4BXXG

Arrested rna polymerase ii-bye1 complex
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
171
structure length
171
Chain Sequence
MFFIKDLSLNITLHPSFFGPRMKQYLKTKLLEEVEGSCTGKFGYILCVLDYDNIDIQRGRILPTDGSAEFNVKYRAVVFKPFKGEVVDGTVVSCSQHGFEVQVGPMKVFVTKHLMPQDLTFNAGSNPPSYQSSEDVITIKSRIRVKIEGCISQVSSIHAIGSIKEDYLGAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
publication title Structures of RNA Polymerase II Complexes with Bye1, a Chromatin-Binding Phf3/Dido1 Homologue
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
total genus 29
structure length 171
sequence length 171
ec nomenclature
pdb deposition date 2013-07-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00575 S1 S1 RNA binding domain
G PF03876 SHS2_Rpb7-N SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4bxxG02
3.30.1490.120 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 RNA polymerase Rpb7-like, N-terminal domain 4bxxG01
1LM0A 4B3TQ 2YYZA 2VQEL 1PA6A 4JBKA 3HOYG 4B3SL 1VQ6A 2ASBA 2Q2UA 3RR5A 3PIOA 1X6OA 3KFUA 2AWOA 1IZ6A 4DUYQ 2WB1G 3I4MH 2V1CC 5GQOA 3S1NH 3STBD 5BR8Q 2E5LL 1N9WA 3F2CA 1EWIA 1PFSA 2L15A 3E9HA 2VQEQ 2HT1A 2F4VL 4B3SQ 3H0GG 3PUXA 1NMFA 3U4ZA 1VQOA 1YJ9A 4GNXC 1WI5A 4GOPC 4R4OA 2ATWA 5IYDH 2RHSB 4JI1L 4YCWA 3NEMA 1V1QA 4DR7Q 1B7YB 3EN2A 3RN5A 4MZ9A 1C9OA 2ID0A 4L5QA 4AQYL 2E5LQ 4LF8L 5M3FH 2WAQE 4IPHA 1BBUA 3S15H 1GO3E 4DV2L 2ZTEA 1XMQQ 1HR0W 2K14A 1Y1WH 3GO5A 2KCMA 2IHEA 4TQUS 4AYBE 4DR4L 2KHJA 4QIWE 2PQAB 4YWMA 4X62Q 1PH7A 4JI7L 3S14H 3PV0A 1JT8A 1JB7A 1C7YA 2UXCL 4LF8Q 4EX5A 1VQJA 4DAMA 4BBRG 4DV2Q 1QZHA 1KHIA 1N36L 4JI8L 1QVFA 1V43A 2Q2HA 2JA6G 4NXNL 4DR4Q 2R92G 3A5ZB 2JA5H 4O2DA 4NPSA 2AMCB 4C3JH 4JBWA 4OO1I 4X64L 3CC7A 1X56A 1YJNA 1R9TH 1GKHA 3M85A 3HOVH 3HOXH 3AQQA 4K0KL 3UDXA 1N36Q 4DNIA 1IL2A 5M3MG 4AH6A 4NXNQ 3PIPA 4WJ3M 4LW1A 4LFAQ 3L7ZC 4MTNA 5J3BA 4LFCL 3FHWA 1AH9A 4X64Q 2R7ZH 1WCMH 2JA9A 1FJGQ 5FJ8G 1XJVA 3CCVA 5IP7G 4NXMQ 1KD1C 4HJ8A 1CSPA 1OXTA 4L5SA 3HOYH 2Q2IA 3A0JA 1VQ5A 4A93G 4DV5Q 3CQZH 4HJ9A 3GTLH 3S2DH 2OTJA 3PUVA 2Y0SE 3K8AA 2A1AA 4JBJA 3F2DA 4L5RC 1XNRQ 3PO3G 5K36G 4A3IG 1EOVA 4A3MH 4P74A 3K0XA 4DAYB 3TRZA 1NY4A 3GTMH 1MJEA 4P73A 4QJFA 3H0GH 5GAGC 2NVTH 3UDGA 3A74A 2ZTDA 2UUBQ 2WFWA 1CKNB 1O7IA 2RF4A 1S3OA 2VS1A 5IP9G 2D0OA 2GVAA 5IT9c 4BY1G 1SRUA 5GROA 4C3IH 2N49A 3CC2A 4DK6C 2JA7G 1C0AA 1SMXA 3TEHB 3I7FA 3CMAA 1E7ZA 1VQLA 3CCJA 4IPDA 1EQQA 3S17H 3M4OH 4DV7Q 2ZJQA 3GDEA 4A4IA 2UXDQ 5IYBG 2ES2A 1G51A 3CAMA 1QUQB 3W1BA 1HNWL 4BA1I 2MNAA 4BBRH 1E24A 1OXUA 2K5NA 3UDIA 2IX1A 4LFBQ 4DUZL 2JA6H 2R92H 3HKZG 4PZ8A 1XMOL 1PH4A 3I55A 3KDFB 4IJHA 2JQOA 5H1SE 4YWLA 1HNWQ 4DV3L 1K83H 1BVSA 4A3KG 4B3ML 4LUOA 4YY3Q 1PYSB 2LXKA 1V9PA 1NJIC 5M3MH 1CSQA 4FDBA 3J81i 2QA4A 3GTGH 1XMOQ 1Y1VG 4X66L 2YV5A 4DK3C 4DV6Q 2IT1A 1A63A 5JJKA 2MO0A 1N33Q 4LF6L 2CWPA 4UP9A 5FJ8H 1YIJA 5ELNA 3J81c 5IP7H 4DR2L 1K3RA 3BZCA 1IBML 4B3MQ 4JYAL 1YBYA 5LMUL 1PVOA 1UE6A 4A93H 1CKOA 4DR3L 2UU9L 4GKJQ 3CCSA 1CKNA 3K7AH 4X66Q 5C44G 4B3RL 1A0IA 4A3EG 1P8LA 4JBMA 3I4OA 1X55A 3OTOQ 3PO3H 1YNXA 1EYGA 4JV5Q 1XTDA 3CF5A 4HIKA 1KQSA 3AYHB 3E0EA 4DR2Q 4DR5L 3KF6A 3U50C 2QGQA 1XNQQ 4JYAQ 3MEFA 2DGYA 4IJLA 4R4QA 2UXBL 3CCEA 4HJAA 4PG3A 3HKSA 1VQ9A 2HQLA 4JOIC 3D31A 3GTKH 4LF7Q 4JI5L 4B3RQ 4P71A 3PF5A 1Q7YC 1WOCA 1LUZA 4AYBG 3ULLA 1YVCA 2VW9A 3DLLA 4A3MG 2MO1A 1QUQA 2WP8J 5IP9H 5C0XJ 4BY1H 3CPWA 1YITA 4H02A 2JA7H 2BH2A 1HZAA 4IPCA 1VQPA 2GVBA 1PH3A 4XIGS 2HIVA 1Q12A 1KIXA 4NB3A 3HOUG 3UDFA 4UP8A 5C4JH 5LMNL 3KDFA 2CQOA 1X54A 3NELA 1D8LA 3PGZA 5IYCG 1S72A 2C35B 1HZBA 1I50H 5IYBH 2F4VQ 2MFIA 3H15A 1S40A 4QL5A 3STBC 1ASZA 3HOZH 3CP0A 2R93G 3AEVA 1Z47A 2I5HA 4OWWB 1VQEA 3F8TA 4JI1Q 4A3FG 5LMNQ 3Q8DA 3K80C 4AQYQ 4JCVE 2E2HH 2ZJPA 2B63G 2I0QA 4GN3B 4PMWA 4A3KH 1I3QH 3S24A 4LUVA 2A8VA 3TQYA 4YHHL 1VS0A 3CCLA 3JAMi 4KHZA 4A75A 1IBKL 4JI7Q 1G291 2I5MX 1RIPA 3PUZA 4JI0L 1Y1VH 2JK8A 4L5TA 4R1JA 4OONA 2DUDA 4APVA 1Q81C 1N34L 2VUMG 1VQFA 4JC0A 2UXCQ 1E1TA 4OX9L 3JAMc 1WJJA 2OQKA 2WB1E 4JI8Q 3NENA 4EQ5A 4IFDJ 3MXNB 1Q46A 4QY7A 3S16H 1PH9A 4GLVB 1EFWA 1TWGH 3GTJH 5E7NA 3F2BA 3L2PA 5C44H 2CFMA 4YWKA 4A3EH 1N34Q 5JJLA 3S2HH 1BKBA 4A3BG 4BBSG 4K0KQ 2ZM6L 3W5OA 1ASYA 3BU2A 1MIUA 4HJ7A 4MNOA 4LFCQ 2YTYA 1L2FA 1YEZA 3CCQA 2EXDA 4DV0L 1IBLL 3J7A5 5LMNW 4JG2A 2E2IH 4IO9A 2NN6G 3ULPA 2ZM6Q 1J5EL 2EQSA 4A3JG 3F1ZA 5GAEC 2IY5B 2PQAA 2JJQA 3HFZB 2BA0A 1KRSA 3HOUH 2AHOB 4C3HH 2RHQB 4ALPA 5JJIA 1T9HA 1VQMA 1EQRA 5IYCH 1E22A 1UE1A 2D62A 4JI3L 1CUKA 3ULJA 3CMEA 4DR1L 1PH8A 2OTLA 2BH8A 3KLWA 3CCMA 5HY6A 1J5EQ 4BA2I 2VY3A 2R93H 3S1RH 2VQFL 1E3PA 4LWCA 4A3FH 4DV4L 4AIMA 2I5LX 1PH2A 5JEAJ 2JEBI 1QVGA 4YCUA 1VQ8A 1AE2A 4PZ7A 5IY0A 4DV1L 3T1YL 1A62A 2B63H 1VQNA 3HOZG 1EIFA 2IHFA 1YHBA 4P72A 1RL2A 2VL6A 1PH1A 1VQ7A 3UE1A 3GTPH 1W2BA 3J80i 1KC8C 2AWNA 1GD7A 1UE7A 2VUMH 1Q82C 1UE5A 1X3GA 1XPRA 2MQHA 2R7DA 3T1YQ 1X3EA 1YHQA 1JMCA 3HOWG 1SROA 5ELOA 2LXJA 3J80c 2RCNA 4LF4L 3M9BA 4IPGA 2KCTA 2PNHA 4X65L 2ZJRA 1U5KA 3RN2A 4DUZQ 1KL9A 3TS0A 1SLJA 4JOIA 4LUZA 5IWAL 1OTCA 3PF4A 1IYJB 4LF9L 3G48A 1MJCA 3CPFA 5M5XH 2E8GA 3BJUA 4DV3Q 4R4IA 3ICEA 4A3BH 4BBSH 1VQGA 4LF4Q 1I6HH 1DGSA 3RLNA 4POFA 3RNUA 3I2ZA 4X65Q 3PO2G 5M5WH 4TVAB 2NVXH 1A8VA 3GD7A 4POGA 1M1KC 1QVCA 5FLMG 1FVIA 4JI6L 3M7NA 3S1MH 2HHHL 1VQIA 1L0WA 2D0PA 4LF6Q 3FKIG 1PH6A 1IBMQ 2NN6I 3T1HL 5LMUQ 1L1OB 4GS3A 4DR3Q 1P16A 3LGJA 1YHAA 2WAQG 4P75A 4A3JH 2UU9Q 2UUAL 4GKKL 4ME3A 4LF5L 3ZJYC 5M5YH 2XGTA 4B3TL 3G71A 4R4TA 3CCRA 4RG1A 4DR6L 3I4NG 3FP9A 2XTIA 4DR5Q 2JEAI 2NVYH 3HKZE 3T1HQ 3PUYA 4A3GG 2UXBQ 2R7FA 1JJCB 1E1OA 4LF5Q 3B6YA 2F3IA 4JI5Q 4GKKQ 3KJPA 1N8RC 2N8NA 3AFPA 1Q1BA 2Z0SA 4GN4B 5BR8L 4DR6Q 4PZ6A 4HIDA 3ER0A 2QEXA 3J81j 1G6PA 1TWCH 4Y52H 2A19A 4YCVA 4KHPL 2CCZA 1W3SA 4J15A 1OXSC 4C2MH 4A3DH 4OXPA 3WWVA 2YU9H 1K73C 4QGUA 1KXLA 3W1GA 4DR7L 1OXVA 4A3LG 5GAHC 4A3CG 1VQBA 2K4KA 3M3YH 3HOWH 1XMQL 2NZOA 4KHPQ 1LYLA 2K5VA 4DPGA 4IOCA 3OW2A 1Q8KA 4X62L 1VQCA 2VNUD 1YZ6A 2KENA 5C0XG 2KBNA 3G4SA 1Z9FA 3K81C 1HJPA 1HNZL 3S1QH 2Y0SG 3PUWA 3L0OA 5AJ3L 3UE0A 1L1OA 3PO2H 4XTCS 3NBHB 4YHHQ 1PV4A 1NMGA 3BZKA 1PYBA 1IBKQ 1EIYB 4JI0Q 4BY7G 2B29A 5FLMH 1K8GA 1HNZQ 2JA8G 1YJWA 2N78A 3KOJA 4O0AA 4HIMA 4UPAA 4OX9Q 5AJ3Q 1NTGA 3FKIH 2K50A 1PH5A 5C3EG 1Q1EA 1VQAA 4UP7A 3EBEA 1TWAH 5FLXc 1MKHA 2N3SA 5EAYA 4LFAL 1UEBA 1TXYA 2EIFA 2BA1A 4DKAC 4BXXG 1OXXK 4QQBX 5DLQE 1K9MC 2Z6KA 2OWOA 1HZ9A 2IX0A 1I5FA 1KAWA 1B8AA 1VQDA 2B3GA 1FJGL 2YTVA 4NXML 3CCUA 3CD6A 3I4NH 1TWFH 1VQKA 1U0LA 1GM5A 2HIXA 1SFOH 1L1OC 4DV5L 4A3GH 3K7UC 2PI2E 1HH2P 3G6EA 1UWVA 2FXQA 1SN8A 1AE3A 4GLAC 3KJOA 4UY8C 1XNRL 2LSSA 4DV0Q 3U58A 1QZGA 1IBLQ 3ERSX 3AFQA 3CC4A 3RLOA 2PMZE 3I56A 1IXRA 4GLXA 4IFDG 4WJ4A 1Q86C 2NZHA 3D0FA 3GTOH 3KF8B 2UUBL 3CXCA 5C4XG 1EUJA 3U4VA 3KYHC 3A5UA 2Z6KC 2ZTCA 2E2JH 3M4PA 1PHJA 4A3LH 4R4CA 4JI3Q 4DR1Q 1K0RA 4A3CH 1H95A 1J6QA 1JJGA 2JE6I 2ALYB 2R6GA 3RLFA 1GVPA 1VQ4A 1WYDA 1VCIA 2OQ0A 1FGUA 4GNXB 4GOPB 2VQFQ 1K8AC 1HNXL 2Q2TA 3GTQH 3I4MG 4DV7L 1B70B 3RZOH 1D7QA 1KRTA 4DV4Q 4Y7NH 3PSIA 4KLKA 3TS2A 2UXDL 5C0XI 2NVQH 4DV1Q 2F52A 1FL0A 2H5XA 3KF6B 4HIOA 1JE5A 3H3VH 3J7ZC 1SR3A 4OWXB 4A76A 3H3VI 4LFBL 1YI2A 5IYDG 1HNXQ 1NE3A 2VZAA 2K5HA 5HGQA 1I94L 4JI2L 1X9NA 4BY7H 4A3DG 2JA8H 5M3FG 1VQHA 3CW2C 2K75A 3RZDH 1X3FA 3SGIA 1Y1WG 4YY3L 3E9IA 2K52A 5C3EH 3EIVA 2YTXA 4X6AH 4LNQA 1Y14B 5IWAQ 1I94Q 2UUCL 1XPUA 4IOAA 4BXXH 4JI2Q 3VDYA 1BBWA 5JEAG 4DV6L 4LF9Q 2KHIA 4HJ5A 1M90C 2CKZB 1XPOA 1JJ2A 3IRBA 1CKMA 1N33L 3JC66 4OWTB 1HR0L 1NBWA 1X65A 1HZCA 1TWHH 5GADC 4GKJL 2JA5G 4OO1G 2UUCQ 1N32L 1LTLA 2PI2A 3OYYA 4JI6Q 2GN5A 3OTOL 4JI4L 2HHHQ 4JV5L 2AKWB 5IE8A 1HR0Q 3PCOB 3HOXG 3HOVG 1XNQL 2OCEA 4IFDI 3M4QA 4GNXA 4GN5A 4GOPA 1N32Q 3TREA 1SE8A 3DM3A 4KI0A 5C4XH 4DUYL 2UUAQ 4LF7L 1WFQA 4RMFA 1WCMG 2R7ZG 2CWAA 4JI4Q 4A3IH
chains in the Genus database with same CATH superfamily
4B3TQ 1QILA 1TWCB 1LO5D 4B3SL 3L9AX 1VQ6A 4KHPH 1X6OA 1B3AA 2Q8RE 3G7LA 2OF1A 1B44D 4YJ3F 2F0OA 3NSWA 5DG7A 2WB1G 2V1CC 1SYFA 3S1NH 3HG9A 2E2HB 5L1KA 5BR8Q 3F2CA 2CH4A 1EWIA 4FU0A 2L15A 2HT1A 3PUXA 3KTMA 5J2UF 3DEOA 3GILA 2ATWA 4X62H 2F3VA 4KY7A 3P1HA 2WV6D 1V1QA 5K5PA 1STEA 3RN5A 4AQYL 1PMRA 4C3IG 3T5LA 1BBUA 2F0DA 2QDLA 1F2YA 2ZTEA 3VR4A 3VYTA 2K14A 1TS5A 1XMQQ 2KCMA 1SNCA 4ECSA 3T5KA 4DR4H 4TQUS 3SI8A 4TV8F 4FO2A 3VR5A 1SAPA 2GPSA 5D65A 1E2WA 4PMCA 3PV0A 4RHRA 4LF8Q 1XWEA 1AN8A 4DK0A 1AP0A 3BVZA 1J8IA 1PRTB 5KFJA 3ORRA 1V4YA 3UI2A 1PYWD 1D5ZC 5KG0A 3KUPA 2AMCB 2I46A 4JBWA 3LWBA 1SJHD 2V58A 2XNAC 5K2MA 5CORA 5KFUA 3HOVH 1AEXA 3AQQA 3UDXA 1N36Q 3CHBD 1R4QB 2PZTA 4AH6A 4LFAQ 3L7ZC 3HKZA 1AH9A 1PDQA 2K28A 4XDXA 5KFSA 2FK1A 2SNSA 2R7ZH 5KFGA 1FJGQ 1E2ZA 4CDEC 3NE5B 2FLPA 1I6VC 2VB3X 4HJ8A 1CSPA 2FMMA 5KFCA 1D5MC 3HGBA 3HOYH 1S5DD 4A93G 4K2KA 2R93B 2FLLA 3Q8RB 4O2AF 4ECVA 3CQZH 4YB8B 1Q8IA 3K8AA 4JBJA 3F2DA 4C5CA 3IN5A 3TSSA 3K0XA 4DAYB 3K5NA 1F9QA 1MJEA 4UCUA 3A7AB 4ED2A 4QJFA 5GAGC 1LABA 3NBHA 2UUBQ 2ENBA 5KG5A 4DV7H 2J4XA 2F03A 3KLSA 1LTSD 2VS1A 2D0OA 1HFGA 2GVAA 3MC0B 5IT9c 4ECRA 2NB0A 1KDAA 1XXGA 2CW0C 2JP1A 4R7RA 4B9XA 2XCLA 3I7FA 1WTRA 1UNNC 1E7ZA 4FVMA 4QWAA 3SK8A 3PR5B 3L4KA 2ZJQA 4QIWA 1EU4A 3GDEA 3CAMA 1HNWL 3TQ1A 4BBRH 4QW9A 2K5NA 3BG3A 4ZK9B 5IT9L 4LFBQ 2EY1A 3I73A 4JVZA 2JA6H 3T13A 2BQRA 2I8CA 1WVLA 3HKZG 1WTVA 5L9XA 1GSOA 3OSPA 4DV3L 1UC9A 5IGBA 4B3MH 3TMEA 4MV1A 1AN7A 1JKJB 4WJWA 4YY3Q 1PYSB 3ITPA 1GJXA 1V9PA 4GKJH 1NJIC 2UVRA 1Q3LA 1CFMA 2QA4A 3J81i 3GTGH 1DV1A 4U6PA 2XRSD 2A69C 5M5YB 1A63A 4JI4H 1LTAD 1KAAA 2DZDA 2B63A 2K03A 2VXWA 1AZPA 1XNQH 1LTBD 1E0BA 3J81c 2GA4B 5LMUL 2N55A 5C4XB 2UU9L 1E4GT 1VDZA 1CKNA 4DUYH 2MGSA 3I4LA 1I4QA 5EOYA 2VUMA 1X55A 5K36H 3PO3H 2N88A 1XTDA 4ZAIA 4HIKA 3AYHB 4HSVA 1YNJD 2F0MA 3GIQA 4DR5L 4XZ3B 2QGQA 4HCSA 4JYAQ 3T5JA 2QKIC 2B2VC 1LT3D 1Y69U 1GUNA 3J81L 4BWSC 3T51B 4JI5L 4NP5A 3S1NB 3V4SA 3PF5A 2RGVA 1LLRD 3ULLA 2VW9A 2NU8B 5IP9H 5T1IA 1STGA 2QW7A 2K01A 1JOOA 1DYQA 4M1UB 1ENCA 2R85A 5C4JH 4QWBA 1ZQ7A 2CQOA 5IYCG 3RIZA 4HYKA 4DV2H 2F4VQ 5KNDA 3H15A 1GGOA 2EYPA 3Q6SA 4QL5A 1K3BC 3HOZH 2V5AA 4J0MA 1JXLA 1DONA 1Z47A 3GV3A 4OWWB 1VQEA 4JI1Q 5LMNQ 2W6QA 1KC7A 1XX8A 3X3NA 2B63G 2I0QA 2FB9A 1K1SA 3DHQA 1A6XA 5FK9C 1GYFA 1WD0A 5FO7B 4KHZA 5CBEE 4A75A 2WKDA 2I5MX 1GXDC 5JJZA 3PUZA 3U9OA 4JI7Q 1Y1VH 3F8NA 4X64H 4L5TA 4F50A 4R1JA 4FNFA 1CI3M 3MWYW 1Q81C 2VUMG 3HOVB 2UXCQ 3IFTA 4OX9L 2HVSA 5KFKA 4RH6A 4JI8Q 2YW2A 4C2MA 4QY7A 4U673 1BF4A 1BCPD 3S16H 1TWGH 2R7ZB 3GTJH 3JRXA 5CA1F 3I3CA 1EYDA 1HA6A 2ICIA 4V0BA 4MV7A 2VPQA 2AGQA 4JW0A 5BPHA 1BKBA 1O78A 4ULLA 2LS01 3CQZB 3WNZA 2ZM6L 4J9SA 2Z4IA 3KALA 2RCFA 3QJYA 4CDDC 4LFCQ 2YTYA 3P7JA 2E2JB 5JPMC 4IO9A 3CRKC 3PW4A 5D3DA 4A3JG 5IGGA 3GTQB 1D6EC 2BA0A 1XDNA 1KRSA 4IUUA 3HOUH 2FP4B 1JOQA 4LSAA 3R5HA 4ALPA 1I4RA 5JJIA 3K3PA 3MR2A 2K6AA 1T9HA 1VQMA 3N44B 1E22A 2W9CA 2D62A 3CMEA 3J80E 5L1LA 3J7AK 3CCMA 2VY3A 2EY5A 2R6FA 2WAQA 3S1RH 4HNUA 3KLSX 4BY7B 4ZLTF 4RB1A 1S5ED 1QVGA 5C8YF 4YR2A 4BBRB 3KAJA 4L6TB 5FD6A 4DV1L 5IY0A 1BCPF 1SFOA 3HOZG 4P72A 5HV6A 3QIAA 3RB0A 5CC4A 2TMPA 2BCOA 3AB9A 3BDLA 2PYKA 3BVGA 4FXGC 3UE1A 1O7YA 2AWNA 2R7KA 1KLGD 1UE7A 5I2YA 1EUDB 1UE5A 3JSNA 1YHQA 2R7DA 3T1YQ 1A3TA 1X3EA 1Y8OB 