4BY1J

Elongating rna polymerase ii-bye1 tld complex soaked with ampcpp
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
65
structure length
65
Chain Sequence
MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of RNA Polymerase II Complexes with Bye1, a Chromatin-Binding Phf3/Dido1 Homologue
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
total genus 16
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2013-07-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF01194 RNA_pol_N RNA polymerases N / 8 kDa subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 4by1J00
1ETWA 3S1QJ 3RQIA 1VI0A 3BR1A 2D5VA 2E2HJ 2HYJA 1WPKA 4J19A 1FEXA 2DA5A 4QSHA 1JT6A 3TW6A 5E3NA 2Y30A 4M3GA 3HKZN 3HB9A 1U78A 1RPWA 1GV2A 5FKKA 5C44J 3HOXJ 1BW6A 3FIWA 2NVQJ 4BBSJ 2O7OA 4FISA 5F08A 4CYCB 1W0TA 2EH3A 5F04A 2CUEA 1NK2P 4UUTA 2JMWA 3DEWA 1ORKA 3S16J 1U9NA 2TCTA 3JRCA 2KT0A 1O4XA 1ZQ3P 1LFUP 5C4XJ 1B8IB 3BG5A 3ZQFA 2WB1N 2ID6A 2DMTA 3BR3A 1IRZA 2R5YB 1HOMA 4D5FA 3OSFA 3RKQA 2X6OA 2DA1A 4B1RA 1A5JA 1ETYA 2HI3A 1HCRA 4RDUA 2MW8A 1VFCA 2CQXA 2KDZA 4Y52J 2ZB9A 1JKRC 1MBKA 1ZK8A 2OF7A 2N8GA 5HODA 1WCMJ 4A3IJ 3GTPJ 1WH7A 4IHWA 3ZQIA 1WI3A 4M3BA 5IP9J 2WAQN 5M5WJ 1RETA 4ABZA 1B8IA 4B4CA 3LOCA 2XPUA 3B6CA 5JLXA 1TWCJ 1ZKGA 3FK6A 2VI6A 1K61A 2XB5A 1D5YA 1Y1WJ 5GPCA 2IBDA 3QPSA 1NTCA 2L7FP 1Y1VJ 4AYBN 4A3FJ 5C4JJ 1ZR2A 1YRNB 1SANA 2XRLA 2Y9YA 1JJ8C 1HDPA 3ZQLA 4GFBA 3RZOJ 4XRSG 3I4NJ 2CRGA 2DMUA 1B72B 1IV6A 2L9RA 2O8KA 2RAEA 2IAIA 3SDGA 5EGOB 2EZIA 2JA7J 2XGCA 1U9OA 5FKMA 3CDLA 4V2FA 2JA5J 1EF4A 4IHXA 3IH3A 5IYCJ 5EZGA 4A3CJ 3MN2A 4UUSB 9ANTA 3BTCA 1JUPA 1JGGA 4IEJA 2JK3A 1JTXA 5EEAA 4A3BJ 2FJ1A 1H89C 4BY1J 1QVTA 5EG0B 2I10A 4MFDA 1RESA 1JKPC 4DYCA 2DA7A 1RKWA 5EYRA 4XIDA 1GV5A 3Q3SA 1LFBA 2OPTA 3GTMJ 5FLMJ 1MBJA 2Y9ZA 4W1UA 3HGYA 1HDDC 3HOVJ 3HDDA 4MIMA 1DU6A 3HOWJ 2CUFA 2Y0SN 1JKQC 2M2EA 3HM5A 1UHSA 2R5ZA 1F43A 3Q0UA 5IP6A 4BKXA 3CQZJ 1FTZA 3JRFA 3S17J 3D1NI 2LFBA 2M0CA 3I4MJ 1JT0A 3S1MJ 1GT0C 2VUMJ 3LSGA 1R9TJ 3S2HJ 1JTYA 3F0CA 5JLWA 3K7AJ 2FD5A 2NS8A 1JJ6C 3TP0A 2LLKA 5J1RA 5FLVA 1AKHB 4IHYA 3BG9A 2K9NA 3FKIJ 3TP3A 1Z0XA 1IJWC 3HOYJ 1XS9A 2K9QA 4A3JJ 1H88C 5IYBJ 4C3IJ 2VPRA 3W6VA 1B72A 2HOSA 4XRMA 1AHDP 5C3EJ 4B3AA 4A69C 2QF7A 1AKHA 2COBA 5EGOA 3PM1A 2NVXJ 3HOUJ 3FISA 5K7FA 1MBGA 3GBGA 5GPAA 1MH3A 4DZJA 2ID3A 1ETQA 5J1YA 3E7LA 3BR2A 4UUSA 5DS9A 1BA5A 1QPIA 2JA6J 1XG1A 5F0HA 1IDYA 2ELKA 1TWHJ 2ECCA 2HOAA 1ETKA 2E2IJ 3MVPA 1GVDA 4D7NA 4EEFG 2XGDA 2XPWA 1BL0A 2DA3A 2LP0A 3BTLA 5F1JA 3TW7A 2X9DA 1JKOC 4DZPA 1UG2A 3JR9A 2Y2ZA 1I50J 1S7EA 1OFCX 2EZLA 4D5CA 3IV5A 1SFOJ 4I6ZA 4C2MJ 1E3OC 3LNQA 3JRHA 5M3MJ 5M5YJ 3JRIA 4MLOA 4A3LJ 3M3YJ 1X58A 1TWGJ 3GTLJ 4MO7A 1W0UA 1H8AC 3JRBA 2LKXA 4XRSA 1I3QJ 2NVTJ 4G12A 4JX6A 1HLVA 1LE8A 1TC3C 5FKOA 2HOTA 3HEFA 1APLC 3A01A 1Q1VA 2QCOA 2B63J 1FJLA 3PO2J 2EBIA 4RBOA 4XK4A 2E19A 2DN0A 1JUMA 1QVUA 1P7JA 3LSJA 4FE7A 2IEKA 5F0CA 3IH4A 3BTJA 3K2AA 4DYRA 2GLOA 4XICA 2K40A 5IOYA 4A3KJ 2GBYA 5GP9A 1MSFC 3HOZJ 3GTOJ 5E3MA 5DTDA 2LK2A 4M6VA 1IGNA 2AO9A 2HXIA 3S2DJ 2EQRA 2FX0A 1XC5A 3SFIA 2H1KA 2E1OA 4QIWN 2NOGA 1ETVA 2JWTA 2WV1A 1P7IA 4M3DA 1BW5A 2X48A 3A01B 3JRGA 1ZGWA 3M4OJ 1K83J 1MNMC 1RR7A 5EF6A 3HGGA 2DMNA 1ENHA 2R93J 3O8HA 1MBHA 1VNDA 4S0HB 3A03A 1GDTA 2VKVA 2ME6A 2MGQA 4C3JJ 4W97A 4CYCA 1VF9A 1F36A 3ZQCA 3G1MA 1IG7A 3BTIA 2Y31A 3RZDJ 1UMQA 4HNVA 1TWAJ 5M5XJ 1POGA 1Z77A 4FCYA 3BR0A 1IUFA 2R0QC 1T33A 1CQTA 2XB0X 5F27A 4BBRJ 2DA6A 3JREA 5J1UA 3QPLA 3H3VK 4AC0A 4A3MJ 2HDDA 3IH2A 3FK7A 5IOZA 2XGEA 2YS9A 4D7MA 2DA2A 3BQYA 1T56A 3VPRA 1JUSA 1IC8A 3PO3J 2E2JJ 2VKEA 4NDLA 3NAUA 5F0FA 4FTHA 2JA8J 2M34A 2LD5A 2DMPA 3WHCA 2CU7A 2GM4A 2PMZN 1PUFA 5IP7J 3DCFA 4AUXA 2P81A 5FKLA 3O8GA 3S1NJ 2TRTA 2W48A 4BY7J 1WH5A 2R5ZB 1GUUA 4LOCA 1PUFB 1FIPA 2L7MP 2R7ZJ 3ZQGA 3SJMA 2JN6A 3QQAA 5EZHA 2ME0A 4JP0A 5IPAA 5EDNA 1MBEA 2R92J 1MSEC 2XPVA 3A02A 1ETXA 2DMQA 2CQQA 2M8GX 1ZTRA 1QRYA 1TWFJ 4JX5A 2K9SA 3ZOBA 1AU7A 3Q0VA 2H8RA 3JRAA 2L0KA 2G0EA 3HBLA 1X2MA 1OJLA 4BXXJ 1HF0A 1A6IA 3TEDA 2NS7A 1G2HA 2LY9A 3BT9A 1ZR4A 2YU9J 3OOUA 4Y7NJ 5M3FJ 1X2NA 3B6AA 4JYKA 4DW6A 3S1RJ 2O9LA 5FJ8J 3L1PA 5FKNA 5E3LA 2AHQA 2NVYJ 3G1LA 2M9HA 4M3FA 2CJJA 2EZHA 4DYQA 4X6AJ 3CMYA 2LR8A 4M3EA 3S15J 5J3LA 1NK3P 2EZKA 4MFEA 4V2GA 5K7HA 3H0GJ 4I76A 1WGXA 3OIOA 3GTGJ 3GTKJ 3OSGA 3GTJJ 3BR5A 2L7ZA 1ETOA 4C3HJ 2MG4A 4FE4A 2DJNA 1FTTA 2JJ7A 2MSYA 3G1OA 3WHBA 2YUSA 3CCYA 1YRNA 3S14J 3ZQHA 5IYDJ 2R5YA 2XSDC 4IHVA 3MKLA 5BNGA 1ITYA 4A3GJ 1U8BA 2FQ4A 2HQ5A 3C2BA 5EG0A 3BQZA 2DA4A 3LSRA 2ECBA 4L5EA 5E3OA 3GTQJ 4QTRA 1FIAA 4X1EA 3Q0WA 2LTPA 1DU0A 4JX4A 3NARA 3BR6A 1RKTA 1MH4A 1LE8B 3BG3A 3UKGA 1OCPA 5K7ZA 3LSPA 4A93J 3JRDA 1I6HJ 2LVSA 2DTZA 1OCTC 1IDZA 2HXOA 1MBFA 4A3DJ 1BJZA 4A3EJ
chains in the Genus database with same CATH superfamily
2E5ZA 4MTDA 3S1QJ 2X51A 2A6EF 3CUQC 3BR1A 2MLKA 3ONQA 2F6CA 1YI2I 1T0FA 3WE3A 4J19A 1FEXA 2DA5A 1E17A 2K9LA 1R23A 2BY1A 3TW6A 3U2RA 2K27A 3OYDA 2JA2A 2OBPA 1SAUA 1RPWA 1GV2A 3CCQI 5FKKA 5C44J 4ESJA 2DFIA 4IVNA 3HRMA 5ILSA 3BJAA 4HPQA 2NVQJ 1Z21A 2P5LC 3MZHA 2K02A 3GFLA 4GO1A 2D1VA 3U1KA 3CLQA 4H0EA 2A07F 2F5CA 1SFUA 4LD5A 2EH3A 4Q48A 2CUEA 5JVTA 3S16J 1U9NA 1P6RA 4G9YA 2ZFWA 5FFZA 5KVRA 2PI0A 5BQTA 1BM9A 2GZWA 3RYRA 2CGPA 4ZC3A 1KQ0A 3KP2A 1T38A 4RM3A 3BZ6A 4L0ZB 3BG5A 3ZQFA 3RCOA 4YELA 2WB1N 1BR2A 2HVQA 1UJ8A 3BR3A 3KCCA 5ICEA 3SZTA 5B66C 1G3YA 3RKQA 2QKMB 1A5JA 1XDSA 1G4DA 3CCUI 3IAS2 3DFGA 2K4JA 4EATA 2KDZA 2VL8A 4GXOA 3EETA 3KYDB 2VQHA 1MBKA 1X1CA 1BI2A 2KJCA 2OF7A 4L0YB 5HODA 3GX4X 4P96A 1WH7A 3F9KA 4IHWA 4ASNA 4IRHA 5KK1A 3OYGA 3WGGA 1WI3A 4M3BA 4HOBA 3RQ4A 4HG2A 2HVSA 1Y0NA 1LEAA 2IA0A 3RIRA 1RETA 1YQAA 