4BXXX

Arrested rna polymerase ii-bye1 complex
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
134
structure length
120
Chain Sequence
b'EKEHKLRYNAEKMFSTLFSKFIVPETIEAKVISISQEFAHNLEEELYKACLNVEKIYTEKVRSLYSNLKDKKNLELKAHVVEGKLPLNKLVNMNASELANPDLQEFKEKRDKIILENFIV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
publication title Structures of RNA Polymerase II Complexes with Bye1, a Chromatin-Binding Phf3/Dido1 Homologue
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
total genus 26
structure length 120
sequence length 134
ec nomenclature
pdb deposition date 2013-07-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF07500 TFIIS_M Transcription factor S-II (TFIIS), central domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.30 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Transcription elongation factor S-II, central domain 4bxxX00
3PO3S 3NDQA 4BY1X 2LW4A 1ENWA 4BY7X 4BXXX 3GTMS 2DMEA
chains in the Genus database with same CATH superfamily
5HBJB 5EFQB 2QDJA 3QZ9B 1FINB 1H27B 4EOIB 2C5XB 3TNWB 2CZ6B 2R7GA 3BHVB 3M03A 2UZEB 2WJ9A 3QWLA 4ZGDB 2PMIB 5HNBB 2UZBB 1UGRB 4YOOA 3MIAB 4F7SB 2JGZB 4BCOB 4CFNB 2KMGA 3VKGA 1JSTB 1H1SB 1AHJB 3BHTB 2DD4B 2IW8B 1JOWA 2CZ0B 4ZGEB 3MI9B 2PK2A 4FX3B 4EC8B 2IN3A 3TNHB 4BCMB 4EOOB 3PO3S 3X20B 1QMZB 2AHJB 5DQVA 1PKDB 1H1RB 3QYEA 2ZPIB 3X24B 2QQ8A 4CFMB 3G33B 4TTHA 1UNHD 4EORB 4HLQA 4EOJB 2WPAB 5LMKB 1D3UB 2ZZDB 4BY1X 3B57A 3K7AM 3DDPB 1OL1B 4EOLB 4OGRB 2CCHB 4AKHA 3HZJA 2BS2A 4EOQB 2I40B 2DD5B 1UGSB 1H28B 2C4GB 3EJ1B 1TFBA 3A8LB 3F5XB 2CZ1B 1C9BA 4HNUA 1FKMA 4KRDB 2IW6B 2ZPGB 5DQWA 2CCIB 5LQFB 4ROEA 2D0QB 3QYGB 1E9HB 5IDNB 4BCJB 1XO2A 4FM4B 4IMYB 1FVVB 1VYWB 2LW4A 5HBEB 1OIUB 4CFWB 1OIYB 2ZPBB 2G77A 4YOSA 1JKWA 1O9KB 1AD6A 3TN8B 4YC3B 2UZDB 3A8GB 2C6TB 4OB2B 3QZ5B 3A8MB 4OB1B 4BXXX 2PK9B 2ZPHB 2B9RA 3A8OB 4OB0B 3KHIA 5IDPB 2BPMB 1W98B 1GUXA 4BCQB 1VOLA 3QXEB 4BCFB 4CFUD 4HL4A 3MY5B 2G9XB 4BCNB 2WHBB 2CYZB 2V22B 1GH6B 4F7LB 3X28B 3TW7A 2ZPEB 3X25B 1E7PA 2WXVB 2QGSA 3DTOA 1UNLD 4M6VA 2ZPFB 3EOCB 3VYGB 4KRCB 3DL1A 1F5QB 4UN0A 4LOCA 1H1PB 4CFXB 1ENWA 3QYHB 3QHWB 4ELJA 2CJMB 4F6UB 2DXCB 2WIHB 2PJQA 1H24B 2W9ZA 3VYHB 4CXAB 3VKHA 4EOPB 3X26B 2W99A 2F2CA 4OR5B 4BCMD 4G6LB 1H25B 1OKWB 4RODA 2QF7A 2C5OB 5IF1B 3NDQA 2WFYB 2PHGA 2IVXA 3BLRB 