A;  4DK1 A;  5JEA H;  3QIA A;  4RMF A;  3BS1 A;  2J9G A;  2NN6 H;  4R4T A;  1TT2 A;  2BQU A;  3WO1 A;  3D0F A;  4IUT A;  2YL2 A;  4FU0 A;  2OLS A;  1PXU A;  3HG9 A;  5HBR B;  1S0M A;  2HIV A;  2I46 A;  4IN3 A;  2OEO A;  2HT1 A;  4LFA L;  1TA8 A;  1CI3 M;  3T1Y Q;  5HY6 A;  4ZCK A;  4UCS A;  1LTR D;  5KG7 A;  2F1M A;  1HNW L;  2PI2 A;  4XDX A;  3QZ8 A;  2A68 C;  1EIF A;  5D1O B;  3PW7 A;  3GTK A;  4F4W A;  1EEI D;  4HID A;  1E24 A;  1CQI B;  3OIQ A;  4ZAI A;  4XYM B;  1UAP A;  2P5Z X;  4JI2 H;  3M3Y B;  2V59 A;  3A56 A;  3GIJ A;  2ASD A;  5DGB A;  5EWG A;  3S15 B;  1PX2 A;  4JV0 A;  1KTK A;  1IBL L;  1PTO H;  3DM1 A;  4BBR B;  2R7Z B;  3PIO A;  2EOT A;  1PLF A;  3L9A X;  5NUC A;  2Z6K C;  3S1Q B;  5CV4 A;  2VR1 A;  4TQS A;  2UUA L;  1PH2 A;  2LY7 A;  2CWP A;  4YCV A;  4DR5 Q;  1EQQ A;  1B70 B;  2ZTC A;  4JI3 Q;  1M8A A;  3KXY T;  1Y69 U;  4YHH H;  4RGM A;  3HOX B;  4DR3 H;  1UE5 A;  4JI7 Q;  1RJP A;  2PZT A;  4TQR A;  2FKL A;  2YZG A;  2B2U C;  5JOB A;  1S68 A;  1CTM A;  5L1K A;  1PFB A;  2F0O A;  1I3Q B;  3KDF A;  2R86 A;  4BXX G;  1PRT F;  1HZ9 A;  2M2L A;  3T1Y L;  4WJW A;  1E4F T;  5IGC A;  3JC6 6;  2B3G A;  4UP9 A;  5M3F H;  2UU9 Q;  4DR2 L;  4IOC A;  4A3L G;  5GON F;  2ZDG A;  2GPS A;  4RUC A;  4DLK A;  3TIN A;  2XCP A;  4AYB E;  2E74 C;  3OMG A;  4X3S A;  1VAJ A;  3NTI A;  3EA6 A;  2CZG A;  3B6Y A;  1N8R C;  1QOH A;  2F0E A;  2Z6B A;  5IP7 H;  3LNN A;  4F50 A;  4Q0F A;  3ERS X;  4ZI7 F;  1IBK Q;  3R8B A;  3K3P A;  4DV7 L;  4UCT A;  4PG3 A;  1KJ9 A;  1H9J A;  4GS3 A;  3JAM E;  5EPJ A;  4RNM A;  3RAQ A;  1YNJ C;  4Y52 H;  1R4Q B;  3C1F A;  2CKZ B;  1F77 A;  2Z9H A;  5EZY F;  4G3I A;  1C9O A;  1YIJ A;  1LTL A;  2E5L L;  2NVT B;  2B2T A;  3NEM A;  4HAE A;  4GNX B;  4ZKC B;  4FBT A;  1X32 A;  3MWY W;  5COY A;  4JI3 L;  5KEE A;  4C2M B;  5CMD A;  4FXK C;  3VA7 A;  4J9N A;  4JI6 Q;  4RH6 A;  1WTW A;  1BUV T;  2F52 A;  3S17 H;  2R6F A;  5IT9 c;  5IYC G;  4Q44 A;  2PMZ B;  2K4K A;  2A69 D;  1L0X B;  2K28 A;  3ETJ A;  3Q0A A;  3Q8R B;  1G29 1;  1GVP A;  2JA6 G;  1KC7 A;  3R23 A;  5IP9 H;  2KBN A;  2AGP A;  5ELB A;  3VA5 A;  1E2W A;  2EXD A;  5FK9 C;  5ELO A;  2WIN B;  2FPI B;  1IL2 A;  1NCV A;  4QWE A;  5JVG 3;  1IBM H;  2XRS D;  2ICE C;  4X62 L;  1IBK L;  4WOR A;  1XJV A;  1CZW A;  1Q1B A;  1WCM H;  2QEJ C;  5CC4 A;  2YS7 A;  3A5Z B;  3OOC A;  4WD3 A;  4ZUI A;  2EYL A;  3HOY G;  3OW7 A;  4XQJ A;  1XPU A;  1EZ8 A;  2WKC A;  1MKH A;  1TY0 A;  1PMR A;  1BCP B;  4APM A;  3T53 B;  2WTF A;  1K3R A;  3EPI A;  5LMU L;  3URY A;  3E9H A;  1QJO A;  2C28 A;  1BDO A;  4EQO A;  1R4P B;  1SAP A;  4NKL A;  2RSO A;  4IWY A;  5JAV A;  2UXB Q;  3QWN A;  5CA0 F;  5C3E G;  4L8J A;  4A3M B;  3A8I E;  4R4Q A;  1K9M C;  4MV4 A;  1J5E Q;  1A2T A;  4U7C A;  3RB4 A;  4TV9 F;  4EBD A;  4LF8 H;  1S40 A;  3SVM A;  1K1Q A;  5D3I B;  2SNS A;  3GTP B;  5CA1 F;  4LF9 H;  1B3Q A;  3H3V C;  1E2V A;  1G2S A;  4JOI A;  4BY7 B;  1SBB B;  2VUM G;  1LTT D;  1VS0 A;  4H0L C;  3WDN A;  3MFI A;  1XNQ L;  4KHP Q;  1GSH A;  1T9H A;  3GTK H;  1N32 Q;  2DJF C;  5C5J A;  3I91 A;  4QCL A;  3Q8P B;  2RA4 A;  2E2I B;  1PK8 A;  3QOJ A;  4FXD A;  4J9S A;  4FF4 A;  4DV2 H;  2I07 B;  2DNE A;  2PQA B;  4GOP C;  3NWS A;  1MJE A;  1JWM D;  4L5R C;  4YQW A;  2R8K A;  1L0W A;  1S0O A;  2E2H A;  3G6E A;  4B3S H;  2CQO A;  4PV1 C;  4JYA L;  3ULL A;  5M9O A;  1EZ6 A;  1XMQ H;  4O4L F;  4AIM A;  1STE A;  2OWO A;  5C3X A;  1A6X A;  5KFI A;  4DL7 A;  4J0M A;  3F2U A;  2JA9 A;  1ESF A;  3GV3 A;  5GQO A;  3ULJ A;  1XX8 A;  1VKZ A;  2XGT A;  2RCF A;  1BGW A;  2YW2 A;  2D2C C;  4QWD A;  3ND9 A;  3S14 B;  1UUP A;  4AYB G;  5DLF A;  1VQH A;  1L0Y B;  3AQQ A;  4RAU C;  4K0K H;  3HKS A;  1LO5 D;  3NP8 A;  2YCH A;  4RZQ A;  3MFH A;  3KLW A;  2JEF A;  2F3I A;  4LAA A;  2J6T A;  1C0A A;  4MN3 A;  3CC2 A;  3BZD B;  5IT9 W;  2XIW A;  5GRO A;  1JJG A;  4R4O A;  4DV0 H;  1CQJ B;  3EIV A;  3PZP A;  2AGQ A;  4JBW A;  2L1B A;  3L0O A;  2C00 A;  4DL5 A;  2IL8 A;  4KV6 A;  4DR6 H;  1CKN A;  1NNX A;  2RDF A;  5COR A;  3H0G B;  3BVZ A;  4DV1 Q;  2A6E D;  3GP7 A;  