4K8IA 5ELOA 2AU0A 2RCNA 4LF4L 2KCTA 2PNHA 4DUZQ 1KL9A 3TS0A 1SLJA 3PF4A 3LWUA 3PIP3 2OLSA 2OH2A 3G48A 1MJCA 4LF6H 3CPFA 3V6JA 1HTLD 4A3BH 4BBSH 1DGSA 2W9BA 4X65Q 4DR3H 1CQIB 2NVXH 1A8VA 4M9UA 3H09A 3PO3B 4JI6L 3M7NA 3FMAA 4S3SA 2F0FA 3GV7B 3IAYA 2SNMA 2UXBH 2NN6I 1WH2A 5A2QL 3LGJA 4P75A 2WAQG 4APMA 4Z9CB 2NYZD 4K5XA 3ZJYC 5KIXA 3ZYYX 3GV5B 3BA8A 3NP8A 3FP9A 3M4IA 2JEAI 2I07B 3T1HQ 4A3GG 2EE1A 4F4XA 4K2LA 1TQOA 4RZQA 3N42B 1E1OA 5KG1A 5KFMA 1YNJC 5C4JB 1ULZA 4HQ6A 1N8RC 1TT2A 4HR7B 1SYBA 3K5HA 4GN4B 5FOBB 2DPIA 4KMUC 1JR0D 2CQYA 5KYLA 2QEXA 1G6PA 2F0EA 1Y1WB 2RKSA 3GIJA 1CK1A 2ZJTA 4KHPL 2B2WC 1W3SA 2L9HA 4IUNA 4XX0B 1C8CA 2VOBA 2EYJA 2ICEC 4IURA 1K73C 4MHEA 3W1GA 1V8QA 1OXVA 3FMCA 4Q0YA 1U4MA 3HOWH 5FLXE 4L1KA 1LYLA 1TVXA 2K5VA 3C2PA 1Q8KA 2EYMA 1Y1VB 4X62L 1TS3A 5C0XG 2KBNA 1HNZL 2W9AA 1HRJA 2K5WA 4G7ZC 3GIKA 3S16B 3KK7A 3PO2H 3VR3A 3GTJB 4I50F 1PYBA 1YNND 4JI0Q 3KHLA 2JA8G 2N78A 2W6MA 1NTGA 3FKIH 3KHRA 1VQAA 1QJOA 3EBEA 1TWAH 4UP7A 4IZOA 3P20A 5EAYA 2B2TA 4DKAC 1TXYA 4O2BF 5DLQE 2Z6KA 4DV0H 2YCHA 1IBLH 2JYOA 1I5FA 5LA6F 3GTMB 3PN1A 4EYHB 3I4NH 1TWFH 1VQKA 3GIPA 3I70A 1EY5A 4KTAA 3HOUB 3URYA 1HH2P 5E4XA 3K57A 3KJOA 5KFAA 3ERSX 1EZ8A 1KTKA 4IFDG 4ED8A 2NZHA 3S1RB 3GTOH 2JA5A 3CXCA 5IYZF 2A6HD 1GUWA 4J9NA 1Z7TA 3A5UA 1IOWA 3T56B 2ZTCA 5E1FA 4M8AA 2VB2X 4CHTB 3Q8PB 4JI3Q 3V4ZA 4MIUA 1E4EB 3E6ZX 1E4FT 2QDBA 5JQWA 4NW2A 4TQRA 3R8BA 1VCIA 2R92B 1BOSA 2Q2TA 3D4WA 3QOJA 5DEHA 1PX2A 1T5XD 4DV7L 3RZOH 4DL7A 4MA5A 1EY4A 4O4HF 4KLKA 5DAUA 2ALZA 3NQTA 2R7NA 2EJGC 1M0WA 2H5XA 1FL0A 3KF6B 4XT3B 3MHBA 4O4LF 3H3VH 4XQQA 3J7ZC 4HNTA 5M3MB 2C2EA 1M4VA 1RYRA 1JE4A 5IWAH 2K5HA 5C3WA 4JI2L 1X9NA 1I4PA 2C22A 1CS0A 4MV6A 4A3BB 4BBSB 2FLNA 2NZ1D 3RZDH 3H0GA 5EGTA 4J9OA 2NVXB 2DY8A 2K52A 4X6AH 1HA5A 2YTXA 5LL6X 1IKLA 1V1OA 1Y14B 3PW0A 3J80L 3G6XA 2HHHH 1FD7D 1M90C 1XPOA 1CKMA 1Z6HA 1I7NA 4OWTB 2PN1A 1X65A 3M9NB 2YZNA 3D4RA 3BQ2A 2AGOA 2ZT9C 4ZCKA 2JA5G 3GTKB 4GKJL 2UUAH 5KEEA 4TUYF 4C3JG 5LP6F 3OYYA 3GV8B 4JI4L 4B3TH 1TIID 5IE8A 4RWSC 3HOXG 1HR0Q 2J6TA 1D5XC 3MXUA 1XNQL 1C3OA 4O4IF 1CT1D 3RB4A 1MSHA 1SE8A 4KI0A 4DUYL 3ORQA 5LHY1 3K5MA 5BR8H 4A3IH 4KN7C 1BGWA 3G6YA 2Q2UA 2F4IA 1F9SA 4HSPA 4J9RA 4WBNF 1Z2PX 3VA5A 1UUPA 1LT6D 4ZKCB 3MR5A 4Q0FA 2E5LL 3K5OA 3HOWB 3S15H 2R8JA 1EIGA 1XMQH 4B3SQ 3H0GG 3U4ZA 2IJ0A 2KUMA 5BMVF 2HVQA 1WI5A 2DPJA 1SYGA 4LK1C 2YL2A 5DLGA 4HMIA 1B7YB 4RCOA 4LF8H 4MZ9A 3H20A 2FFKB 2C28A 4A3DH 5KFZA 4DV2L 5BPFA 1KJ9A 3GO5A 1Z2NX 4AYBE 2PQAB 4YWMA 1K28A 1PH7A 3S14H 1SMYC 1JT8A 1C7YA 5CA0F 4EX5A 1BQQT 1SYEA 3DUZA 1N36H 1TWAB 3R2TA 2Q2HA 4LFAH 5CV5A 3SVMA 1EY0A 3A5ZB 4QUFA 4DK1A 4OO1I 1AUVA 4AYBB 4X64L 1X56A 1R9TH 1I50A 5F9LA 1FJGH 2Z9HA 1TWCA 1TWFB 3M85A 4EG0A 1YNNC 2EOTA 4DNIA 3EQLC 5FO8B 4WJ3M 1A3VA 1B4OA 4MTNA 3PQIA 2JN4A 2A68D 5IT9E 1WCMH 5FLXL 2JA9A 2E2HA 3R5XA 5FJ8G 4J9PA 3CCVA 5IP7G 4K5WA 1I3QA 4L5SA 1JWUD 5TSSA 3GTOB 2YS6A 2DNCA 5I6WA 2Q2IA 3A0JA 1U9RA 4MAMA 1EWHA 1FNWA 4DV5Q 3ETHA 2ATLA 2UUBH 2KSWA 1L0XB 2Y0SE 2A1AA 4L5RC 2WIIB 3G6JB 1XNRQ 3EVQA 3KBGA 2W6ZA 4A3IG 1EOVA 4P74A 2EPBA 4R8UB 4OELB 4NDXA 3GV6A 3TBIB 3UDGA 2QEJC 3A74A 2C2DA 2KQ3A 3SE0A 1SYXB 1HNXH 2JEFA 3LP8A 2WFWA 1O7IA 1B04A 1S0NA 2W6OA 2A6HC 3K6OA 5ELCA 2Y0SB 4OIJA 2L5TA 4C3IH 3CC2A 4Q8EA 2EJMA 2Z1CA 1JDBB 3PW7A 4LFBH 1VMCA 1SMXA 1IKMA 4RGTA 3BDCA 3CMAA 3S17H 2PW5A 1CA6A 3E5SA 2NU6B 2PCFB 1PXUA 5EBCA 1VF7A 3FEWX 1PRTD 2XIWA 5JVG3 4RB3C 4J9LA 3J81E 4CC6A 5KFPA 1WSCA 3UDIA 1ZHQA 4YY3H 5KFYA 2IX1A 2BQ3A 2UUCH 1SBBB 1KEEA 4PZ8A 1XMOL 4RGMA 4O42A 3SEBA 4KD3A 3WOEA 4GC6A 4ED0A 3I55A 3KDFB 1A3UA 4YWLA 4KHVA 1HNWQ 1K83H 1FYCA 1BVSA 2R93A 2QF7A 4FF4A 4YAJB 1SE3A 2B2VA 2LXKA 2BOSA 1LT5D 2YV5A 4DV6Q 1IYUA 5JJKA 4DAYA 2MO0A 4LF6L 4C56C 1EYCA 2NVYB 2SDFA 1K3RA 1YBYA 1RYSA 1UE6A 4A93H 4DR3L 2DWCA 2O03A 1MI2A 4B3RL 1ZXTA 4A3EG 3MVVA 4JBMA 1JB3A 1UC8A 3FPUB 2YYAA 3OUZA 2VQEH 1K1QA 4F7XA 1WTOA 4RUCA 3K3VA 1UEAB 2UXBL 4DFAA 4PG3A 3HKSA 4LH6A 2R8IA 4H44C 1PRTF 5JAVA 4P71A 3M4YA 4RNNA 2F0HA 1YVCA 2WINB 3BABA 5EWEA 1BUVT 1STAA 1WTQA 2F4VH 4JV2A 4H02A 2VA2A 2BH2A 4QWCA 1EIHA 2RDJA 1VQPA 5KFRA 1PH3A 4XIGS 2HIVA 4JI1H 3UQ8A 3UDFA 4UP8A 3S1QB 4A3DB 1X54A 1GOZA 3TZDA 1Y8NB 2FINB 1UNSA 5EKIA 1HTPA 2R93G 1FR3A 4N8X1 3TP6A 1BO0A 1O7LA 1PZKD 4KV6A 3S14B 2IW3A 4JI7H 4A3FG 2YZGA 2NUAB 1AUXA 1D1IA 2A6ED 3Q8DA 2UXCH 3K80C 2R7MA 3HZXA 5JVDF 1KBLA 4F88A 4GN3B 4PMWA 4JI8H 5KT5A 5JOBA 4LUVA 4NXNH 4QWEA 3CCLA 2CH4W 1MHWC 4RHSA 3E3XA 1R9TB 4LMYA 2JK8A 4APVA 4OONA 1VQFA 1RD9D 1IL8A 2WB1E 2HCIA 5DQHA 3NENA 2VA3A 1Q46A 5M9OA 1EFWA 4RA8A 5EDWA 2YU9A 4LFCH 4ECWA 1WCMB 4MA0A 3L2PA 2AQ2B 2B2YC 4ETSA 1N48A 5T14A 4MV9A 5EKLA 3NBIA 4K0KQ 2DJGC 3DWQA 4KKTA 5EWFA 1MSGA 1CZGA 4EQOA 5KT4A 2WB1B 3BU2A 1C4QA 1YEZA 1RJQA 2EXDA 4DF7A 3BA9A 3N8DA 4DV0L 1IBLL 3MFHA 3S9WA 2RGRA 2XIGA 2FPGB 2PW7A 5LMNW 4ID6A 2NN6G 2F0LA 2A68C 3RBDA 3HP3A 5J22A 2ZM6Q 1J5EL 2O5IC 3F1ZA 5GAEC 1TA8A 3HFZB 3C46A 2KCCA 2KVMA 1KJJA 3RGZA 5CAEB 1TY2A 1EQRA 4C3IB 5IYCH 4DL6A 1PH8A 3ULJA 4RAYA 1NAPA 2R61A 2AQ3B 4HCEA 1SE4A 3TP7A 1EZ1A 3FDTA 5A2QE 2JEBI 4RUAA 5C1PA 4CGYB 1DOKA 2A5HA 4H7BA 4PZ7A 1A62A 2B63H 2BDNA 2W8KA 5C3EB 2HDMA 1EIFA 2RSNA 1U4PA 1YHBA 4DUZH 2RBMA 2F1MA 1KDCA 2K5DA 2VL6A 1B50A 4IWYA 2R7ZA 4TRDA 1EZ6A 1W2BA 1KC8C 3MJFA 5KFNA 2W57A 4EEYA 1GD7A 1K83B 5HURA 3MWDA 2VUMH 2MQHA 3A55A 3CQZA 3QO2A 4CJ0B 2LXJA 1PRTC 2E76C 3A54A 3RN2A 1U5KA 1F2LA 5IWAL 4JOIA 1OTCA 4X66H 1MD2D 3SK6A 1UAPA 4PMBA 5CMDA 3GLKA 4PWQA 2BQUA 2E8GA 3BJUA 2J9GA 5EWGA 4DR2H 3BS1A 4R4IA 3ICEA 1PZJD 1VQGA 4LF4Q 3BDOA 3RLNA 3GTQA 2V9WA 5D3IB 5KYIA 4TSSA 5FLMG 3G6VA 1FVIA 2HHHL 1EY7A 3GP7A 3AMUA 1PH6A 1IBMQ 3MXPA 2B2WA 2KEEA 4HEDA 4GS3A 2MPMA 5E4WC 4A3JH 4JV1A 2UUAL 5D14A 2CQAA 5EJWA 1WTPA 3N52A 4ME3A 2E2DC 3R5FA 3LMLA 1RK5A 4B3TL 5ELFA 3BZDB 2B8FA 5KG6A 3DEPA 3QB3A 1SEIA 2IA6A 3HKZE 3CU7A 1Y8PB 3PUYA 1GLVA 3IL8A 3NUCA 4YP3A 2OEOA 3B6YA 4ILWA 1EY6A 2DN8A 4O3RA 1Q1BA 2Z0SA 2MCTA 2NU7B 5BR8L 5DQIA 4ED7A 4PZ6A 4HIDA 1DV2A 2X69A 4Y52H 4YCVA 1F9RA 4HAEA 3HKZB 4C2MH 3HRZC 1K8OA 1ET6A 3WWVA 5DM73 4A3LG 5GAHC 3TP8A 4UDUC 2ZDQA 1RODA 2K4KA 4QMGA 3M3YH 2SCUB 1XMQL 2NZOA 3Q1KA 1KDBA 2EZVA 3V05A 4KHPQ 4UCVA 4C1NK 3MEHA 4DXGA 3HB9A 4JI0H 2VNUD 1JOKA 2KENA 1N34H 2VUGA 1HUMA 1Z9FA 1HJPA 4JPBW 1HCZA 4UCRA 2PBZA 3PUWA 5AJ3L 5L1JA 2A6EC 4DNTB 5C4ZA 2FE3A 3NBHB 4YHHQ 1PV4A 3BZKA 1IBKQ 4DAPA 4BY7G 1HNZQ 1NR4A 2XGPA 5KG3A 4EBEA 4HIMA 3HOYB 3BYYB 4OEMB 1PTOH 1Q1EA 1JDEA 1WTHA 1DXMA 4LFAL 2Z4HA 4UCTA 2ASJA 3PIO3 1U4RA 4HNVA 4HR7A 4EQPA 4G3IA 3TDQA 1VQDA 2B3GA 3MAQA 1FJGL 1CA5A 3T5HA 1Y1WA 3CD6A 4YR3A 4QF4A 4R8IA 1SFOH 2G9DA 2TSSA 4A3GH 2PI2E 3R3OA 1NNXA 1UWVA 4GLAC 2LSSA 4L63B 1QZGA 4JI3H 5D1OB 1CHPD 2G9HD 3R2IA 3KF8B 2UUBL 5LOVF 5CB4F 1Y1VA 1EUJA 1U4LA 3U4VA 3MXGA 4DAVA 2B63B 2M2LA 4R4CA 5J1ZA 2B2UC 1K0RA 2KECA 4DR1Q 1H95A 1J6QA 1HXYD 2ALYB 2L12A 2J0TD 2JA6B 3GTJA 1T5EA 1VQ4A 1ZETA 2OQ0A 4GOPB 1HNXL 3I4MG 2VQFQ 3RUPA 4FS1A 1JX4A 2O2LD 3E5NA 2VUMB 1D7QA 1KRTA 4DV4Q 4Y7NH 5C0XH 1STHA 2DY7A 2R84A 1JE5A 3GTLA 4LFBL 3GTGB 5IYDG 1NE3A 3WOFA 4MN3A 5IGDA 3JAMW 3GTMA 2JA8H 5M3FG 1G6ZA 1WD1A 1O80A 1Y1WG 2QILA 2AGPA 4YY3L 3EIVA 2FMAA 2UUCL 3RJ0A 4JI2Q 5ELBA 1BBWA 4X3SA 5JEAG 4LF9Q 4HJ5A 3NTKA 1HR0H 3JC66 1TWHH 1I7LA 2L1BA 2OXPA 4OO1G 1ZHSA 4IWXA 3VPCA 1LTLA 4GKKH 5LL6S 5KRUA 1FGBD 4IUVA 4DR6H 4JK1C 3PCOB 1E4EA 1GHJA 3MTSA 4ZUJA 3JSLA 4IFDH 4WD3A 2R3ZA 5C5LA 2R92A 3HBLA 1EY9A 4FM9A 3J7AF 5F9NA 1CZWA 4JI4Q 4LF5Q 3RV3A 4ED1A 4KK7A 2VQEL 1H9SB 1PA6A 4EBDA 2AQ1B 4JBKA 3HOZB 2HUGA 4DL5A 2J6SA 2ASBA 3RR5A 3PIOA 3I8ZA 1QE6A 5KFVA 3KFUA 2AWOA 4PV1C 4DUYQ 3DMUA 5GQOA 3TP5A 1KNEA 3STBD 3M3YB 4J1MA 1PFBA 1PFSA 1RKNA 3E9HA 2F4VL 5T1GA 3MZ5A 2LY7A 2KCNA 1SMYD 4GOPC 2FMCA 3L3OC 2RHSB 3I90A 4JI1L 4FXDA 3IKJA 4YCWA 5D1PA 4DR7Q 4Q45A 5J39A 5DGBA 1EQTA 2DNEA 3T4AC 1C9OA 2ID0A 4L5QA 5L37A 1H9JA 2E5LQ 1JJGA 2WAQE 4IPHA 3RTXA 1GO3E 4IZ8A 4X3UA 2FJ2A 1HR0W 1RF2D 5IODA 5KFIA 3GTKA 1TWGB 1WTWA 4DR4L 2KHJA 3CRLC 4ZI7F 1G2TA 4JI7L 5L1IA 1SJED 4WRDA 4O1NA 4F4WA 4PQXA 5LXTF 5F2DA 2Z6BA 2F0SA 2UXCL 2SOBA 2JA7A 1PTOB 3G8CA 1XYIA 4DAMA 4DV2Q 3NTIA 1QZHA 1ZEQX 2IX3A 2RDHA 5G3LF 4JI8L 4ECTA 1SCUB 1V43A 2WAQB 4NXNL 2R92G 4TV9F 2JA5H 5GONF 3D4DA 4O2DA 4C3JH 3QZ7A 4RAZA 3CC7A 1GSHA 4ZYSA 3HOXH 4A3GB 2W70A 4DV5H 4DNRB 5M3MG 5DGAA 3PIPA 4LW1A 2D5DA 5J3BA 4LFCL 1XNRH 4X64Q 1AW7A 1SDFA 4F4ZA 2PZWA 3MA2B 4NXMQ 1OXTA 2E75C 1JLLB 3OPOA 1VQ5A 3SK4A 2IBKA 4HJ9A 4IUTA 3S2DH 2OTJA 2NBFA 3NK9A 5DM63 4O3QA 3DXJC 4A3MH 2BDOA 4ECYA 1I6UA 3OHXC 2ZXOA 1NY4A 1SNDA 1RDPD 3LWEA 2WYOA 3FVQA 3K5LA 4P73A 3H0GH 4CKBA 2K04A 2NVTH 2BR0A 3ND8A 4O3SA 4Y7NB 1S3OA 2IPKD 1QWYA 5KFXA 3WO1A 2XVSA 1F9PA 4BY1G 1SRUA 3RBEA 4K6DA 2JA7G 1C0AA 4DK6C 1BDOA 1F77A 2F3WA 1G91A 3TEHB 5FPOA 1EYZA 4G7OC 1VQLA 4IPDA 1EWCA 1I94H 4AYBA 2JA8B 3E0JA 4IUPA 2E2IA 1TWFA 4A4IA 2UXDQ 2JEJA 5IYBG 3W1BA 1QUQB 2RDGA 3C1EA 3OIPA 4BA1I 2MNAA 2F0JA 1E24A 4RGNA 2DLNA 3JRWA 3RF2A 5COYA 4DUZL 3N43B 1PLFA 2MJ8A 4DV6H 3BJYA 5H1SE 2KOLA 3PW5A 1G2SA 1TWHB 4A3KG 4B3ML 3RFCA 5DG9A 4RB2C 2UVWA 2CVRA 4O3PA 1SYCA 1CSQA 4FDBA 4PNYA 1N32H 1XMOQ 4X66L 1EQVA 2IT1A 3RGXA 3AU7A 2KHSA 4R8UA 1N33Q 3SDZA 5FJ8H 1YIJA 5ELNA 4DR2L 2EJFC 5IP7H 3NXWA 2DIKA 1PVOA 1NSNS 2EYFA 5BN4A 5J2TF 3GTPA 4N9PA 5C44G 2IL8A 2YRXA 2EYOA 4XQNA 3OTOQ 2PZUA 4JV5Q 3CF5A 2Y0SA 3U50C 3MEFA 4IJLA 4RZRA 4HJAA 1HPCA 3RV4A 2HQLA 2EDGA 3D31A 4LF7Q 4B3RQ 3V6HA 1Q7YC 1LUZA 4AYBG 4EVOA 3DLLA 4A3MG 4X3TA 2K33A 5C0XJ 1YITA 1JQYD 1LT4D 4IPCA 4E6IA 1RJPA 2R7LA 1EY8A 3EJIA 5IT9W 2GVBA 4C3HG 1Q12A 1IYVA 3KAKA 3BYTB 3X3MA 3KDFA 3NELA 1S72A 2C35B 1I50H 5EPJA 1QOHA 2MFIA 1BXTA 1S40A 3STBC 3PO2B 2I80A 1A9XA 5KFWA 1A2TA 4FS2A 3AEVA 2I5HA 3F8TA 1K0SA 2B2YA 2H1EA 1RJRA 1STYA 4AQYQ 1II3A 2E2HH 3FKIB 2NVYA 3V6KA 2IP4A 4CKEA 3RB3A 2A8VA 1I3QH 5CYUA 3S24A 2JA5B 3VYUA 3JAMi 2FPPB 2X0SA 4I7AA 1G291 1F2ZA 1RIPA 2O4XA 4JI0L 1N34L 1JORA 3HOXB 3I4NB 4CBVA 5I4DA 1VBHA 4K0KH 3JAMc 1WJJA 2OQKA 1ILPA 4IFDJ 4EQ5A 3MXNB 1IOVA 1PH9A 4GLVB 4XYQA 3VPBA 5E7NA 2A73B 3F2BA 1M0TA 3VYRA 4A3EH 5JJLA 4DL2A 4IHJF 1IHZA 3SHLA 1OWTA 2RSOA 4IQZA 3S2DB 1EEFD 4YJ2F 3PR4A 3JAML 4RAUC 1MIUA 2HVRA 1L2FA 1PZID 3CCQA 4CC5A 3J7A5 1X32A 2F0IA 4J6HA 1LTID 4H0LC 2NVTB 4I7ZC 2M05A 1QCBD 2EQSA 5CV8A 3SR1A 1I4XA 2IY5B 2JJQA 2ZDHA 3RZOB 2AHOB 4KN4C 1A2UA 3GQBA 5C6AA 5C5JA 3N41B 3D3RA 1H9RA 4ODGA 2JSOA 5AFWA 1DOLA 1S9FA 4JI3L 4CJ1B 2OTLA 1CUKA 5A35A 2BH8A 5HY6A 1J5EQ 4BA2I 2R93H 1ENFA 1E3PA 2HD3A 4LWCA 4YBZB 1O7ZA 4A3FH 1BJTA 1EUCB 2I5LX 2NUCA 1PH2A 4FF3A 3RZDB 4YCUA 4HMJA 3J7AV 1S03G 2IHFA 5KT7A 3DWAA 1RL2A 3V2TA 1FNVA 1ML0D 4ZKBB 2EYHA 4YQWA 1Q82C 1JMCA 1RHPA 2YZMA 4KJOA 3M9BA 1DZ1A 2WB1A 2NU9B 1D1KA 1S5CD 2FJZA 2XD4A 4IALA 5M5XH 4O3OA 4FP5D 4DV3Q 1IBMH 4JYAH 3OWEB 4POFA 4L8JA 3I2ZA 3VR2A 4TVAB 5M5WH 4C5BA 1HQMC 2L11A 3GD7A 2OT2A 4P2CB 1SNMA 1QVCA 5CV7A 4E4TA 4A3IB 1SNOA 4RNOA 3S1MH 1VQIA 1L0WA 4UAIA 1LTRD 4K8JA 2EYLA 2NN6H 4J8QA 5LMUQ 1KJQA 3QFFA 1KJ8A 1L1OB 1S5FD 1ILQA 1P16A 4DN4M 1YHAA 2UU9Q 4M7EA 5KT2A 4ECZA 1W6JA 2F0GA 4GKKL 2C9OA 3ND9A 5M5YH 3S15B 2XGTA 3G71A 3CCRA 4DR6L 2K5QA 1D2BA 2M9VA 2XTIA 3PMFA 5CBAE 4DR5Q 2R7FA 1JJCB 4IRCA 4G4KA 3KXYT 4TQSA 4JI5Q 