3OMYA 1Z6TA 3ABUA 4ABZA 2GOMA 2ZMEC 3ZN1A 5JLXA 1XMAA 3TGNA 4ZYDA 2PJRA 2IA1A 1TWCJ 2I5UA 2XB5A 3KP4A 1Y1WJ 1ZELA 1NTCA 4HSTA 4YEJA 1YRNB 2XRLA 2O0YA 5HLTA 1HDPA 4JOMA 3ZQLA 4GFBA 4XRSG 3FBNB 4HAMA 2QSGX 2VKDA 4HX7A 3I4NJ 2CRGA 4M9XA 2RQQA 1X1DA 1X1AA 3ZRGA 5AONA 1S72I 2DQRA 5HLGA 2EZIA 1IN4A 2WADA 3CCVI 1EF4A 5FKMA 3CDLA 3M8EA 3IH3A 1Z9CA 4A3CJ 2TDXA 1MMGA 4AVZA 4EJOA 1V5EA 3OYKA 1SFKA 2HFHA 2JK3A 3I59B 1FOWA 5GADJ 1H89C 3MZ8A 2R7FA 2XIGA 3BCAA 4MFDA 2PQ8A 1JKPC 4RM2A 4BL0B 2P8TA 1I27A 5CQEA 4DYCA 2DA7A 5DEQA 4XIDA 4KT5C 3CJTB 1Z7LA 3K1PA 4HX8A 1T8IA 2DK8A 2OPTA 3M7GA 4JQFA 1QPMA 2JPCA 4FQGA 1MBJA 3K70C 4N9HA 4WXHA 1Z67A 5ICCA 2HTJA 2X0LA 1LPQA 4KN7X 2WY7Q 3HOVJ 4CCOA 1ZAOA 4S04A 3HOWJ 1XDUA 1F1ZA 2AS5F 4RAFA 4BQOA 2M2EA 3HM5A 5EEGA 4N4OB 3LQRA 4NC6A 4RAZA 5IP6A 4O3MA 4BKXA 2I8DA 2LFBA 3C1DA 1WSUA 3I4MJ 3QP5A 4KICA 1JT0A 3D5LA 2IT0A 2R7OA 3A0BC 3GW2A 4K2EA 1B59A 2ZCWA 5D4RA 2V7FA 1J9IA 3K4JA 5CQGA 1K79A 3MWMA 1SD5A 1JTYA 4OAYA 2XV4S 4A5MA 4EJWA 5IT9Z 4D9JA 3KEYA 2FOKA 3FKIJ 3RPQA 4WWCA 2VLAA 4OIPF 3HOYJ 2YPRA 1XS9A 3E6CC 2XRNA 1S6LA 2E1NA 2VPRA 4FETA 1D0XA 4LLLA 4ZTFA 5J47A 2FE3A 3SZPA 3OL3A 2ZJRF 5C3EJ 3KLNA 3NWTA 4A69C 2QF7A 2QKLB 2QLZA 4U0WA 2PG4A 2FXAA 1SVMA 3FISA 5GAEJ 1L3LA 3KEQA 3FXUA 3CUQA 4DZJA 5GAHJ 1IN5A 4IQ4A 2DT7B 2Q1ZB 2X1EA 5J1YA 2P0WA 3BR2A 4F92B 2KISA 4HRIA 1XMXA 1R49A 1XMKA 1UAAA 4PFPA 1CGPA 1QQIA 2KKOA 2J5PA 1VQKI 2XKOA 1BL0A 2LP0A 4RB1A 5E8GA 4C30A 2JZYA 3T8RA 3JR9A 2CFXA 4QPQA 5JHFA 1J5YA 1S7EA 1OFCX 1T08B 3A1YA 3IV5A 4I6ZA 3GZ6A 4PGGA 4HNUA 1LUJB 4A3LJ 5LEKA 3CP2A 4DBQA 3KPHA 5FLXZ 3V4GA 3CDHA 1YW8A 4NHJA 2XAGA 1G3WA 1FPQA 3T5XA 3C7JA 3SFZA 1BI0A 1FNNA 3D5SC 4NC7A 3JRBA 2LKXA 2OTLI 4JX6A 5A2QZ 4BEHA 2HOTA 1KGSA 3HSRA 1TQIA 2CV0A 2RC4A 1USSA 1G6NA 2V9KA 3GLXA 1Y6IA 1FJLA 2V9VA 2EBIA 4M73A 3K6GA 3HHHA 1HBXG 4FE7A 3BTJA 4LB6B 4A0XA 3WGIA 4HF1A 1KONA 5IOYA 2KRFA 4A3KJ 3RPUA 3HOZJ 4TV7A 1GHCA 4FX0A 3GFJA 3J7ZI 2LK2A 3S2WA 1ZLKA 4Y33A 1IGNA 5FLXK 2HXIA 5DUKA 2EV5A 5GAGJ 1XC5A 3HPGA 3AL0B 1TTYA 1R1VA 2XUBA 5KAIC 2STWA 2JWTA 4I2OA 1K6OA 2FBHA 4IZZA 1BW5A 3J81K 3A01B 1RUNA 1MMDA 2CQ7A 2WWYA 1AOYA 3ECOA 3M4OJ 3WTUC 3CF5F 2OUMA 4LG0A 1J59A 2VE8A 3DU6A 2Q2EB 1ENHA 5DCFA 1TT0A 3PJRA 3A03A 2YR2A 2LMDA 4E70A 2VKVA 1DDNA 4U88A 2ME6A 4DQ2A 4BS9A 3LSTA 3RKWA 1MMSA 4CYCA 4ENMA 3ZQCA 2BHYA 1XSDA 1IN6A 3WG7H 2BEOA 1KU9A 1UMQA 3H3ZA 4NB5A 4HNVA 1OLTA 3BG6A 4CH7A 3KP3A 1R22A 1DQUA 1R5HA 2J5OA 3FMSA 5M5XJ 4FCYA 1WJDA 3BR0A 1IUFA 1YS6A 3VYRB 2R0QC 3OYEA 3V42A 1W36C 4RB0A 4NC8A 1LVAA 1Z1DA 1H9TA 2DA6A 3JREA 1IXSB 5J1UA 3KFWX 4L5IA 3QPLA 1EA3A 3OYNA 5D6FA 2KQRA 4XMYA 4AC0A 2QQ8A 2MC4A 2HDDA 2KIFA 3FK7A 4M6YA 3HRSA 1OCCH 1VQOI 2DA2A 1BN5A 2ZMEB 1IC8A 1I5ZA 5F0FA 3NAUA 3LAJA 1K7AA 2AXTC 2H1LA 2LD5A 2DMPA 2E7WA 1D3YA 2CU7A 1SC7A 3I53A 3V8LA 4PJNA 3DCFA 2P4WA 1IN8A 4OAZA 3K9TA 4BY7J 4CCMA 1LDDA 4XOTA 4BU2A 2NYXA 3EYYA 4LMYA 3COAC 2EFQA 3SDBA 3LWFA 5EZHA 3QPHA 4OMYA 2RGVA 2K9MA 4LG0B 3A02A 1KQ9A 1ETXA 2CQQA 2DOEA 4C2UA 1ZTRA 5FB2A 2L9NA 5LRSA 4CYDA 2BYVE 2L7KA 4BJ5C 1P4WA 1LDJA 2ZXJA 2BHZA 1D5VA 2V1UA 1PJRA 1AU7A 3JRAA 1ON1A 1VZ0A 2L0KA 3J7YJ 1YHQI 2LSOA 1M1EB 4BXFA 1USTA 3FHZA 3HC7A 3ZP5A 2QENA 3BLYA 1LNWA 1ERDA 3BT9A 4UHTA 3OOUA 1FWZA 1K6YA 5HS9A 4Y7NJ 4EJTA 1OR7C 3B6AA 4XSZF 4CICA 3TL4X 1ZG1A 1DP3A 3ML6A 3L1PA 2DQLA 5FKNA 3TO9A 5E3LA 2NVYJ 5HOOA 1D8KA 3QODA 4S05A 2PJRB 2EILH 2H6BA 2LY1A 4RS8A 1MDMA 2M5WA 5EJCA 2UZKA 2XAJA 2BV6A 1ACIA 5L3DA 2LF8A 2EZKA 4MFEA 2OC6A 1BBYA 5TRDA 5K7HA 3MMYB 3GWZA 1BR4A 3T8TA 2X6XA 3DKWA 3F3XA 2VC0A 3GTKJ 1FT9A 2HKOA 2OAZA 1OYYA 2FUG2 1J09A 1Y56A 2FBKA 2MG4A 1FTTA 3KETA 3I3LA 3C2HA 3QP6A 2R7WA 1TZLA 3OYBA 2LKSA 2WB1A 1DPRA 2JRTA 1Y8RB 2NXNB 3DEEA 2HGCA 5H6QA 2Z5UA 4IHVA 3PUFA 3MKLA 2ZFUA 1OCOH 1S8NA 2PLYA 4NBQA 4XNFA 2FQ4A 3VYUB 5EG0A 1W5CC 4Y17A 4LB5A 3ZN0A 4KDPA 1NH3A 2IS2A 3J80K 1YJWI 3H9QA 2W57A 2ETHA 1DU0A 1UHWA 4JX4A 3K2ZA 1CF7B 4ZH4F 2NRAC 1OYIA 3GYHX 2RKHA 3N05A 4BHCA 2NNYA 3WTVC 3BG3A 1OCPA 2UUZA 3ERED 2BXZA 2WTEA 4XLEA 1UZCA 3S3MA 2MLGA 3HG9A 1X3WB 3EUKL 2LBFA 3FHNA 2ICWG 1MZBA 1ZHFA 2HXOA 2A5WA 4YRVA 4A3EJ 3LSMA 3MAJA 4PSXA 2CFOA 1VI0A 5ILUA 2D5VA 2E2HJ 3BROA 1R71A 3IL2A 3BZCA 4QSHA 1FP1D 4F91B 1DGRM 2L4MA 1G59A 4IQJA 1U78A 2K3FA 3E6BA 3WG9A 1TT5B 3ROUA 3WTZA 4LLNA 1FZPB 2R7SA 1FYLA 4BBSJ 2JPBA 4FISA 5F08A 4CYCB 1W0TA 2F5FA 2F48A 1A31A 2JMWA 4HF0A 3SHFA 3K4MA 3JRCA 1HKQA 2OZUA 4RLFA 1TNTA 4ON0A 1ZQ3P 2M4GA 5LEJA 1QZYA 1FOXA 4WX9A 3QU3A 1V4RA 3C3WA 1BIBA 2DMTA 3F8FA 3GUDA 2A05A 4E7KA 1SVOA 2DA1A 2HI3A 1O3QA 1XGOA 2KFDA 2DK5A 1YIJI 4GCVA 4XKBA 4B44A 2R7VA 4DBRA 1N75A 1ZK8A 1YJ9I 1AA7A 1S29A 4A3IJ 3ZQIA 4XLNF 2DTRA 2BBYA 5ILVA 2QBYA 2YSRA 2VASA 3I54A 3VSKA 5M5WJ 4Q5SF 4B4CA 3I55I 3LOCA 2XPUA 3DLAA 2EFNA 3FK6A 1K61A 4PJMA 1PP7U 4LJZF 1D5YA 2O6GE 1VQ6I 4I98B 5GPCA 3FXKA 2B9SA 2EA4A 2L7FP 5TGTA 1FY7A 2MC3A 2NVUB 3T1BA 2ZKZA 3GFMA 2VBXA 3FX3A 4XORA 4CGZA 3CESA 5DYMA 1WJEA 1B72B 2MBFA 2FMYA 2O8KA 4HNTA 3TMOA 2NNNA 1J0RA 2Z9OA 4BNCA 2XGCA 5K5RA 4OOIA 4IRGA 1ON2A 5IYCJ 1P4XA 2PEXA 1V3FA 4UUSB 1XSVA 1JUPA 1VQNI 2CUJA 4Y13A 5CKTA 4G6QA 2GXAA 1QO0D 3IUOA 1JTXA 2XROA 5EEAA 4A3BJ 4EQQA 3G2BA 2D1HA 3HOTA 1UG0A 3L7WA 4XOPA 1B6AA 2OJED 3CMMA 3S93A 3N4MA 2IA2A 1WJAA 2VB6A 5EYRA 2JVGA 2YX7A 1QGPA 4RMNA 2W00A 3KP6A 3GTMJ 1WRJA 2Y9ZA 4W1UA 4I0BA 3DBLB 4LFUA 1HDDC 2ZNZA 3R6SA 2VPLA 1MNEA 4RLQA 2HTSA 4IKFA 1T0FC 2Y0SN 3EQLF 1FSHA 2EJRA 3NQOA 3RKXA 1F43A 3Q0UA 3CQZJ 3CC7I 2HYGD 3JRFA 2PJPA 2ESHA 4XLAA 5E8IA 3BPXA 3S1MJ 2VUMJ 1DUXC 4E7ZA 2Z2SB 3EPZA 1KU2A 5J8CA 3DTIA 3F0CA 5JLWA 2OTJI 1QZEA 2COMA 3K7AJ 2RVCA 1Z91A 3J80Z 5J1RA 4OIOF 5FLVA 4ZJZA 4IHYA 2K9NA 3TP3A 1Z0XA 2O3FA 1Y39A 