2NU6 B;  3RB3 A;  1SE8 A;  5T1G A;  2AWN A;  1TWG A;  3DWA A;  4DFA A;  1EHI A;  3FKI A;  3UFX B;  5KFO A;  3I55 A;  2JP1 A;  1D5M C;  4ECY A;  4RB1 A;  2VY3 A;  4DV6 Q;  3PW0 A;  2Z8L A;  3HOZ G;  5C4X G;  2EIF A;  3HS0 C;  4K8J A;  2JA5 B;  1D7Q A;  1E4E A;  2F0S A;  2V1C C;  1TWC H;  5LMN H;  1IHZ A;  1GUG A;  5D3D A;  1SYC A;  3GTL B;  1JQY D;  2RBM A;  3CF5 A;  3I73 A;  3V4Z A;  1TAE A;  1RK5 A;  2NTS A;  1EY8 A;  4IUQ A;  1JR0 D;  4QIW E;  2NWG A;  3P75 A;  2IX3 A;  3VDY A;  5KND A;  2O5J C;  4JI5 H;  2HUG A;  1HA5 A;  4UPA A;  4Y8V B;  4A3J B;  3HFZ B;  2HD3 A;  4Q8E A;  1H9R A;  4DR4 L;  5M5Y B;  2W9A A;  5JEA G;  4H02 A;  3IAY A;  1PYS B;  1GHJ A;  1TWA B;  2BH8 A;  2NN6 G;  2C2E A;  3H15 A;  1MI2 A;  4RB2 C;  1I4G A;  3H40 A;  4DV1 L;  1FNU A;  2EVB A;  4KKT A;  5FD6 A;  1HHV A;  4HQ6 A;  2VQD A;  1BVS A;  3I70 A;  2D9U A;  1U4L A;  5AJ3 L;  4A3C G;  4F4Z A;  4O2B F;  1IW7 D;  4GLA C;  4IFD H;  1X3G A;  3SHL A;  4LF5 H;  2DNC A;  3ETH A;  2BDN A;  2Y0S A;  5KFC A;  3MWM A;  2HHH L;  5E1F A;  3HOV H;  4RCO A;  2UVU A;  4E6I A;  3G4S A;  2M9V A;  1STG A;  5EQ0 A;  5C5M A;  3UDX A;  5JQW A;  1K8G A;  2K5N A;  1NR4 A;  1SMX A;  4DAP A;  4KY5 A;  1O7Y A;  1SMY D;  4LUZ A;  1WD1 A;  1JDE A;  5FO8 B;  2CFM A;  2ATL A;  3A5U A;  2EY1 A;  2K1B A;  2N78 A;  2EYF A;  4TQU S;  1N34 H;  2QIL A;  3K58 A;  4R8N A;  1M90 C;  4RAZ A;  2ZXP A;  1EUD B;  4LF6 Q;  3A8J E;  2K75 A;  2BE5 C;  2OXP A;  4K6D A;  4B9X A;  2DY7 A;  3RLO A;  4LF4 H;  4FVM A;  1CT1 D;  1EEF D;  4A3F B;  2E2H H;  2J6U A;  3EVQ A;  4DK0 A;  5BN3 A;  2E8G A;  3Q8D A;  3S1N B;  3N41 B;  4C3J B;  3STB C;  5IGB A;  5H80 A;  1EWC A;  2E2J B;  3SK6 A;  2UXC Q;  3RGX A;  1PTO D;  3A74 A;  3RMH A;  4ED1 A;  3HOW H;  4L6T B;  1VQB A;  3KF6 B;  3L4K A;  4A3I H;  4HR7 A;  5IP7 G;  4JI6 H;  2W9C A;  4PZ6 A;  3UQ8 A;  4JV1 A;  5F2D A;  3SE7 A;  2D0O A;  5CGK A;  2KVM A;  5IGG A;  4CDF C;  1JOR A;  1DOK A;  4JG2 A;  4NXN H;  5IGF A;  4YR3 A;  1MSG A;  1B7Y B;  3S9W A;  1N48 A;  4J9M A;  3HOU H;  2C9O A;  3D4W A;  1SEB D;  3M7G A;  4DKA C;  4WBN F;  2B29 A;  4IZO A;  4WRD A;  4DPG A;  1A9X A;  4QUC A;  2UUC H;  4Q43 A;  1CQF A;  4KY6 A;  2JA7 B;  3GTM B;  3ER0 A;  2V58 A;  2K04 A;  2Z1C A;  4LF6 L;  3M4O B;  1SFO A;  3I4M G;  1IZ6 A;  3JAM L;  1SSO A;  2B39 A;  3A7L A;  5EOY A;  3K80 C;  5L1I A;  5C3W A;  3WOF A;  4FF1 A;  2B63 A;  4N8F A;  1FJG Q;  4DF7 A;  4R8I A;  1F2L A;  1EYZ A;  3RR5 A;  1TWG H;  1C48 A;  1RCV D;  3FKI H;  2J7Z A;  1JIH A;  2F4V H;  3N52 A;  1PFS A;  3IFD A;  5IP9 G;  1BXT A;  1EWI A;  1FD7 D;  4YWM A;  5KFK A;  1LTB D;  1FR3 A;  2Q8I B;  3S16 H;  1S5B D;  4JI1 H;  1ET9 A;  4ED2 A;  3MHB A;  1VQO A;  5M3M H;  3J7Z C;  3GTJ B;  4BWS C;  2B2W C;  2C2D A;  3DF7 A;  1E4G T;  5C0X H;  1O78 A;  2UXB H;  4X6A H;  2DLN A;  2KSW A;  1J5E H;  1WCM G;  3K3V A;  3GTG B;  1RJR A;  1AP0 A;  3AYH B;  4JI2 Q;  3RN5 A;  1VQF A;  4GC7 A;  3H6M A;  4YWK A;  4A3K B;  3NEL A;  5ELD A;  5CB4 F;  2MP1 A;  5KG2 A;  1F2Y A;  1SR3 A;  2W7P A;  1Q1E A;  1F9R A;  4HIK A;  2CHB D;  1WTR A;  4G7Z C;  3QR8 A;  5KFR A;  4RGT A;  4B9W A;  2M05 A;  5KT3 A;  2KCT A;  4C5B A;  4XZ3 B;  1Q8I A;  2ZM6 H;  3G6X A;  4YHH Q;  4RKB A;  3OHB A;  1K83 A;  3PVX A;  1CHP D;  3HKZ E;  4DR3 Q;  3TME A;  3RUZ A;  3BZK A;  1BBX C;  1M0T A;  3MXN B;  3SE0 A;  1EOT A;  1EUC B;  1LUZ A;  2XWJ B;  1S5E D;  5IT9 E;  5BR8 H;  3MEF A;  3S24 A;  1KNA A;  4HSP A;  2RF4 A;  1JMC A;  1AE3 A;  5DQI A;  2DPI A;  3HEJ A;  4EGV A;  3QFF A;  2K7V A;  2R85 A;  1D5Z C;  3NHH A;  2HDL A;  3MZ5 A;  1B8A A;  3K7A B;  4UCR A;  5CV8 A;  4I4T F;  5CR3 A;  3H94 A;  3CC7 A;  1GD7 A;  5DG9 A;  1MD2 D;  2RGR A;  1MSH A;  1SJE D;  1UNS A;  2AMC B;  1CE8 A;  1LTI D;  2XGQ A;  5J39 A;  1GUW A;  3ICE A;  2RDH A;  4BS9 A;  1C7Y A;  1SYB A;  2WB1 A;  3H09 A;  4R7R A;  4O3N A;  4HYK A;  1LLR D;  1N9W A;  2RSN A;  1PRT D;  2ZXO A;  3M4Q A;  4DR3 L;  4HSV A;  4LSA A;  2KCC A;  4POG A;  4JCV E;  4X3T A;  1QB5 D;  4R4C A;  2ES2 A;  4ED6 A;  1PA6 A;  1I3Q A;  2Q2H A;  2NVY B;  4NXM L;  2RDG