4R9WA 3KJPA 2WE6A 5LMNH 3RUZA 5DLFA 2N8NA 5KNCA 1I50B 2XWBB 5I6YA 3H3VC 2P0AA 3J81j 3TN2A 4QWDA 2A19A 4B08A 2W7OA 2K05A 1RK6A 2YU9H 4QGUA 2QK4A 2MP1A 1SYDA 4A3CG 1VQBA 3OSNA 1I3QB 2NTTA 4Q5VA 4YHHH 4DPGA 4IOCA 3OW2A 4IRDA 1EOTA 1IBKH 1C48A 1VQCA 1HNZH 5IOCA 3K0YA 1LV9A 3G4SA 4EFBA 2A74C 2ZDGA 2WDTA 5EBDA 3NWTA 3UE0A 4KKUA 5KG2A 1B33N 5A2QW 4A3EB 2HGSA 2X6LA 5ISRA 1GHKA 4ED6A 2AQ4A 5FLMH 4ME5A 1YJWA 3MR6A 4UPAA 4ZHQF 4OX9Q 5AJ3Q 2R8KA 2K50A 1PH5A 5C3EG 4IUQA 1LACA 1TU2B 1MKHA 3J7YW 4R8NA 4BXXG 1RCVD 2J6UA 2OWOA 4N8FA 3RD4A 4G57A 5KT3A 1E2VA 2Q8IB 1DIKA 1SNQA 2B2UA 3CCUA 1U0LA 1ICFB 3D8GA 4K6LA 1L1OC 4DV5L 4XYOA 2P5ZX 2PPBC 1STNA 3C3LA 3G6EA 4UCOA 2FXQA 1SN8A 4KY5A 1XNRL 4EQNA 3U58A 3AFQA 1BR9A 3CC4A 3RLOA 4DR1H 2PMZE 1IXRA 3L4JA 4RGOS 2V4QA 2KA7A 2KJXA 5KFFA 2FPIB 3P75A 1TY0A 3S17B 2XRQD 1JWSD 5C4XG 1DD2A 2VQFH 4A3FB 2PNRC 3KYHC 4DV4H 2E2JH 5IGEA 2KEDA 4YAKB 3M4PA 3OSOA 4G7HC 3FRPB 1PHJA 4A3LH 3T1YH 3NQIA 1V1PB 2JE6I 2I87A 2L4NA 1HUNA 1H9MA 2PMZB 1WYDA 4GNXB 1TR5A 1FGUA 3GTQH 2XWJB 2L55A 1B70B 3TS2A 2W71A 3M7GA 2NVQH 4DV1Q 5BN3A 2CHBD 1QB5D 4HIOA 3Q8QB 4DA2A 2E74C 3D6CA 1SR3A 4OWXB 4A76A 3H3VI 4X65H 1S97A 1HNXQ 3FDSA 4JI2H 5HGQA 2Z8LA 3QWNA 1I94L 3WDNA 5M5XB 5DG8A 4LF9H 2BE5D 2GPWA 4BY7H 3H94A 4HN7A 1TS2A 3TZUA 4RU9A 2K75A 3H4DA 4IN3A 4KD4A 5M5WB 4XT1B 4A93B 3E9IA 1R4PB 3I72A 4EYIB 2HQEA 4LNQA 5FD5A 4IOAA 2O5JC 3NTHA 3S1MB 4FF2A 1V51A 1W96A 4DV6L 2KHIA 5KKNB 2CKZB 5D1OA 3SE7A 3IRBA 2AUJD 4UHVA 1HZCA 3RMHA 3T1HH 3KF8A 5I2XA 2UUCQ 1N32L 4IR9A 2RA4A 4GZYC 5KFQA 4LF5H 2PI2A 5C4HA 2GN5A 4F8MA 4JI6Q 1QNUA 4UFZA 3HOVG 3MFYA 3EROA 1BNZA 5LYJF 4DL3A 3SXHA 1CTMA 1M7JA 5JUMA 2JA6A 4GN5A 4GOPA 1I4HA 1DOMA 4I65A 2NTSA 4MTDA 2R7ZG 4EGQA 5JVH3 1KNAA 1M8AA 4F87A 5CGKA 1LM0A 3H6MA 2YYZA 1QNKA 4PDBA 2B39A 3TIGA 3H4BA 3HOYG 4JV0A 4Q8FA 5CV4A 2SEBD 2R82A 4KKSA 3GTGA 1AFPA 4MTEA 1SEBD 2YU9B 1IZ6A 4FBUA 3I4MH 2WACA 4QW8A 1S10A 4DR7H 2E5LH 2VPSA 1N9WA 2VQEQ 3EYYA 1ENAA 1VQOA 1NMFA 1YJ9A 4GNXC 3GIMA 4R4OA 1B1ZA 5IYDH 4MV4A 4XXEA 3NEMA 4DXFA 3EN2A 3J80W 2CZGA 4LF8L 5M3FH 1VBGA 2JEIA 3OUUA 4ECUA 2W6PA 1Y1WH 4OHJA 2H4OA 2IHEA 1SNPA 4QIWE 4N9TA 1B6RA 4X62Q 3QR8A 2F0NA 5C1OA 3KLRA 5JEAH 2RVLA 1JB7A 3K59A 2F0PA 1VQJA 4BBRG 1KHIA 1N36L 3M9MB 1QVFA 2JA6G 4DR4Q 1RJTA 2R8GA 4A2AA 4OO1H 4NPSA 3HS0C 1YJNA 4QIWB 4LH7A 4ZRZA 1EL0A 1GKHA 1H9SA 1CQJB 2C00A 4NXMH 4K0KL 3PZPA 5I9PA 1IL2A 3GIDA 4NXNQ 3QOLA 2EY6A 3FHWA 1DJRD 1GUTA 2RDIA 2MUYA 4F4YA 1XJVA 2HJWA 4MTKA 3PW2A 1KD1C 3GIIA 1DCZA 3JZIA 1X3QA 2IWHA 3GTLH 5FPRA 5JVLA 1TS4A 3I12A 3PUVA 3HEJA 1JC7A 3NWSA 5K36G 4DGZA 3PO3G 2XCPA 2R8HA 3MFGA 4I7HA 3TRZA 1FKAH 3GTMH 1QG7A 3CVZA 1B3QA 1TWGA 3W2DA 2ZTDA 1EYAA 1B53A 1CKNB 2RF4A 2QYZA 2PO4A 5IP9G 1AZQA 2NVQB 3SK5A 2UXDH 1NCVA 3BQ0A 4RCNA 4K14A 5GROA 2V4DA 2N49A 4TKOB 3Q24A 3DWPA 2W8LA 2HDLA 3CCJA 1EQQA 1GUGA 1PTOD 4FF1A 3M4OH 1RTOA 4DV7Q 1PFMA 2ES2A 1G51A 1GUSA 5KFEA 1WTXA 4Q43A 3D6WA 1J9OA 1OXUA 3K5IA 2F0KA 1XMOH 2R92H 4FXKC 2F0WA 4ABNA 1RTNA 1PH4A 4QCLA 1HFNA 2R86A 1N56A 4IJHA 5I9OA 2JQOA 1N33H 5FLXW 4MV8A 1CHQD 2C2RA 3VYSA 2BE5C 4LUOA 4A3JB 4RKBA 2C5CA 3A8KE 5M3MH 5DQGA 3DF7A 4Y8VB 2WTFA 1Y1VG 4ZUIA 4DK3C 1S0MA 1ZKOA 3OTOH 4JV5H 3Q22A 4RFBA 2CWPA 4ECXA 4UP9A 5FKAC 3TINA 1IBML 4B3MQ 3BZCA 3NPPA 3LNNA 4JYAL 1DM0B 1CKOA 1S5BD 2LMCB 4GKJQ 2L0CA 3CCSA 3M9OB 4LF7H 3K7AH 4B3RH 4X66Q 5G3LD 1A0IA 3U9TA 1P8LA 3RAQA 5CV6A 3I4OA 2RQXA 1BCPB 1YNXA 1LTTD 1EYGA 3N40P 1KQSA 3E0EA 4DR2Q 3KHHA 4B3SH 3KF6A 1XNQQ 1PTOF 2DGYA 4R4QA 1W93A 3CCEA 5KT6A 4EBCA 4C2MB 1VQ9A 5DNFA 3I4MB 4JOIC 1X3PA 3K58A 1T36A 3GTKH 4EEQA 1WOCA 1H9KA 2MO1A 1QUQA 2WP8J 4IR1A 4BY1H 3CPWA 3VMMA 2JA7H 2NVXA 1HZAA 2LFNA 4XYMB 3HOUG 1KIXA 3W3AA 4NB3A 3A8JE 2F0VA 5LMNL 1GUOA 3PGZA 5EPLA 1D8LA 5M3FB 4EFEA 4U7CA 4AQYH 3JAME 1HZBA 4ZQIA 1A15A 4XQJA 5IYBH 1TWHA 2V4RA 4BS9A 1ASZA 3CP0A 1MGSA 5D8DA 4I55F 2XC9A 4FBTA 1L0YB 1JICA 3H91A 5KGUA 2YS7A 1VMPA 4JCVE 3OHBA 2ZJPA 2W9CB 2PQEA 3IFDA 4A3KH 1S68A 1S0OA 3TQYA 3V96A 2X6GA 4YHHL 1VS0A 4WFN3 1IBKL 2DUDA 1VKZA 3O13A 4JC0A 1E1TA 4J9QA 5KNBA 3MWEA 1SFOB 5LL6b 2DJFC 5CR3A 3KHGA 4NKLA 5IGFA 4ZOLF 2K7VA 1B2TA 1VAJA 5EZYF 1EU3A 1BXRA 3EPIA 4I4TF 3GQCA 5C44H 2CFMA 4YWKA 1N34Q 2EY2A 1KLUD 3Q23A 3S2HH 4A3BG 4BBSG 1F2MA 1SE2A 3GTLB 4U68A 3BAAA 3W5OA 1ASYA 2VR1A 1ESRA 4HJ7A 4MNOA 1BCPC 3C0FB 4JG2A 2E2IH 4DLKA 3ULPA 2UVUA 2K1BA 1J5EH 4ECQA 1NR2A 2W9BB 3MFIA 1EHIA 2PQAA 1TAEA 2MHVA 1STBA 3FPPA 4KJNA 2RHQB 3A56A 5CV9A 4C3HH 3KBXA 3MR3A 3FKIA 1UE1A 4DR1L 1W6KA 4J9MA 1TWAA 3KLWA 5KFLA 3T53B 3M4OB 4ZQ3A 2VQFL 1LTGD 3H40A 3RAXA 2CW7A 4DV4L 4AIMA 5JEAJ 1HNWH 1VQ8A 1EEID 1AE2A 3T1YL 1VQNA 2R87A 2V59A 3LX0A 3MXNA 4CDCC 1PH1A 1I4GA 1VQ7A 3R23A 1ZYRD 3GTPH 3A7LA 3J80i 5ELEA 2M00A 4RNMA 1G8ZD 3VA7A 1ESFA 4DV3H 1XPRA 1PTOC 1X3GA 1T94A 3HOWG 3NHHA 3IG0A 3GTOA 1SROA 3J80c 4CDFC 4IPGA 4ME6A 3Q0AA 4X65L 2ZJRA 3EA6A 4LUZA 1IYJB 3ERQA 4LF9L 2F0QA 1BNCA 4JUZA 5KFTA 2JXMB 1FNUA 2ASLA 1ET9A 1I6HH 5LMUH 3QG1A 3RNUA 1IW7D 3BVMA 3PO2G 4C5AA 3F2UA 4LSXA 2UU9H 3K7AB 2QCPX 4B9WA 2FKLA 4CKCA 4POGA 1B9NA 1M1KC 3OMGA 1WR2A 4K5VA 5HBRB 2WKCA 4A2BA 2D0PA 4LF6Q 3FKIG 1TKWB 5JH7F 4DR5H 4MV3A 2NWGA 3T1HL 1SXTA 3WO0A 4DR3Q 2RDFA 4JI5H 4XYLB 1KJIA 4Q44A 2XSCA 1HQRD 4LF5L 3OOCA 1CM9A 4BY1B 3ONAB 4R4TA 4C1NI 4RG1A 2JA7B 3I4NG 4EGJA 2ASDA 2XCAA 2NVYH 1Z2OX 5EPKA 5IGCA 2UXBQ 1BBXC 1B9MA 1KABA 3OMCA 2F3IA 2D2CC 4GKKQ 3AFPA 3HXLA 4DR6Q 1NUCA 3ER0A 4LMQD 1CE8A 4DU9A 1TWCH 2HCCA 1CQVA 4X3KA 4NLGA 5KG7A 2F0UA 2CCZA 4J15A 4WORA 1OXSC 4OXPA 4BWGB 1KXLA 4DR7L 1Q90A 3NGDA 4IAJA 4A3KB 3N6RA 5ELDA 1XTCD 3BG5A 1EFID 4C3JB 3R93A 2EXZA 1YZ6A 3K81C 3S1QH 3TIIA 3OW7A 4GC7A 4OX9H 5BN5A 2Y0SG 1M6VA 3L0OA 2LKVA 4EGVA 1L1OA 4XTCS 2K32A 3N6XA 5C44B 1NMGA 1EIYB 4UCSA 5EQ0A 3MWMA 2B29A 2B8GA 1K8GA 3J81W 3S2HB 4QUCA 4O0AA 3KOJA 3T16A 1ICWA 4LJZC 5IIFA 2ZM6H 3PVXA 5FLXc 4OIKA 1ONLA 2N3SA 1UEBA 2EIFA 3I91A 2BA1A 4QQBX 2JEGA 1OXXK 1L2ZA 4OGQC 1K9MC 1JWMD 4A3MB 1HZ9A 4YR0A 2E2IB 2IX0A 1CQFA 1B8AA 1KAWA 2YTVA 4NXML 1MBYA 2W7PA 3VPDA 5NUCA 3H0GB 3BQ1A 1GM5A 2HIXA 3K7UC 4C3HB 2PVPA 5JPNC 3Q8SB 4UY8C 1AE3A 4KY6A 4H13C 1SSOA 4DV0Q 1IBLQ 4QB4A 3VR6A 1GSAA 4RB0A 4GLXA 3I56A 4WJ4A 4LAAA 4RKLA 1Q86C 5KFDA 3OWFA 3QZ8A 2CW8A 3D0FA 4O3NA 2FHTA 5KFBA 2D9UA 2B2TC 1B6SA 1R9TA 2Z6KC 2CW0D 3UFXB 4DL4A 5EKKA 2GLTA 4DV1H 1HHVA 4A3CH 2R6GA 3RLFA 1S4ZA 1GVPA 3C1FA 3GTPB 1K8AC 5KFHA 1WCMA 1JIHA 1PFNA 5HGTA 5I47A 3ETJA 3PSIA 5KFOA 2UXDL 4CJ2C 5C0XI 4OL7A 4J9KA 2F52A 4LF4H 2EVBA 2F0TA 5C5MA 1YI2A 1C30A 2VZAA 2VQDA 4A3DG 3TQTA 1ZYRC 4IRKA 1I6HB 1VQHA 3CW2C 1JCKB 1X3FA 3SGIA 1O75A 2UVVA 3EFXD 4FYDA 5E3FA 4HTHA 2A69D 5C3EH 2FK3A 5FO9B 5KX5F 2IMWP 5IWAQ 1XPUA 1I94Q 1MZBA 2ZXPA 4BXXH 3VDYA 2W6NA 1T3NA 4JI6H 2G5DA 5C3XA 1N33L 1JJ2A 1PK8A 2Q8TA 4YIJA 1HR0L 1NBWA 5H80A 3EPGA 4ED3A 3CKIB 3Q2OA 5GADC 4V190 1VF5C 2YRWA 3OIQA 3U9SA 1IW7C 2FK2A 1OO9B 5KG4A 2XGQA 3RB6A 3OTOL 4JV5L 2HHHQ 2AKWB 1V1PA 2ZXRA 2OCEA 3OHAA 3A8IE 4IFDI 2PMZA 3M4QA 4GNXA 2XN9C 2J7ZA 3DM1A 3TREA 1N32Q 5C4XH 1K8MA 2AUKA 3DM3A 2UUAQ 4NMZA 4LF7L 1WFQA 4RMFA 1WCMG 2CWAA 1K83A
chains in the Genus database with same CATH topology
1LM0A 4B3TQ 2YYZA 2VQEL 1PA6A 4JBKA 3HOYG 4B3SL 1VQ6A 2ASBA 2Q2UA 3RR5A 3PIOA 1X6OA 3KFUA 2AWOA 1IZ6A 4DUYQ 2WB1G 3I4MH 2V1CC 5GQOA 3S1NH 3STBD 5BR8Q 2E5LL 1N9WA 3F2CA 1EWIA 1PFSA 2L15A 3E9HA 2VQEQ 2HT1A 2F4VL 4B3SQ 3H0GG 3PUXA 1NMFA 3U4ZA 1VQOA 1YJ9A 4GNXC 1WI5A 4GOPC 4R4OA 2ATWA 5IYDH 2RHSB 4JI1L 4YCWA 3NEMA 1V1QA 4DR7Q 1B7YB 3EN2A 3RN5A 4MZ9A 1C9OA 2ID0A 4L5QA 4AQYL 2E5LQ 4LF8L 5M3FH 2WAQE 4IPHA 1BBUA 3S15H 1GO3E 4DV2L 2ZTEA 1XMQQ 1HR0W 2K14A 1Y1WH 3GO5A 2KCMA 2IHEA 4TQUS 4AYBE 4DR4L 2KHJA 4QIWE 2PQAB 4YWMA 4X62Q 1PH7A 4JI7L 3S14H 3PV0A 1JT8A 1JB7A 1C7YA 2UXCL 4LF8Q 4EX5A 1VQJA 4DAMA 4BBRG 4DV2Q 1QZHA 1KHIA 1N36L 4JI8L 1QVFA 1V43A 2Q2HA 2JA6G 4NXNL 4DR4Q 2R92G 3A5ZB 2JA5H 4O2DA 4NPSA 2AMCB 4C3JH 4JBWA 4OO1I 4X64L 3CC7A 1X56A 1YJNA 1R9TH 1GKHA 3M85A 3HOVH 3HOXH 3AQQA 4K0KL 3UDXA 1N36Q 4DNIA 1IL2A 5M3MG 4AH6A 4NXNQ 3PIPA 4WJ3M 4LW1A 4LFAQ 3L7ZC 4MTNA 5J3BA 4LFCL 3FHWA 1AH9A 4X64Q 2R7ZH 1WCMH 2JA9A 1FJGQ 5FJ8G 1XJVA 3CCVA 5IP7G 4NXMQ 1KD1C 4HJ8A 1CSPA 1OXTA 4L5SA 3HOYH 2Q2IA 3A0JA 1VQ5A 4A93G 4DV5Q 3CQZH 4HJ9A 3GTLH 3S2DH 2OTJA 3PUVA 2Y0SE 3K8AA 2A1AA 4JBJA 3F2DA 4L5RC 1XNRQ 3PO3G 5K36G 4A3IG 1EOVA 4A3MH 4P74A 3K0XA 4DAYB 3TRZA 1NY4A 3GTMH 1MJEA 4P73A 4QJFA 3H0GH 5GAGC 2NVTH 3UDGA 3A74A 2ZTDA 2UUBQ 2WFWA 1CKNB 1O7IA 2RF4A 1S3OA 2VS1A 5IP9G 2D0OA 2GVAA 5IT9c 4BY1G 1SRUA 5GROA 4C3IH 2N49A 3CC2A 4DK6C 2JA7G 1C0AA 1SMXA 3TEHB 3I7FA 3CMAA 1E7ZA 1VQLA 3CCJA 4IPDA 1EQQA 3S17H 3M4OH 4DV7Q 2ZJQA 3GDEA 4A4IA 2UXDQ 5IYBG 2ES2A 1G51A 3CAMA 1QUQB 3W1BA 1HNWL 4BA1I 2MNAA 4BBRH 1E24A 1OXUA 2K5NA 3UDIA 2IX1A 4LFBQ 4DUZL 2JA6H 2R92H 3HKZG 4PZ8A 1XMOL 1PH4A 3I55A 3KDFB 4IJHA 2JQOA 5H1SE 4YWLA 1HNWQ 4DV3L 1K83H 1BVSA 4A3KG 4B3ML 4LUOA 4YY3Q 1PYSB 2LXKA 1V9PA 1NJIC 5M3MH 1CSQA 4FDBA 3J81i 2QA4A 3GTGH 1XMOQ 1Y1VG 4X66L 2YV5A 4DK3C 4DV6Q 2IT1A 1A63A 5JJKA 2MO0A 1N33Q 4LF6L 2CWPA 4UP9A 5FJ8H 1YIJA 5ELNA 3J81c 5IP7H 4DR2L 1K3RA 3BZCA 1IBML 4B3MQ 4JYAL 1YBYA 5LMUL 1PVOA 1UE6A 4A93H 1CKOA 4DR3L 2UU9L 4GKJQ 3CCSA 1CKNA 3K7AH 4X66Q 5C44G 4B3RL 1A0IA 4A3EG 1P8LA 4JBMA 3I4OA 1X55A 3OTOQ 3PO3H 1YNXA 1EYGA 4JV5Q 1XTDA 3CF5A 4HIKA 1KQSA 3AYHB 3E0EA 4DR2Q 4DR5L 3KF6A 3U50C 2QGQA 1XNQQ 4JYAQ 3MEFA 2DGYA 4IJLA 4R4QA 2UXBL 3CCEA 4HJAA 4PG3A 3HKSA 1VQ9A 2HQLA 4JOIC 3D31A 3GTKH 4LF7Q 4JI5L 4B3RQ 4P71A 3PF5A 1Q7YC 1WOCA 1LUZA 4AYBG 3ULLA 1YVCA 2VW9A 3DLLA 4A3MG 2MO1A 1QUQA 2WP8J 5IP9H 5C0XJ 4BY1H 3CPWA 1YITA 4H02A 2JA7H 2BH2A 1HZAA 4IPCA 1VQPA 2GVBA 1PH3A 4XIGS 2HIVA 1Q12A 1KIXA 4NB3A 3HOUG 3UDFA 4UP8A 5C4JH 5LMNL 3KDFA 2CQOA 1X54A 3NELA 1D8LA 3PGZA 5IYCG 1S72A 2C35B 1HZBA 1I50H 5IYBH 2F4VQ 2MFIA 3H15A 1S40A 4QL5A 3STBC 1ASZA 3HOZH 3CP0A 2R93G 3AEVA 1Z47A 2I5HA 4OWWB 1VQEA 3F8TA 4JI1Q 4A3FG 5LMNQ 3Q8DA 3K80C 4AQYQ 4JCVE 2E2HH 2ZJPA 2B63G 2I0QA 4GN3B 4PMWA 4A3KH 1I3QH 3S24A 4LUVA 2A8VA 3TQYA 4YHHL 1VS0A 3CCLA 3JAMi 4KHZA 4A75A 1IBKL 4JI7Q 1G291 2I5MX 1RIPA 3PUZA 4JI0L 1Y1VH 2JK8A 4L5TA 4R1JA 4OONA 2DUDA 4APVA 1Q81C 1N34L 2VUMG 1VQFA 4JC0A 2UXCQ 1E1TA 4OX9L 3JAMc 1WJJA 2OQKA 2WB1E 4JI8Q 3NENA 4EQ5A 4IFDJ 3MXNB 1Q46A 4QY7A 3S16H 1PH9A 4GLVB 1EFWA 1TWGH 3GTJH 5E7NA 3F2BA 3L2PA 5C44H 2CFMA 4YWKA 4A3EH 1N34Q 5JJLA 3S2HH 1BKBA 4A3BG 4BBSG 4K0KQ 2ZM6L 3W5OA 1ASYA 3BU2A 1MIUA 4HJ7A 4MNOA 4LFCQ 2YTYA 1L2FA 1YEZA 3CCQA 2EXDA 4DV0L 1IBLL 3J7A5 5LMNW 4JG2A 2E2IH 4IO9A 2NN6G 3ULPA 2ZM6Q 1J5EL 2EQSA 4A3JG 3F1ZA 5GAEC 2IY5B 2PQAA 2JJQA 3HFZB 2BA0A 1KRSA 3HOUH 2AHOB 4C3HH 2RHQB 4ALPA 5JJIA 1T9HA 1VQMA 1EQRA 5IYCH 1E22A 1UE1A 2D62A 4JI3L 1CUKA 3ULJA 3CMEA 4DR1L 1PH8A 2OTLA 2BH8A 3KLWA 3CCMA 5HY6A 1J5EQ 4BA2I 2VY3A 2R93H 3S1RH 2VQFL 1E3PA 4LWCA 4A3FH 4DV4L 4AIMA 2I5LX 1PH2A 5JEAJ 2JEBI 1QVGA 4YCUA 1VQ8A 1AE2A 4PZ7A 5IY0A 4DV1L 3T1YL 1A62A 2B63H 1VQNA 3HOZG 1EIFA 2IHFA 1YHBA 4P72A 1RL2A 2VL6A 1PH1A 1VQ7A 3UE1A 3GTPH 1W2BA 3J80i 1KC8C 2AWNA 1GD7A 1UE7A 2VUMH 1Q82C 1UE5A 1X3GA 1XPRA 2MQHA 2R7DA 3T1YQ 1X3EA 1YHQA 1JMCA 3HOWG 1SROA 5ELOA 2LXJA 3J80c 2RCNA 4LF4L 3M9BA 4IPGA 2KCTA 2PNHA 4X65L 2ZJRA 1U5KA 3RN2A 4DUZQ 