4EOMB 4BCHB 4QSHA 3O0GD 4CFVB 4EONB 2DPPB 1GY3B 1IREB 4BCIB 5ACBA 2BS3A 3POMA 1OL2B 4JX6A 3TNIB 4ROCA 4OB3B 5EJCA 5HVYB 2C5NB 5ICPB 4EOKB 1KXUA 4HNVA 3BG5A 1OI9B 1UGPB 2QFZA 4II5B 3QYBA 4F70B 2IW9B 2WMBB 4YOZA 5FGKB 1OGUB 1OKVB 1H4LD 1UGQB 4Z6YA 1UNGD 3WVEB 3WVDB 3DDQB 1VINA 2KR6A 2WEVB 2ZCFB 2CZ7B 4JX4A 4I3ZB 2W9FA 1H1QB 4AI6A 2UZLB 2WIPB 3HO8A 1AISB 1GUXB 2BS4A 2WMAB 2BKZB 3RGFB 4EOSB 4F6SB 3BLHB 3HHTB 4HNTA 5HQ0B 4BY7X 3EIDB 3BG9A 4ZGJB 5I5ZB 2DMEA 4BCQD 4BBRM 1QLBA 4BCGB 2EUFA 4BCND 5IHYA 1H26B 2W2HA 4MFEA 4ELLA 1BU2A 4MIMA 3MY1B 2QDYB 1G3NC 2W96A 1V29B 3DOGB 3DJBA 5L2WB 4NSTB 1JSUB 4CRLB 4AKIA 1N4MA 2UUEB 3LQ5B 4NC6A 4BCKB 4BCPB 2C5VB 3BG3A 3A8HB 4MFDA 3QHRB 3GTMS 4EC9B 3HBLA 1URCB 1P5EB 5HBHB 2X1NB 4AKGA 3BHUB 3HB9A 3BLQB 4F7JB 4JX5A 3TW6A 1O9KA 2I53A 4BBSM 5BNJB 4CFUB 1ZP2A 4Y72B 1TD6A 5CYIB 2DXBB 3H4CA 4F6WB 4F7NB 5CEIB
chains in the Genus database with same CATH topology
3PO3S 3NDQA 4BY1X 2LW4A 1ENWA 4BY7X 4BXXX 3GTMS 2DMEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PO3 S;  3NDQ A;  4BY1 X;  2LW4 A;  1ENW A;  4BY7 X;  4BXX X;  3GTM S;  2DME A; 
#chains in the Genus database with same CATH topology
 5HBJ B;  5EFQ B;  2QDJ A;  3QZ9 B;  1FIN B;  1H27 B;  4EOI B;  2C5X B;  3TNW B;  2CZ6 B;  2R7G A;  3BHV B;  3M03 A;  2UZE B;  2WJ9 A;  3QWL A;  4ZGD B;  2PMI B;  5HNB B;  2UZB B;  1UGR B;  4YOO A;  3MIA B;  4F7S B;  2JGZ B;  4BCO B;  4CFN B;  2KMG A;  3VKG A;  1JST B;  1H1S B;  1AHJ B;  3BHT B;  2DD4 B;  2IW8 B;  1JOW A;  2CZ0 B;  4ZGE B;  3MI9 B;  2PK2 A;  4FX3 B;  4EC8 B;  2IN3 A;  3TNH B;  4BCM B;  4EOO B;  3PO3 S;  3X20 B;  1QMZ B;  2AHJ B;  5DQV A;  1PKD B;  1H1R B;  3QYE A;  2ZPI B;  3X24 B;  2QQ8 A;  4CFM B;  3G33 B;  4TTH A;  1UNH D;  4EOR B;  4HLQ A;  4EOJ B;  2WPA B;  5LMK B;  1D3U B;  2ZZD B;  4BY1 X;  3B57 A;  3K7A M;  3DDP B;  1OL1 B;  4EOL B;  4OGR B;  2CCH B;  4AKH A;  3HZJ A;  2BS2 A;  4EOQ B;  2I40 B;  2DD5 B;  1UGS B;  1H28 B;  2C4G B;  3EJ1 B;  1TFB A;  3A8L B;  3F5X B;  2CZ1 B;  1C9B A;  4HNU A;  1FKM A;  4KRD B;  2IW6 B;  2ZPG B;  5DQW A;  2CCI B;  5LQF B;  4ROE A;  2D0Q B;  3QYG B;  1E9H B;  5IDN B;  4BCJ B;  1XO2 A;  4FM4 B;  4IMY B;  1FVV B;  1VYW B;  2LW4 A;  5HBE B;  1OIU B;  4CFW B;  1OIY B;  2ZPB B;  2G77 A;  4YOS A;  1JKW A;  1O9K B;  1AD6 A;  