A;  1LM0 A;  3OTO H;  2QF7 A;  3D6W A;  4DV6 H;  3D8G A;  3ORR A;  1WJJ A;  5FOB B;  1S97 A;  2G5D A;  1A8V A;  3AEV A;  3V4S A;  1L2F A;  1A3U A;  2NUC A;  3X3N A;  1YHB A;  2FMM A;  2ZXR A;  1ICF B;  4KTA A;  1JT8 A;  1IBM Q;  4TVA B;  4X66 H;  1A0I A;  5M5X H;  2K6A A;  5IYB H;  1STB A;  1AFP A;  2OH2 A;  1EU4 A;  3M9N B;  5GAH C;  1SFO H;  3I90 A;  2VL6 A;  4DR1 H;  2BA1 A;  4P71 A;  4EGJ A;  2V4R A;  2KCN A;  4L5T A;  2PO4 A;  1GM5 A;  4GNX A;  5KNC A;  2XC9 A;  2L5T A;  4R8U B;  1UE6 A;  1W6J A;  2JJQ A;  4C2M A;  4DAM A;  2F4I A;  3J80 i;  4IUR A;  5EBD A;  3FDS A;  3KTM A;  5L9X A;  4EEY A;  4RCN A;  1HNZ H;  4IJL A;  1XPR A;  5JPN C;  1V1P B;  4OO1 I;  2J6S A;  2EYJ A;  4ZRZ A;  4LF7 L;  1LT5 D;  4MV1 A;  4LF9 Q;  3SK5 A;  3PSI A;  2NZ1 D;  2B8F A;  3MR6 A;  2KHS A;  2JA6 B;  1SE2 A;  1LT4 D;  2R7F A;  2A5H A;  1PDQ A;  4DV2 Q;  2RHS B;  1WH2 A;  1DYQ A;  4DU9 A;  3GTQ H;  3EYY A;  2KED A;  1QWY A;  3HKZ G;  2NB0 A;  1CSP A;  1WYD A;  4B3S Q;  2CW0 D;  3I4N B;  2FMA A;  3SXH A;  3VYR A;  2N55 A;  2NU9 B;  4IHJ F;  3GIM A;  1S03 G;  2K14 A;  5C4H A;  4DK6 C;  1NAP A;  4KJN A;  1XMQ Q;  4YAK B;  3PR5 B;  4GC6 A;  1I6H B;  2JEG A;  3HOV G;  1B2T A;  4POF A;  4DUZ H;  1CKO A;  2W6M A;  2MQH A;  3C2P A;  3HOY B;  2NYZ D;  4XT3 B;  1SDF A;  1K83 H;  4ILW A;  2FE3 A;  1HZB A;  2K5Q A;  2W8K A;  3R3O A;  4HN7 A;  4H13 C;  2R7L A;  1IYV A;  1XNR H;  5IGD A;  4LF8 L;  4K0K Q;  2ICI A;  2Y0S E;  2F0U A;  3HZX A;  1B50 A;  3GTP A;  3LGJ A;  1Y1V H;  5C3E B;  1PZJ D;  3QZ7 A;  4J9K A;  3QG1 A;  4B3T H;  4LFB H;  5IOC A;  2KOL A;  4DV0 Q;  2YU9 B;  4RAY A;  4MA5 A;  2EZV A;  4RGO S;  2C35 B;  3CCJ A;  1NUC A;  2E2I A;  3TRE A;  2VUM B;  1KDC A;  4DV2 L;  5KT7 A;  4CDD C;  4MHE A;  2RDI A;  4A2B A;  1ILQ A;  2PQA A;  5CV5 A;  1BF4 A;  1VQL A;  5A2Q E;  4RNO A;  4DR6 Q;  4G7O C;  2FMC A;  1TS5 A;  2JQO A;  1X3F A;  4M1U B;  1ASY A;  4IPD A;  3SDZ A;  4DAY A;  4QMG A;  1XMQ L;  3GIK A;  1ZHQ A;  2M00 A;  3M9B A;  3S1R H;  2FJZ A;  3HOW G;  3J7Y W;  4YY3 H;  2O4X A;  4O3O A;  5I9P A;  2C2R A;  2GPW A;  1KJQ A;  1QNK A;  3CP0 A;  1T5X D;  2EE1 A;  3J7A 5;  2PN1 A;  1GUT A;  5GAD C;  1YHQ A;  5KG5 A;  4C3I H;  3PV0 A;  5D65 A;  5I6Y A;  4QL5 A;  4U67 3;  5IWA Q;  4JV5 H;  2B2T C;  2OF1 A;  4A3G H;  1FJG H;  1EYA A;  1OXX K;  5LMN Q;  3MTS A;  3W1B A;  4K0K L;  1FL0 A;  4IUN A;  1Z2O X;  5TSS A;  2X6L A;  1Q82 C;  1RDP D;  4EQ5 A;  1HQM C;  3T56 B;  1W96 A;  2NVX A;  3AMU A;  4AYB B;  4X3K A;  3BZC A;  2K05 A;  1G91 A;  1KJ8 A;  1ONL A;  1K0R A;  1SE4 A;  4JI5 Q;  4MV9 A;  3T1H H;  2LXJ A;  1GGO A;  1DXM A;  4ED8 A;  3X3M A;  2F3V A;  1OXS C;  3LWE A;  3S2D B;  1CZG A;  2WAQ E;  5BMV F;  5KFD A;  2ZTE A;  2HCI A;  4DR6 L;  4F87 A;  1ZYR D;  5KFX A;  1GUO A;  1HH2 P;  3FKI G;  2Z4I A;  4X64 Q;  2DWC A;  4J9R A;  3H0G A;  1STY A;  1I4X A;  3BQ1 A;  2YS6 A;  2MJ8 A;  3ONA B;  3G6V A;  3V2T A;  1D1I A;  3CPW A;  4L1K A;  4NDX A;  3OMC A;  5CV6 A;  2WDT A;  2JEI A;  4MZ9 A;  5M3M G;  1N33 L;  4C2M H;  5C0X G;  5LL6 X;  3RZO H;  1ENA A;  4LF5 Q;  1DD2 A;  3WNZ A;  5IWA L;  2W9B B;  4XQN A;  4LH6 A;  4KD3 A;  1RTN A;  4A76 A;  1X9N A;  3MR2 A;  3CCR A;  4EFB A;  1TWF A;  1DCZ A;  4MTK A;  5J22 A;  2K03 A;  5I2Y A;  1EOV A;  2L9H A;  3HOZ B;  5C4X B;  3VPC A;  3SK8 A;  2ZJQ A;  5HUR A;  1LAB A;  2N8N A;  3TP8 A;  2WYO A;  4JI8 H;  3UE1 A;  1A15 A;  1NY4 A;  5KT4 A;  1QZH A;  1O7I A;  1QIL A;  1X56 A;  1N34 Q;  4RHR A;  4MIU A;  3VR5 A;  3PO3 H;  2KCM A;  4JOI C;  4OGQ C;  1H9M A;  4LW1 A;  5ELN A;  3J81 c;  1TWA A;  4A3E H;  4XTC S;  4XYQ A;  3CHB D;  4LF4 Q;  2YRX A;  5FLX W;  5EAY A;  2N49 A;  2CH4 A;  1ENC A;  1P8L A;  3U9O A;  2Y0S G;  1L2Z A;  1XMO H;  3CD6 A;  4EYI B;  2WKD A;  4LF5 L;  4GKK H;  4DR5 L;  1QCB D;  2E76 C;  3CCL A;  4AQY H;  3OYY A;  5IT9 L;  3ORQ A;  2E75 C;  2RCN A;  4A3M H;  2HJW A;  3M7N A;  4JI7 L;  2K32 A;  1B6R A;  4ED0 A;  1GSO A;  3GD7 A;  3CCQ A;  1EIY B;  1SN8 A;  4FP5 D;  4RFB A;  1E7Z A;  4NXN Q;  4BY7 H;  1HTL D;  2PZU A;  3EFX D;  1X3Q A;  3MR3 A;  4LMY A;  