1KL9A 3TS0A 1SLJA 4JOIA 4LUZA 5IWAL 1OTCA 3PF4A 1IYJB 4LF9L 3G48A 1MJCA 3CPFA 5M5XH 2E8GA 3BJUA 4DV3Q 4R4IA 3ICEA 4A3BH 4BBSH 1VQGA 4LF4Q 1I6HH 1DGSA 3RLNA 4POFA 3RNUA 3I2ZA 4X65Q 3PO2G 5M5WH 4TVAB 2NVXH 1A8VA 3GD7A 4POGA 1M1KC 1QVCA 5FLMG 1FVIA 4JI6L 3M7NA 3S1MH 2HHHL 1VQIA 1L0WA 2D0PA 4LF6Q 3FKIG 1PH6A 1IBMQ 2NN6I 3T1HL 5LMUQ 1L1OB 4GS3A 4DR3Q 1P16A 3LGJA 1YHAA 2WAQG 4P75A 4A3JH 2UU9Q 2UUAL 4GKKL 4ME3A 4LF5L 3ZJYC 5M5YH 2XGTA 4B3TL 3G71A 4R4TA 3CCRA 4RG1A 4DR6L 3I4NG 3FP9A 2XTIA 4DR5Q 2JEAI 2NVYH 3HKZE 3T1HQ 3PUYA 4A3GG 2UXBQ 2R7FA 1JJCB 1E1OA 4LF5Q 3B6YA 2F3IA 4JI5Q 4GKKQ 3KJPA 1N8RC 2N8NA 3AFPA 1Q1BA 2Z0SA 4GN4B 5BR8L 4DR6Q 4PZ6A 4HIDA 3ER0A 2QEXA 3J81j 1G6PA 1TWCH 4Y52H 2A19A 4YCVA 4KHPL 2CCZA 1W3SA 4J15A 1OXSC 4C2MH 4A3DH 4OXPA 3WWVA 2YU9H 1K73C 4QGUA 1KXLA 3W1GA 4DR7L 1OXVA 4A3LG 5GAHC 4A3CG 1VQBA 2K4KA 3M3YH 3HOWH 1XMQL 2NZOA 4KHPQ 1LYLA 2K5VA 4DPGA 4IOCA 3OW2A 1Q8KA 4X62L 1VQCA 2VNUD 1YZ6A 2KENA 5C0XG 2KBNA 3G4SA 1Z9FA 3K81C 1HJPA 1HNZL 3S1QH 2Y0SG 3PUWA 3L0OA 5AJ3L 3UE0A 1L1OA 3PO2H 4XTCS 3NBHB 4YHHQ 1PV4A 1NMGA 3BZKA 1PYBA 1IBKQ 1EIYB 4JI0Q 4BY7G 2B29A 5FLMH 1K8GA 1HNZQ 2JA8G 1YJWA 2N78A 3KOJA 4O0AA 4HIMA 4UPAA 4OX9Q 5AJ3Q 1NTGA 3FKIH 2K50A 1PH5A 5C3EG 1Q1EA 1VQAA 4UP7A 3EBEA 1TWAH 5FLXc 1MKHA 2N3SA 5EAYA 4LFAL 1UEBA 1TXYA 2EIFA 2BA1A 4DKAC 4BXXG 1OXXK 4QQBX 5DLQE 1K9MC 2Z6KA 2OWOA 1HZ9A 2IX0A 1I5FA 1KAWA 1B8AA 1VQDA 2B3GA 1FJGL 2YTVA 4NXML 3CCUA 3CD6A 3I4NH 1TWFH 1VQKA 1U0LA 1GM5A 2HIXA 1SFOH 1L1OC 4DV5L 4A3GH 3K7UC 2PI2E 1HH2P 3G6EA 1UWVA 2FXQA 1SN8A 1AE3A 4GLAC 3KJOA 4UY8C 1XNRL 2LSSA 4DV0Q 3U58A 1QZGA 1IBLQ 3ERSX 3AFQA 3CC4A 3RLOA 2PMZE 3I56A 1IXRA 4GLXA 4IFDG 4WJ4A 1Q86C 2NZHA 3D0FA 3GTOH 3KF8B 2UUBL 3CXCA 5C4XG 1EUJA 3U4VA 3KYHC 3A5UA 2Z6KC 2ZTCA 2E2JH 3M4PA 1PHJA 4A3LH 4R4CA 4JI3Q 4DR1Q 1K0RA 4A3CH 1H95A 1J6QA 1JJGA 2JE6I 2ALYB 2R6GA 3RLFA 1GVPA 1VQ4A 1WYDA 1VCIA 2OQ0A 1FGUA 4GNXB 4GOPB 2VQFQ 1K8AC 1HNXL 2Q2TA 3GTQH 3I4MG 4DV7L 1B70B 3RZOH 1D7QA 1KRTA 4DV4Q 4Y7NH 3PSIA 4KLKA 3TS2A 2UXDL 5C0XI 2NVQH 4DV1Q 2F52A 1FL0A 2H5XA 3KF6B 4HIOA 1JE5A 3H3VH 3J7ZC 1SR3A 4OWXB 4A76A 3H3VI 4LFBL 1YI2A 5IYDG 1HNXQ 1NE3A 2VZAA 2K5HA 5HGQA 1I94L 4JI2L 1X9NA 4BY7H 4A3DG 2JA8H 5M3FG 1VQHA 3CW2C 2K75A 3RZDH 1X3FA 3SGIA 1Y1WG 4YY3L 3E9IA 2K52A 5C3EH 3EIVA 2YTXA 4X6AH 4LNQA 1Y14B 5IWAQ 1I94Q 2UUCL 1XPUA 4IOAA 4BXXH 4JI2Q 3VDYA 1BBWA 5JEAG 4DV6L 4LF9Q 2KHIA 4HJ5A 1M90C 2CKZB 1XPOA 1JJ2A 3IRBA 1CKMA 1N33L 3JC66 4OWTB 1HR0L 1NBWA 1X65A 1HZCA 1TWHH 5GADC 4GKJL 2JA5G 4OO1G 2UUCQ 1N32L 1LTLA 2PI2A 3OYYA 4JI6Q 2GN5A 3OTOL 4JI4L 2HHHQ 4JV5L 2AKWB 5IE8A 1HR0Q 3PCOB 3HOXG 3HOVG 1XNQL 2OCEA 4IFDI 3M4QA 4GNXA 4GN5A 4GOPA 1N32Q 3TREA 1SE8A 3DM3A 4KI0A 5C4XH 4DUYL 2UUAQ 4LF7L 1WFQA 4RMFA 1WCMG 2R7ZG 2CWAA 4JI4Q 4A3IH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LM0 A;  4B3T Q;  2YYZ A;  2VQE L;  1PA6 A;  4JBK A;  3HOY G;  4B3S L;  1VQ6 A;  2ASB A;  2Q2U A;  3RR5 A;  3PIO A;  1X6O A;  3KFU A;  2AWO A;  1IZ6 A;  4DUY Q;  2WB1 G;  3I4M H;  2V1C C;  5GQO A;  3S1N H;  3STB D;  5BR8 Q;  2E5L L;  1N9W A;  3F2C A;  1EWI A;  1PFS A;  2L15 A;  3E9H A;  2VQE Q;  2HT1 A;  2F4V L;  4B3S Q;  3H0G G;  3PUX A;  1NMF A;  3U4Z A;  1VQO A;  1YJ9 A;  4GNX C;  1WI5 A;  4GOP C;  4R4O A;  2ATW A;  5IYD H;  2RHS B;  4JI1 L;  4YCW A;  3NEM A;  1V1Q A;  4DR7 Q;  1B7Y B;  3EN2 A;  3RN5 A;  4MZ9 A;  1C9O A;  2ID0 A;  4L5Q A;  4AQY L;  2E5L Q;  4LF8 L;  5M3F H;  2WAQ E;  4IPH A;  1BBU A;  3S15 H;  1GO3 E;  4DV2 L;  2ZTE A;  1XMQ Q;  1HR0 W;  2K14 A;  1Y1W H;  3GO5 A;  2KCM A;  2IHE A;  4TQU S;  4AYB E;  4DR4 L;  2KHJ A;  4QIW E;  2PQA B;  4YWM A;  4X62 Q;  1PH7 A;  4JI7 L;  3S14 H;  3PV0 A;  1JT8 A;  1JB7 A;  1C7Y A;  2UXC L;  4LF8 Q;  4EX5 A;  1VQJ A;  4DAM A;  4BBR G;  4DV2 Q;  1QZH A;  1KHI A;  1N36 L;  4JI8 L;  1QVF A;  1V43 A;  2Q2H A;  2JA6 G;  4NXN L;  4DR4 Q;  2R92 G;  3A5Z B;  2JA5 H;  4O2D A;  4NPS A;  2AMC B;  4C3J H;  4JBW A;  4OO1 I;  4X64 L;  3CC7 A;  1X56 A;  1YJN A;  1R9T H;  1GKH A;  3M85 A;  3HOV H;  3HOX H;  3AQQ A;  4K0K L;  3UDX A;  1N36 Q;  4DNI A;  1IL2 A;  5M3M G;  4AH6 A;  4NXN Q;  3PIP A;  4WJ3 M;  4LW1 A;  4LFA Q;  3L7Z C;  4MTN A;  5J3B A;  4LFC L;  3FHW A;  1AH9 A;  4X64 Q;  2R7Z H;  1WCM H;  2JA9 A;  1FJG Q;  5FJ8 G;  1XJV A;  3CCV A;  5IP7 G;  4NXM Q;  1KD1 C;  4HJ8 A;  1CSP A;  1OXT A;  4L5S A;  3HOY H;  2Q2I A;  3A0J A;  1VQ5 A;  4A93 G;  4DV5 Q;  3CQZ H;  4HJ9 A;  3GTL H;  3S2D H;  2OTJ A;  3PUV A;  2Y0S E;  3K8A A;  2A1A A;  4JBJ A;  3F2D A;  4L5R C;  1XNR Q;  3PO3 G;  5K36 G;  4A3I G;  1EOV A;  4A3M H;  4P74 A;  3K0X A;  4DAY B;  3TRZ A;  1NY4 A;  3GTM H;  1MJE A;  4P73 A;  4QJF A;  3H0G H;  5GAG C;  2NVT H;  3UDG A;  3A74 A;  2ZTD A;  2UUB Q;  2WFW A;  1CKN B;  1O7I A;  2RF4 A;  1S3O A;  2VS1 A;  5IP9 G;  2D0O A;  2GVA A;  5IT9 c;  4BY1 G;  1SRU A;  5GRO A;  4C3I H;  2N49 A;  3CC2 A;  4DK6 C;  2JA7 G;  1C0A A;  1SMX A;  3TEH B;  3I7F A;  3CMA A;  1E7Z A;  1VQL A;  3CCJ A;  4IPD A;  1EQQ A;  3S17 H;  3M4O H;  4DV7 Q;  2ZJQ A;  3GDE A;  4A4I A;  2UXD Q;  5IYB G;  2ES2 A;  1G51 A;  3CAM A;  1QUQ B;  3W1B A;  1HNW L;  4BA1 I;  2MNA A;  4BBR H;  1E24 A;  1OXU A;  2K5N A;  3UDI A;  2IX1 A;  4LFB Q;  4DUZ L;  2JA6 H;  2R92 H;  3HKZ G;  4PZ8 A;  1XMO L;  1PH4 A;  3I55 A;  3KDF B;  4IJH A;  2JQO A;  5H1S E;  4YWL A;  1HNW Q;  4DV3 L;  1K83 H;  1BVS A;  4A3K G;  4B3M L;  4LUO A;  4YY3 Q;  1PYS B;  2LXK A;  1V9P A;  1NJI C;  5M3M H;  1CSQ A;  4FDB A;  3J81 i;  2QA4 A;  3GTG H;  1XMO Q;  1Y1V G;  4X66 L;  2YV5 A;  4DK3 C;  4DV6 Q;  2IT1 A;  1A63 A;  5JJK A;  2MO0 A;  1N33 Q;  4LF6 L;  2CWP A;  4UP9 A;  5FJ8 H;  1YIJ A;  5ELN A;  3J81 c;  5IP7 H;  4DR2 L;  1K3R A;  3BZC A;  1IBM L;  4B3M Q;  4JYA L;  1YBY A;  5LMU L;  1PVO A;  1UE6 A;  4A93 H;  1CKO A;  4DR3 L;  2UU9 L;  4GKJ Q;  3CCS A;  1CKN A;  3K7A H;  4X66 Q;  5C44 G;  4B3R L;  1A0I A;  4A3E G;  1P8L A;  4JBM A;  3I4O A;  1X55 A;  3OTO Q;  3PO3 H;  1YNX A;  1EYG A;  4JV5 Q;  1XTD A;  3CF5 A;  4HIK A;  1KQS A;  3AYH B;  3E0E A;  4DR2 Q;  4DR5 L;  3KF6 A;  3U50 C;  2QGQ A;  1XNQ Q;  4JYA Q;  3MEF A;  2DGY A;  4IJL A;  4R4Q A;  2UXB L;  3CCE A;  4HJA A;  4PG3 A;  3HKS A;  1VQ9 A;  2HQL A;  4JOI C;  3D31 A;  3GTK H;  4LF7 Q;  4JI5 L;  4B3R Q;  4P71 A;  3PF5 A;  1Q7Y C;  1WOC A;  1LUZ A;  4AYB G;  3ULL A;  1YVC A;  2VW9 A;  3DLL A;  4A3M G;  2MO1 A;  1QUQ A;  2WP8 J;  5IP9 H;  5C0X J;  4BY1 H;  3CPW A;  1YIT A;  4H02 A;  2JA7 H;  2BH2 A;  1HZA A;  4IPC A;  1VQP A;  2GVB A;  1PH3 A;  4XIG S;  2HIV A;  1Q12 A;  1KIX A;  4NB3 A;  3HOU G;  3UDF A;  4UP8 A;  5C4J H;  5LMN L;  3KDF A;  2CQO A;  1X54 A;  3NEL A;  1D8L A;  3PGZ A;  5IYC G;  1S72 A;  2C35 B;  1HZB A;  1I50 H;  5IYB H;  2F4V Q;  2MFI A;  3H15 A;  1S40 A;  4QL5 A;  3STB C;  1ASZ A;  3HOZ H;  3CP0 A;  2R93 G;  3AEV A;  1Z47 A;  2I5H A;  4OWW B;  1VQE A;  3F8T A;  4JI1 Q;  4A3F G;  5LMN Q;  3Q8D A;  3K80 C;  4AQY Q;  4JCV E;  2E2H H;  2ZJP A;  2B63 G;  2I0Q A;  4GN3 B;  4PMW A;  4A3K H;  1I3Q H;  3S24 A;  4LUV A;  2A8V A;  3TQY A;  4YHH L;  1VS0 A;  3CCL A;  3JAM i;  4KHZ A;  4A75 A;  1IBK L;  4JI7 Q;  1G29 1;  2I5M X;  1RIP A;  3PUZ A;  4JI0 L;  1Y1V H;  2JK8 A;  4L5T A;  4R1J A;  4OON A;  2DUD A;  4APV A;  1Q81 C;  1N34 L;  2VUM G;  1VQF A;  4JC0 A;  2UXC Q;  1E1T A;  4OX9 L;  3JAM c;  1WJJ A;  2OQK A;  2WB1 E;  4JI8 Q;  3NEN A;  4EQ5 A;  4IFD J;  3MXN B;  1Q46 A;  4QY7 A;  3S16 H;  1PH9 A;  4GLV B;  1EFW A;  1TWG H;  3GTJ H;  5E7N A;  3F2B A;  3L2P A;  5C44 H;  2CFM A;  4YWK A;  4A3E H;  1N34 Q;  5JJL A;  3S2H H;  1BKB A;  4A3B G;  4BBS G;  4K0K Q;  2ZM6 L;  3W5O A;  1ASY A;  3BU2 A;  1MIU A;  4HJ7 A;  4MNO A;  4LFC Q;  2YTY A;  1L2F A;  1YEZ A;  3CCQ A;  2EXD A;  4DV0 L;  1IBL L;  3J7A 5;  5LMN W;  4JG2 A;  2E2I H;  4IO9 A;  2NN6 G;  3ULP A;  2ZM6 Q;  1J5E L;  2EQS A;  4A3J G;  3F1Z A;  5GAE C;  2IY5 B;  2PQA A;  2JJQ A;  3HFZ B;  2BA0 A;  1KRS A;  3HOU H;  2AHO B;  4C3H H;  2RHQ B;  4ALP A;  5JJI A;  1T9H A;  1VQM A;  1EQR A;  5IYC H;  1E22 A;  1UE1 A;  2D62 A;  4JI3 L;  1CUK A;  3ULJ A;  3CME A;  4DR1 L;  1PH8 A;  2OTL A;  2BH8 A;  3KLW A;  3CCM A;  5HY6 A;  1J5E Q;  4BA2 I;  2VY3 A;  2R93 H;  3S1R H;  2VQF L;  1E3P A;  4LWC A;  4A3F H;  4DV4 L;  4AIM A;  2I5L X;  1PH2 A;  5JEA J;  2JEB I;  1QVG A;  4YCU A;  1VQ8 A;  1AE2 A;  4PZ7 A;  5IY0 A;  4DV1 L;  3T1Y L;  1A62 A;  2B63 H;  1VQN A;  3HOZ G;  1EIF A;  2IHF A;  1YHB A;  4P72 A;  1RL2 A;  2VL6 A;  1PH1 A;  1VQ7 A;  3UE1 A;  3GTP H;  1W2B A;  3J80 i;  1KC8 C;  2AWN A;  1GD7 A;  1UE7 A;  2VUM H;  1Q82 C;  1UE5 A;  1X3G A;  1XPR A;  2MQH A;  2R7D A;  3T1Y Q;  1X3E A;  1YHQ A;  1JMC A;  3HOW G;  1SRO A;  5ELO A;  2LXJ A;  3J80 c;  2RCN A;  4LF4 L;  3M9B A;  4IPG A;  2KCT A;  2PNH A;  4X65 L;  2ZJR A;  1U5K A;  3RN2 A;  4DUZ Q;  1KL9 A;  3TS0 A;  1SLJ A;  4JOI A;  4LUZ A;  5IWA L;  1OTC A;  3PF4 A;  1IYJ B;  4LF9 L;  3G48 A;  1MJC A;  3CPF A;  5M5X H;  2E8G A;  3BJU A;  4DV3 Q;  4R4I A;  3ICE A;  4A3B H;  4BBS H;  1VQG A;  4LF4 Q;  1I6H H;  1DGS A;  3RLN A;  4POF A;  3RNU A;  3I2Z A;  4X65 Q;  3PO2 G;  5M5W H;  4TVA B;  2NVX H;  1A8V A;  3GD7 A;  4POG A;  1M1K C;  1QVC A;  5FLM G;  1FVI A;  4JI6 L;  3M7N A;  3S1M H;  2HHH L;  1VQI A;  1L0W A;  2D0P A;  4LF6 Q;  3FKI G;  1PH6 A;  1IBM Q;  2NN6 I;  3T1H L;  5LMU Q;  1L1O B;  4GS3 A;  4DR3 Q;  1P16 A;  3LGJ A;  1YHA A;  2WAQ G;  4P75 A;  4A3J H;  2UU9 Q;  2UUA L;  4GKK L;  4ME3 A;  4LF5 L;  3ZJY C;  5M5Y H;  2XGT A;  4B3T L;  3G71 A;  4R4T A;  3CCR A;  4RG1 A;  4DR6 L;  3I4N G;  3FP9 A;  2XTI A;  4DR5 Q;  2JEA I;  2NVY H;  3HKZ E;  3T1H Q;  3PUY A;  4A3G G;  2UXB Q;  2R7F A;  1JJC B;  1E1O A;  4LF5 Q;  3B6Y A;  2F3I A;  4JI5 Q;  4GKK Q;  3KJP A;  1N8R C;  2N8N A;  3AFP A;  1Q1B A;  2Z0S A;  4GN4 B;  5BR8 L;  4DR6 Q;  4PZ6 A;  4HID A;  3ER0 A;  2QEX A;  3J81 j;  1G6P A;  1TWC H;  4Y52 H;  2A19 A;  4YCV A;  4KHP L;  2CCZ A;  1W3S A;  4J15 A;  1OXS C;  4C2M H;  4A3D H;  4OXP A;  3WWV A;  2YU9 H;  1K73 C;  4QGU A;  1KXL A;  3W1G A;  4DR7 L;  1OXV A;  4A3L G;  5GAH C;  4A3C G;  1VQB A;  2K4K A;  3M3Y H;  3HOW H;  1XMQ L;  2NZO A;  4KHP Q;  1LYL A;  2K5V A;  4DPG A;  4IOC A;  3OW2 A;  1Q8K A;  4X62 L;  1VQC A;  2VNU D;  1YZ6 A;  2KEN A;  5C0X G;  2KBN A;  3G4S A;  1Z9F A;  3K81 C;  1HJP A;  1HNZ L;  3S1Q H;  2Y0S G;  3PUW A;  3L0O A;  5AJ3 L;  3UE0 A;  1L1O A;  3PO2 H;  4XTC S;  3NBH B;  4YHH Q;  1PV4 A;  1NMG A;  3BZK A;  1PYB A;  1IBK Q;  1EIY B;  4JI0 Q;  4BY7 G;  2B29 A;  5FLM H;  1K8G A;  1HNZ Q;  2JA8 G;  1YJW A;  2N78 A;  3KOJ A;  4O0A A;  4HIM A;  4UPA A;  4OX9 Q;  5AJ3 Q;  1NTG A;  3FKI H;  2K50 A;  1PH5 A;  5C3E G;  1Q1E A;  1VQA A;  4UP7 A;  3EBE A;  1TWA H;  5FLX c;  1MKH A;  2N3S A;  5EAY A;  4LFA L;  1UEB A;  1TXY A;  2EIF A;  2BA1 A;  4DKA C;  4BXX G;  1OXX K;  4QQB X;  5DLQ E;  1K9M C;  2Z6K A;  2OWO A;  1HZ9 A;  2IX0 A;  1I5F A;  1KAW A;  1B8A A;  1VQD A;  2B3G A;  1FJG L;  2YTV A;  4NXM L;  3CCU A;  3CD6 A;  3I4N H;  1TWF H;  1VQK A;  1U0L A;  1GM5 A;  2HIX A;  1SFO H;  