3M07A 3W6VA 1IRGA 2Q8KA 1B72A 3IWFA 3K1NA 4LK0F 1Q1HA 2NAZA 2IS6A 2ELJA 2COBA 5EGOA 1QU3A 2PX9A 3HOUJ 4I09A 5K7FA 1OKRA 1IV8A 3OS2A 1MBGA 3F8MA 4I01A 3ZXSA 2E36A 2OCEA 3REOA 1ETQA 3E7LA 1BA5A 1W5SA 5DCMA 4V19K 2L2OA 1XG1A 5F0HA 3K4BA 2ECCA 3CLOA 2LY2A 4IHTA 4IL6C 3OYJA 4FHTA 3AG1H 4D7NA 1ZN2A 4EEFG 5JFRA 2FSWA 3BTLA 5FGMA 4HBLA 2X9DA 4BQQA 3O6BB 3CP8A 3OYFA 1O7FA 2V1DA 2VQGA 3VYTB 3JTHA 4WF2A 4D5CA 4ZYAA 4C2MJ 1T6SA 1MD0A 4L18B 3RSNA 3JRIA 4MLOA 5JHUA 2WV0A 3VYSB 2V6EA 5D5XB 4P9UA 5E79C 1BOAA 1KA8A 1TWGJ 3GTLJ 3DPUA 1YFHA 5FFXA 2EK5A 1SAXA 1MW7A 1S7OA 2LREA 4BJTA 4BJ6C 1I3QJ 2GWRA 3EUAA 4KUMA 4PK4A 2JUGA 2QCOA 2R7QA 5L3BA 2JUCA 3FF5A 2DBBA 2F5EA 1XGMA 4RBOA 1LJ9A 5L3EA 1HSTA 1JUMA 3MZYA 4IF4A 5H20A 5F0CA 3OYCA 3HRUA 2HR3A 2GLOA 4HSRA 4BHPA 1FOYA 5D8KB 3HL2A 1ZRFA 2GXBA 1IUYA 2GBYA 5GP9A 1LEBA 3IWZA 2AXLA 1ZRDA 4UUVA 5LBQA 2AO9A 4F93B 2X6WA 2KZGA 5E17F 4A6DA 4QIWN 3GZ5A 2WV1A 3W3CA 2DPUA 1X4PA 2KLOA 1QZZA 2EPFA 3LMMA 4M3DA 2VE9A 3JRGA 4NQWA 4HF2A 3RTRA 1ZGWA 1A04A 2GQQA 1GVJA 2F4IA 1K83J 4XKWA 2K3PA 1RR7A 1MNMC 1HQCA 1R36A 5DD8A 5EF6A 4N0BA 4G7OF 3HGGA 3CJQB 1Z3XA 2DMNA 2VJ4A 3W2WA 2HWVA 3O8HA 5CVIA 1MBHA 1VNDA 2VXZA 4KFCA 5ED4A 4KJZA 2VOPA 2O5RA 3LA3A 3GF2A 3FXOA 3V7CA 4ENNA 3FXQA 6PAXA 5E18F 1VF9A 3BTIA 5LHIA 2Y31A 1Z6RA 3RZDJ 1ZLJA 1G3SA 4LLGF 3BG7A 3P9CA 1QHHD 5B3SH 1OISA 1TWAJ 1POGA 3ELKA 4IXAA 1IXCA 2JTVA 2W85A 4ZDPA 1T33A 2DI3A 4O6JA 2XB0X 2ISZA 1DGWY 2FBIA 4P9FA 4EJVA 2OQGA 5HLIA 3LL7A 2KP6A 3CCEI 4HQEA 2M1BA 4IOAF 4BEHB 2EV0A 2BY3A 2ZMEA 1HKSA 1TNSA 4BDYA 4IJAA 1DP7P 3E5XA 4CXFA 4XM3A 3PNVA 2HZDA 2DOAA 3OY9A 1BOBA 3VPRA 1JUSA 4P1WA 4FASD 2X1DA 2VKEA 2CO5A 1YJNI 4FTHA 3EUHC 1H0MA 1HA8A 5F64A 5D5VB 2M34A 2UV1A 3VODA 2JSPA 3PNYA 4R8HA 2PMZN 2VJ5A 1BC8C 1R5GA 1XCBA 5CVRA 4OIRF 2P81A 1IRFA 5D5WB 2M8EA 1Y8QB 3KX2A 5B1BH 4XL9A 1SMTA 3HZJA 5LRRA 2MFZA 4U87A 2R5ZB 3PQKA 3KLOA 4LOCA 2L7MP 1PUFB 2R7ZJ 3A0HC 4A5NA 3SJMA 2JN6A 3TDUC 5LD2C 2V9PA 2VJIA 2F2EA 3BJ6A 4DJAA 1VQ4I 5IPAA 2XPVA 2FF4A 3ABKH 2DMQA 2M8GX 2F4MB 3QPTA 2VC1A 1KU7A 3HRTA 1QRYA 2IS1A 2EFPA 1TWFJ 4I99C 3DU5A 4G6DA 3ZOBA 2F5VA 1G8XA 1RC9A 4XBFA 2G0EA 2LNBA 5CVUA 1R1TA 5HDKA 3IKTA 2Y75A 4BXXJ 3E3VA 1HF0A 1X19A 2B0LA 2O03A 3LFUA 3TEDA 2BW3A 2NS7A 4G6TB 5DUIA 1WFXA 5FD5A 4B47A 1ZR4A 1E3HA 2P7VB 3W2VA 3KYCB 5M3FJ 1PVEA 2O9LA 4YIRX 4MQ9F 5FJ8J 3CCRI 2DPDA 1HXDA 1R58A 4E7IA 2L01A 1RZ4A 3P9IA 3K10A 4XONA 3G1LA 1WJCA 2M9HA 4PGHA 3GLLA 1UELB 2CJJA 3MCZA 3HUGB 4HLYA 2R7RA 4X6AJ 4M3EA 4Y3OA 3L9FA 3OYLA 3S15J 4YIIA 3OR2C 4AIDA 4FT8A 2LOOA 4BXUA 1C0WA 3H0GJ 4I76A 1Z05A 2ZXWH 2ZXIA 4GDFA 3ZMSA 3BR5A 3DV8A 3SEZA 4C3HJ 2XASA 5KAFC 5K5OA 4FE4A 2DJNA 4U0VA 4HQMA 1EH7A 3G1OA 4AYBA 3N97A 2DFEA 1YS7A 3I0TA 1FMWA 4EM0B 1YRNA 5GTHC 3GZNB 3MKWB 2XSDC 3I9V2 1A36A 2EINH 1FSEA 3V8KA 5FO5A 1U3EM 1MMAA 2W4SA 3FDYA 3OWTA 4QPOA 3GTQJ 1FIAA 2E60A 3JW4A 2EFWA 4XRFA 1O3RA 3M9AA 1XTAA 3WE2A 5J4YA 5LLQA 2W25A 3NARA 3BR6A 1BC7C 3JAMZ 3UR3C 3Q9SA 5ERIA 5IT3A 1NG6A 2A69F 2XSJC 2A3SA 4A93J 4G7HF 3JRDA 3KP5A 4G8XA 2HYFA 1OCTC 2QA4I 4J00A 1MBFA 5CVVA 1ETWA 5A2QK 3RQIA 3WTXC 1JHHA 2PFBA 4JK1X 2DT5A 4OWRB 3BDDA 3AAFA 1WPKA 3OIQA 1JT6A 3SXYA 4GYIA 1MIJA 3DEUA 1U5TB 2IS4A 2FA5A 5HS7A 4ZYEA 2Y30A 3HKZN 3HB9A 2AQEA 3AKZA 3DBHB 4BH9A 3HOXJ 1N78A 1D1AA 2ADUA 4OMZA 2BY2A 1PP8F 2CSOA 4L5JA 3K70D 4ZZDA 4AIJA 3FWEA 3D0SA 4KIGA 1ORKA 2LG4A 2LH9A 2DXIA 2TCTA 4L9TA 3CUOA 3V8JA 4OU0A 3WU0A 1LFUP 2P5KA 2GIZA 2BY0A 3WODF 1B8IB 3BZKA 3MKZA 2ID6A 3M1EA 1IRZA 3HOSA 2R5YB 3BCBA 4D5FA 3OSFA 1ONVA 2KIMA 3SEQA 2MH9A 2HQNA 3I4PA 4B1RA 1ETYA 3CMEI 3AG3H 4RDUA 3OL4A 2CW0F 2GA1A 2P5VA 4HLXA 2CQXA 3ZMDA 4Y52J 5JR3A 4XKVA 4GRIA 3ULQB 1WZ2A 1YO5C 2N8GA 3GTPJ 1WCMJ 3OYIA 3DLLF 2V4JC 3JSOA 1LB2A 4AU7A 4P5OA 2A6TA 3FBIB 3BWGA 3DF8A 3CCSI 3F6OA 2E1MC 4L9JA 1YW7A 1D8JA 1ZKGA 2VI6A 1TBXA 4B3XA 1HKTA 2HU9A 4RB3C 4ENJA 2IBDA 3QPSA 4AYBN 3M8JA 1Y1VJ 4A3FJ 4QWQA 4ITVA 1KYZA 2CG4A 2LRDA 2Y9YA 3RZOJ 2D2WA 2X4HA 4B8XA 2DMUA 3WTYC 2L9RA 3L09A 3P7NA 2RAEA 2IAIA 3I56I 1VQ8I 1B1BA 2H09A 5EGOB 5HLHA 2HKXA 4LK1F 2JA7J 1W7PA 4V2FA 4BQAA 3PSFA 3BOQA 3U1DA 2ACJA 2L4AA 2NS0A 3MN2A 1OPCA 3LSHA 9ANTA 1T2KA 1Y0UA 2VKHA 1I6XA 2IGOA 4IEJA 5KHDA 2FJ1A 1WVRA 3F6VA 4BY1J 1QVTA 1K78B 5EG0B 1P92A 4KIFA 3H92A 1B4AA 2XGXA 4XKCA 1IF1A 2ZNYA 4MTEA 1RKWA 1GXQA 2DAOA 5B1AH 1GV5A 2Q2EA 3Q3SA 2UXNA 2DT6A 1LFBA 3F23A 3TDZC 1A35A 1DPUA 5FLMJ 4D1QA 4HYEA 3PIOF 3HGYA 3BC8A 4AM3A 2WAFA 3SZGA 3LSIA 1JKQC 1GLNA 1UHSA 3KZYA 1FTZA 3QAHA 4CO8A 1FBSA 2CQKA 1GT0C 1YLFA 3G73A 2P7CB 4HDVA 1S5LC 1R9TJ 2PBIA 4AIHA 1FYKA 2O61A 2RV8A 3S2HJ 2DODA 1ZARA 2VBZA 5L3GA 1P2FA 4BE0A 1BR1A 5TISC 2FD5A 4MHGA 3TP0A 3VEPA 1SD4A 3HKZA 4WK8F 4E7HA 4C2TA 4OIQF 4XN0A 4XLCA 5H6RA 4HZFA 1ODDA 2KIQA 3L2WA 4A3JJ 1H88C 5IYBJ 5J4VA 5CVJA 5E20A 2HOSA 4XRMA 3WTTC 1S9HA 1V5FA 4CZCA 1W1WE 1AHDP 2XF6A 4B3AA 3DBRB 4HV6A 1VQ7I 3K69A 1EH8A 3GBGA 1Z3YA 2QYOA 1MH3A 5GPAA 2L3DA 1PUEE 1FOKA 4UVAA 4Q4ZF 4CSWA 2EIJH 2M0MA 3WTSC 4RA2A 5DS9A 1FYMA 3JSPA 2DW4A 2JA6J 3BY6A 5DM6F 5F6FA 3OR1C 2HOAA 2OZ6A 1ETKA 4XLHA 3W6JB 1GVDA 2XGDA 2W1OA 5F1JA 3TW7A 1JKOC 2CW7A 1UG2A 5F1RA 1I50J 2ZBKA 5D5UB 2E1CA 3H36A 3LNQA 3JRHA 5M3MJ 2XAFA 5AIQA 3K4LA 2QUFA 4B43A 2BGCA 4UNOA 1SMYF 1U5TC 1KYWA 3M3YJ 3VDXA 4MO7A 4UB8C 2HVRA 1MJBA 2KIUA 1H8AC 5LFAA 2DFHA 1HLVA 2IGMA 2R7DA 4UXNA 2CW8A 1O3TA 3CD6I 3HEFA 3SQNA 3A01A 1Q1VA 3C2GA 2B63J 3PO2J 3B73A 1OMIA 3U9GA 3DKYA 1P7JA 2IVMA 3LSJA 4BYYA 2CWEA 2UWMA 3K2AA 2AQFA 3HIFA 4L9VA 2VJJA 4XICA 2K40A 4A0ZA 4AD9A 1BI3A 2HDWA 3ZMVA 1MSFC 3TO6A 3F22A 2OA4A 1X3UA 3GTOJ 5E3MA 1YOVB 1W7PB 5DV5A 5DTDA 1K4TA 1OCRH 4XR6A 3SFIA 2H1KA 4XLFA 5HNFA 1GXPA 1ETVA 1RI7A 1REPC 1K4SA 2X48A 3CJRB 