3TN8 B;  4YC3 B;  2UZD B;  3A8G B;  2C6T B;  4OB2 B;  3QZ5 B;  3A8M B;  4OB1 B;  4BXX X;  2PK9 B;  2ZPH B;  2B9R A;  3A8O B;  4OB0 B;  3KHI A;  5IDP B;  2BPM B;  1W98 B;  1GUX A;  4BCQ B;  1VOL A;  3QXE B;  4BCF B;  4CFU D;  4HL4 A;  3MY5 B;  2G9X B;  4BCN B;  2WHB B;  2CYZ B;  2V22 B;  1GH6 B;  4F7L B;  3X28 B;  3TW7 A;  2ZPE B;  3X25 B;  1E7P A;  2WXV B;  2QGS A;  3DTO A;  1UNL D;  4M6V A;  2ZPF B;  3EOC B;  3VYG B;  4KRC B;  3DL1 A;  1F5Q B;  4UN0 A;  4LOC A;  1H1P B;  4CFX B;  1ENW A;  3QYH B;  3QHW B;  4ELJ A;  2CJM B;  4F6U B;  2DXC B;  2WIH B;  2PJQ A;  1H24 B;  2W9Z A;  3VYH B;  4CXA B;  3VKH A;  4EOP B;  3X26 B;  2W99 A;  2F2C A;  4OR5 B;  4BCM D;  4G6L B;  1H25 B;  1OKW B;  4ROD A;  2QF7 A;  2C5O B;  5IF1 B;  3NDQ A;  2WFY B;  2PHG A;  2IVX A;  3BLR B;  4EOM B;  4BCH B;  4QSH A;  3O0G D;  4CFV B;  4EON B;  2DPP B;  1GY3 B;  1IRE B;  4BCI B;  5ACB A;  2BS3 A;  3POM A;  1OL2 B;  4JX6 A;  3TNI B;  4ROC A;  4OB3 B;  5EJC A;  5HVY B;  2C5N B;  5ICP B;  4EOK B;  1KXU A;  4HNV A;  3BG5 A;  1OI9 B;  1UGP B;  2QFZ A;  4II5 B;  3QYB A;  4F70 B;  2IW9 B;  2WMB B;  4YOZ A;  5FGK B;  1OGU B;  1OKV B;  1H4L D;  1UGQ B;  4Z6Y A;  1UNG D;  3WVE B;  3WVD B;  3DDQ B;  1VIN A;  2KR6 A;  2WEV B;  2ZCF B;  2CZ7 B;  4JX4 A;  4I3Z B;  2W9F A;  1H1Q B;  4AI6 A;  2UZL B;  2WIP B;  3HO8 A;  1AIS B;  1GUX B;  2BS4 A;  2WMA B;  2BKZ B;  3RGF B;  4EOS B;  4F6S B;  3BLH B;  3HHT B;  4HNT A;  5HQ0 B;  4BY7 X;  3EID B;  3BG9 A;  4ZGJ B;  5I5Z B;  2DME A;  4BCQ D;  4BBR M;  1QLB A;  4BCG B;  2EUF A;  4BCN D;  5IHY A;  1H26 B;  2W2H A;  4MFE A;  4ELL A;  1BU2 A;  4MIM A;  3MY1 B;  2QDY B;  1G3N C;  2W96 A;  1V29 B;  3DOG B;  3DJB A;  5L2W B;  4NST B;  1JSU B;  4CRL B;  4AKI A;  1N4M A;  2UUE B;  3LQ5 B;  4NC6 A;  4BCK B;  4BCP B;  2C5V B;  3BG3 A;  3A8H B;  4MFD A;  3QHR B;  3GTM S;  4EC9 B;  3HBL A;  1URC B;  1P5E B;  5HBH B;  2X1N B;  4AKG A;  3BHU B;  3HB9 A;  3BLQ B;  4F7J B;  4JX5 A;  3TW6 A;  1O9K A;  2I53 A;  4BBS M;  5BNJ B;  4CFU B;  1ZP2 A;  4Y72 B;  1TD6 A;  5CYI B;  2DXB B;  3H4C A;  4F6W B;  4F7N B;  5CEI B; 
#chains in the Genus database with same CATH homology
 3PO3 S;  3NDQ A;  4BY1 X;  2LW4 A;  1ENW A;  4BY7 X;  4BXX X;  3GTM S;  2DME A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...