1L1O C;  4DV5 L;  4A3G H;  3K7U C;  2PI2 E;  1HH2 P;  3G6E A;  1UWV A;  2FXQ A;  1SN8 A;  1AE3 A;  4GLA C;  3KJO A;  4UY8 C;  1XNR L;  2LSS A;  4DV0 Q;  3U58 A;  1QZG A;  1IBL Q;  3ERS X;  3AFQ A;  3CC4 A;  3RLO A;  2PMZ E;  3I56 A;  1IXR A;  4GLX A;  4IFD G;  4WJ4 A;  1Q86 C;  2NZH A;  3D0F A;  3GTO H;  3KF8 B;  2UUB L;  3CXC A;  5C4X G;  1EUJ A;  3U4V A;  3KYH C;  3A5U A;  2Z6K C;  2ZTC A;  2E2J H;  3M4P A;  1PHJ A;  4A3L H;  4R4C A;  4JI3 Q;  4DR1 Q;  1K0R A;  4A3C H;  1H95 A;  1J6Q A;  1JJG A;  2JE6 I;  2ALY B;  2R6G A;  3RLF A;  1GVP A;  1VQ4 A;  1WYD A;  1VCI A;  2OQ0 A;  1FGU A;  4GNX B;  4GOP B;  2VQF Q;  1K8A C;  1HNX L;  2Q2T A;  3GTQ H;  3I4M G;  4DV7 L;  1B70 B;  3RZO H;  1D7Q A;  1KRT A;  4DV4 Q;  4Y7N H;  3PSI A;  4KLK A;  3TS2 A;  2UXD L;  5C0X I;  2NVQ H;  4DV1 Q;  2F52 A;  1FL0 A;  2H5X A;  3KF6 B;  4HIO A;  1JE5 A;  3H3V H;  3J7Z C;  1SR3 A;  4OWX B;  4A76 A;  3H3V I;  4LFB L;  1YI2 A;  5IYD G;  1HNX Q;  1NE3 A;  2VZA A;  2K5H A;  5HGQ A;  1I94 L;  4JI2 L;  1X9N A;  4BY7 H;  4A3D G;  2JA8 H;  5M3F G;  1VQH A;  3CW2 C;  2K75 A;  3RZD H;  1X3F A;  3SGI A;  1Y1W G;  4YY3 L;  3E9I A;  2K52 A;  5C3E H;  3EIV A;  2YTX A;  4X6A H;  4LNQ A;  1Y14 B;  5IWA Q;  1I94 Q;  2UUC L;  1XPU A;  4IOA A;  4BXX H;  4JI2 Q;  3VDY A;  1BBW A;  5JEA G;  4DV6 L;  4LF9 Q;  2KHI A;  4HJ5 A;  1M90 C;  2CKZ B;  1XPO A;  1JJ2 A;  3IRB A;  1CKM A;  1N33 L;  3JC6 6;  4OWT B;  1HR0 L;  1NBW A;  1X65 A;  1HZC A;  1TWH H;  5GAD C;  4GKJ L;  2JA5 G;  4OO1 G;  2UUC Q;  1N32 L;  1LTL A;  2PI2 A;  3OYY A;  4JI6 Q;  2GN5 A;  3OTO L;  4JI4 L;  2HHH Q;  4JV5 L;  2AKW B;  5IE8 A;  1HR0 Q;  3PCO B;  3HOX G;  3HOV G;  1XNQ L;  2OCE A;  4IFD I;  3M4Q A;  4GNX A;  4GN5 A;  4GOP A;  1N32 Q;  3TRE A;  1SE8 A;  3DM3 A;  4KI0 A;  5C4X H;  4DUY L;  2UUA Q;  4LF7 L;  1WFQ A;  4RMF A;  1WCM G;  2R7Z G;  2CWA A;  4JI4 Q;  4A3I H; 
#chains in the Genus database with same CATH topology
 4B3T Q;  1QIL A;  1TWC B;  1LO5 D;  4B3S L;  3L9A X;  1VQ6 A;  4KHP H;  1X6O A;  1B3A A;  2Q8R E;  3G7L A;  2OF1 A;  1B44 D;  4YJ3 F;  2F0O A;  3NSW A;  5DG7 A;  2WB1 G;  2V1C C;  1SYF A;  3S1N H;  3HG9 A;  2E2H B;  5L1K A;  5BR8 Q;  3F2C A;  2CH4 A;  1EWI A;  4FU0 A;  2L15 A;  2HT1 A;  3PUX A;  3KTM A;  5J2U F;  3DEO A;  3GIL A;  2ATW A;  4X62 H;  2F3V A;  4KY7 A;  3P1H A;  2WV6 D;  1V1Q A;  5K5P A;  1STE A;  3RN5 A;  4AQY L;  1PMR A;  4C3I G;  3T5L A;  1BBU A;  2F0D A;  2QDL A;  1F2Y A;  2ZTE A;  3VR4 A;  3VYT A;  2K14 A;  1TS5 A;  1XMQ Q;  2KCM A;  1SNC A;  4ECS A;  3T5K A;  4DR4 H;  4TQU S;  3SI8 A;  4TV8 F;  4FO2 A;  3VR5 A;  1SAP A;  2GPS A;  5D65 A;  1E2W A;  4PMC A;  3PV0 A;  4RHR A;  4LF8 Q;  1XWE A;  1AN8 A;  4DK0 A;  1AP0 A;  3BVZ A;  1J8I A;  1PRT B;  5KFJ A;  3ORR A;  1V4Y A;  3UI2 A;  1PYW D;  1D5Z C;  5KG0 A;  3KUP A;  2AMC B;  2I46 A;  4JBW A;  3LWB A;  1SJH D;  2V58 A;  2XNA C;  5K2M A;  5COR A;  5KFU A;  3HOV H;  1AEX A;  3AQQ A;  3UDX A;  1N36 Q;  3CHB D;  1R4Q B;  2PZT A;  4AH6 A;  4LFA Q;  3L7Z C;  3HKZ A;  1AH9 A;  1PDQ A;  2K28 A;  4XDX A;  5KFS A;  2FK1 A;  2SNS A;  2R7Z H;  5KFG A;  1FJG Q;  1E2Z A;  4CDE C;  3NE5 B;  2FLP A;  1I6V C;  2VB3 X;  4HJ8 A;  1CSP A;  2FMM A;  5KFC A;  1D5M C;  3HGB A;  3HOY H;  1S5D D;  4A93 G;  4K2K A;  2R93 B;  2FLL A;  3Q8R B;  4O2A F;  4ECV A;  3CQZ H;  4YB8 B;  1Q8I A;  3K8A A;  4JBJ A;  3F2D A;  4C5C A;  3IN5 A;  3TSS A;  3K0X A;  4DAY B;  3K5N A;  1F9Q A;  1MJE A;  4UCU A;  3A7A B;  4ED2 A;  4QJF A;  5GAG C;  1LAB A;  3NBH A;  2UUB Q;  2ENB A;  5KG5 A;  4DV7 H;  2J4X A;  2F03 A;  3KLS A;  1LTS D;  2VS1 A;  2D0O A;  1HFG A;  2GVA A;  3MC0 B;  5IT9 c;  4ECR A;  2NB0 A;  1KDA A;  1XXG A;  2CW0 C;  2JP1 A;  4R7R A;  4B9X A;  2XCL A;  3I7F A;  1WTR A;  1UNN C;  1E7Z A;  4FVM A;  4QWA A;  3SK8 A;  3PR5 B;  3L4K A;  2ZJQ A;  4QIW A;  1EU4 A;  3GDE A;  3CAM A;  1HNW L;  3TQ1 A;  4BBR H;  4QW9 A;  2K5N A;  3BG3 A;  4ZK9 B;  5IT9 L;  4LFB Q;  2EY1 A;  3I73 A;  4JVZ A;  2JA6 H;  3T13 A;  2BQR A;  2I8C A;  1WVL A;  3HKZ G;  1WTV A;  5L9X A;  1GSO A;  3OSP A;  4DV3 L;  1UC9 A;  5IGB A;  4B3M H;  3TME A;  4MV1 A;  1AN7 A;  1JKJ B;  4WJW A;  4YY3 Q;  1PYS B;  3ITP A;  1GJX A;  1V9P A;  4GKJ H;  1NJI C;  2UVR A;  1Q3L A;  1CFM A;  2QA4 A;  3J81 i;  3GTG H;  1DV1 A;  4U6P A;  2XRS D;  2A69 C;  5M5Y B;  1A63 A;  4JI4 H;  1LTA D;  1KAA A;  2DZD A;  2B63 A;  2K03 A;  2VXW A;  1AZP A;  1XNQ H;  1LTB D;  1E0B A;  3J81 c;  2GA4 B;  5LMU L;  2N55 A;  5C4X B;  2UU9 L;  1E4G T;  1VDZ A;  1CKN A;  4DUY H;  2MGS A;  3I4L A;  1I4Q A;  5EOY A;  2VUM A;  1X55 A;  5K36 H;  3PO3 H;  2N88 A;  1XTD A;  4ZAI A;  4HIK A;  3AYH B;  4HSV A;  1YNJ D;  2F0M A;  3GIQ A;  4DR5 L;  4XZ3 B;  2QGQ A;  4HCS A;  4JYA Q;  3T5J A;  2QKI C;  2B2V C;  1LT3 D;  1Y69 U;  1GUN A;  3J81 L;  4BWS C;  3T51 B;  4JI5 L;  4NP5 A;  3S1N B;  3V4S A;  3PF5 A;  2RGV A;  1LLR D;  3ULL A;  2VW9 A;  2NU8 B;  5IP9 H;  5T1I A;  1STG A;  2QW7 A;  2K01 A;  1JOO A;  1DYQ A;  4M1U B;  1ENC A;  2R85 A;  5C4J H;  4QWB A;  1ZQ7 A;  2CQO A;  5IYC G;  3RIZ A;  4HYK A;  4DV2 H;  2F4V Q;  5KND A;  3H15 A;  1GGO A;  2EYP A;  3Q6S A;  4QL5 A;  1K3B C;  3HOZ H;  2V5A A;  4J0M A;  1JXL A;  1DON A;  1Z47 A;  3GV3 A;  4OWW B;  1VQE A;  4JI1 Q;  5LMN Q;  2W6Q A;  1KC7 A;  1XX8 A;  3X3N A;  2B63 G;  2I0Q A;  2FB9 A;  1K1S A;  3DHQ A;  1A6X A;  5FK9 C;  1GYF A;  1WD0 A;  5FO7 B;  4KHZ A;  5CBE E;  4A75 A;  2WKD A;  2I5M X;  1GXD C;  5JJZ A;  3PUZ A;  3U9O A;  4JI7 Q;  1Y1V H;  3F8N A;  4X64 H;  4L5T A;  4F50 A;  4R1J A;  4FNF A;  1CI3 M;  3MWY W;  1Q81 C;  2VUM G;  3HOV B;  2UXC Q;  3IFT A;  4OX9 L;  2HVS A;  5KFK A;  4RH6 A;  4JI8 Q;  2YW2 A;  4C2M A;  4QY7 A;  4U67 3;  1BF4 A;  1BCP D;  3S16 H;  1TWG H;  2R7Z B;  3GTJ H;  3JRX A;  5CA1 F;  3I3C A;  1EYD A;  1HA6 A;  2ICI A;  4V0B A;  4MV7 A;  2VPQ A;  2AGQ A;  4JW0 A;  5BPH A;  1BKB A;  1O78 A;  4ULL A;  2LS0 1;  3CQZ B;  3WNZ A;  2ZM6 L;  4J9S A;  2Z4I A;  3KAL A;  2RCF A;  3QJY A;  4CDD C;  4LFC Q;  2YTY A;  3P7J A;  2E2J B;  5JPM C;  4IO9 A;  3CRK C;  3PW4 A;  5D3D A;  4A3J G;  5IGG A;  3GTQ B;  1D6E C;  2BA0 A;  1XDN A;  1KRS A;  4IUU A;  3HOU H;  2FP4 B;  1JOQ A;  4LSA A;  3R5H A;  4ALP A;  1I4R A;  5JJI A;  3K3P A;  3MR2 A;  2K6A A;  1T9H A;  1VQM A;  3N44 B;  1E22 A;  2W9C A;  2D62 A;  3CME A;  3J80 E;  5L1L A;  3J7A K;  3CCM A;  2VY3 A;  2EY5 A;  2R6F A;  2WAQ A;  3S1R H;  4HNU A;  3KLS X;  4BY7 B;  4ZLT F;  4RB1 A;  1S5E D;  1QVG A;  5C8Y F;  4YR2 A;  4BBR B;  3KAJ A;  4L6T B;  5FD6 A;  4DV1 L;  5IY0 A;  1BCP F;  1SFO A;  3HOZ G;  4P72 A;  5HV6 A;  3QIA A;  3RB0 A;  5CC4 A;  2TMP A;  2BCO A;  3AB9 A;  3BDL A;  2PYK A;  3BVG A;  4FXG C;  3UE1 A;  1O7Y A;  2AWN A;  2R7K A;  1KLG D;  1UE7 A;  5I2Y A;  1EUD B;  1UE5 A;  3JSN A;  1YHQ A;  2R7D A;  3T1Y Q;  1A3T A;  1X3E A;  1Y8O B;  4K8I A;  5ELO A;  2AU0 A;  2RCN A;  4LF4 L;  2KCT A;  2PNH A;  4DUZ Q;  1KL9 A;  3TS0 A;  1SLJ A;  3PF4 A;  3LWU A;  3PIP 3;  2OLS A;  2OH2 A;  3G48 A;  1MJC A;  4LF6 H;  3CPF A;  3V6J A;  1HTL D;  4A3B H;  4BBS H;  1DGS A;  2W9B A;  4X65 Q;  4DR3 H;  1CQI B;  2NVX H;  1A8V A;  4M9U A;  3H09 A;  3PO3 B;  4JI6 L;  3M7N A;  3FMA A;  4S3S A;  2F0F A;  3GV7 B;  3IAY A;  2SNM A;  2UXB H;  2NN6 I;  1WH2 A;  5A2Q L;  3LGJ A;  4P75 A;  2WAQ G;  4APM A;  4Z9C B;  2NYZ D;  4K5X A;  3ZJY C;  5KIX A;  3ZYY X;  3GV5 B;  3BA8 A;  3NP8 A;  3FP9 A;  3M4I A;  2JEA I;  2I07 B;  3T1H Q;  4A3G G;  2EE1 A;  4F4X A;  4K2L A;  1TQO A;  4RZQ A;  3N42 B;  1E1O A;  5KG1 A;  5KFM A;  1YNJ C;  5C4J B;  1ULZ A;  4HQ6 A;  1N8R C;  1TT2 A;  4HR7 B;  1SYB A;  3K5H A;  4GN4 B;  5FOB B;  2DPI A;  4KMU C;  1JR0 D;  2CQY A;  5KYL A;  2QEX A;  1G6P A;  2F0E A;  1Y1W B;  2RKS A;  3GIJ A;  1CK1 A;  2ZJT A;  4KHP L;  2B2W C;  1W3S A;  2L9H A;  4IUN A;  4XX0 B;  1C8C A;  2VOB A;  2EYJ A;  2ICE C;  4IUR A;  1K73 C;  4MHE A;  3W1G A;  1V8Q A;  1OXV A;  3FMC A;  4Q0Y A;  1U4M A;  3HOW H;  5FLX E;  4L1K A;  1LYL A;  1TVX A;  2K5V A;  3C2P A;  1Q8K A;  2EYM A;  1Y1V B;  4X62 L;  1TS3 A;  5C0X G;  2KBN A;  1HNZ L;  2W9A A;  1HRJ A;  2K5W A;  4G7Z C;  3GIK A;  3S16 B;  3KK7 A;  3PO2 H;  3VR3 A;  3GTJ B;  4I50 F;  1PYB A;  1YNN D;  4JI0 Q;  3KHL A;  2JA8 G;  2N78 A;  2W6M A;  1NTG A;  3FKI H;  3KHR A;  1VQA A;  1QJO A;  3EBE A;  1TWA H;  4UP7 A;  4IZO A;  3P20 A;  5EAY A;  2B2T A;  4DKA C;  1TXY A;  4O2B F;  5DLQ E;  2Z6K A;  4DV0 H;  2YCH A;  1IBL H;  2JYO A;  1I5F A;  5LA6 F;  3GTM B;  3PN1 A;  4EYH B;  3I4N H;  1TWF H;  1VQK A;  3GIP A;  3I70 A;  1EY5 A;  4KTA A;  3HOU B;  3URY A;  1HH2 P;  5E4X A;  3K57 A;  3KJO A;  5KFA A;  3ERS X;  1EZ8 A;  1KTK A;  4IFD G;  4ED8 A;  2NZH A;  3S1R B;  3GTO H;  2JA5 A;  3CXC A;  5IYZ F;  2A6H D;  1GUW A;  4J9N A;  1Z7T A;  3A5U A;  1IOW A;  3T56 B;  2ZTC A;  5E1F A;  4M8A A;  2VB2 X;  4CHT B;  3Q8P B;  4JI3 Q;  3V4Z A;  4MIU A;  1E4E B;  3E6Z X;  1E4F T;  2QDB A;  5JQW A;  4NW2 A;  4TQR A;  3R8B A;  1VCI A;  2R92 B;  1BOS A;  2Q2T A;  3D4W A;  3QOJ A;  5DEH A;  1PX2 A;  1T5X D;  4DV7 L;  3RZO H;  4DL7 A;  4MA5 A;  1EY4 A;  4O4H F;  4KLK A;  5DAU A;  2ALZ A;  3NQT A;  2R7N A;  2EJG C;  1M0W A;  2H5X A;  1FL0 A;  3KF6 B;  4XT3 B;  3MHB A;  4O4L F;  3H3V H;  4XQQ A;  3J7Z C;  4HNT A;  5M3M B;  2C2E A;  1M4V A;  1RYR A;  1JE4 A;  5IWA H;  2K5H A;  5C3W A;  4JI2 L;  1X9N A;  1I4P A;  2C22 A;  1CS0 A;  4MV6 A;  4A3B B;  4BBS B;  2FLN A;  2NZ1 D;  3RZD H;  3H0G A;  5EGT A;  4J9O A;  2NVX B;  2DY8 A;  2K52 A;  4X6A H;  1HA5 A;  2YTX A;  5LL6 X;  1IKL A;  1V1O A;  1Y14 B;  3PW0 A;  3J80 L;  3G6X A;  2HHH H;  1FD7 D;  1M90 C;  1XPO A;  1CKM A;  1Z6H A;  1I7N A;  4OWT B;  2PN1 A;  1X65 A;  3M9N B;  2YZN A;  3D4R A;  3BQ2 A;  2AGO A;  2ZT9 C;  4ZCK A;  2JA5 G;  3GTK B;  4GKJ L;  2UUA H;  5KEE A;  4TUY F;  4C3J G;  5LP6 F;  3OYY A;  3GV8 B;  4JI4 L;  4B3T H;  1TII D;  5IE8 A;  4RWS C;  3HOX G;  1HR0 Q;  2J6T A;  1D5X C;  3MXU A;  1XNQ L;  1C3O A;  4O4I F;  1CT1 D;  3RB4 A;  1MSH A;  1SE8 A;  4KI0 A;  4DUY L;  3ORQ A;  5LHY 1;  3K5M A;  5BR8 H;  4A3I H;  4KN7 C;  1BGW A;  3G6Y A;  2Q2U A;  2F4I A;  1F9S A;  4HSP A;  4J9R A;  4WBN F;  1Z2P X;  3VA5 A;  1UUP A;  1LT6 D;  4ZKC B;  3MR5 A;  4Q0F A;  2E5L L;  3K5O A;  3HOW B;  3S15 H;  2R8J A;  1EIG A;  1XMQ H;  4B3S Q;  3H0G G;  3U4Z A;  2IJ0 A;  2KUM A;  5BMV F;  2HVQ A;  1WI5 A;  2DPJ A;  1SYG A;  4LK1 C;  2YL2 A;  5DLG A;  4HMI A;  1B7Y B;  4RCO A;  4LF8 H;  4MZ9 A;  3H20 A;  2FFK B;  2C28 A;  4A3D H;  5KFZ A;  4DV2 L;  5BPF A;  1KJ9 A;  3GO5 A;  1Z2N X;  4AYB E;  2PQA B;  4YWM A;  1K28 A;  1PH7 A;  3S14 H;  1SMY C;  1JT8 A;  1C7Y A;  5CA0 F;  4EX5 A;  1BQQ T;  1SYE A;  3DUZ A;  1N36 H;  1TWA B;  3R2T A;  2Q2H A;  4LFA H;  5CV5 A;  3SVM A;  1EY0 A;  3A5Z B;  4QUF A;  4DK1 A;  4OO1 I;  1AUV A;  4AYB B;  4X64 L;  1X56 A;  1R9T H;  1I50 A;  5F9L A;  1FJG H;  2Z9H A;  1TWC A;  1TWF B;  3M85 A;  4EG0 A;  1YNN C;  2EOT A;  4DNI A;  3EQL C;  5FO8 B;  4WJ3 M;  1A3V A;  1B4O A;  4MTN A;  3PQI A;  2JN4 A;  2A68 D;  5IT9 E;  1WCM H;  5FLX L;  2JA9 A;  2E2H A;  3R5X A;  5FJ8 G;  4J9P A;  3CCV A;  5IP7 G;  4K5W A;  1I3Q A;  4L5S A;  1JWU D;  5TSS A;  3GTO B;  2YS6 A;  2DNC A;  5I6W A;  2Q2I A;  3A0J A;  1U9R A;  4MAM A;  1EWH A;  1FNW A;  4DV5 Q;  3ETH A;  2ATL A;  2UUB H;  2KSW A;  1L0X B;  2Y0S E;  2A1A A;  4L5R C;  2WII B;  3G6J B;  1XNR Q;  3EVQ A;  3KBG A;  2W6Z A;  4A3I G;  1EOV A;  4P74 A;  2EPB A;  4R8U B;  4OEL B;  4NDX A;  3GV6 A;  3TBI B;  3UDG A;  2QEJ C;  3A74 A;  2C2D A;  2KQ3 A;  3SE0 A;  1SYX B;  1HNX H;  2JEF A;  3LP8 A;  2WFW A;  1O7I A;  1B04 A;  1S0N A;  2W6O A;  2A6H C;  3K6O A;  5ELC A;  2Y0S B;  4OIJ A;  2L5T A;  4C3I H;  3CC2 A;  4Q8E A;  2EJM A;  2Z1C A;  1JDB B;  3PW7 A;  4LFB H;  1VMC A;  1SMX A;  1IKM A;  4RGT A;  3BDC A;  3CMA A;  3S17 H;  2PW5 A;  1CA6 A;  3E5S A;  2NU6 B;  2PCF B;  1PXU A;  5EBC A;  1VF7 A;  3FEW X;  1PRT D;  2XIW A;  5JVG 3;  4RB3 C;  4J9L A;  3J81 E;  4CC6 A;  5KFP A;  1WSC A;  3UDI A;  1ZHQ A;  4YY3 H;  5KFY A;  2IX1 A;  2BQ3 A;  2UUC H;  1SBB B;  1KEE A;  4PZ8 A;  1XMO L;  4RGM A;  4O42 A;  3SEB A;  4KD3 A;  3WOE A;  4GC6 A;  4ED0 A;  3I55 A;  3KDF B;  1A3U A;  4YWL A;  4KHV A;  1HNW Q;  1K83 H;  1FYC A;  1BVS A;  2R93 A;  2QF7 A;  4FF4 A;  4YAJ B;  1SE3 A;  2B2V A;  2LXK A;  2BOS A;  1LT5 D;  2YV5 A;  4DV6 Q;  1IYU A;  5JJK A;  4DAY A;  2MO0 A;  4LF6 L;  4C56 C;  1EYC A;  2NVY B;  2SDF A;  1K3R A;  1YBY A;  1RYS A;  1UE6 A;  4A93 H;  4DR3 L;  2DWC A;  2O03 A;  1MI2 A;  4B3R L;  1ZXT A;  4A3E G;  3MVV A;  4JBM A;  1JB3 A;  1UC8 A;  3FPU B;  2YYA A;  3OUZ A;  2VQE H;  1K1Q A;  4F7X A;  1WTO A;  4RUC A;  3K3V A;  1UEA B;  2UXB L;  4DFA A;  4PG3 A;  3HKS A;  4LH6 A;  2R8I A;  4H44 C;  1PRT F;  5JAV A;  4P71 A;  3M4Y A;  4RNN A;  2F0H A;  1YVC A;  2WIN B;  3BAB A;  5EWE A;  1BUV T;  1STA A;  1WTQ A;  2F4V H;  4JV2 A;  4H02 A;  2VA2 A;  2BH2 A;  4QWC A;  1EIH A;  2RDJ A;  1VQP A;  5KFR A;  1PH3 A;  4XIG S;  2HIV A;  4JI1 H;  3UQ8 A;  3UDF A;  4UP8 A;  3S1Q B;  4A3D B;  1X54 A;  1GOZ A;  3TZD A;  1Y8N B;  2FIN B;  1UNS A;  5EKI A;  1HTP A;  2R93 G;  1FR3 A;  4N8X 1;  3TP6 A;  1BO0 A;  1O7L A;  1PZK D;  4KV6 A;  3S14 B;  2IW3 A;  4JI7 H;  4A3F G;  2YZG A;  2NUA B;  1AUX A;  1D1I A;  2A6E D;  3Q8D A;  2UXC H;  3K80 C;  2R7M A;  3HZX A;  5JVD F;  1KBL A;  4F88 A;  4GN3 B;  4PMW A;  4JI8 H;  5KT5 A;  5JOB A;  4LUV A;  4NXN H;  4QWE A;  3CCL A;  2CH4 W;  1MHW C;  4RHS A;  3E3X A;  1R9T B;  4LMY A;  2JK8 A;  4APV A;  4OON A;  1VQF A;  1RD9 D;  1IL8 A;  2WB1 E;  2HCI A;  5DQH A;  3NEN A;  2VA3 A;  1Q46 A;  5M9O A;  1EFW A;  4RA8 A;  5EDW A;  2YU9 A;  4LFC H;  4ECW A;  1WCM B;  4MA0 A;  3L2P A;  2AQ2 B;  2B2Y C;  4ETS A;  1N48 A;  5T14 A;  4MV9 A;  5EKL A;  3NBI A;  4K0K Q;  2DJG C;  3DWQ A;  4KKT A;  5EWF A;  1MSG A;  1CZG A;  4EQO A;  5KT4 A;  2WB1 B;  3BU2 A;  1C4Q A;  1YEZ A;  1RJQ A;  2EXD A;  4DF7 A;  3BA9 A;  3N8D A;  4DV0 L;  1IBL L;  3MFH A;  3S9W A;  2RGR A;  2XIG A;  2FPG B;  2PW7 A;  5LMN W;  4ID6 A;  2NN6 G;  2F0L A;  2A68 C;  3RBD A;  3HP3 A;  5J22 A;  2ZM6 Q;  1J5E L;  2O5I C;  3F1Z A;  5GAE C;  1TA8 A;  3HFZ B;  3C46 A;  2KCC A;  2KVM A;  1KJJ A;  3RGZ A;  5CAE B;  1TY2 A;  1EQR A;  4C3I B;  5IYC H;  4DL6 A;  1PH8 A;  3ULJ A;  4RAY A;  1NAP A;  2R61 A;  2AQ3 B;  4HCE A;  1SE4 A;  3TP7 A;  1EZ1 A;  3FDT A;  5A2Q E;  2JEB I;  4RUA A;  5C1P A;  4CGY B;  1DOK A;  2A5H A;  4H7B A;  4PZ7 A;  1A62 A;  2B63 H;  2BDN A;  2W8K A;  5C3E B;  2HDM A;  1EIF A;  2RSN A;  1U4P A;  1YHB A;  4DUZ H;  2RBM A;  2F1M A;  1KDC A;  2K5D A;  2VL6 A;  1B50 A;  4IWY A;  2R7Z A;  4TRD A;  1EZ6 A;  1W2B A;  1KC8 C;  3MJF A;  5KFN A;  2W57 A;  4EEY A;  1GD7 A;  1K83 B;  5HUR A;  3MWD A;  2VUM H;  2MQH A;  3A55 A;  3CQZ A;  3QO2 A;  4CJ0 B;  2LXJ A;  1PRT C;  2E76 C;  3A54 A;  3RN2 A;  1U5K A;  1F2L A;  5IWA L;  4JOI A;  1OTC A;  4X66 H;  1MD2 D;  3SK6 A;  1UAP A;  4PMB A;  5CMD A;  3GLK A;  4PWQ A;  2BQU A;  2E8G A;  3BJU A;  2J9G A;  5EWG A;  4DR2 H;  3BS1 A;  4R4I A;  3ICE A;  1PZJ D;  1VQG A;  4LF4 Q;  3BDO A;  3RLN A;  3GTQ A;  2V9W A;  5D3I B;  5KYI A;  4TSS A;  5FLM G;  3G6V A;  1FVI A;  2HHH L;  1EY7 A;  3GP7 A;  3AMU A;  1PH6 A;  1IBM Q;  3MXP A;  2B2W A;  2KEE A;  4HED A;  4GS3 A;  2MPM A;  5E4W C;  4A3J H;  4JV1 A;  2UUA L;  5D14 A;  2CQA A;  5EJW A;  1WTP A;  3N52 A;  4ME3 A;  2E2D C;  3R5F A;  3LML A;  1RK5 A;  4B3T L;  5ELF A;  3BZD B;  2B8F A;  5KG6 A;  3DEP A;  3QB3 A;  1SEI A;  2IA6 A;  3HKZ E;  3CU7 A;  1Y8P B;  3PUY A;  1GLV A;  3IL8 A;  3NUC A;  4YP3 A;  2OEO A;  3B6Y A;  4ILW A;  1EY6 A;  2DN8 A;  4O3R A;  1Q1B A;  2Z0S A;  2MCT A;  2NU7 B;  5BR8 L;  5DQI A;  4ED7 A;  4PZ6 A;  4HID A;  1DV2 A;  2X69 A;  4Y52 H;  4YCV A;  1F9R A;  4HAE A;  3HKZ B;  4C2M H;  3HRZ C;  1K8O A;  1ET6 A;  3WWV A;  5DM7 3;  4A3L G;  5GAH C;  3TP8 A;  4UDU C;  2ZDQ A;  1ROD A;  2K4K A;  4QMG A;  3M3Y H;  2SCU B;  1XMQ L;  2NZO A;  3Q1K A;  1KDB A;  2EZV A;  3V05 A;  4KHP Q;  4UCV A;  4C1N K;  3MEH A;  4DXG A;  3HB9 A;  4JI0 H;  2VNU D;  1JOK A;  2KEN A;  1N34 H;  2VUG A;  1HUM A;  1Z9F A;  1HJP A;  4JPB W;  1HCZ A;  4UCR A;  2PBZ A;  3PUW A;  5AJ3 L;  5L1J A;  2A6E C;  4DNT B;  5C4Z A;  2FE3 A;  3NBH B;  4YHH Q;  1PV4 A;  3BZK A;  1IBK Q;  4DAP A;  4BY7 G;  1HNZ Q;  1NR4 A;  2XGP A;  5KG3 A;  4EBE A;  4HIM A;  3HOY B;  3BYY B;  4OEM B;  1PTO H;  1Q1E A;  1JDE A;  1WTH A;  1DXM A;  4LFA L;  2Z4H A;  4UCT A;  2ASJ A;  3PIO 3;  1U4R A;  4HNV A;  4HR7 A;  4EQP A;  4G3I A;  3TDQ A;  1VQD A;  2B3G A;  3MAQ A;  1FJG L;  1CA5 A;  3T5H A;  1Y1W A;  3CD6 A;  4YR3 A;  4QF4 A;  4R8I A;  1SFO H;  2G9D A;  2TSS A;  4A3G H;  2PI2 E;  3R3O A;  1NNX A;  1UWV A;  4GLA C;  2LSS A;  4L63 B;  1QZG A;  4JI3 H;  5D1O B;  1CHP D;  2G9H D;  3R2I A;  3KF8 B;  2UUB L;  5LOV F;  5CB4 F;  1Y1V A;  1EUJ A;  1U4L A;  3U4V A;  3MXG A;  4DAV A;  2B63 B;  2M2L A;  4R4C A;  5J1Z A;  2B2U C;  1K0R A;  2KEC A;  4DR1 Q;  1H95 A;  1J6Q A;  1HXY D;  2ALY B;  2L12 A;  2J0T D;  2JA6 B;  3GTJ A;  1T5E A;  1VQ4 A;  1ZET A;  2OQ0 A;  4GOP B;  1HNX L;  3I4M G;  2VQF Q;  3RUP A;  4FS1 A;  1JX4 A;  2O2L D;  3E5N A;  2VUM B;  1D7Q A;  1KRT A;  4DV4 Q;  4Y7N H;  5C0X H;  1STH A;  2DY7 A;  2R84 A;  1JE5 A;  3GTL A;  4LFB L;  3GTG B;  5IYD G;  1NE3 A;  3WOF A;  4MN3 A;  5IGD A;  3JAM W;  3GTM A;  2JA8 H;  5M3F G;  1G6Z A;  1WD1 A;  1O80 A;  1Y1W G;  2QIL A;  2AGP A;  4YY3 L;  3EIV A;  2FMA A;  2UUC L;  3RJ0 A;  4JI2 Q;  5ELB A;  1BBW A;  4X3S A;  5JEA G;  4LF9 Q;  4HJ5 A;  3NTK A;  1HR0 H;  3JC6 6;  1TWH H;  1I7L A;  2L1B A;  2OXP A;  4OO1 G;  1ZHS A;  4IWX A;  3VPC A;  1LTL A;  4GKK H;  5LL6 S;  5KRU A;  1FGB D;  4IUV A;  4DR6 H;  4JK1 C;  3PCO B;  1E4E A;  1GHJ A;  3MTS A;  4ZUJ A;  3JSL A;  4IFD H;  4WD3 A;  2R3Z A;  5C5L A;  2R92 A;  3HBL A;  1EY9 A;  4FM9 A;  3J7A F;  5F9N A;  1CZW A;  4JI4 Q;  4LF5 Q;  3RV3 A;  4ED1 A;  4KK7 A;  2VQE L;  1H9S B;  1PA6 A;  4EBD A;  2AQ1 B;  4JBK A;  3HOZ B;  2HUG A;  4DL5 A;  2J6S A;  2ASB A;  3RR5 A;  3PIO A;  3I8Z A;  1QE6 A;  5KFV A;  3KFU A;  2AWO A;  4PV1 C;  4DUY Q;  3DMU A;  5GQO A;  3TP5 A;  1KNE A;  3STB D;  3M3Y B;  4J1M A;  1PFB A;  1PFS A;  1RKN A;  3E9H A;  2F4V L;  5T1G A;  3MZ5 A;  2LY7 A;  2KCN A;  1SMY D;  4GOP C;  2FMC A;  3L3O C;  2RHS B;  3I90 A;  4JI1 L;  4FXD A;  3IKJ A;  4YCW A;  5D1P A;  4DR7 Q;  4Q45 A;  5J39 A;  5DGB A;  1EQT A;  2DNE A;  3T4A C;  1C9O A;  2ID0 A;  4L5Q A;  5L37 A;  1H9J A;  2E5L Q;  1JJG A;  2WAQ E;  4IPH A;  3RTX A;  1GO3 E;  4IZ8 A;  4X3U A;  2FJ2 A;  1HR0 W;  1RF2 D;  5IOD A;  5KFI A;  3GTK A;  1TWG B;  1WTW A;  4DR4 L;  2KHJ A;  3CRL C;  4ZI7 F;  1G2T A;  4JI7 L;  5L1I A;  1SJE D;  4WRD A;  4O1N A;  4F4W A;  4PQX A;  5LXT F;  5F2D A;  2Z6B A;  2F0S A;  2UXC L;  2SOB A;  2JA7 A;  1PTO B;  3G8C A;  1XYI A;  4DAM A;  4DV2 Q;  3NTI A;  1QZH A;  1ZEQ X;  2IX3 A;  2RDH A;  5G3L F;  4JI8 L;  4ECT A;  1SCU B;  1V43 A;  2WAQ B;  4NXN L;  2R92 G;  4TV9 F;  2JA5 H;  5GON F;  3D4D A;  4O2D A;  4C3J H;  3QZ7 A;  4RAZ A;  3CC7 A;  1GSH A;  4ZYS A;  3HOX H;  4A3G B;  2W70 A;  4DV5 H;  4DNR B;  5M3M G;  5DGA A;  3PIP A;  4LW1 A;  2D5D A;  5J3B A;  4LFC L;  1XNR H;  4X64 Q;  1AW7 A;  1SDF A;  4F4Z A;  2PZW A;  3MA2 B;  4NXM Q;  1OXT A;  2E75 C;  1JLL B;  3OPO A;  1VQ5 A;  3SK4 A;  2IBK A;  4HJ9 A;  4IUT A;  3S2D H;  2OTJ A;  2NBF A;  3NK9 A;  5DM6 3;  4O3Q A;  3DXJ C;  4A3M H;  2BDO A;  4ECY A;  1I6U A;  3OHX C;  2ZXO A;  1NY4 A;  1SND A;  1RDP D;  3LWE A;  2WYO A;  3FVQ A;  3K5L A;  4P73 A;  3H0G H;  4CKB A;  2K04 A;  2NVT H;  2BR0 A;  3ND8 A;  4O3S A;  4Y7N B;  1S3O A;  2IPK D;  1QWY A;  5KFX A;  3WO1 A;  2XVS A;  1F9P A;  4BY1 G;  1SRU A;  3RBE A;  4K6D A;  2JA7 G;  1C0A A;  4DK6 C;  1BDO A;  1F77 A;  2F3W A;  1G91 A;  3TEH B;  5FPO A;  1EYZ A;  4G7O C;  1VQL A;  4IPD A;  1EWC A;  1I94 H;  4AYB A;  2JA8 B;  3E0J A;  4IUP A;  2E2I A;  1TWF A;  4A4I A;  2UXD Q;  2JEJ A;  5IYB G;  3W1B A;  1QUQ B;  2RDG A;  3C1E A;  3OIP A;  4BA1 I;  2MNA A;  2F0J A;  1E24 A;  4RGN A;  2DLN A;  3JRW A;  3RF2 A;  5COY A;  4DUZ L;  3N43 B;  1PLF A;  2MJ8 A;  4DV6 H;  3BJY A;  5H1S E;  2KOL A;  3PW5 A;  1G2S A;  1TWH B;  4A3K G;  4B3M L;  3RFC A;  5DG9 A;  4RB2 C;  2UVW A;  2CVR A;  4O3P A;  1SYC A;  1CSQ A;  4FDB A;  4PNY A;  1N32 H;  1XMO Q;  4X66 L;  1EQV A;  2IT1 A;  3RGX A;  3AU7 A;  2KHS A;  4R8U A;  1N33 Q;  3SDZ A;  5FJ8 H;  1YIJ A;  5ELN A;  4DR2 L;  2EJF C;  5IP7 H;  3NXW A;  2DIK A;  1PVO A;  1NSN S;  2EYF A;  5BN4 A;  5J2T F;  3GTP A;  4N9P A;  5C44 G;  2IL8 A;  2YRX A;  2EYO A;  4XQN A;  3OTO Q;  2PZU A;  4JV5 Q;  3CF5 A;  2Y0S A;  3U50 C;  3MEF A;  4IJL A;  4RZR A;  4HJA A;  1HPC A;  3RV4 A;  2HQL A;  2EDG A;  3D31 A;  4LF7 Q;  4B3R Q;  3V6H A;  1Q7Y C;  1LUZ A;  4AYB G;  4EVO A;  3DLL A;  4A3M G;  4X3T A;  2K33 A;  5C0X J;  1YIT A;  1JQY D;  1LT4 D;  4IPC A;  4E6I A;  1RJP A;  2R7L A;  1EY8 A;  3EJI A;  5IT9 W;  2GVB A;  4C3H G;  1Q12 A;  1IYV A;  3KAK A;  3BYT B;  3X3M A;  3KDF A;  3NEL A;  1S72 A;  2C35 B;  1I50 H;  5EPJ A;  1QOH A;  2MFI A;  1BXT A;  1S40 A;  3STB C;  3PO2 B;  2I80 A;  1A9X A;  5KFW A;  1A2T A;  4FS2 A;  3AEV A;  2I5H A;  3F8T A;  1K0S A;  2B2Y A;  2H1E A;  1RJR A;  1STY A;  4AQY Q;  1II3 A;  2E2H H;  3FKI B;  2NVY A;  3V6K A;  2IP4 A;  4CKE A;  3RB3 A;  2A8V A;  1I3Q H;  5CYU A;  3S24 A;  2JA5 B;  3VYU A;  3JAM i;  2FPP B;  2X0S A;  4I7A A;  1G29 1;  1F2Z A;  1RIP A;  2O4X A;  4JI0 L;  1N34 L;  1JOR A;  3HOX B;  3I4N B;  4CBV A;  5I4D A;  1VBH A;  4K0K H;  3JAM c;  1WJJ A;  2OQK A;  1ILP A;  4IFD J;  4EQ5 A;  3MXN B;  1IOV A;  1PH9 A;  4GLV B;  4XYQ A;  3VPB A;  5E7N A;  2A73 B;  3F2B A;  1M0T A;  3VYR A;  4A3E H;  5JJL A;  4DL2 A;  4IHJ F;  1IHZ A;  3SHL A;  1OWT A;  2RSO A;  4IQZ A;  3S2D B;  1EEF D;  4YJ2 F;  3PR4 A;  3JAM L;  4RAU C;  1MIU A;  2HVR A;  1L2F A;  1PZI D;  3CCQ A;  4CC5 A;  3J7A 5;  1X32 A;  2F0I A;  4J6H A;  1LTI D;  4H0L C;  2NVT B;  4I7Z C;  2M05 A;  1QCB D;  2EQS A;  5CV8 A;  3SR1 A;  1I4X A;  2IY5 B;  