3OOPA 2G7HA 3Q9VA 4XN3A 2IRFG 3FM5A 2JSCA 2K85A 2GOXB 3TOAA 1WJBA 3FM3A 4LITA 2OQRA 1WWXA 1HC8A 2DYRH 4N9IA 4ZDOA 3KP7A 3RPUD 1W7PD 4S0HB 2VBWA 2ZXHA 3GCMA 3WU1B 4GYGA 4KYWA 1KZHA 1L0OC 1R1UA 1WJ5A 2QQBA 4C3JJ 1F5TA 3P5JA 3G1MA 1IG7A 4ZYGA 4UB6C 4IOCF 1FX7A 2L5QA 2LYCA 3RI4A 3QOEA 4KMFA 3ZR8X 3EYIA 2W7NA 1Z77A 2VQCA 2V6CA 1FLIA 2R4GA 1JHFA 3NEUA 5F27A 4BBRJ 1HW2A 2KZVA 2JVHA 3I71A 4DNCA 3M8FA 1RNLA 2LC2A 4M74A 5GTIC 2CH0A 1V54H 2UXXA 5BOXA 2WA0A 2VIXA 3S3NA 2DU9A 4BGDA 3ABLH 3NRVA 5J40A 4CA0A 2XGEA 4D7MA 2MA3A 4UVBA 4BACA 1T56A 4ZDLA 3HYIA 2HPIA 4E4HA 2B7EA 3E5UA 5JVGF 4ZYHA 3J7AO 4EGZA 3L00A 3FMRA 3K1MA 5IP7J 1N77A 2ISYA 5FKLA 3VWBA 5J8FA 3O8GA 1EKEA 1HW1A 2W48A 4BQNA 2XAHA 4ZZLA 4HDUA 4YFKF 1WH5A 1GUUA 3KIOA 2CV1A 2STTA 2VQLA 3KEOA 1PDNC 2K7LA 1H9GA 3CC4I 3ERMA 3H5NA 4JP0A 4A6EA 4UY8I 5BPDA 3ZQQA 2HQAA 2L54A 2R92J 1MSEC 3KZIC 3GXOA 4F55A 1JI8A 3FKJA 3OS0A 3KZZA 2OU2A 2H94A 2W24A 1ZGAA 2DDBA 4HX4A 3HTSB 3LA7A 2FU4A 3Q0VA 2HPMA 2H8RA 3MKYB 3ZGKA 3HBLA 4II3A 1OJLA 2KHMA 3QOPA 2JQ7A 1A6IA 2WAQA 3L2VA 4XLPF 1J7KA 5D6EA 3F8BA 1G2HA 4Y4RA 1W4MA 2YU9J 3I64A 1IXRC 3I59A 3S1RJ 2CYYA 5FROA 1P4AA 5D4SA 2RREA 4EJUA 2KDOA 2BW3B 2QZ8A 4M3FA 1XX5A 3OV8A 2DFFA 4L9NA 4DYQA 3CMYA 3EDPA 2LR8A 5J3LA 5H2FC 2KL4A 2HDCA 4E7SA 2FQ3A 1WGXA 2VN2A 3R61A 3GTGJ 2MABA 3G4SI 3OSGA 2KRHA 5LHHA 2L7ZA 1N25A 2GXGA 1OYWA 1JXSA 3RJPA 4NQWB 2ZJQF 1ZRCA 3CCYA 1U2WA 2PMZA 2FNAA 3PFIA 3R60A 3QWLA 4B09A 2R5YA 5IYDJ 2ZC2A 4EGYA 5ICGA 2L9SA 3S32A 1SFXA 1LDKB 1XD7A 3DTKA 5BNGA 3L2UA 3ABMH 1ITYA 5IY5H 3H9GA 2A5YB 2HQ5A 1UFMA 3C2BA 2DA4A 3H1CA 3LSRA 1E2XA 1XCVA 1IO2A 3D5RC 4L5EA 1B9MA 4QTRA 1LKXA 2R7UA 4X1EA 3Q0WA 1UHMA 2LTPA 3CMAI 2E71A 1ZGJA 3ZQ7A 3ZMZA 2FMLA 2XKPA 3PL8A 2LBFB 3O2PE 1MH4A 1BI1A 1LE8B 2V1XA 3H5AA 4BE1A 3UKGA 3DPTA 1SD6A 5K7ZA 2CV2A 2DTZA 5L3FA 4MEYF 2YX4A 2VOOA 3U21A 4G94A 2RNJA 4YFXF 2HYJA 2E35A 4EM2A 1ZREA 4FX4A 3QRFF 2F4OB 3BJOA 3JCUC 4XQFA 1MNDA 5E3NA 1X4OA 2DYSH 4U7BA 4M3GA 5CPRB 1S3JA 2ELHA 2DCEA 2KPMA 2M45A 4J01A 2V26A 1V55H 3AFHA 5DM7F 1A6QA 1FBUA 3AG2H 3W2AA 1BW6A 3FIWA 3K0LA 2XF7A 3G6EI 2O7OA 1ZH5A 3OYHA 2HS5A 4N4NB 2HNHA 2XF5A 1P9QC 2XAQA 5F04A 1NK2P 3DEWA 4UUTA 3CCJI 1RIOH 3BPVA 1R6RA 1TL8A 4UV9A 2VXDA 2KT0A 1O4XA 1UCRA 5E1ZB 1SFEA 2IW5A 2DJIA 2BVLA 4PSWA 5C4XJ 2DOFA 4CCNA 3CUQB 4A2UA 3CTAA 5CLSA 3PFYA 4IHSA 1HOMA 1T95A 2RDPA 4MEXF 2X6OA 4M72A 1BIAA 1YITI 3B02A 3E97A 4R79A 1QA6A 1HCRA 2RN7A 5FRMA 2OCCH 2MW8A 4U0YA 1VFCA 2H8WA 3FZVA 2O8XA 2ZB9A 4IO9F 2WY8Q 1R4NB 1JKRC 2BVMA 3IKVA 3KE2A 2VBYA 1R4MB 1CF7A 2OD5A 5IP9J 2WAQN 5JI6A 5KCMA 5L3CA 4U7DA 5FRNA 3K4CA 4EM1A 3M1CA 3H0DA 1ULYA 4A12A 1B8IA 2A6HF 2ESNA 5K1YA 3ZPLA 2M87A 3B6CA 2IPQX 3F8NA 4RGRA 4KISA 2QVOA 2V1NA 1RUOA 2X6YA 2XC7A 4NUBA 4KNYA 3FXMA 5C4JJ 1ZR2A 1SANA 1TQMA 1X1PA 1YTYA 1JJ8C 1I39A 2CUZA 3PQJA 4YG2F 3PNTA 3J7AY 1IV6A 5EEHA 3SDGA 5D8LB 3FMQA 4DIQA 2EB7A 3FXRA 1VQPI 4WXDA 1U9OA 2IJLA 2JA5J 1X3ZB 2ZSIB 4GGGA 1MKMA 3TBIA 3ESWB 3TKYA 3E6MA 2MD0A 1YYVA 2QM3A 2E34A 1VQLI 5EZGA 1WI9A 3BTCA 3H5RA 1JGGA 4WXCA 1O7LA 2GAUA 2LF7A 4CUGA 4Y15A 3DQVC 4NNJA 4IX7A 4AWXB 1OQYA 2FOWA 3F21A 3GMEA 3WU2C 3OYMA 2I10A 1RESA 2E5NA 4ETSA 2Z33A 3E5QA 2M4KA 2RNGA 1YX3A 3MD2A 4PJLA 1QBJA 1EJ9A 2NOJB 5BS6A 1U8RA 3Q5FA 1ZG5A 1O3SA 3DP7A 3R0AA 2YU3A 2QEXI 1W36D 1BJAA 3HDDA 4MIMA 1DU6A 3VOEA 3HSEA 4MGRA 4A0YA 2EFOA 2CUFA 5E1XA 4CCJA 2M7BA 3ABTA 4G7ZF 2QSHX 1FBQA 3TOBA 2R5ZA 2M7AA 3S17J 3D1NI 2M0CA 1WJFA 2X1CA 2A61A 3HPHA 4PDKA 4UVCA 3LSGA 4RAYA 3GFIA 5LHGA 2FNPA 4M9SA 3OYAA 3NWSA 3CO6C 2NS8A 1I1GA 1JJ6C 2HOEA 3VB2A 3LQQA 2LLKA 3J81Z 3F72A 1AKHB 3H35A 1D0YA 2GA2A 3BG9A 1F9NA 1IJWC 2VONA 4LGWA 1RRJA 2K9QA 4ANJA 4C3IJ 3PUBA 4KN4X 2G9WA 3ECHA 1AKHA 4F7ZA 2WAEA 4HEA2 3PM1A 3CZ6A 2NVXJ 2Q0OA 4PCQA 4BAYA 4LIUA 4I7HA 2DDAA 3TQNA 4BDZA 4KA4A 2H27A 2ID3A 3E0JB 1O57A 3MEXA 4UUSA 2PMUA 4F3QA 2H6CA 1MJAA 1QPIA 5AIPA 1IDYA 2ELKA 4HW0A 2QBYB 1TWHJ 4YFNF 4LIVA 2G7UA 3UNGC 2E2IJ 5E1WA 3MVPA 2LDUA 5TJJA 3JTGA 2XPWA 1YIOA 2DA3A 3JAMK 2C6YA 2Y48A 4P55A 5DCMB 5KNLA 4M71A 2X85A 4DZPA 3I5UA 2W82A 2DO7A 2Y2ZA 3V7SA 2EZLA 1SFOJ 1E3OC 2L9VA 4YIFA 1D1BA 2CQNA 4Q47A 4XSXF 5M5YJ 3ISPA 4E7LA 1TW3A 4E6KG 3QU6A 1JE8A 3IHUA 3O3KA 1IAWA 2EIKH 2WC2A 1X58A 5LGTA 2VT3A 4II2A 4RGSA 2ZJPF 1W0UA 1STZA 2PN6A 2E7XA 2KJBA 4XRSA 3C18A 1ZG3A 2NVTJ 4G12A 1LE8A 1TC3C 5FKOA 4WCGA 4H4KC 5LGNA 1APLC 5BMZA 1XGSA 5HDGA 2W84A 2BZTA 2WBMA 3LFKA 2E19A 4XK4A 2DN0A 1QVUA 4AVPA 3S8PA 1I3AA 2IEKA 3IH4A 2IP2A 4I02A 4DYRA 2JT1A 2M3AA 3WGHA 2P6SA 1FP2A 4RGXA 1VQ5I 1ZYRF 2BOLA 4PJJA 3I58A 1NHAA 1D1CA 1E0EA 2K4BA 4BUPA 3BP8A 2XDVA 3CCLI 2FEZA 4M6VA 3S2DJ 3QYFA 3PSIA 2EQRA 2FX0A 2ZO4A 1HW5A 3HTUA 2E1OA 2NOGA 3DXJF 3IP4B 1VQ9I 5IT9K 1P7IA 1FC3A 1KU3A 4ESBA 3OIPA 1QHGA 3CJNA 2HZTA 3IC7A 3QYBA 2MD5A 1J2XA 3A2KA 1OR7A 3R4KA 1R00A 3HXLA 4PZJA 4EVIA 3DTEA 2R93J 2KRCA 3EUHA 4IHXA 1TP4A 1IN7A 4O5VA 1GDTA 1B9NA 2EA2A 4C9YA 2K86A 2IGNA 3H3UA 3GEZA 2MGQA 1XPXA 2Z1DA 5CJ9A 3L2QA 3CF2A 4W97A 4IPAA 1F36A 3RYPA 2V79A 2LKPA 1RR8C 4HA8A 1XGNA 3AL0C 3H9JA 3ZMUA 2CS3A 3MFKA 3CO7C 1VQMI 3HJEA 4MQVA 1SVLA 4DOZA 3DKXA 1V5GA 3W6KB 3V7RA 1PYVA 1CQTA 3IRRA 3RDIA 2KMUA 4AIKA 1R7JA 1WQ2A 5J6XA 1X1BA 4MNUA 3H3VK 1OCZH 1W5TA 2ZJ2A 4A3MJ 5ICFA 3CC2I 4M9ZA 1WHUA 1R5ID 3IH2A 3L2CA 4PFOA 2R7TA 5IOZA 2YS9A 1J75A 3E1SA 2D45A 4I0AA 3BQYA 4M6XA 4QLCU 3PO3J 2XAUA 2E2JJ 1D0ZA 4NDLA 4RB2C 1S7AA 2R7XA 1IZ1A 2OV7A 4EV0A 2JA8J 1EH6A 1XSXA 1HSJA 5HNHA 3WHCA 2GM4A 1QNTA 1PUFA 4KT6A 2EWNA 4AUXA 2GIVA 1KQ8A 3F8CA 3S1NJ 2TRTA 4DGWB 4KIBA 1YG2A 2QQAA 2ZSHB 3P9KA 3MQ0A 1U5TA 2F5DA 4PJ0C 1FIPA 4IRIA 3ZQGA 3QQAA 5B5EC 3S3OA 1LFPA 4ZTJA 2VODA 2Y69H 1XN7A 1EV7A 2ME0A 2QGUA 5EDNA 3KYLA 1MBEA 