4DXG A;  3F1Z A;  2UUC Q;  2UU9 L;  1JOO A;  4DV4 H;  1LTS D;  1QUQ A;  2B2V C;  3K7U C;  3SI8 A;  4R9W A;  1FNV A;  1S5F D;  3BDL A;  2W6N A;  1KQS A;  4K14 A;  2VQF H;  3RBE A;  1O7L A;  4LF4 L;  5C8Y F;  4HMJ A;  1NTG A;  2R92 H;  5KFM A;  1SCU B;  5KNB A;  3KUP A;  1VQC A;  3A7A B;  1HZC A;  4GLX A;  2XCA A;  3K6O A;  3OWF A;  3Q23 A;  2F4V Q;  3TQT A;  3E9I A;  2R8G A;  2CH4 W;  5E4X A;  1Y1W A;  2RQX A;  2HQL A;  4JI1 Q;  5IGE A;  4IAL A;  3KF6 A;  2IA6 A;  4JI6 L;  1VQM A;  3K81 C;  4TKO B;  3RJ0 A;  5FKA C;  2C5C A;  5KFE A;  1EYC A;  3V6K A;  2WAQ G;  1EY0 A;  4LK1 C;  2PBZ A;  3C0F B;  5IYB G;  4IQZ A;  2WFW A;  4A93 H;  2NVX H;  3V05 A;  1HRJ A;  2LMC B;  4NLG A;  1JOQ A;  1A63 A;  1WTQ A;  3V96 A;  4GZY C;  1H9S B;  4IOA A;  5LMN W;  1EYG A;  5KIX A;  3GTM A;  3ZJY C;  2ZT9 C;  1TKW B;  3A55 A;  4PWQ A;  4LUV A;  3RV3 A;  3CCV A;  4OWX B;  1G6P A;  3NTH A;  1HUM A;  5F9L A;  1GKH A;  1ZHS A;  4A2A A;  1AH9 A;  5EWE A;  5L1L A;  2B2U A;  3RLF A;  5IIF A;  1EZ1 A;  5T1I A;  3H0G H;  3IFT A;  3I4M B;  3J7A K;  1EFW A;  4IPG A;  3M9O B;  3J81 W;  2ZM6 Q;  1KC8 C;  1I50 B;  2QK4 A;  3S17 B;  1C4Q A;  4MV6 A;  5LHY 1;  3PO2 G;  1VCI A;  3CQZ B;  4KLK A;  4TUY F;  1PH8 A;  1DIK A;  4NPS A;  4EFE A;  1VQJ A;  4NP5 A;  1GUS A;  2A69 C;  5BR8 Q;  1VDZ A;  5BPF A;  4O3S A;  1KAB A;  4ECV A;  1GO3 E;  4DL3 A;  4QIW B;  1U0L A;  2W6Z A;  1V4Y A;  1EY4 A;  2UXB L;  1TWF H;  5KGU A;  1J5E L;  3BJU A;  2W70 A;  1WI5 A;  1F2M A;  3LX0 A;  2R93 A;  4FF2 A;  3AB9 A;  1WTP A;  1NMF A;  5IWA H;  1P16 A;  3TN2 A;  1B4O A;  1WCM B;  3TII A;  2AKW B;  4KHP L;  1N36 H;  4HTH A;  4ZYS A;  2OQK A;  1N32 L;  1ULZ A;  4P72 A;  4M8A A;  3VR6 A;  4OON A;  2KJX A;  2F3W A;  2NTT A;  4J6H A;  1F2Z A;  3NEN A;  4UHV A;  5KT6 A;  3NTK A;  1B44 D;  3K0X A;  2HVQ A;  4CJ2 C;  1Y14 B;  1O75 A;  2ZM6 L;  1SNO A;  5KFH A;  4IR9 A;  4JI4 Q;  2FHT A;  5ELE A;  5DNF A;  1G2T A;  1EY6 A;  1Y1V G;  1PH4 A;  2YRW A;  1CA5 A;  3PW4 A;  3D4D A;  3PUZ A;  3N6R A;  4IUP A;  5C4J H;  3MXN A;  3CPF A;  3S1M H;  1OXT A;  4M9U A;  1XPO A;  2XNA C;  3IKJ A;  4XX0 B;  4LFA H;  3TZD A;  4K8I A;  3OTO Q;  1C30 A;  5IYD H;  4EEQ A;  2VS1 A;  1QVC A;  1HNW H;  1B1Z A;  2IX1 A;  2VQE Q;  4RA8 A;  1H95 A;  1BJT A;  1VQP A;  1PVO A;  3KLS A;  4B3M H;  1M1K C;  3H4D A;  2A1A A;  3T5K A;  3NWT A;  4DAV A;  4X66 Q;  5H1S E;  2FFK B;  4OEM B;  4LSX A;  5A2Q L;  2NUA B;  2WB1 G;  4RB0 A;  3VPB A;  4N9T A;  4RKL A;  2NBF A;  4DR1 Q;  5J3B A;  3QB3 A;  2H5X A;  1V8Q A;  4ULL A;  2UVV A;  4C3I G;  4CKC A;  5HGQ A;  4L5S A;  4HNU A;  4ECX A;  2UUA H;  4A3G G;  2A6H D;  4J9Q A;  3O13 A;  4UDU C;  2F0T A;  4FXG C;  3SK4 A;  5GAG C;  4JVZ A;  4X64 H;  3FPU B;  2FPP B;  3M4Y A;  3U50 C;  3VPD A;  2PNH A;  1HNZ Q;  4PQX A;  2K33 A;  3S1N H;  2IBK A;  1F9S A;  2E2J H;  4PDB A;  1SYX B;  3G6Y A;  1QNU A;  4HED A;  5DM6 3;  1I4H A;  1A62 A;  2F0W A;  1Y1W H;  3NXW A;  3F2C A;  4DV6 L;  4CJ0 B;  4C3H H;  1B3A A;  3JRX A;  1TS2 A;  2GVA A;  4HJ8 A;  5CV9 A;  1NBW A;  1U4R A;  2EY6 A;  1GSA A;  5BN4 A;  3RV4 A;  2B2Y C;  1HXY D;  4HJA A;  3KHH A;  3TQY A;  3UI2 A;  3RNU A;  1SRO A;  1UNN C;  1FGU A;  2AQ2 B;  4X66 L;  4KKS A;  3IG0 A;  2CQY A;  2FJ2 A;  2PI2 E;  4MNO A;  2QKI C;  4FF3 A;  3BDO A;  2RGV A;  1VQE A;  4DR1 L;  1TWH A;  2BQR A;  3OIP A;  5FPO A;  2I5L X;  1SE3 A;  2A6E C;  2SOB A;  2E5L H;  1CM9 A;  3JAM i;  3G7L A;  1DOM A;  4DL4 A;  5DAU A;  4DUZ Q;  2ALY B;  1I4R A;  5DLQ E;  2CCZ A;  4A3B H;  4WFN 3;  2GN5 A;  4JI0 H;  4RGN A;  1KRT A;  1PH3 A;  1HNZ L;  3HXL A;  4UAI A;  2EJF C;  1TWC B;  1B04 A;  1TII D;  2VOB A;  1V1P A;  1DM0 B;  4BBS H;  4ZK9 B;  1XNR Q;  4Y7N H;  2KUM A;  3U9S A;  1RD9 D;  3BAA A;  4YB8 B;  3Q2O A;  1NJI C;  4J9P A;  4UCV A;  1EQT A;  5M3F G;  5L1J A;  2JA8 H;  1CQV A;  5FO7 B;  2I8C A;  4ECR A;  3PO3 G;  3EBE A;  2PNR C;  3RIZ A;  1BBW A;  4A3E G;  4B3T Q;  4HCS A;  4LFB Q;  3SEB A;  1KJJ A;  3Q1K A;  1L1O A;  3BG3 A;  1WTV A;  1S72 A;  2AWO A;  3LML A;  2R93 H;  2JA6 A;  2DGY A;  2FK1 A;  3E3X A;  