2JJQ A;  2ZDH A;  3RZO B;  2AHO B;  4KN4 C;  1A2U A;  3GQB A;  5C6A A;  5C5J A;  3N41 B;  3D3R A;  1H9R A;  4ODG A;  2JSO A;  5AFW A;  1DOL A;  1S9F A;  4JI3 L;  4CJ1 B;  2OTL A;  1CUK A;  5A35 A;  2BH8 A;  5HY6 A;  1J5E Q;  4BA2 I;  2R93 H;  1ENF A;  1E3P A;  2HD3 A;  4LWC A;  4YBZ B;  1O7Z A;  4A3F H;  1BJT A;  1EUC B;  2I5L X;  2NUC A;  1PH2 A;  4FF3 A;  3RZD B;  4YCU A;  4HMJ A;  3J7A V;  1S03 G;  2IHF A;  5KT7 A;  3DWA A;  1RL2 A;  3V2T A;  1FNV A;  1ML0 D;  4ZKB B;  2EYH A;  4YQW A;  1Q82 C;  1JMC A;  1RHP A;  2YZM A;  4KJO A;  3M9B A;  1DZ1 A;  2WB1 A;  2NU9 B;  1D1K A;  1S5C D;  2FJZ A;  2XD4 A;  4IAL A;  5M5X H;  4O3O A;  4FP5 D;  4DV3 Q;  1IBM H;  4JYA H;  3OWE B;  4POF A;  4L8J A;  3I2Z A;  3VR2 A;  4TVA B;  5M5W H;  4C5B A;  1HQM C;  2L11 A;  3GD7 A;  2OT2 A;  4P2C B;  1SNM A;  1QVC A;  5CV7 A;  4E4T A;  4A3I B;  1SNO A;  4RNO A;  3S1M H;  1VQI A;  1L0W A;  4UAI A;  1LTR D;  4K8J A;  2EYL A;  2NN6 H;  4J8Q A;  5LMU Q;  1KJQ A;  3QFF A;  1KJ8 A;  1L1O B;  1S5F D;  1ILQ A;  1P16 A;  4DN4 M;  1YHA A;  2UU9 Q;  4M7E A;  5KT2 A;  4ECZ A;  1W6J A;  2F0G A;  4GKK L;  2C9O A;  3ND9 A;  5M5Y H;  3S15 B;  2XGT A;  3G71 A;  3CCR A;  4DR6 L;  2K5Q A;  1D2B A;  2M9V A;  2XTI A;  3PMF A;  5CBA E;  4DR5 Q;  2R7F A;  1JJC B;  4IRC A;  4G4K A;  3KXY T;  4TQS A;  4JI5 Q;  4R9W A;  3KJP A;  2WE6 A;  5LMN H;  3RUZ A;  5DLF A;  2N8N A;  5KNC A;  1I50 B;  2XWB B;  5I6Y A;  3H3V C;  2P0A A;  3J81 j;  3TN2 A;  4QWD A;  2A19 A;  4B08 A;  2W7O A;  2K05 A;  1RK6 A;  2YU9 H;  4QGU A;  2QK4 A;  2MP1 A;  1SYD A;  4A3C G;  1VQB A;  3OSN A;  1I3Q B;  2NTT A;  4Q5V A;  4YHH H;  4DPG A;  4IOC A;  3OW2 A;  4IRD A;  1EOT A;  1IBK H;  1C48 A;  1VQC A;  1HNZ H;  5IOC A;  3K0Y A;  1LV9 A;  3G4S A;  4EFB A;  2A74 C;  2ZDG A;  2WDT A;  5EBD A;  3NWT A;  3UE0 A;  4KKU A;  5KG2 A;  1B33 N;  5A2Q W;  4A3E B;  2HGS A;  2X6L A;  5ISR A;  1GHK A;  4ED6 A;  2AQ4 A;  5FLM H;  4ME5 A;  1YJW A;  3MR6 A;  4UPA A;  4ZHQ F;  4OX9 Q;  5AJ3 Q;  2R8K A;  2K50 A;  1PH5 A;  5C3E G;  4IUQ A;  1LAC A;  1TU2 B;  1MKH A;  3J7Y W;  4R8N A;  4BXX G;  1RCV D;  2J6U A;  2OWO A;  4N8F A;  3RD4 A;  4G57 A;  5KT3 A;  1E2V A;  2Q8I B;  1DIK A;  1SNQ A;  2B2U A;  3CCU A;  1U0L A;  1ICF B;  3D8G A;  4K6L A;  1L1O C;  4DV5 L;  4XYO A;  2P5Z X;  2PPB C;  1STN A;  3C3L A;  3G6E A;  4UCO A;  2FXQ A;  1SN8 A;  4KY5 A;  1XNR L;  4EQN A;  3U58 A;  3AFQ A;  1BR9 A;  3CC4 A;  3RLO A;  4DR1 H;  2PMZ E;  1IXR A;  3L4J A;  4RGO S;  2V4Q A;  2KA7 A;  2KJX A;  5KFF A;  2FPI B;  3P75 A;  1TY0 A;  3S17 B;  2XRQ D;  1JWS D;  5C4X G;  1DD2 A;  2VQF H;  4A3F B;  2PNR C;  3KYH C;  4DV4 H;  2E2J H;  5IGE A;  2KED A;  4YAK B;  3M4P A;  3OSO A;  4G7H C;  3FRP B;  1PHJ A;  4A3L H;  3T1Y H;  3NQI A;  1V1P B;  2JE6 I;  2I87 A;  2L4N A;  1HUN A;  1H9M A;  2PMZ B;  1WYD A;  4GNX B;  1TR5 A;  1FGU A;  3GTQ H;  2XWJ B;  2L55 A;  1B70 B;  3TS2 A;  2W71 A;  3M7G A;  2NVQ H;  4DV1 Q;  5BN3 A;  2CHB D;  1QB5 D;  4HIO A;  3Q8Q B;  4DA2 A;  2E74 C;  3D6C A;  1SR3 A;  4OWX B;  4A76 A;  3H3V I;  4X65 H;  1S97 A;  1HNX Q;  3FDS A;  4JI2 H;  5HGQ A;  2Z8L A;  3QWN A;  1I94 L;  3WDN A;  5M5X B;  5DG8 A;  4LF9 H;  2BE5 D;  2GPW A;  4BY7 H;  3H94 A;  4HN7 A;  1TS2 A;  3TZU A;  4RU9 A;  2K75 A;  3H4D A;  4IN3 A;  4KD4 A;  5M5W B;  4XT1 B;  4A93 B;  3E9I A;  1R4P B;  3I72 A;  4EYI B;  2HQE A;  4LNQ A;  5FD5 A;  4IOA A;  2O5J C;  3NTH A;  3S1M B;  4FF2 A;  1V51 A;  1W96 A;  4DV6 L;  2KHI A;  5KKN B;  2CKZ B;  5D1O A;  3SE7 A;  3IRB A;  2AUJ D;  4UHV A;  1HZC A;  3RMH A;  3T1H H;  3KF8 A;  5I2X A;  2UUC Q;  1N32 L;  4IR9 A;  2RA4 A;  4GZY C;  5KFQ A;  4LF5 H;  2PI2 A;  5C4H A;  2GN5 A;  4F8M A;  4JI6 Q;  1QNU A;  4UFZ A;  3HOV G;  3MFY A;  3ERO A;  1BNZ A;  5LYJ F;  4DL3 A;  3SXH A;  1CTM A;  1M7J A;  5JUM A;  2JA6 A;  4GN5 A;  4GOP A;  1I4H A;  1DOM A;  4I65 A;  2NTS A;  4MTD A;  2R7Z G;  4EGQ A;  5JVH 3;  1KNA A;  1M8A A;  4F87 A;  5CGK A;  1LM0 A;  3H6M A;  2YYZ A;  1QNK A;  4PDB A;  2B39 A;  3TIG A;  3H4B A;  3HOY G;  4JV0 A;  4Q8F A;  5CV4 A;  2SEB D;  2R82 A;  4KKS A;  3GTG A;  1AFP A;  4MTE A;  1SEB D;  2YU9 B;  1IZ6 A;  4FBU A;  3I4M H;  2WAC A;  4QW8 A;  1S10 A;  4DR7 H;  2E5L H;  2VPS A;  1N9W A;  2VQE Q;  3EYY A;  1ENA A;  1VQO A;  1NMF A;  1YJ9 A;  4GNX C;  3GIM A;  4R4O A;  1B1Z A;  5IYD H;  4MV4 A;  4XXE A;  3NEM A;  4DXF A;  3EN2 A;  3J80 W;  2CZG A;  4LF8 L;  5M3F H;  1VBG A;  2JEI A;  3OUU A;  4ECU A;  2W6P A;  1Y1W H;  4OHJ A;  2H4O A;  2IHE A;  1SNP A;  4QIW E;  4N9T A;  1B6R A;  4X62 Q;  3QR8 A;  2F0N A;  5C1O A;  3KLR A;  5JEA H;  2RVL A;  1JB7 A;  3K59 A;  2F0P A;  1VQJ A;  4BBR G;  1KHI A;  1N36 L;  3M9M B;  1QVF A;  2JA6 G;  4DR4 Q;  1RJT A;  2R8G A;  4A2A A;  4OO1 H;  4NPS A;  3HS0 C;  1YJN A;  4QIW B;  4LH7 A;  4ZRZ A;  1EL0 A;  1GKH A;  1H9S A;  1CQJ B;  2C00 A;  4NXM H;  4K0K L;  3PZP A;  5I9P A;  1IL2 A;  3GID A;  4NXN Q;  3QOL A;  2EY6 A;  3FHW A;  1DJR D;  1GUT A;  2RDI A;  2MUY A;  4F4Y A;  1XJV A;  2HJW A;  4MTK A;  3PW2 A;  1KD1 C;  3GII A;  1DCZ A;  3JZI A;  1X3Q A;  2IWH A;  3GTL H;  5FPR A;  5JVL A;  1TS4 A;  3I12 A;  3PUV A;  3HEJ A;  1JC7 A;  3NWS A;  5K36 G;  4DGZ A;  3PO3 G;  2XCP A;  2R8H A;  3MFG A;  4I7H A;  3TRZ A;  1FKA H;  3GTM H;  1QG7 A;  3CVZ A;  1B3Q A;  1TWG A;  3W2D A;  2ZTD A;  1EYA A;  1B53 A;  1CKN B;  2RF4 A;  2QYZ A;  2PO4 A;  5IP9 G;  1AZQ A;  2NVQ B;  3SK5 A;  2UXD H;  1NCV A;  3BQ0 A;  4RCN A;  4K14 A;  5GRO A;  2V4D A;  2N49 A;  4TKO B;  3Q24 A;  3DWP A;  2W8L A;  2HDL A;  3CCJ A;  1EQQ A;  1GUG A;  1PTO D;  4FF1 A;  3M4O H;  1RTO A;  4DV7 Q;  1PFM A;  2ES2 A;  1G51 A;  1GUS A;  5KFE A;  1WTX A;  4Q43 A;  3D6W A;  1J9O A;  1OXU A;  3K5I A;  2F0K A;  1XMO H;  2R92 H;  4FXK C;  2F0W A;  4ABN A;  1RTN A;  1PH4 A;  4QCL A;  1HFN A;  2R86 A;  1N56 A;  4IJH A;  5I9O A;  2JQO A;  1N33 H;  5FLX W;  4MV8 A;  1CHQ D;  2C2R A;  3VYS A;  2BE5 C;  4LUO A;  4A3J B;  4RKB A;  2C5C A;  3A8K E;  5M3M H;  5DQG A;  3DF7 A;  4Y8V B;  2WTF A;  1Y1V G;  4ZUI A;  4DK3 C;  1S0M A;  1ZKO A;  3OTO H;  4JV5 H;  3Q22 A;  4RFB A;  2CWP A;  4ECX A;  4UP9 A;  5FKA C;  3TIN A;  1IBM L;  4B3M Q;  3BZC A;  3NPP A;  3LNN A;  4JYA L;  1DM0 B;  1CKO A;  1S5B D;  2LMC B;  4GKJ Q;  2L0C A;  3CCS A;  3M9O B;  4LF7 H;  3K7A H;  4B3R H;  4X66 Q;  5G3L D;  1A0I A;  3U9T A;  1P8L A;  3RAQ A;  5CV6 A;  3I4O A;  2RQX A;  1BCP B;  1YNX A;  1LTT D;  1EYG A;  3N40 P;  1KQS A;  3E0E A;  4DR2 Q;  3KHH A;  4B3S H;  3KF6 A;  1XNQ Q;  1PTO F;  2DGY A;  4R4Q A;  1W93 A;  3CCE A;  5KT6 A;  4EBC A;  4C2M B;  1VQ9 A;  5DNF A;  3I4M B;  4JOI C;  1X3P A;  3K58 A;  1T36 A;  3GTK H;  4EEQ A;  1WOC A;  1H9K A;  2MO1 A;  1QUQ A;  2WP8 J;  4IR1 A;  4BY1 H;  3CPW A;  3VMM A;  2JA7 H;  2NVX A;  1HZA A;  2LFN A;  4XYM B;  3HOU G;  1KIX A;  3W3A A;  4NB3 A;  3A8J E;  2F0V A;  5LMN L;  1GUO A;  3PGZ A;  5EPL A;  1D8L A;  5M3F B;  4EFE A;  4U7C A;  4AQY H;  3JAM E;  1HZB A;  4ZQI A;  1A15 A;  4XQJ A;  5IYB H;  1TWH A;  2V4R A;  4BS9 A;  1ASZ A;  3CP0 A;  1MGS A;  5D8D A;  4I55 F;  2XC9 A;  4FBT A;  1L0Y B;  1JIC A;  3H91 A;  5KGU A;  2YS7 A;  1VMP A;  4JCV E;  3OHB A;  2ZJP A;  2W9C B;  2PQE A;  3IFD A;  4A3K H;  1S68 A;  1S0O A;  3TQY A;  3V96 A;  2X6G A;  4YHH L;  1VS0 A;  4WFN 3;  1IBK L;  2DUD A;  1VKZ A;  3O13 A;  4JC0 A;  1E1T A;  4J9Q A;  5KNB A;  3MWE A;  1SFO B;  5LL6 b;  2DJF C;  5CR3 A;  3KHG A;  4NKL A;  5IGF A;  4ZOL F;  2K7V A;  1B2T A;  1VAJ A;  5EZY F;  1EU3 A;  1BXR A;  3EPI A;  4I4T F;  3GQC A;  5C44 H;  2CFM A;  4YWK A;  1N34 Q;  2EY2 A;  1KLU D;  3Q23 A;  3S2H H;  4A3B G;  4BBS G;  1F2M A;  1SE2 A;  3GTL B;  4U68 A;  3BAA A;  3W5O A;  1ASY A;  2VR1 A;  1ESR A;  4HJ7 A;  4MNO A;  1BCP C;  3C0F B;  4JG2 A;  2E2I H;  4DLK A;  3ULP A;  2UVU A;  2K1B A;  1J5E H;  4ECQ A;  1NR2 A;  2W9B B;  3MFI A;  1EHI A;  2PQA A;  1TAE A;  2MHV A;  1STB A;  3FPP A;  4KJN A;  2RHQ B;  3A56 A;  5CV9 A;  4C3H H;  3KBX A;  3MR3 A;  3FKI A;  1UE1 A;  4DR1 L;  1W6K A;  4J9M A;  1TWA A;  3KLW A;  5KFL A;  3T53 B;  3M4O B;  4ZQ3 A;  2VQF L;  1LTG D;  3H40 A;  3RAX A;  2CW7 A;  4DV4 L;  4AIM A;  5JEA J;  1HNW H;  1VQ8 A;  1EEI D;  1AE2 A;  3T1Y L;  1VQN A;  2R87 A;  2V59 A;  3LX0 A;  3MXN A;  4CDC C;  1PH1 A;  1I4G A;  1VQ7 A;  3R23 A;  1ZYR D;  3GTP H;  3A7L A;  3J80 i;  5ELE A;  2M00 A;  4RNM A;  1G8Z D;  3VA7 A;  1ESF A;  4DV3 H;  1XPR A;  1PTO C;  1X3G A;  1T94 A;  3HOW G;  3NHH A;  3IG0 A;  3GTO A;  1SRO A;  3J80 c;  4CDF C;  4IPG A;  4ME6 A;  3Q0A A;  4X65 L;  2ZJR A;  3EA6 A;  4LUZ A;  1IYJ B;  3ERQ A;  4LF9 L;  2F0Q A;  1BNC A;  4JUZ A;  5KFT A;  2JXM B;  1FNU A;  2ASL A;  1ET9 A;  1I6H H;  5LMU H;  3QG1 A;  3RNU A;  1IW7 D;  3BVM A;  3PO2 G;  4C5A A;  3F2U A;  4LSX A;  2UU9 H;  3K7A B;  2QCP X;  4B9W A;  2FKL A;  4CKC A;  4POG A;  1B9N A;  1M1K C;  3OMG A;  1WR2 A;  4K5V A;  5HBR B;  2WKC A;  4A2B A;  2D0P A;  4LF6 Q;  3FKI G;  1TKW B;  5JH7 F;  4DR5 H;  4MV3 A;  2NWG A;  3T1H L;  1SXT A;  3WO0 A;  4DR3 Q;  2RDF A;  4JI5 H;  4XYL B;  1KJI A;  4Q44 A;  2XSC A;  1HQR D;  4LF5 L;  3OOC A;  1CM9 A;  4BY1 B;  3ONA B;  4R4T A;  4C1N I;  4RG1 A;  2JA7 B;  3I4N G;  4EGJ A;  2ASD A;  2XCA A;  2NVY H;  1Z2O X;  5EPK A;  5IGC A;  2UXB Q;  1BBX C;  1B9M A;  1KAB A;  3OMC A;  2F3I A;  2D2C C;  4GKK Q;  3AFP A;  3HXL A;  4DR6 Q;  1NUC A;  3ER0 A;  4LMQ D;  1CE8 A;  4DU9 A;  1TWC H;  2HCC A;  1CQV A;  4X3K A;  4NLG A;  5KG7 A;  2F0U A;  2CCZ A;  4J15 A;  4WOR A;  1OXS C;  4OXP A;  4BWG B;  1KXL A;  4DR7 L;  1Q90 A;  3NGD A;  4IAJ A;  4A3K B;  3N6R A;  5ELD A;  1XTC D;  3BG5 A;  1EFI D;  4C3J B;  3R93 A;  2EXZ A;  1YZ6 A;  3K81 C;  3S1Q H;  3TII A;  3OW7 A;  4GC7 A;  4OX9 H;  5BN5 A;  2Y0S G;  1M6V A;  3L0O A;  2LKV A;  4EGV A;  1L1O A;  4XTC S;  2K32 A;  3N6X A;  5C44 B;  1NMG A;  1EIY B;  4UCS A;  5EQ0 A;  3MWM A;  2B29 A;  2B8G A;  1K8G A;  3J81 W;  3S2H B;  4QUC A;  4O0A A;  3KOJ A;  3T16 A;  1ICW A;  4LJZ C;  5IIF A;  2ZM6 H;  3PVX A;  5FLX c;  4OIK A;  1ONL A;  2N3S A;  1UEB A;  2EIF A;  3I91 A;  2BA1 A;  4QQB X;  2JEG A;  1OXX K;  1L2Z A;  4OGQ C;  1K9M C;  1JWM D;  4A3M B;  1HZ9 A;  4YR0 A;  2E2I B;  2IX0 A;  1CQF A;  1B8A A;  1KAW A;  2YTV A;  4NXM L;  1MBY A;  2W7P A;  3VPD A;  5NUC A;  3H0G B;  3BQ1 A;  1GM5 A;  2HIX A;  3K7U C;  4C3H B;  2PVP A;  5JPN C;  3Q8S B;  4UY8 C;  1AE3 A;  4KY6 A;  4H13 C;  1SSO A;  4DV0 Q;  1IBL Q;  4QB4 A;  3VR6 A;  1GSA A;  4RB0 A;  4GLX A;  3I56 A;  4WJ4 A;  4LAA A;  4RKL A;  1Q86 C;  5KFD A;  3OWF A;  3QZ8 A;  2CW8 A;  3D0F A;  4O3N A;  2FHT A;  5KFB A;  2D9U A;  2B2T C;  1B6S A;  1R9T A;  2Z6K C;  2CW0 D;  3UFX B;  4DL4 A;  5EKK A;  2GLT A;  4DV1 H;  1HHV A;  4A3C H;  2R6G A;  3RLF A;  1S4Z A;  1GVP A;  3C1F A;  3GTP B;  1K8A C;  5KFH A;  1WCM A;  1JIH A;  1PFN A;  5HGT A;  5I47 A;  3ETJ A;  3PSI A;  5KFO A;  2UXD L;  4CJ2 C;  5C0X I;  4OL7 A;  4J9K A;  2F52 A;  4LF4 H;  2EVB A;  2F0T A;  5C5M A;  1YI2 A;  1C30 A;  2VZA A;  2VQD A;  4A3D G;  3TQT A;  1ZYR C;  4IRK A;  1I6H B;  1VQH A;  3CW2 C;  1JCK B;  1X3F A;  3SGI A;  1O75 A;  2UVV A;  3EFX D;  4FYD A;  5E3F A;  4HTH A;  2A69 D;  5C3E H;  2FK3 A;  5FO9 B;  5KX5 F;  2IMW P;  5IWA Q;  1XPU A;  1I94 Q;  1MZB A;  2ZXP A;  4BXX H;  3VDY A;  2W6N A;  1T3N A;  4JI6 H;  2G5D A;  5C3X A;  1N33 L;  1JJ2 A;  1PK8 A;  2Q8T A;  4YIJ A;  1HR0 L;  1NBW A;  5H80 A;  3EPG A;  4ED3 A;  3CKI B;  3Q2O A;  5GAD C;  4V19 0;  1VF5 C;  2YRW A;  3OIQ A;  3U9S A;  1IW7 C;  2FK2 A;  1OO9 B;  5KG4 A;  2XGQ A;  3RB6 A;  3OTO L;  4JV5 L;  2HHH Q;  2AKW B;  1V1P A;  2ZXR A;  2OCE A;  3OHA A;  3A8I E;  4IFD I;  2PMZ A;  3M4Q A;  4GNX A;  2XN9 C;  2J7Z A;  3DM1 A;  3TRE A;  1N32 Q;  5C4X H;  1K8M A;  2AUK A;  3DM3 A;  2UUA Q;  4NMZ A;  4LF7 L;  1WFQ A;  4RMF A;  1WCM G;  2CWA A;  1K83 A; 