4F52A 4KITB 2HEOA 1T39A 2HQRA 3LA2A 4Z2YA 1VTNC 4RGUA 2VT2A 4E7JA 1MGTA 3CDIA 3L2RA 3T0YA 4CDGA 4PUSA 5FD6A 4JX5A 2K9SA 1I1SA 1TLHB 3DPLC 5DDGA 4BE2A 4EMSA 1IRXA 3VFZA 2FRHA 5K5QA 1MJ9A 1X2MA 2M30A 3G3ZA 3QYEA 4BHBA 2P6TA 2LY9A 5DD4A 1TW2A 1U6GA 4R1HA 1X2NA 3HUGA 4DW6A 4JYKA 1K78A 4JBAA 3DWLE 2MYSA 4OINF 1YW9A 2AHQA 3FXJA 1FMVA 2DLLA 2EZHA 4CCLA 2EIMH 3AG4H 5HS8A 2R3SA 1NK3P 2BXYA 4CZZA 4V2GA 1Z7UA 2Z16A 5LGUA 4CCKA 3WTWC 1SEUA 1JGSA 1LVKA 2L02A 2Y0SA 3OIOA 1YX5A 3X2QH 3IRQA 3VSLA 1LQ1A 3GTJJ 1E3PA 1ETOA 3HHGA 3GVAA 2JJ7A 3FXLA 2MSYA 2Z3YA 3ZCOA 4RAGA 5CYVA 3LSKA 2YUSA 3WHBA 3ASNH 3ASOH 3GO5A 3S14J 3ZQHA 4B48A 4D0PA 4Z6YA 3SYTA 1F4KA 3K4KA 1SD7A 1MDMB 1YE9A 1XB4A 2QWWA 3R0JA 4A3GJ 2E1MB 3OS1A 3HSFA 1MMNA 1U8BA 3CCMI 4ENKA 3K4NA 3E6DA 1G3TA 3BQZA 4X0GA 3PIPF 2ECBA 4KMUX 1T98A 3ZMTA 4LG3A 5E3OA 5BPIA 1NG7A 2PMHA 4ESFA 3IAM2 2Y0MA 3A4CA 2A68F 3G71I 1RKTA 3LAPA 2QSFX 4UV8A 2IXSA 2CMPA 3TO7A 1AWCA 5HVQC 4CHUA 1WKMA 2RQPA 5HDNA 2MH2A 3LSPA 1IW7F 1TQPA 2BE5F 2XHKA 1I6HJ 1UB9A 2IGKA 2LVSA 2K5CA 2Z99A 2JRMA 2XVCA 4HV5A 1IDZA 2EV6A 2QQ9A 3RKYA 4A3DJ 1BJZA 1U0JA
chains in the Genus database with same CATH topology
1ETWA 3S1QJ 3RQIA 1VI0A 3BR1A 2D5VA 2E2HJ 2HYJA 1WPKA 4J19A 1FEXA 2DA5A 4QSHA 1JT6A 3TW6A 5E3NA 2Y30A 4M3GA 3HKZN 3HB9A 1U78A 1RPWA 1GV2A 5FKKA 5C44J 3HOXJ 1BW6A 3FIWA 2NVQJ 4BBSJ 2O7OA 4FISA 5F08A 4CYCB 1W0TA 2EH3A 5F04A 2CUEA 1NK2P 4UUTA 2JMWA 3DEWA 1ORKA 3S16J 1U9NA 2TCTA 3JRCA 2KT0A 1O4XA 1ZQ3P 1LFUP 5C4XJ 1B8IB 3BG5A 3ZQFA 2WB1N 2ID6A 2DMTA 3BR3A 1IRZA 2R5YB 1HOMA 4D5FA 3OSFA 3RKQA 2X6OA 2DA1A 4B1RA 1A5JA 1ETYA 2HI3A 1HCRA 4RDUA 2MW8A 1VFCA 2CQXA 2KDZA 4Y52J 2ZB9A 1JKRC 1MBKA 1ZK8A 2OF7A 2N8GA 5HODA 1WCMJ 4A3IJ 3GTPJ 1WH7A 4IHWA 3ZQIA 1WI3A 4M3BA 5IP9J 2WAQN 5M5WJ 1RETA 4ABZA 1B8IA 4B4CA 3LOCA 2XPUA 3B6CA 5JLXA 1TWCJ 1ZKGA 3FK6A 2VI6A 1K61A 2XB5A 1D5YA 1Y1WJ 5GPCA 2IBDA 3QPSA 1NTCA 2L7FP 1Y1VJ 4AYBN 4A3FJ 5C4JJ 1ZR2A 1YRNB 1SANA 2XRLA 2Y9YA 1JJ8C 1HDPA 3ZQLA 4GFBA 3RZOJ 4XRSG 3I4NJ 2CRGA 2DMUA 1B72B 1IV6A 2L9RA 2O8KA 2RAEA 2IAIA 3SDGA 5EGOB 2EZIA 2JA7J 2XGCA 1U9OA 5FKMA 3CDLA 4V2FA 2JA5J 1EF4A 4IHXA 3IH3A 5IYCJ 5EZGA 4A3CJ 3MN2A 4UUSB 9ANTA 3BTCA 1JUPA 1JGGA 4IEJA 2JK3A 1JTXA 5EEAA 4A3BJ 2FJ1A 1H89C 4BY1J 1QVTA 5EG0B 2I10A 4MFDA 1RESA 1JKPC 4DYCA 2DA7A 1RKWA 5EYRA 4XIDA 1GV5A 3Q3SA 1LFBA 2OPTA 3GTMJ 5FLMJ 1MBJA 2Y9ZA 4W1UA 3HGYA 1HDDC 3HOVJ 3HDDA 4MIMA 1DU6A 3HOWJ 2CUFA 2Y0SN 1JKQC 2M2EA 3HM5A 1UHSA 2R5ZA 1F43A 3Q0UA 5IP6A 4BKXA 3CQZJ 1FTZA 3JRFA 3S17J 3D1NI 2LFBA 2M0CA 3I4MJ 1JT0A 3S1MJ 1GT0C 2VUMJ 3LSGA 1R9TJ 3S2HJ 1JTYA 3F0CA 5JLWA 3K7AJ 2FD5A 2NS8A 1JJ6C 3TP0A 2LLKA 5J1RA 5FLVA 1AKHB 4IHYA 3BG9A 2K9NA 3FKIJ 3TP3A 1Z0XA 1IJWC 3HOYJ 1XS9A 2K9QA 4A3JJ 1H88C 5IYBJ 4C3IJ 2VPRA 3W6VA 1B72A 2HOSA 4XRMA 1AHDP 5C3EJ 4B3AA 4A69C 2QF7A 1AKHA 2COBA 5EGOA 3PM1A 2NVXJ 3HOUJ 3FISA 5K7FA 1MBGA 3GBGA 5GPAA 1MH3A 4DZJA 2ID3A 1ETQA 5J1YA 3E7LA 3BR2A 4UUSA 5DS9A 1BA5A 1QPIA 2JA6J 1XG1A 5F0HA 1IDYA 2ELKA 1TWHJ 2ECCA 2HOAA 1ETKA 2E2IJ 3MVPA 1GVDA 4D7NA 4EEFG 2XGDA 2XPWA 1BL0A 2DA3A 2LP0A 3BTLA 5F1JA 3TW7A 2X9DA 1JKOC 4DZPA 1UG2A 3JR9A 2Y2ZA 1I50J 1S7EA 1OFCX 2EZLA 4D5CA 3IV5A 1SFOJ 4I6ZA 4C2MJ 1E3OC 3LNQA 3JRHA 5M3MJ 5M5YJ 3JRIA 4MLOA 4A3LJ 3M3YJ 1X58A 1TWGJ 3GTLJ 4MO7A 1W0UA 1H8AC 3JRBA 2LKXA 4XRSA 1I3QJ 2NVTJ 4G12A 4JX6A 1HLVA 1LE8A 1TC3C 5FKOA 2HOTA 3HEFA 1APLC 3A01A 1Q1VA 2QCOA 2B63J 1FJLA 3PO2J 2EBIA 4RBOA 4XK4A 2E19A 2DN0A 1JUMA 1QVUA 1P7JA 3LSJA 4FE7A 2IEKA 5F0CA 3IH4A 3BTJA 3K2AA 4DYRA 2GLOA 4XICA 2K40A 5IOYA 4A3KJ 2GBYA 5GP9A 1MSFC 3HOZJ 3GTOJ 5E3MA 5DTDA 2LK2A 4M6VA 1IGNA 2AO9A 2HXIA 3S2DJ 2EQRA 2FX0A 1XC5A 3SFIA 2H1KA 2E1OA 4QIWN 2NOGA 1ETVA 2JWTA 2WV1A 1P7IA 4M3DA 1BW5A 2X48A 3A01B 3JRGA 1ZGWA 3M4OJ 1K83J 1MNMC 1RR7A 5EF6A 3HGGA 2DMNA 1ENHA 2R93J 3O8HA 1MBHA 1VNDA 4S0HB 3A03A 1GDTA 2VKVA 2ME6A 2MGQA 4C3JJ 4W97A 4CYCA 1VF9A 1F36A 3ZQCA 3G1MA 1IG7A 3BTIA 2Y31A 3RZDJ 1UMQA 4HNVA 1TWAJ 5M5XJ 1POGA 1Z77A 4FCYA 3BR0A 1IUFA 2R0QC 1T33A 1CQTA 2XB0X 5F27A 4BBRJ 2DA6A 3JREA 5J1UA 3QPLA 3H3VK 4AC0A 4A3MJ 2HDDA 3IH2A 3FK7A 5IOZA 2XGEA 2YS9A 4D7MA 2DA2A 3BQYA 1T56A 3VPRA 1JUSA 1IC8A 3PO3J 2E2JJ 2VKEA 4NDLA 3NAUA 5F0FA 4FTHA 2JA8J 2M34A 2LD5A 2DMPA 3WHCA 2CU7A 2GM4A 2PMZN 1PUFA 5IP7J 3DCFA 4AUXA 2P81A 5FKLA 3O8GA 3S1NJ 2TRTA 2W48A 4BY7J 1WH5A 2R5ZB 1GUUA 4LOCA 1PUFB 1FIPA 2L7MP 2R7ZJ 3ZQGA 3SJMA 2JN6A 3QQAA 5EZHA 2ME0A 4JP0A 5IPAA 5EDNA 1MBEA 2R92J 1MSEC 2XPVA 3A02A 1ETXA 2DMQA 2CQQA 2M8GX 1ZTRA 1QRYA 1TWFJ 4JX5A 2K9SA 3ZOBA 1AU7A 3Q0VA 2H8RA 3JRAA 2L0KA 2G0EA 3HBLA 1X2MA 1OJLA 4BXXJ 1HF0A 1A6IA 3TEDA 2NS7A 1G2HA 2LY9A 3BT9A 1ZR4A 2YU9J 3OOUA 4Y7NJ 5M3FJ 1X2NA 3B6AA 4JYKA 4DW6A 3S1RJ 2O9LA 5FJ8J 3L1PA 5FKNA 5E3LA 2AHQA 2NVYJ 3G1LA 2M9HA 4M3FA 2CJJA 2EZHA 4DYQA 4X6AJ 3CMYA 2LR8A 4M3EA 3S15J 5J3LA 1NK3P 2EZKA 4MFEA 4V2GA 5K7HA 3H0GJ 4I76A 1WGXA 3OIOA 3GTGJ 3GTKJ 3OSGA 3GTJJ 3BR5A 2L7ZA 1ETOA 4C3HJ 2MG4A 4FE4A 2DJNA 1FTTA 2JJ7A 2MSYA 3G1OA 3WHBA 2YUSA 3CCYA 1YRNA 3S14J 3ZQHA 5IYDJ 2R5YA 2XSDC 4IHVA 3MKLA 5BNGA 1ITYA 4A3GJ 1U8BA 2FQ4A 2HQ5A 3C2BA 5EG0A 3BQZA 2DA4A 3LSRA 2ECBA 4L5EA 5E3OA 3GTQJ 4QTRA 1FIAA 4X1EA 3Q0WA 2LTPA 1DU0A 4JX4A 3NARA 3BR6A 1RKTA 1MH4A 1LE8B 3BG3A 3UKGA 1OCPA 5K7ZA 3LSPA 4A93J 3JRDA 1I6HJ 2LVSA 2DTZA 1OCTC 1IDZA 2HXOA 1MBFA 4A3DJ 1BJZA 4A3EJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ETW A;  3S1Q J;  3RQI A;  1VI0 A;  3BR1 A;  2D5V A;  2E2H J;  2HYJ A;  1WPK A;  4J19 A;  1FEX A;  2DA5 A;  4QSH A;  1JT6 A;  3TW6 A;  5E3N A;  2Y30 A;  4M3G A;  3HKZ N;  3HB9 A;  1U78 A;  1RPW A;  1GV2 A;  5FKK A;  5C44 J;  3HOX J;  1BW6 A;  3FIW A;  2NVQ J;  4BBS J;  2O7O A;  4FIS A;  5F08 A;  4CYC