4B08 A;  1U9R A;  4X62 H;  4HIM A;  1EIG A;  4O4H F;  4A4I A;  3W1G A;  3KYH C;  2R7M A;  2W6P A;  1HQR D;  4K6L A;  4DUY Q;  3TBI B;  1OO9 B;  4N8X 1;  1KD1 C;  1CS0 A;  3NK9 A;  3NUC A;  3RZD H;  2ID0 A;  4DUZ L;  1LYL A;  3HKZ B;  4YY3 Q;  1KXL A;  1G8Z D;  1GXD C;  1VQ7 A;  2UUB Q;  1S9F A;  3G71 A;  5LMU H;  1IW7 C;  5JEA J;  3NQI A;  2XIG A;  1DOL A;  2XD4 A;  3HOV B;  2MGS A;  3EJI A;  1TVX A;  3TS0 A;  4JV5 Q;  1LT3 D;  4IUU A;  1XNR L;  3L3O C;  3I3C A;  1KHI A;  5C5L A;  3LWU A;  1JCK B;  5C0X I;  3H3V I;  2IT1 A;  4KI0 A;  5D14 A;  2UXC L;  2TSS A;  1SMY C;  5LA6 F;  1YNN D;  3K5L A;  1W2B A;  2MO0 A;  4HIO A;  5KFN A;  1JB3 A;  3G6J B;  1BCP D;  3ND8 A;  3T1H Q;  1XNQ H;  3TSS A;  3C46 A;  5KG1 A;  1PH7 A;  2R92 G;  2QCP X;  1LTA D;  1FVI A;  4G57 A;  1SLJ A;  3BVM A;  4PMC A;  3K7A H;  3KHG A;  1HR0 Q;  1IOV A;  3BVG A;  4ZOL F;  5EKK A;  1HCZ A;  2E2H B;  4O2A F;  3J81 E;  1SRU A;  3CME A;  4LFC H;  2FB9 A;  5JVH 3;  4PNY A;  1Q7Y C;  5I4D A;  2V9W A;  5F9N A;  1ENF A;  1VQA A;  4J9L A;  4YY3 L;  3DMU A;  1SND A;  2WV6 D;  1A2U A;  5KT2 A;  2Z4H A;  2QDL A;  2W8L A;  2OTJ A;  1SNM A;  2XWB B;  1RKN A;  2YTY A;  3MEH A;  5DQG A;  1UC9 A;  4RNN A;  3E0E A;  4JV5 L;  3FVQ A;  1PTO C;  4A93 G;  3HOW B;  3KF8 A;  4KHZ A;  1FJG L;  3KLS X;  4GNX C;  1AUX A;  1KDA A;  2F0K A;  4DK3 C;  3CVZ A;  4H7B A;  3M85 A;  1YVC A;  2XCL A;  3CCE A;  5ELC A;  4XIG S;  1I7N A;  3HB9 A;  3T1H L;  4I50 F;  4JI8 Q;  2V4D A;  2KEE A;  1Q81 C;  2I80 A;  2DUD A;  2F0L A;  2I0Q A;  2XN9 C;  4DNT B;  5D1O A;  2EYH A;  2MUY A;  3DUZ A;  4QF4 A;  1XTC D;  4JI2 L;  1EY7 A;  5KFS A;  1XTD A;  5C6A A;  4YAJ B;  3V6H A;  2Q8R E;  3KOJ A;  4EGQ A;  5KFA A;  2XVS A;  2SCU B;  1I5F A;  1TWH H;  3LWB A;  4UY8 C;  3CKI B;  1BNC A;  4ZUJ A;  3FKI B;  2VNU D;  1XMO Q;  3H20 A;  2R7Z A;  3S2H B;  3PF5 A;  1VQ9 A;  3NSW A;  4GKK Q;  5CBE E;  2YYA A;  4HNT A;  1EUJ A;  1JB7 A;  2W9B A;  4IRD A;  5DG8 A;  4E4T A;  4JI4 H;  5M3M B;  4YHH L;  4AQY Q;  3KJO A;  2R3Z A;  3Q24 A;  1D2B A;  1JJC B;  1WD0 A;  3FMA A;  3GV6 A;  3P20 A;  4RG1 A;  2C22 A;  1WVL A;  2BCO A;  2Q2T A;  2VZA A;  1X54 A;  3IN5 A;  4L5Q A;  2H4O A;  1OTC A;  1YBY A;  5L37 A;  4APV A;  2IHF A;  3I7F A;  4KMU C;  2A8V A;  2NVQ H;  2PQE A;  4DXF A;  4DV4 Q;  4GOP B;  4KJO A;  2IX0 A;  4DR4 H;  3M4P A;  2VQE H;  5EKL A;  2VQF Q;  4X3U A;  3TP6 A;  1IKL A;  2EJG C;  4ECT A;  1SNP A;  4I7Z C;  2JEJ A;  4O2D A;  4KHV A;  4ME6 A;  5KFV A;  5KFP A;  4R4I A;  4DV5 Q;  3I4N H;  3EPG A;  5G3L F;  3RLN A;  1IKM A;  1Z2N X;  3RUP A;  4QW8 A;  5E3F A;  5J2U F;  4QWA A;  2EQS A;  4BY1 H;  4C5A A;  5KFQ A;  1KIX A;  2B2W A;  1E0B A;  4GKK L;  3BA9 A;  1N56 A;  3C1E A;  2CWA A;  4MV8 A;  2Y0S B;  1X3P A;  3FDT A;  2EYO A;  4AQY L;  1NE3 A;  4CC5 A;  2EYP A;  5M5W H;  3RN2 A;  2HHH H;  2B63 H;  1AW7 A;  5I47 A;  3FRP B;  5KG3 A;  5LXT F;  3K5M A;  4I7A A;  4A3D H;  1QZG A;  1EQV A;  1DZ1 A;  3K8A A;  2ZJR A;  3C3L A;  5C3E H;  2NU7 B;  1EFI D;  4DL6 A;  2PMZ A;  3MAQ A;  1AEX A;  1KJI A;  2CW7 A;  3ITP A;  4QB4 A;  1GOZ A;  3T4A C;  2YZN A;  3K5H A;  1ESR A;  1ZEQ X;  4DV4 L;  4OEL B;  1Y8O B;  3DWP A;  4ZQI A;  2YTV A;  1CFM A;  3QJY A;  2VQF L;  1UEB A;  2F0F A;  4PMB A;  3JSL A;  2DPJ A;  1IBM L;  4YR0 A;  4U68 A;  4HJ9 A;  1H9K A;  1QVF A;  4EBE A;  1TR5 A;  1STA A;  2KQ3 A;  2ZDQ A;  2KEN A;  5C44 H;  1U4M A;  2V4Q A;  1Y1W G;  1PRT C;  4YJ3 F;  1AZQ A;  4IFD G;  4FO2 A;  1HR0 W;  1O7Z A;  4C3H G;  3VYT A;  4CBV A;  5KT5 A;  4QY7 A;  1V1O A;  1JWU D;  1TS4 A;  3FEW X;  2VPQ A;  4IJH A;  3PGZ A;  3KAJ A;  3MJF A;  3MWE A;  2LFN A;  4MAM A;  3W2D A;  2OT2 A;  4OO1 H;  4HR7 B;  3GIL A;  4M7E A;  2JXM B;  3D3R A;  2W9C B;  2H1E A;  1TU2 B;  3I8Z A;  3KAL A;  5DEH A;  5EPK A;  2Q2I A;  3U4Z A;  4JW0 A;  1ZXT A;  2R7D A;  4IPC A;  4CDC C;  4LF9 L;  1PZK D;  2WP8 J;  3ULP A;  2DN8 A;  2WAQ B;  1H9S A;  5C1P A;  4GN3 B;  2A68 D;  4EBC A;  5K36 H;  3L4J A;  1N36 Q;  1RK6 A;  2LKV A;  5CV7 A;  3SR1 A;  4ZQ3 A;  2RVL A;  4F4X A;  4J1M A;  4A3B G;  4B3R Q;  4JBJ A;  5FLX c;  1M6V A;  2QEX A;  1D8L A;  3U4V A;  4EQP A;  2JN4 A;  3M3Y H;  5HGT A;  3DWQ A;  4BBS G;  2RDJ A;  3NBI A;  1NR2 A;  1VQ8 A;  1BCP F;  5J1Z A;  3S15 H;  1I50 A;  4B3S L;  4CKB A;  3J80 c;  4IO9 A;  2JA8 G;  2FPG B;  3GIQ A;  5JUM A;  1Q8K A;  4BBR H;  3KHR A;  3OPO A;  4DUY H;  2R7Z H;  2IMW P;  4O42 A;  3S1Q H;  4JBM A;  1E2Z A;  3CQZ A;  2F0M A;  2NN6 I;  2BR0 A;  2QDB A;  2B8G A;  4A3I G;  2UUB H;  2R93 G;  1QG7 A;  4LFA Q;  3PO2 B;  4G4K A;  5HV6 A;  1JDB B;  1S4Z A;  3GTO B;  3MXU A;  4UCO A;  2NZO A;  3HOX H;  4V19 0;  1HNW Q;  3HOU G;  4EQN A;  3Q6S A;  1WR2 A;  3CC4 A;  4XT1 B;  4B3M Q;  4KD4 A;  1I3Q H;  1YIT A;  4MTN A;  5KX5 F;  3GTQ B;  3A0J A;  1R9T B;  1DV1 A;  3MR5 A;  1ML0 D;  4GKJ H;  3N6X A;  1E1O A;  1IBL Q;  4DV0 L;  1YJN A;  2X6G A;  4HNV A;  2CW0 C;  1STH A;  4YWL A;  3Q22 A;  3J7A V;  3OWE B;  1PH1 A;  2UUA Q;  1HR0 H;  1J6Q A;  1TQO A;  4XYL B;  1Z6H A;  4ECQ A;  1K83 B;  1VQ5 A;  1NSN S;  3NPP A;  1YNJ D;  3M4I A;  2NU8 B;  1A3T A;  5C1O A;  1I7L A;  1RJQ A;  1AZP A;  1D5X C;  4IFD J;  3N40 P;  2NVT H;  4C56 C;  1Y1V B;  1U4P A;  3CRL C;  4A3C H;  4JUZ A;  3JRW A;  3T5J A;  4DR2 Q;  2JA5 A;  5LMN L;  2EJM A;  4A75 A;  4B3M L;  5LL6 b;  1CSQ A;  2K50 A;  3GTL A;  1BOS A;  1VQK A;  2NZH A;  1NMG A;  2VXW A;  5DGA A;  5KFZ A;  1A3V A;  4BA2 I;  1RYR A;  1W3S A;  1RHP A;  1FKA H;  4JI5 L;  4DV7 Q;  4OX9 H;  3PF4 A;  5KFB A;  4XQQ A;  3J81 L;  2TMP A;  1Y8P B;  1V9P A;  3S1R B;  4ED7 A;  2E5L Q;  2WB1 B;  1MIU A;  2W71 A;  2IPK D;  2UXD H;  5KKN B;  1Z9F A;  2PPB C;  4X64 L;  1LAC A;  4C3I B;  2W6O A;  3A8K E;  4JI0 Q;  4WJ3 M;  4RU9 A;  2K5D A;  3J81 j;  2JE6 I;  1X6O A;  4A3G B;  4IUV A;  1O80 A;  1BQQ T;  3R5H A;  2PW5 A;  4F8M A;  3DM3 A;  5EDW A;  4JV2 A;  5KFW A;  2KHI A;  3TS2 A;  4J15 A;  1VF7 A;  1Y8N B;  4HCE A;  4WJ4 A;  3DHQ A;  4QQB X;  2R84 A;  4YJ2 F;  3J80 W;  3WOE A;  4NXM H;  2KHJ A;  1RYS A;  4LUO A;  1JX4 A;  2PCF B;  1I94 H;  1ASZ A;  4LH7 A;  2R8H A;  3KAK A;  5I9O A;  4X65 H;  4IRC A;  3EQL C;  4QGU A;  1YJ9 A;  3V6J A;  5KFL A;  4KN4 C; 
#chains in the Genus database with same CATH homology
 3DLL A;  2JA7 G;  2A1A A;  4P75 A;  3AYH B;  4JI2 Q;  3RN5 A;  4BA1 I;  1VQF A;  1R9T H;  4X62 Q;  3GTP H;  4YWK A;  4X66 Q;  3NEL A;  2FXQ A;  5H1S E;  2WB1 G;  2R6G A;  4DV3 Q;  1N34 L;  1SR3 A;  4JBK A;  1Q1E A;  4O0A A;  1U5K A;  4DR1 Q;  5J3B A;  4HIK A;  2H5X A;  2ASB A;  2E2I H;  3S2D H;  2YTX A;  5HGQ A;  4L5S A;  1E22 A;  4A3G G;  5LMU Q;  3I4M H;  2IHE A;  4PMW A;  1PH5 A;  4JI0 L;  2KCT A;  1I50 H;  5GAG C;  1PH9 A;  4YHH Q;  3U50 C;  3HKZ E;  3CCM A;  2PNH A;  4DR3 Q;  1HNZ Q;  1Q12 A;  3S1N H;  3BZK A;  2E2J H;  2WB1 E;  3CQZ H;  4JC0 A;  3PUV A;  3MXN B;  1A62 A;  1Y1W H;  4P73 A;  1G51 A;  2ATW A;  1LUZ A;  3F2C A;  4DV6 L;  1HZA A;  4C3H H;  3L2P A;  3MEF A;  3S24 A;  2GVA A;  4HJ8 A;  1JMC A;  1NBW A;  2RF4 A;  3NBH B;  1AE3 A;  5C0X J;  1XNQ Q;  3S14 H;  4AH6 A;  4HJA A;  4A3K G;  3TQY A;  3I4N G;  2ZJP A;  1B8A A;  1SRO A;  5C4X H;  4NXN L;  2VW9 A;  3RNU A;  3HOZ H;  1FGU A;  4X66 L;  3GDE A;  4ME3 A;  4BY1 G;  3CC7 A;  1KL9 A;  1GD7 A;  2PI2 E;  3L7Z C;  4MNO A;  2Z6K A;  4DV3 L;  3KFU A;  2A19 A;  3WWV A;  2UUC L;  4JYA Q;  3PUW A;  1VQE A;  2XTI A;  2N3S A;  4DR1 L;  4LFC Q;  1N36 L;  5GAE C;  2AMC B;  2I5L X;  3J81 i;  4PZ7 A;  1E1T A;  4B3R L;  2AHO B;  2B63 G;  3AFQ A;  3JAM i;  1N33 Q;  1K8A C;  3ICE A;  4YCU A;  4DUZ Q;  2ALY B;  2HIX A;  4OWT B;  1C7Y A;  1KRS A;  3IRB A;  1N9W A;  5DLQ E;  3KF8 B;  2CCZ A;  4A3B H;  4A3D G;  1CUK A;  2GN5 A;  4RMF A;  3M4Q A;  4DR3 L;  1KRT A;  3TEH B;  1PH3 A;  1HNZ L;  3OW2 A;  4R4T A;  4POG A;  4JCV E;  5FLM H;  4BBS H;  4R4C A;  3D0F A;  4Y7N H;  2ES2 A;  1XNR Q;  2F4V L;  2IY5 B;  1NJI C;  1JE5 A;  2K5V A;  1PA6 A;  5M3F G;  2JA8 H;  2Q2H A;  4NXM L;  3PO3 G;  2HIV A;  1LM0 A;  1IXR A;  3EBE A;  2HT1 A;  4LFA L;  4JI1 L;  3T1Y Q;  1X65 A;  5HY6 A;  3CXC A;  2JA5 H;  1BBW A;  1WJJ A;  4A3E G;  4B3T Q;  4LFB Q;  1HNW L;  2PI2 A;  1L1O A;  2PMZ E;  1A8V A;  1EIF A;  