#chains in the Genus database with same CATH homology
 1LM0 A;  4B3T Q;  2YYZ A;  2VQE L;  1PA6 A;  4JBK A;  3HOY G;  4B3S L;  1VQ6 A;  2ASB A;  2Q2U A;  3RR5 A;  3PIO A;  1X6O A;  3KFU A;  2AWO A;  1IZ6 A;  4DUY Q;  2WB1 G;  3I4M H;  2V1C C;  5GQO A;  3S1N H;  3STB D;  5BR8 Q;  2E5L L;  1N9W A;  3F2C A;  1EWI A;  1PFS A;  2L15 A;  3E9H A;  2VQE Q;  2HT1 A;  2F4V L;  4B3S Q;  3H0G G;  3PUX A;  1NMF A;  3U4Z A;  1VQO A;  1YJ9 A;  4GNX C;  1WI5 A;  4GOP C;  4R4O A;  2ATW A;  5IYD H;  2RHS B;  4JI1 L;  4YCW A;  3NEM A;  1V1Q A;  4DR7 Q;  1B7Y B;  3EN2 A;  3RN5 A;  4MZ9 A;  1C9O A;  2ID0 A;  4L5Q A;  4AQY L;  2E5L Q;  4LF8 L;  5M3F H;  2WAQ E;  4IPH A;  1BBU A;  3S15 H;  1GO3 E;  4DV2 L;  2ZTE A;  1XMQ Q;  1HR0 W;  2K14 A;  1Y1W H;  3GO5 A;  2KCM A;  2IHE A;  4TQU S;  4AYB E;  4DR4 L;  2KHJ A;  4QIW E;  2PQA B;  4YWM A;  4X62 Q;  1PH7 A;  4JI7 L;  3S14 H;  3PV0 A;  1JT8 A;  1JB7 A;  1C7Y A;  2UXC L;  4LF8 Q;  4EX5 A;  1VQJ A;  4DAM A;  4BBR G;  4DV2 Q;  1QZH A;  1KHI A;  1N36 L;  4JI8 L;  1QVF A;  1V43 A;  2Q2H A;  2JA6 G;  4NXN L;  4DR4 Q;  2R92 G;  3A5Z B;  2JA5 H;  4O2D A;  4NPS A;  2AMC B;  4C3J H;  4JBW A;  4OO1 I;  4X64 L;  3CC7 A;  1X56 A;  1YJN A;  1R9T H;  1GKH A;  3M85 A;  3HOV H;  3HOX H;  3AQQ A;  4K0K L;  3UDX A;  1N36 Q;  4DNI A;  1IL2 A;  5M3M G;  4AH6 A;  4NXN Q;  3PIP A;  4WJ3 M;  4LW1 A;  4LFA Q;  3L7Z C;  4MTN A;  5J3B A;  4LFC L;  3FHW A;  1AH9 A;  4X64 Q;  2R7Z H;  1WCM H;  2JA9 A;  1FJG Q;  5FJ8 G;  1XJV A;  3CCV A;  5IP7 G;  4NXM Q;  1KD1 C;  4HJ8 A;  1CSP A;  1OXT A;  4L5S A;  3HOY H;  2Q2I A;  3A0J A;  1VQ5 A;  4A93 G;  4DV5 Q;  3CQZ H;  4HJ9 A;  3GTL H;  3S2D H;  2OTJ A;  3PUV A;  2Y0S E;  3K8A A;  2A1A A;  4JBJ A;  3F2D A;  4L5R C;  1XNR Q;  3PO3 G;  5K36 G;  4A3I G;  1EOV A;  4A3M H;  4P74 A;  3K0X A;  4DAY B;  3TRZ A;  1NY4 A;  3GTM H;  1MJE A;  4P73 A;  4QJF A;  3H0G H;  5GAG C;  2NVT H;  3UDG A;  3A74 A;  2ZTD A;  2UUB Q;  2WFW A;  1CKN B;  1O7I A;  2RF4 A;  1S3O A;  2VS1 A;  5IP9 G;  2D0O A;  2GVA A;  5IT9 c;  4BY1 G;  1SRU A;  5GRO A;  4C3I H;  2N49 A;  3CC2 A;  4DK6 C;  2JA7 G;  1C0A A;  1SMX A;  3TEH B;  3I7F A;  3CMA A;  1E7Z A;  1VQL A;  3CCJ A;  4IPD A;  1EQQ A;  3S17 H;  3M4O H;  4DV7 Q;  2ZJQ A;  3GDE A;  4A4I A;  2UXD Q;  5IYB G;  2ES2 A;  1G51 A;  3CAM A;  1QUQ B;  3W1B A;  1HNW L;  4BA1 I;  2MNA A;  4BBR H;  1E24 A;  1OXU A;  2K5N A;  3UDI A;  2IX1 A;  4LFB Q;  4DUZ L;  2JA6 H;  2R92 H;  3HKZ G;  4PZ8 A;  1XMO L;  1PH4 A;  3I55 A;  3KDF B;  4IJH A;  2JQO A;  5H1S E;  4YWL A;  1HNW Q;  4DV3 L;  1K83 H;  1BVS A;  4A3K G;  4B3M L;  4LUO A;  4YY3 Q;  1PYS B;  2LXK A;  1V9P A;  1NJI C;  5M3M H;  1CSQ A;  4FDB A;  3J81 i;  2QA4 A;  3GTG H;  1XMO Q;  1Y1V G;  4X66 L;  2YV5 A;  4DK3 C;  4DV6 Q;  2IT1 A;  1A63 A;  5JJK A;  2MO0 A;  1N33 Q;  4LF6 L;  2CWP A;  4UP9 A;  5FJ8 H;  1YIJ A;  5ELN A;  3J81 c;  5IP7 H;  4DR2 L;  1K3R A;  3BZC A;  1IBM L;  4B3M Q;  4JYA L;  1YBY A;  5LMU L;  1PVO A;  1UE6 A;  4A93 H;  1CKO A;  4DR3 L;  2UU9 L;  4GKJ Q;  3CCS A;  1CKN A;  3K7A H;  4X66 Q;  5C44 G;  4B3R L;  1A0I A;  4A3E G;  1P8L A;  4JBM A;  3I4O A;  1X55 A;  3OTO Q;  3PO3 H;  1YNX A;  1EYG A;  4JV5 Q;  1XTD A;  3CF5 A;  4HIK A;  1KQS A;  3AYH B;  3E0E A;  4DR2 Q;  4DR5 L;  3KF6 A;  3U50 C;  2QGQ A;  1XNQ Q;  4JYA Q;  3MEF A;  2DGY A;  4IJL A;  4R4Q A;  2UXB L;  3CCE A;  4HJA A;  4PG3 A;  3HKS A;  1VQ9 A;  2HQL A;  4JOI C;  3D31 A;  3GTK H;  4LF7 Q;  4JI5 L;  4B3R Q;  4P71 A;  3PF5 A;  1Q7Y C;  1WOC A;  1LUZ A;  4AYB G;  3ULL A;  1YVC A;  2VW9 A;  3DLL A;  4A3M G;  2MO1 A;  1QUQ A;  2WP8 J;  5IP9 H;  5C0X J;  4BY1 H;  3CPW A;  1YIT A;  4H02 A;  2JA7 H;  2BH2 A;  1HZA A;  4IPC A;  1VQP A;  2GVB A;  1PH3 A;  4XIG S;  2HIV A;  1Q12 A;  1KIX A;  4NB3 A;  3HOU G;  3UDF A;  4UP8 A;  5C4J H;  5LMN L;  3KDF A;  2CQO A;  1X54 A;  3NEL A;  1D8L A;  3PGZ A;  5IYC G;  1S72 A;  2C35 B;  1HZB A;  1I50 H;  5IYB H;  2F4V Q;  2MFI A;  3H15 A;  1S40 A;  4QL5 A;  3STB C;  1ASZ A;  3HOZ H;  3CP0 A;  2R93 G;  3AEV A;  1Z47 A;  2I5H A;  4OWW B;  1VQE A;  3F8T A;  4JI1 Q;  4A3F G;  5LMN Q;  3Q8D A;  3K80 C;  4AQY Q;  4JCV E;  2E2H H;  2ZJP A;  2B63 G;  2I0Q A;  4GN3 B;  4PMW A;  4A3K H;  1I3Q H;  3S24 A;  4LUV A;  2A8V A;  3TQY A;  4YHH L;  1VS0 A;  3CCL A;  3JAM i;  4KHZ A;  4A75 A;  1IBK L;  4JI7 Q;  1G29 1;  2I5M X;  1RIP A;  3PUZ A;  4JI0 L;  1Y1V H;  2JK8 A;  4L5T A;  4R1J A;  4OON A;  2DUD A;  4APV A;  1Q81 C;  1N34 L;  2VUM G;  1VQF A;  4JC0 A;  2UXC Q;  1E1T A;  4OX9 L;  3JAM c;  1WJJ A;  2OQK A;  2WB1 E;  4JI8 Q;  3NEN A;  4EQ5 A;  4IFD J;  3MXN B;  1Q46 A;  4QY7 A;  3S16 H;  1PH9 A;  4GLV B;  1EFW A;  1TWG H;  3GTJ H;  5E7N A;  3F2B A;  3L2P A;  5C44 H;  2CFM A;  4YWK A;  4A3E H;  1N34 Q;  5JJL A;  3S2H H;  1BKB A;  4A3B G;  4BBS G;  4K0K Q;  2ZM6 L;  3W5O A;  1ASY A;  3BU2 A;  1MIU A;  4HJ7 A;  4MNO A;  4LFC Q;  2YTY A;  1L2F A;  1YEZ A;  3CCQ A;  2EXD A;  4DV0 L;  1IBL L;  3J7A 5;  5LMN W;  4JG2 A;  2E2I H;  4IO9 A;  2NN6 G;  3ULP A;  2ZM6 Q;  1J5E L;  2EQS A;  4A3J G;  3F1Z A;  5GAE C;  2IY5 B;  2PQA A;  2JJQ A;  3HFZ B;  2BA0 A;  1KRS A;  3HOU H;  2AHO B;  4C3H H;  2RHQ B;  4ALP A;  5JJI A;  1T9H A;  1VQM A;  1EQR A;  5IYC H;  1E22 A;  1UE1 A;  2D62 A;  4JI3 L;  1CUK A;  3ULJ A;  3CME A;  4DR1 L;  1PH8 A;  2OTL A;  2BH8 A;  3KLW A;  3CCM A;  5HY6 A;  1J5E Q;  4BA2 I;  2VY3 A;  2R93 H;  3S1R H;  2VQF L;  1E3P A;  4LWC A;  4A3F H;  4DV4 L;  4AIM A;  2I5L X;  1PH2 A;  5JEA J;  2JEB I;  1QVG A;  4YCU A;  1VQ8 A;  1AE2 A;  4PZ7 A;  5IY0 A;  4DV1 L;  3T1Y L;  1A62 A;  2B63 H;  1VQN A;  3HOZ G;  1EIF A;  2IHF A;  1YHB A;  4P72 A;  1RL2 A;  2VL6 A;  1PH1 A;  1VQ7 A;  3UE1 A;  3GTP H;  1W2B A;  3J80 i;  1KC8 C;  2AWN A;  1GD7 A;  1UE7 A;  2VUM H;  1Q82 C;  1UE5 A;  1X3G A;  1XPR A;  2MQH A;  2R7D A;  3T1Y Q;  1X3E A;  1YHQ A;  1JMC A;  3HOW G;  1SRO A;  5ELO A;  2LXJ A;  3J80 c;  2RCN A;  4LF4 L;  3M9B A;  4IPG A;  2KCT A;  2PNH A;  4X65 L;  2ZJR A;  1U5K A;  3RN2 A;  4DUZ Q;  1KL9 A;  3TS0 A;  1SLJ A;  4JOI A;  4LUZ A;  5IWA L;  1OTC A;  3PF4 A;  1IYJ B;  4LF9 L;  3G48 A;  1MJC A;  3CPF A;  5M5X H;  2E8G A;  3BJU A;  4DV3 Q;  4R4I A;  3ICE A;  4A3B H;  4BBS H;  1VQG A;  4LF4 Q;  1I6H H;  1DGS A;  3RLN A;  4POF A;  3RNU A;  3I2Z A;  4X65 Q;  3PO2 G;  5M5W H;  4TVA B;  2NVX H;  1A8V A;  3GD7 A;  4POG A;  1M1K C;  1QVC A;  5FLM G;  1FVI A;  4JI6 L;  3M7N A;  3S1M H;  2HHH L;  1VQI A;  1L0W A;  2D0P A;  4LF6 Q;  3FKI G;  1PH6 A;  1IBM Q;  2NN6 I;  3T1H L;  5LMU Q;  1L1O B;  4GS3 A;  4DR3 Q;  1P16 A;  3LGJ A;  1YHA A;  2WAQ G;  4P75 A;  4A3J H;  2UU9 Q;  2UUA L;  4GKK L;  4ME3 A;  4LF5 L;  3ZJY C;  5M5Y H;  2XGT A;  4B3T L;  3G71 A;  4R4T A;  3CCR A;  4RG1 A;  4DR6 L;  3I4N G;  3FP9 A;  2XTI A;  4DR5 Q;  2JEA I;  2NVY H;  3HKZ E;  3T1H Q;  3PUY A;  4A3G G;  2UXB Q;  2R7F A;  1JJC B;  1E1O A;  4LF5 Q;  3B6Y A;  2F3I A;  4JI5 Q;  4GKK Q;  3KJP A;  1N8R C;  2N8N A;  3AFP A;  1Q1B A;  2Z0S A;  4GN4 B;  5BR8 L;  4DR6 Q;  4PZ6 A;  4HID A;  3ER0 A;  2QEX A;  3J81 j;  1G6P A;  1TWC H;  4Y52 H;  2A19 A;  4YCV A;  4KHP L;  2CCZ A;  1W3S A;  4J15 A;  1OXS C;  4C2M H;  4A3D H;  4OXP A;  3WWV A;  2YU9 H;  1K73 C;  4QGU A;  1KXL A;  3W1G A;  4DR7 L;  1OXV A;  4A3L G;  5GAH C;  4A3C G;  1VQB A;  2K4K A;  3M3Y H;  3HOW H;  1XMQ L;  2NZO A;  4KHP Q;  1LYL A;  2K5V A;  4DPG A;  4IOC A;  3OW2 A;  1Q8K A;  4X62 L;  1VQC A;  2VNU D;  1YZ6 A;  2KEN A;  5C0X G;  2KBN A;  3G4S A;  1Z9F A;  3K81 C;  1HJP A;  1HNZ L;  3S1Q H;  2Y0S G;  3PUW A;  3L0O A;  5AJ3 L;  3UE0 A;  1L1O A;  3PO2 H;  4XTC S;  3NBH B;  4YHH Q;  1PV4 A;  1NMG A;  3BZK A;  1PYB A;  1IBK Q;  1EIY B;  4JI0 Q;  4BY7 G;  2B29 A;  5FLM H;  1K8G A;  1HNZ Q;  2JA8 G;  1YJW A;  2N78 A;  3KOJ A;  4O0A A;  4HIM A;  4UPA A;  4OX9 Q;  5AJ3 Q;  1NTG A;  3FKI H;  2K50 A;  1PH5 A;  5C3E G;  1Q1E A;  1VQA A;  4UP7 A;  3EBE A;  1TWA H;  5FLX c;  1MKH A;  2N3S A;  5EAY A;  4LFA L;  1UEB A;  1TXY A;  2EIF A;  2BA1 A;  4DKA C;  4BXX G;  1OXX K;  4QQB X;  5DLQ E;  1K9M C;  2Z6K A;  2OWO A;  1HZ9 A;  2IX0 A;  1I5F A;  1KAW A;  1B8A A;  1VQD A;  2B3G A;  1FJG L;  2YTV A;  4NXM L;  3CCU A;  3CD6 A;  3I4N H;  1TWF H;  1VQK A;  1U0L A;  1GM5 A;  2HIX A;  1SFO H;  1L1O C;  4DV5 L;  4A3G H;  3K7U C;  2PI2 E;  1HH2 P;  3G6E A;  1UWV A;  2FXQ A;  1SN8 A;  1AE3 A;  4GLA C;  3KJO A;  4UY8 C;  1XNR L;  2LSS A;  4DV0 Q;  3U58 A;  1QZG A;  1IBL Q;  3ERS X;  3AFQ A;  3CC4 A;  3RLO A;  2PMZ E;  3I56 A;  1IXR A;  4GLX A;  4IFD G;  4WJ4 A;  1Q86 C;  2NZH A;  3D0F A;  3GTO H;  3KF8 B;  2UUB L;  3CXC A;  5C4X G;  1EUJ A;  3U4V A;  3KYH C;  3A5U A;  2Z6K C;  2ZTC A;  2E2J H;  3M4P A;  1PHJ A;  4A3L H;  4R4C A;  4JI3 Q;  4DR1 Q;  1K0R A;  4A3C H;  1H95 A;  1J6Q A;  1JJG A;  2JE6 I;  2ALY B;  2R6G A;  3RLF A;  1GVP A;  1VQ4 A;  1WYD A;  1VCI A;  2OQ0 A;  1FGU A;  4GNX B;  4GOP B;  2VQF Q;  1K8A C;  1HNX L;  2Q2T A;  3GTQ H;  3I4M G;  4DV7 L;  1B70 B;  3RZO H;  1D7Q A;  1KRT A;  4DV4 Q;  4Y7N H;  3PSI A;  4KLK A;  3TS2 A;  2UXD L;  5C0X I;  2NVQ H;  4DV1 Q;  2F52 A;  1FL0 A;  2H5X A;  3KF6 B;  4HIO A;  1JE5 A;  3H3V H;  3J7Z C;  1SR3 A;  4OWX B;  4A76 A;  3H3V I;  4LFB L;  1YI2 A;  5IYD G;  1HNX Q;  1NE3 A;  2VZA A;  2K5H A;  5HGQ A;  1I94 L;  4JI2 L;  1X9N A;  4BY7 H;  4A3D G;  2JA8 H;  5M3F G;  1VQH A;  3CW2 C;  2K75 A;  3RZD H;  1X3F A;  3SGI A;  1Y1W G;  4YY3 L;  3E9I A;  2K52 A;  5C3E H;  3EIV A;  2YTX A;  4X6A H;  4LNQ A;  1Y14 B;  5IWA Q;  1I94 Q;  2UUC L;  1XPU A;  4IOA A;  4BXX H;  4JI2 Q;  3VDY A;  1BBW A;  5JEA G;  4DV6 L;  4LF9 Q;  2KHI A;  4HJ5 A;  1M90 C;  2CKZ B;  1XPO A;  1JJ2 A;  3IRB A;  1CKM A;  1N33 L;  3JC6 6;  4OWT B;  1HR0 L;  1NBW A;  1X65 A;  1HZC A;  1TWH H;  5GAD C;  4GKJ L;  2JA5 G;  4OO1 G;  2UUC Q;  1N32 L;  1LTL A;  2PI2 A;  3OYY A;  4JI6 Q;  2GN5 A;  3OTO L;  4JI4 L;  2HHH Q;  4JV5 L;  2AKW B;  5IE8 A;  1HR0 Q;  3PCO B;  3HOX G;  3HOV G;  1XNQ L;  2OCE A;  4IFD I;  3M4Q A;  4GNX A;  4GN5 A;  4GOP A;  1N32 Q;  3TRE A;  1SE8 A;  3DM3 A;  4KI0 A;  5C4X H;  4DUY L;  2UUA Q;  4LF7 L;  1WFQ A;  4RMF A;  1WCM G;  2R7Z G;  2CWA A;  4JI4 Q;  4A3I H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...