B;  1W0T A;  2EH3 A;  5F04 A;  2CUE A;  1NK2 P;  4UUT A;  2JMW A;  3DEW A;  1ORK A;  3S16 J;  1U9N A;  2TCT A;  3JRC A;  2KT0 A;  1O4X A;  1ZQ3 P;  1LFU P;  5C4X J;  1B8I B;  3BG5 A;  3ZQF A;  2WB1 N;  2ID6 A;  2DMT A;  3BR3 A;  1IRZ A;  2R5Y B;  1HOM A;  4D5F A;  3OSF A;  3RKQ A;  2X6O A;  2DA1 A;  4B1R A;  1A5J A;  1ETY A;  2HI3 A;  1HCR A;  4RDU A;  2MW8 A;  1VFC A;  2CQX A;  2KDZ A;  4Y52 J;  2ZB9 A;  1JKR C;  1MBK A;  1ZK8 A;  2OF7 A;  2N8G A;  5HOD A;  1WCM J;  4A3I J;  3GTP J;  1WH7 A;  4IHW A;  3ZQI A;  1WI3 A;  4M3B A;  5IP9 J;  2WAQ N;  5M5W J;  1RET A;  4ABZ A;  1B8I A;  4B4C A;  3LOC A;  2XPU A;  3B6C A;  5JLX A;  1TWC J;  1ZKG A;  3FK6 A;  2VI6 A;  1K61 A;  2XB5 A;  1D5Y A;  1Y1W J;  5GPC A;  2IBD A;  3QPS A;  1NTC A;  2L7F P;  1Y1V J;  4AYB N;  4A3F J;  5C4J J;  1ZR2 A;  1YRN B;  1SAN A;  2XRL A;  2Y9Y A;  1JJ8 C;  1HDP A;  3ZQL A;  4GFB A;  3RZO J;  4XRS G;  3I4N J;  2CRG A;  2DMU A;  1B72 B;  1IV6 A;  2L9R A;  2O8K A;  2RAE A;  2IAI A;  3SDG A;  5EGO B;  2EZI A;  2JA7 J;  2XGC A;  1U9O A;  5FKM A;  3CDL A;  4V2F A;  2JA5 J;  1EF4 A;  4IHX A;  3IH3 A;  5IYC J;  5EZG A;  4A3C J;  3MN2 A;  4UUS B;  9ANT A;  3BTC A;  1JUP A;  1JGG A;  4IEJ A;  2JK3 A;  1JTX A;  5EEA A;  4A3B J;  2FJ1 A;  1H89 C;  4BY1 J;  1QVT A;  5EG0 B;  2I10 A;  4MFD A;  1RES A;  1JKP C;  4DYC A;  2DA7 A;  1RKW A;  5EYR A;  4XID A;  1GV5 A;  3Q3S A;  1LFB A;  2OPT A;  3GTM J;  5FLM J;  1MBJ A;  2Y9Z A;  4W1U A;  3HGY A;  1HDD C;  3HOV J;  3HDD A;  4MIM A;  1DU6 A;  3HOW J;  2CUF A;  2Y0S N;  1JKQ C;  2M2E A;  3HM5 A;  1UHS A;  2R5Z A;  1F43 A;  3Q0U A;  5IP6 A;  4BKX A;  3CQZ J;  1FTZ A;  3JRF A;  3S17 J;  3D1N I;  2LFB A;  2M0C A;  3I4M J;  1JT0 A;  3S1M J;  1GT0 C;  2VUM J;  3LSG A;  1R9T J;  3S2H J;  1JTY A;  3F0C A;  5JLW A;  3K7A J;  2FD5 A;  2NS8 A;  1JJ6 C;  3TP0 A;  2LLK A;  5J1R A;  5FLV A;  1AKH B;  4IHY A;  3BG9 A;  2K9N A;  3FKI J;  3TP3 A;  1Z0X A;  1IJW C;  3HOY J;  1XS9 A;  2K9Q A;  4A3J J;  1H88 C;  5IYB J;  4C3I J;  2VPR A;  3W6V A;  1B72 A;  2HOS A;  4XRM A;  1AHD P;  5C3E J;  4B3A A;  4A69 C;  2QF7 A;  1AKH A;  2COB A;  5EGO A;  3PM1 A;  2NVX J;  3HOU J;  3FIS A;  5K7F A;  1MBG A;  3GBG A;  5GPA A;  1MH3 A;  4DZJ A;  2ID3 A;  1ETQ A;  5J1Y A;  3E7L A;  3BR2 A;  4UUS A;  5DS9 A;  1BA5 A;  1QPI A;  2JA6 J;  1XG1 A;  5F0H A;  1IDY A;  2ELK A;  1TWH J;  2ECC A;  2HOA A;  1ETK A;  2E2I J;  3MVP A;  1GVD A;  4D7N A;  4EEF G;  2XGD A;  2XPW A;  1BL0 A;  2DA3 A;  2LP0 A;  3BTL A;  5F1J A;  3TW7 A;  2X9D A;  1JKO C;  4DZP A;  1UG2 A;  3JR9 A;  2Y2Z A;  1I50 J;  1S7E A;  1OFC X;  2EZL A;  4D5C A;  3IV5 A;  1SFO J;  4I6Z A;  4C2M J;  1E3O C;  3LNQ A;  3JRH A;  5M3M J;  5M5Y J;  3JRI A;  4MLO A;  4A3L J;  3M3Y J;  1X58 A;  1TWG J;  3GTL J;  4MO7 A;  1W0U A;  1H8A C;  3JRB A;  2LKX A;  4XRS A;  1I3Q J;  2NVT J;  4G12 A;  4JX6 A;  1HLV A;  1LE8 A;  1TC3 C;  5FKO A;  2HOT A;  3HEF A;  1APL C;  3A01 A;  1Q1V A;  2QCO A;  2B63 J;  1FJL A;  3PO2 J;  2EBI A;  4RBO A;  4XK4 A;  2E19 A;  2DN0 A;  1JUM A;  1QVU A;  1P7J A;  3LSJ A;  4FE7 A;  2IEK A;  5F0C A;  3IH4 A;  3BTJ A;  3K2A A;  4DYR A;  2GLO A;  4XIC A;  2K40 A;  5IOY A;  4A3K J;  2GBY A;  5GP9 A;  1MSF C;  3HOZ J;  3GTO J;  5E3M A;  5DTD A;  2LK2 A;  4M6V A;  1IGN A;  2AO9 A;  2HXI A;  3S2D J;  2EQR A;  2FX0 A;  1XC5 A;  3SFI A;  2H1K A;  2E1O A;  4QIW N;  2NOG A;  1ETV A;  2JWT A;  2WV1 A;  1P7I A;  4M3D A;  1BW5 A;  2X48 A;  3A01 B;  3JRG A;  1ZGW A;  3M4O J;  1K83 J;  1MNM C;  1RR7 A;  5EF6 A;  3HGG A;  2DMN A;  1ENH A;  2R93 J;  3O8H A;  1MBH A;  1VND A;  4S0H B;  3A03 A;  1GDT A;  2VKV A;  2ME6 A;  2MGQ A;  4C3J J;  4W97 A;  4CYC A;  1VF9 A;  1F36 A;  3ZQC A;  3G1M A;  1IG7 A;  3BTI A;  2Y31 A;  3RZD J;  1UMQ A;  4HNV A;  1TWA J;  5M5X J;  1POG A;  1Z77 A;  4FCY A;  3BR0 A;  1IUF A;  2R0Q C;  1T33 A;  1CQT A;  2XB0 X;  5F27 A;  4BBR J;  2DA6 A;  3JRE A;  5J1U A;  3QPL A;  3H3V K;  4AC0 A;  4A3M J;  2HDD A;  3IH2 A;  3FK7 A;  5IOZ A;  2XGE A;  2YS9 A;  4D7M A;  2DA2 A;  3BQY A;  1T56 A;  3VPR A;  1JUS A;  1IC8 A;  3PO3 J;  2E2J J;  2VKE A;  4NDL A;  3NAU A;  5F0F A;  4FTH A;  2JA8 J;  2M34 A;  2LD5 A;  2DMP A;  3WHC A;  2CU7 A;  2GM4 A;  2PMZ N;  1PUF A;  5IP7 J;  3DCF A;  4AUX A;  2P81 A;  5FKL A;  3O8G A;  3S1N J;  2TRT A;  2W48 A;  4BY7 J;  1WH5 A;  2R5Z B;  1GUU A;  4LOC A;  1PUF B;  1FIP A;  2L7M P;  2R7Z J;  3ZQG A;  3SJM A;  2JN6 A;  3QQA A;  5EZH A;  2ME0 A;  4JP0 A;  5IPA A;  5EDN A;  1MBE A;  2R92 J;  1MSE C;  2XPV A;  3A02 A;  1ETX A;  2DMQ A;  2CQQ A;  2M8G X;  1ZTR A;  1QRY A;  1TWF J;  4JX5 A;  2K9S A;  3ZOB A;  1AU7 A;  3Q0V A;  2H8R A;  3JRA A;  2L0K A;  2G0E A;  3HBL A;  1X2M A;  1OJL A;  4BXX J;  1HF0 A;  1A6I A;  3TED A;  2NS7 A;  1G2H A;  2LY9 A;  3BT9 A;  1ZR4 A;  2YU9 J;  3OOU A;  4Y7N J;  5M3F J;  1X2N A;  3B6A A;  4JYK A;  4DW6 A;  3S1R J;  2O9L A;  5FJ8 J;  3L1P A;  5FKN A;  5E3L A;  2AHQ A;  2NVY J;  3G1L A;  2M9H A;  4M3F A;  2CJJ A;  2EZH A;  4DYQ A;  4X6A J;  3CMY A;  2LR8 A;  4M3E A;  3S15 J;  5J3L A;  1NK3 P;  2EZK A;  4MFE A;  4V2G A;  5K7H A;  3H0G J;  4I76 A;  1WGX A;  3OIO A;  3GTG J;  3GTK J;  3OSG A;  3GTJ J;  3BR5 A;  2L7Z A;  1ETO A;  4C3H J;  2MG4 A;  4FE4 A;  2DJN A;  1FTT A;  2JJ7 A;  2MSY A;  3G1O A;  3WHB A;  2YUS A;  3CCY A;  1YRN A;  3S14 J;  3ZQH A;  5IYD J;  2R5Y A;  2XSD C;  4IHV A;  3MKL A;  5BNG A;  1ITY A;  4A3G J;  1U8B A;  2FQ4 A;  2HQ5 A;  3C2B A;  5EG0 A;  3BQZ A;  2DA4 A;  3LSR A;  2ECB A;  4L5E A;  5E3O A;  3GTQ J;  4QTR A;  1FIA A;  4X1E A;  3Q0W A;  2LTP A;  1DU0 A;  4JX4 A;  3NAR A;  3BR6 A;  1RKT A;  1MH4 A;  1LE8 B;  3BG3 A;  3UKG A;  1OCP A;  5K7Z A;  3LSP A;  4A93 J;  3JRD A;  1I6H J;  2LVS A;  2DTZ A;  1OCT C;  1IDZ A;  2HXO A;  1MBF A;  4A3D J;  1BJZ A;  4A3E J; 