3W5O A;  3AEV A;  3PCO B;  2GVB A;  1S72 A;  2AWO A;  1L2F A;  1E24 A;  2JEB I;  2DGY A;  3SGI A;  5C44 G;  4HID A;  3GTL H;  2R93 H;  1YHB A;  1JT8 A;  1IBM Q;  4TVA B;  1A0I A;  5JJL A;  5M5X H;  4HIM A;  4DAY B;  4A4I A;  4LFC L;  3W1G A;  5IYB H;  3KYH C;  3CMA A;  4EX5 A;  1IBL L;  1VQG A;  5GAH C;  4DUY Q;  4A3J H;  1SFO H;  2VL6 A;  1VQD A;  2BA1 A;  2D0P A;  4P71 A;  3PIO A;  1KD1 C;  3RZD H;  4OO1 G;  5M5Y H;  2ID0 A;  2Z6K C;  4DUZ L;  1LYL A;  4L5T A;  4YY3 Q;  1GM5 A;  4GNX A;  1KXL A;  1VQ7 A;  1TWA H;  2UUA L;  2UUB Q;  1PH2 A;  3G71 A;  4DR5 Q;  2CWP A;  1UE6 A;  2JJQ A;  4YCV A;  1EQQ A;  4NB3 A;  1B70 B;  2ZTC A;  5JEA J;  4DAM A;  4JI3 Q;  3J80 i;  3EN2 A;  3TS0 A;  4JV5 Q;  2I5M X;  1XNR L;  1UE5 A;  4JI7 Q;  4IJL A;  1XPR A;  1KHI A;  4OO1 I;  4LF7 L;  5C0X I;  5K36 G;  3H3V I;  3GO5 A;  2IT1 A;  3KDF A;  4KI0 A;  4LF9 Q;  4BXX G;  2UXC L;  3PSI A;  1HZ9 A;  1WOC A;  3T1Y L;  1VQ4 A;  5BR8 L;  1W2B A;  2MO0 A;  4HIO A;  3JC6 6;  2B3G A;  4UP9 A;  5M3F H;  3T1H Q;  2MFI A;  4DR2 L;  2UU9 Q;  4IOC A;  4A3L G;  1PH7 A;  2R92 G;  1FVI A;  1SLJ A;  4DR4 Q;  3K7A H;  2R7F A;  4AYB E;  1HR0 Q;  3B6Y A;  1YZ6 A;  1N8R C;  4BBR G;  1IYJ B;  2RHS B;  1L1O C;  5IP7 H;  4DV2 Q;  2R7Z G;  3GTQ H;  3ERS X;  1IBK Q;  2BH2 A;  3HKZ G;  4DV7 L;  1SRU A;  4PG3 A;  1CSP A;  1WYD A;  3CME A;  4B3S Q;  4GS3 A;  1Q7Y C;  4Y52 H;  1VQA A;  2K14 A;  4DK6 C;  4YY3 L;  2CKZ B;  1XMQ Q;  5AJ3 Q;  1C9O A;  1YIJ A;  1LTL A;  2E5L L;  3HOV G;  4POF A;  3NEM A;  4GNX B;  3HOX G;  1CKO A;  2OTJ A;  2MQH A;  4JI3 L;  2YTY A;  5E7N A;  4A3F H;  4JI4 L;  3E0E A;  4JV5 L;  1K83 H;  4A93 G;  2HHH Q;  4KHZ A;  4JI6 Q;  1HZB A;  1FJG L;  1E3P A;  4GNX C;  4IFD I;  3BU2 A;  1V43 A;  4DK3 C;  5JJK A;  1RL2 A;  2F52 A;  3STB D;  3S17 H;  3F8T A;  5IT9 c;  4GN5 A;  5IYC G;  4LF8 L;  3M85 A;  1YVC A;  2Y0S E;  4C3J H;  4K0K Q;  2K4K A;  1Q86 C;  3CCE A;  4OWW B;  3LGJ A;  1Y1V H;  3KDF B;  4XIG S;  1G29 1;  1GVP A;  2JA6 G;  3OTO L;  3T1H L;  4JI8 Q;  5FJ8 H;  2KBN A;  5IP9 H;  1Q81 C;  4DV0 Q;  4GOP A;  2DUD A;  2EXD A;  5ELO A;  4UP8 A;  2VQE L;  2I0Q A;  2C35 B;  3CCJ A;  3TRE A;  3PUY A;  1YJW A;  3UDG A;  4DV2 L;  1IL2 A;  4OXP A;  4JI2 L;  2PQA A;  1VQL A;  1XTD A;  4X62 L;  1IBK L;  4DR6 Q;  1XJV A;  2JQO A;  3KOJ A;  1X3F A;  1Q1B A;  1I5F A;  1TWH H;  1WCM H;  4IPD A;  4DNI A;  1ASY A;  2BA0 A;  4UY8 C;  2JA7 H;  3A5Z B;  3CCU A;  1XMQ L;  3GTM H;  1OXV A;  3HOY G;  3M4O H;  3M9B A;  3S1R H;  1XMO Q;  2VNU D;  1XPU A;  3HOW G;  1MKH A;  3PF5 A;  1X55 A;  1UWV A;  1K3R A;  3CP0 A;  5LMU L;  1VQ9 A;  4GKK Q;  3E9H A;  1EUJ A;  1JB7 A;  3J7A 5;  5GAD C;  1YHQ A;  1EQR A;  1UE7 A;  4C3I H;  3PV0 A;  4GN4 B;  4QL5 A;  5IWA Q;  4YHH L;  4AQY Q;  1RIP A;  1V1Q A;  3KJO A;  2UXB Q;  4A3G H;  5C3E G;  1OXX K;  5LMN Q;  1JJC B;  3W1B A;  1K9M C;  4K0K L;  4R4Q A;  1FL0 A;  1J5E Q;  4RG1 A;  1Q82 C;  4EQ5 A;  2L15 A;  1S40 A;  2JK8 A;  2Q2T A;  2VZA A;  1X54 A;  4L5Q A;  4JOI A;  1OTC A;  1YBY A;  4APV A;  2IHF A;  3BZC A;  3I7F A;  1VQ6 A;  2VUM G;  1VS0 A;  1K0R A;  1QUQ B;  4JI5 Q;  1VQI A;  2A8V A;  2OCE A;  1PH6 A;  4IPH A;  2LXJ A;  1XNQ L;  2D62 A;  3GTJ H;  4DV4 Q;  2NVQ H;  4KHP Q;  1T9H A;  3GTK H;  4GOP B;  2IX0 A;  1N32 Q;  1OXS C;  3M4P A;  2VQF Q;  1PHJ A;  2WAQ E;  4UP7 A;  3I4O A;  3GTG H;  4O2D A;  2ZTE A;  2PQA B;  4GOP C;  4DR6 L;  1MJE A;  1HH2 P;  3FKI G;  4A3K H;  4R4I A;  4L5R C;  4X64 Q;  1L0W A;  4DV5 Q;  3I4N H;  3G6E A;  2CQO A;  1OXU A;  3RLN A;  3F2B A;  3ULL A;  4JYA L;  3CCS A;  3CPW A;  2YYZ A;  2EQS A;  4BY1 H;  4AIM A;  4LNQ A;  1KIX A;  4MZ9 A;  2OWO A;  5M3M G;  2LXK A;  4GKK L;  1N33 L;  1BBU A;  4R1J A;  4C2M H;  5C0X G;  4A3M G;  2CWA A;  3RZO H;  4LF5 Q;  5IWA L;  4AQY L;  2JA9 A;  1NE3 A;  5GQO A;  3ULJ A;  5M5W H;  3RN2 A;  2XGT A;  2B63 H;  4A76 A;  1AE2 A;  1X9N A;  1Q46 A;  4QJF A;  2K5H A;  3CCR A;  4AYB G;  1VQH A;  4BY7 G;  3AQQ A;  4A3D H;  2QGQ A;  1QZG A;  1EOV A;  3HKS A;  1UE1 A;  3K8A A;  2ZJR A;  2ZJQ A;  5C3E H;  3KLW A;  4FDB A;  2F3I A;  1C0A