#chains in the Genus database with same CATH topology
 2E5Z A;  4MTD A;  3S1Q J;  2X51 A;  2A6E F;  3CUQ C;  3BR1 A;  2MLK A;  3ONQ A;  2F6C A;  1YI2 I;  1T0F A;  3WE3 A;  4J19 A;  1FEX A;  2DA5 A;  1E17 A;  2K9L A;  1R23 A;  2BY1 A;  3TW6 A;  3U2R A;  2K27 A;  3OYD A;  2JA2 A;  2OBP A;  1SAU A;  1RPW A;  1GV2 A;  3CCQ I;  5FKK A;  5C44 J;  4ESJ A;  2DFI A;  4IVN A;  3HRM A;  5ILS A;  3BJA A;  4HPQ A;  2NVQ J;  1Z21 A;  2P5L C;  3MZH A;  2K02 A;  3GFL A;  4GO1 A;  2D1V A;  3U1K A;  3CLQ A;  4H0E A;  2A07 F;  2F5C A;  1SFU A;  4LD5 A;  2EH3 A;  4Q48 A;  2CUE A;  5JVT A;  3S16 J;  1U9N A;  1P6R A;  4G9Y A;  2ZFW A;  5FFZ A;  5KVR A;  2PI0 A;  5BQT A;  1BM9 A;  2GZW A;  3RYR A;  2CGP A;  4ZC3 A;  1KQ0 A;  3KP2 A;  1T38 A;  4RM3 A;  3BZ6 A;  4L0Z B;  3BG5 A;  3ZQF A;  3RCO A;  4YEL A;  2WB1 N;  1BR2 A;  2HVQ A;  1UJ8 A;  3BR3 A;  3KCC A;  5ICE A;  3SZT A;  5B66 C;  1G3Y A;  3RKQ A;  2QKM B;  1A5J A;  1XDS A;  1G4D A;  3CCU I;  3IAS 2;  3DFG A;  2K4J A;  4EAT A;  2KDZ A;  2VL8 A;  4GXO A;  3EET A;  3KYD B;  2VQH A;  1MBK A;  1X1C A;  1BI2 A;  2KJC A;  2OF7 A;  4L0Y B;  5HOD A;  3GX4 X;  4P96 A;  1WH7 A;  3F9K A;  4IHW A;  4ASN A;  4IRH A;  5KK1 A;  3OYG A;  3WGG A;  1WI3 A;  4M3B A;  4HOB A;  3RQ4 A;  4HG2 A;  2HVS A;  1Y0N A;  1LEA A;  2IA0 A;  3RIR A;  1RET A;  1YQA A;  3OMY A;  1Z6T A;  3ABU A;  4ABZ A;  2GOM A;  2ZME C;  3ZN1 A;  5JLX A;  1XMA A;  3TGN A;  4ZYD A;  2PJR A;  2IA1 A;  1TWC J;  2I5U A;  2XB5 A;  3KP4 A;  1Y1W J;  1ZEL A;  1NTC A;  4HST A;  4YEJ A;  1YRN B;  2XRL A;  2O0Y A;  5HLT A;  1HDP A;  4JOM A;  3ZQL A;  4GFB A;  4XRS G;  3FBN B;  4HAM A;  2QSG X;  2VKD A;  4HX7 A;  3I4N J;  2CRG A;  4M9X A;  2RQQ A;  1X1D A;  1X1A A;  3ZRG A;  5AON A;  1S72 I;  2DQR A;  5HLG A;  2EZI A;  1IN4 A;  2WAD A;  3CCV I;  1EF4 A;  5FKM A;  3CDL A;  3M8E A;  3IH3 A;  1Z9C A;  4A3C J;  2TDX A;  1MMG A;  4AVZ A;  4EJO A;  1V5E A;  3OYK A;  1SFK A;  2HFH A;  2JK3 A;  3I59 B;  1FOW A;  5GAD J;  1H89 C;  3MZ8 A;  2R7F A;  2XIG A;  3BCA A;  4MFD A;  2PQ8 A;  1JKP C;  4RM2 A;  4BL0 B;  2P8T A;  1I27 A;  5CQE A;  4DYC A;  2DA7 A;  5DEQ A;  4XID A;  4KT5 C;  3CJT B;  1Z7L A;  3K1P A;  4HX8 A;  1T8I A;  2DK8 A;  2OPT A;  3M7G A;  4JQF A;  1QPM A;  2JPC A;  4FQG A;  1MBJ A;  3K70 C;  4N9H A;  4WXH A;  1Z67 A;  5ICC A;  2HTJ A;  2X0L A;  1LPQ A;  4KN7 X;  2WY7 Q;  3HOV J;  4CCO A;  1ZAO A;  4S04 A;  3HOW J;  1XDU A;  1F1Z A;  2AS5 F;  4RAF A;  4BQO A;  2M2E A;  3HM5 A;  5EEG A;  4N4O B;  3LQR A;  4NC6 A;  4RAZ A;  5IP6 A;  4O3M A;  4BKX A;  2I8D A;  2LFB A;  3C1D A;  1WSU A;  3I4M J;  3QP5 A;  4KIC A;  1JT0 A;  3D5L A;  2IT0 A;  2R7O A;  3A0B C;  3GW2 A;  4K2E A;  1B59 A;  2ZCW A;  5D4R A;  2V7F A;  1J9I A;  3K4J A;  5CQG A;  1K79 A;  3MWM A;  1SD5 A;  1JTY A;  4OAY A;  2XV4 S;  4A5M A;  4EJW A;  5IT9 Z;  4D9J A;  3KEY A;  2FOK A;  3FKI J;  3RPQ A;  4WWC A;  2VLA A;  4OIP F;  3HOY J;  2YPR A;  1XS9 A;  3E6C C;  2XRN A;  1S6L A;  2E1N A;  2VPR A;  4FET A;  1D0X A;  4LLL A;  4ZTF A;  5J47 A;  2FE3 A;  3SZP A;  3OL3 A;  2ZJR F;  5C3E J;  3KLN A;  3NWT A;  4A69 C;  2QF7 A;  2QKL B;  2QLZ A;  4U0W A;  2PG4 A;  2FXA A;  1SVM A;  3FIS A;  5GAE J;  1L3L A;  3KEQ A;  3FXU A;  3CUQ A;  4DZJ A;  5GAH J;  1IN5 A;  4IQ4 A;  2DT7 B;  2Q1Z B;  2X1E A;  5J1Y A;  2P0W A;  3BR2 A;  4F92 B;  2KIS A;  4HRI A;  1XMX A;  1R49 A;  1XMK A;  1UAA A;  4PFP A;  1CGP A;  1QQI A;  2KKO A;  2J5P A;  1VQK I;  2XKO A;  1BL0 A;  2LP0 A;  4RB1 A;  5E8G A;  4C30 A;  2JZY A;  3T8R A;  3JR9 A;  2CFX A;  4QPQ A;  5JHF A;  1J5Y A;  1S7E A;  1OFC X;  1T08 B;  3A1Y A;  3IV5 A;  4I6Z A;  3GZ6 A;  4PGG A;  4HNU A;  1LUJ B;  4A3L J;  5LEK A;  3CP2 A;  4DBQ A;  3KPH A;  5FLX Z;  3V4G A;  3CDH A;  1YW8 A;  4NHJ A;  2XAG A;  1G3W A;  1FPQ A;  3T5X A;  3C7J A;  3SFZ A;  1BI0 A;  1FNN A;  3D5S C;  4NC7 A;  3JRB A;  2LKX A;  2OTL I;  4JX6 A;  5A2Q Z;  4BEH A;  2HOT A;  1KGS A;  3HSR A;  1TQI A;  2CV0 A;  2RC4 A;  1USS A;  1G6N A;  2V9K A;  3GLX A;  1Y6I A;  1FJL A;  2V9V A;  2EBI A;  4M73 A;  3K6G A;  3HHH A;  1HBX G;  4FE7 A;  3BTJ A;  4LB6 B;  4A0X A;  3WGI A;  4HF1 A;  1KON A;  5IOY A;  2KRF A;  4A3K J;  3RPU A;  3HOZ J;  4TV7 A;  1GHC A;  4FX0 A;  3GFJ A;  3J7Z I;  2LK2 A;  3S2W A;  1ZLK A;  4Y33 A;  1IGN A;  5FLX K;  2HXI A;  5DUK A;  2EV5 A;  5GAG J;  1XC5 A;  3HPG A;  3AL0 B;  1TTY A;  1R1V A;  2XUB A;  5KAI C;  2STW A;  2JWT A;  4I2O A;  1K6O A;  2FBH A;  4IZZ A;  1BW5 A;  3J81 K;  3A01 B;  1RUN A;  1MMD A;  2CQ7 A;  2WWY A;  1AOY A;  3ECO A;  3M4O J;  3WTU C;  3CF5 F;  2OUM A;  4LG0 A;  1J59 A;  2VE8 A;  3DU6 A;  2Q2E B;  1ENH A;  5DCF A;  1TT0 A;  3PJR A;  3A03 A;  2YR2 A;  2LMD A;  4E70 A;  2VKV A;  1DDN A;  4U88 A;  2ME6 A;  4DQ2 A;  4BS9 A;  3LST A;  3RKW A;  1MMS A;  4CYC A;  4ENM A;  3ZQC A;  2BHY A;  1XSD A;  1IN6 A;  3WG7 H;  2BEO A;  1KU9 A;  1UMQ A;  3H3Z A;  4NB5 A;  4HNV A;  1OLT A;  3BG6 A;  4CH7 A;  3KP3 A;  1R22 A;  1DQU A;  1R5H A;  2J5O A;  3FMS A;  5M5X J;  4FCY A;  1WJD A;  3BR0 A;  1IUF A;  1YS6 A;  3VYR B;  2R0Q C;  3OYE A;  3V42 A;  1W36 C;  4RB0 A;  4NC8 A;  1LVA A;  1Z1D A;  1H9T A;  2DA6 A;  3JRE A;  1IXS B;  5J1U A;  3KFW X;  4L5I A;  3QPL A;  1EA3 A;  3OYN A;  5D6F A;  2KQR A;  4XMY A;  4AC0 A;  2QQ8 A;  2MC4 A;  2HDD A;  2KIF A;  3FK7 A;  4M6Y A;  3HRS A;  1OCC H;  1VQO I;  2DA2 A;  1BN5 A;  2ZME B;  1IC8 A;  1I5Z A;  5F0F A;  3NAU