A;  2N8N A;  3CC2 A;  3UE1 A;  5GRO A;  1NY4 A;  1JJG A;  4DV4 L;  1QZH A;  4GKJ Q;  1O7I A;  1MJC A;  1X56 A;  4PZ8 A;  4R4O A;  4B3T L;  4LFB L;  1N34 Q;  2YTV A;  3PO3 H;  1TXY A;  2KCM A;  3EIV A;  4JOI C;  1UEB A;  2VQF L;  4LW1 A;  5ELN A;  3J81 c;  3UE0 A;  4JBW A;  3L0O A;  4A3E H;  4XTC S;  1IBM L;  3JAM c;  4HJ9 A;  1DGS A;  4LF4 Q;  1QVF A;  1CKN A;  2KEN A;  5EAY A;  5C44 H;  1Y1W G;  2N49 A;  1P8L A;  4DV1 Q;  4DUY L;  3UDI A;  1SE8 A;  4IFD G;  2Y0S G;  1HR0 W;  2AWN A;  3I2Z A;  3S2H H;  3CD6 A;  3G48 A;  3I55 A;  4QY7 A;  3TRZ A;  3U58 A;  4LF5 L;  4IJH A;  3PGZ A;  2UUB L;  4DR5 L;  1JJ2 A;  1S3O A;  2VY3 A;  4DV6 Q;  3CCL A;  3HOZ G;  5C4X G;  2EIF A;  3OYY A;  1D7Q A;  2V1C C;  1KAW A;  2RCN A;  4A3M H;  1TWC H;  3H3V H;  3M7N A;  4JI7 L;  2Q2I A;  1X3E A;  3U4Z A;  3GD7 A;  3CCQ A;  1EIY B;  1SN8 A;  2QA4 A;  3CF5 A;  1E7Z A;  4NXN Q;  2K52 A;  2R7D A;  4IPC A;  2NVY H;  3D31 A;  4LF9 L;  4QIW E;  4BY7 H;  2WP8 J;  4GKJ L;  3ULP A;  3VDY A;  2YV5 A;  4GN3 B;  3CW2 C;  3F1Z A;  2UUC Q;  2UU9 L;  4OX9 Q;  1QUQ A;  4UPA A;  3K7U C;  1N36 Q;  1YHA A;  3HFZ B;  4BXX H;  4A3B G;  4DR4 L;  1KQS A;  5JEA G;  3H0G G;  1HR0 L;  4JBJ A;  5FLX c;  4B3R Q;  4H02 A;  2QEX A;  4LF4 L;  1D8L A;  1PYS B;  2BH8 A;  2NN6 G;  3U4V A;  1NTG A;  3M3Y H;  2R92 H;  4A3L H;  3FP9 A;  5FLM G;  4BBS G;  2UXD Q;  3H15 A;  1CKN B;  4DV1 L;  1VQC A;  1VQ8 A;  3S15 H;  4B3S L;  3J80 c;  4IO9 A;  1HZC A;  4GLX A;  2JA8 G;  1Q8K A;  1PYB A;  4BBR H;  2Z0S A;  2R7Z H;  1BVS A;  1Z47 A;  2F4V Q;  5AJ3 L;  4A3C G;  3S1Q H;  2JA5 G;  4JBM A;  3E9I A;  2NN6 I;  4GLA C;  4P74 A;  4NXM Q;  3PUX A;  1X3G A;  4A3I G;  2R93 G;  4LFA Q;  2HQL A;  4JI1 Q;  1I94 Q;  3KF6 A;  2HHH L;  4JI6 L;  3HOV H;  1VQM A;  3FHW A;  3K81 C;  2NZO A;  3HOX H;  3G4S A;  1PV4 A;  4X65 Q;  1HNW Q;  1QVG A;  3UDX A;  3HOU G;  1K8G A;  2WAQ G;  2K5N A;  5IYB G;  2MO1 A;  1SMX A;  3CC4 A;  3AFP A;  2WFW A;  4B3M Q;  1K73 C;  2NVX H;  4A93 H;  4LUZ A;  4A3J G;  1I3Q H;  3CAM A;  1YIT A;  3PIP A;  1A63 A;  2CFM A;  4MTN A;  3A0J A;  3A5U A;  5IYC H;  4OX9 L;  2N78 A;  4JI8 L;  4IOA A;  5LMN W;  4LWC A;  4TQU S;  1HJP A;  1EYG A;  1E1O A;  4YCW A;  3ZJY C;  4DV0 L;  1IBL Q;  2OTL A;  1YJN A;  1M90 C;  2JEA I;  4LUV A;  3CCV A;  2JA6 H;  4OWX B;  4LF6 Q;  2K75 A;  1G6P A;  4YWL A;  1GKH A;  2UUA Q;  3RLO A;  1PH1 A;  2UXD L;  1J6Q A;  1AH9 A;  3RLF A;  3H0G H;  2E2H H;  1EFW A;  4IPG A;  1VQ5 A;  2ZM6 Q;  1KC8 C;  2MNA A;  1HNX Q;  2E8G A;  3Q8D A;  5IE8 A;  3PO2 G;  1VCI A;  1XMO L;  3F2D A;  1I6H H;  3STB C;  3UDF A;  4LF7 Q;  4IFD J;  5IYD G;  2NVT H;  4KLK A;  1PH8 A;  4NPS A;  2UXC Q;  1VQJ A;  2ZTD A;  2I5H A;  1I94 L;  3HOY H;  5BR8 Q;  4A3C H;  3A74 A;  4HJ7 A;  1GO3 E;  3HOW H;  4X65 L;  1VQB A;  3KF6 B;  4DR2 Q;  1U0L A;  4A3I H;  4DR7 Q;  2UXB L;  1TWF H;  5IP7 G;  3KJP A;  5LMN L;  4PZ6 A;  5IY0 A;  2D0O A;  4A75 A;  1J5E L;  4B3M L;  3BJU A;  2LSS A;  1CSQ A;  1WI5 A;  2K50 A;  4JG2 A;  1VQK A;  2NZH A;  1B7Y B;  1NMG A;  3HOU H;  1NMF A;  4DKA C;  1P16 A;  4BA2 I;  2B29 A;  4DPG A;  1W3S A;  4JI5 L;  4DV7 Q;  1YNX A;  2AKW B;  3PF4 A;  4KHP L;  3ER0 A;  2YU9 H;  2OQK A;  1N32 L;  4LF6 L;  4P72 A;  4A3F G;  1V9P A;  3I4M G;  1IZ6 A;  4OON A;  2VUM H;  2E5L Q;  2Q2U A;  3NEN A;  3K80 C;  1MIU A;  1VQN A;  1YEZ A;  3K0X A;  1Y14 B;  1Z9F A;  2ZM6 L;  4ALP A;  4X64 L;  4JI4 Q;  4DV5 L;  1HNX L;  4JI0 Q;  1FJG Q;  4WJ3 M;  3J81 j;  2JE6 I;  4HJ5 A;  1Y1V G;  1X6O A;  4GLV B;  3RR5 A;  1BKB A;  1PH4 A;  1TWG H;  3FKI H;  3DM3 A;  3PUZ A;  4LF8 Q;  1PFS A;  5IP9 G;  5FJ8 G;  5C4J H;  2KHI A;  3TS2 A;  1EWI A;  3CPF A;  4J15 A;  4YWM A;  1OXT A;  3S1M H;  4QQB X;  1CKM A;  4WJ4 A;  1XPO A;  3PO2 H;  2KHJ A;  3S16 H;  4LUO A;  1YI2 A;  3OTO Q;  3GTO H;  5IYD H;  4DR7 L;  3I56 A;  1VQO A;  2RHQ B;  5M3M H;  1L1O B;  1WFQ A;  2VS1 A;  1QVC A;  3J7Z C;  1ASZ A;  5JJI A;  4QGU A;  1YJ9 A;  2IX1 A;  2OQ0 A;  2VQE Q;  1H95 A;  4X6A H;  1VQP A;  1PVO A;  1M1K C;  1WCM G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...