A;  3LAJ A;  1K7A A;  2AXT C;  2H1L A;  2LD5 A;  2DMP A;  2E7W A;  1D3Y A;  2CU7 A;  1SC7 A;  3I53 A;  3V8L A;  4PJN A;  3DCF A;  2P4W A;  1IN8 A;  4OAZ A;  3K9T A;  4BY7 J;  4CCM A;  1LDD A;  4XOT A;  4BU2 A;  2NYX A;  3EYY A;  4LMY A;  3COA C;  2EFQ A;  3SDB A;  3LWF A;  5EZH A;  3QPH A;  4OMY A;  2RGV A;  2K9M A;  4LG0 B;  3A02 A;  1KQ9 A;  1ETX A;  2CQQ A;  2DOE A;  4C2U A;  1ZTR A;  5FB2 A;  2L9N A;  5LRS A;  4CYD A;  2BYV E;  2L7K A;  4BJ5 C;  1P4W A;  1LDJ A;  2ZXJ A;  2BHZ A;  1D5V A;  2V1U A;  1PJR A;  1AU7 A;  3JRA A;  1ON1 A;  1VZ0 A;  2L0K A;  3J7Y J;  1YHQ I;  2LSO A;  1M1E B;  4BXF A;  1UST A;  3FHZ A;  3HC7 A;  3ZP5 A;  2QEN A;  3BLY A;  1LNW A;  1ERD A;  3BT9 A;  4UHT A;  3OOU A;  1FWZ A;  1K6Y A;  5HS9 A;  4Y7N J;  4EJT A;  1OR7 C;  3B6A A;  4XSZ F;  4CIC A;  3TL4 X;  1ZG1 A;  1DP3 A;  3ML6 A;  3L1P A;  2DQL A;  5FKN A;  3TO9 A;  5E3L A;  2NVY J;  5HOO A;  1D8K A;  3QOD A;  4S05 A;  2PJR B;  2EIL H;  2H6B A;  2LY1 A;  4RS8 A;  1MDM A;  2M5W A;  5EJC A;  2UZK A;  2XAJ A;  2BV6 A;  1ACI A;  5L3D A;  2LF8 A;  2EZK A;  4MFE A;  2OC6 A;  1BBY A;  5TRD A;  5K7H A;  3MMY B;  3GWZ A;  1BR4 A;  3T8T A;  2X6X A;  3DKW A;  3F3X A;  2VC0 A;  3GTK J;  1FT9 A;  2HKO A;  2OAZ A;  1OYY A;  2FUG 2;  1J09 A;  1Y56 A;  2FBK A;  2MG4 A;  1FTT A;  3KET A;  3I3L A;  3C2H A;  3QP6 A;  2R7W A;  1TZL A;  3OYB A;  2LKS A;  2WB1 A;  1DPR A;  2JRT A;  1Y8R B;  2NXN B;  3DEE A;  2HGC A;  5H6Q A;  2Z5U A;  4IHV A;  3PUF A;  3MKL A;  2ZFU A;  1OCO H;  1S8N A;  2PLY A;  4NBQ A;  4XNF A;  2FQ4 A;  3VYU B;  5EG0 A;  1W5C C;  4Y17 A;  4LB5 A;  3ZN0 A;  4KDP A;  1NH3 A;  2IS2 A;  3J80 K;  1YJW I;  3H9Q A;  2W57 A;  2ETH A;  1DU0 A;  1UHW A;  4JX4 A;  3K2Z A;  1CF7 B;  4ZH4 F;  2NRA C;  1OYI A;  3GYH X;  2RKH A;  3N05 A;  4BHC A;  2NNY A;  3WTV C;  3BG3 A;  1OCP A;  2UUZ A;  3ERE D;  2BXZ A;  2WTE A;  4XLE A;  1UZC A;  3S3M A;  2MLG A;  3HG9 A;  1X3W B;  3EUK L;  2LBF A;  3FHN A;  2ICW G;  1MZB A;  1ZHF A;  2HXO A;  2A5W A;  4YRV A;  4A3E J;  3LSM A;  3MAJ A;  4PSX A;  2CFO A;  1VI0 A;  5ILU A;  2D5V A;  2E2H J;  3BRO A;  1R71 A;  3IL2 A;  3BZC A;  4QSH A;  1FP1 D;  4F91 B;  1DGR M;  2L4M A;  1G59 A;  4IQJ A;  1U78 A;  2K3F A;  3E6B A;  3WG9 A;  1TT5 B;  3ROU A;  3WTZ A;  4LLN A;  1FZP B;  2R7S A;  1FYL A;  4BBS J;  2JPB A;  4FIS A;  5F08 A;  4CYC B;  1W0T A;  2F5F A;  2F48 A;  1A31 A;  2JMW A;  4HF0 A;  3SHF A;  3K4M A;  3JRC A;  1HKQ A;  2OZU A;  4RLF A;  1TNT A;  4ON0 A;  1ZQ3 P;  2M4G A;  5LEJ A;  1QZY A;  1FOX A;  4WX9 A;  3QU3 A;  1V4R A;  3C3W A;  1BIB A;  2DMT A;  3F8F A;  3GUD A;  2A05 A;  4E7K A;  1SVO A;  2DA1 A;  2HI3 A;  1O3Q A;  1XGO A;  2KFD A;  2DK5 A;  1YIJ I;  4GCV A;  4XKB A;  4B44 A;  2R7V A;  4DBR A;  1N75 A;  1ZK8 A;  1YJ9 I;  1AA7 A;  1S29 A;  4A3I J;  3ZQI A;  4XLN F;  2DTR A;  2BBY A;  5ILV A;  2QBY A;  2YSR A;  2VAS A;  3I54 A;  3VSK A;  5M5W J;  4Q5S F;  4B4C A;  3I55 I;  3LOC A;  2XPU A;  3DLA A;  2EFN A;  3FK6 A;  1K61 A;  4PJM A;  1PP7 U;  4LJZ F;  1D5Y A;  2O6G E;  1VQ6 I;  4I98 B;  5GPC A;  3FXK A;  2B9S A;  2EA4 A;  2L7F P;  5TGT A;  1FY7 A;  2MC3 A;  2NVU B;  3T1B A;  2ZKZ A;  3GFM A;  2VBX A;  3FX3 A;  4XOR A;  4CGZ A;  3CES A;  5DYM A;  1WJE A;  1B72 B;  2MBF A;  2FMY A;  2O8K A;  4HNT A;  3TMO A;  2NNN A;  1J0R A;  2Z9O A;  4BNC A;  2XGC A;  5K5R A;  4OOI A;  4IRG A;  1ON2 A;  5IYC J;  1P4X A;  2PEX A;  1V3F A;  4UUS B;  1XSV A;  1JUP A;  1VQN I;  2CUJ A;  4Y13 A;  5CKT A;  4G6Q A;  2GXA A;  1QO0 D;  3IUO A;  1JTX A;  2XRO A;  5EEA A;  4A3B J;  4EQQ A;  3G2B A;  2D1H A;  3HOT A;  1UG0 A;  3L7W A;  4XOP A;  1B6A A;  2OJE D;  3CMM A;  3S93 A;  3N4M A;  2IA2 A;  1WJA A;  2VB6 A;  5EYR A;  2JVG A;  2YX7 A;  1QGP A;  4RMN A;  2W00 A;  3KP6 A;  3GTM J;  1WRJ A;  2Y9Z A;  4W1U A;  4I0B A;  3DBL B;  4LFU A;  1HDD C;  2ZNZ A;  3R6S A;  2VPL A;  1MNE A;  4RLQ A;  2HTS A;  4IKF A;  1T0F C;  2Y0S N;  3EQL F;  1FSH A;  2EJR A;  3NQO A;  3RKX A;  1F43 A;  3Q0U A;  3CQZ J;  3CC7 I;  2HYG D;  3JRF A;  2PJP A;  2ESH A;  4XLA A;  5E8I A;  3BPX A;  3S1M J;  2VUM J;  1DUX C;  4E7Z A;  2Z2S B;  3EPZ A;  1KU2 A;  5J8C A;  3DTI A;  3F0C A;  5JLW A;  2OTJ I;  1QZE A;  2COM A;  3K7A J;  2RVC A;  1Z91 A;  3J80 Z;  5J1R A;  4OIO F;  5FLV A;  4ZJZ A;  4IHY A;  2K9N A;  3TP3 A;  1Z0X A;  2O3F A;  1Y39 A;  3M07 A;  3W6V A;  1IRG A;  2Q8K A;  1B72 A;  3IWF A;  3K1N A;  4LK0 F;  1Q1H A;  2NAZ A;  2IS6 A;  2ELJ A;  2COB A;  5EGO A;  1QU3 A;  2PX9 A;  3HOU J;  4I09 A;  5K7F A;  1OKR A;  1IV8 A;  3OS2 A;  1MBG A;  3F8M A;  4I01 A;  3ZXS A;  2E36 A;  2OCE A;  3REO A;  1ETQ A;  3E7L A;  1BA5 A;  1W5S A;  5DCM A;  4V19 K;  2L2O A;  1XG1 A;  5F0H A;  3K4B A;  2ECC A;  3CLO A;  2LY2 A;  4IHT A;  4IL6 C;  3OYJ A;  4FHT A;  3AG1 H;  4D7N A;  1ZN2 A;  4EEF G;  5JFR A;  2FSW A;  3BTL A;  5FGM A;  4HBL A;  2X9D A;  4BQQ A;  3O6B B;  3CP8 A;  3OYF A;  1O7F A;  2V1D A;  2VQG A;  3VYT B;  3JTH A;  4WF2 A;  4D5C A;  4ZYA A;  4C2M J;  1T6S A;  1MD0 A;  4L18 B;  3RSN A;  3JRI A;  4MLO A;  5JHU A;  2WV0 A;  3VYS B;  2V6E A;  5D5X B;  4P9U A;  5E79 C;  1BOA A;  1KA8 A;  1TWG J;  3GTL J;  3DPU A;  1YFH A;  5FFX A;  2EK5 A;  1SAX A;  1MW7 A;  1S7O A;  2LRE A;  4BJT A;  4BJ6 C;  1I3Q J;  2GWR A;  3EUA A;  4KUM A;  4PK4 A;  2JUG A;  2QCO A;  2R7Q A;  5L3B A;  2JUC A;  3FF5 A;  2DBB A;  2F5E A;  1XGM A;  4RBO A;  1LJ9 A;  5L3E A;  1HST A;  1JUM A;  3MZY A;  4IF4 A;  5H20 A;  5F0C A;  3OYC A;  3HRU A;  2HR3 A;  2GLO A;  4HSR A;  4BHP A;  1FOY A;  5D8K B;  3HL2 A;  1ZRF A;  2GXB A;  1IUY A;  2GBY A;  5GP9 A;  1LEB A;  3IWZ A;  2AXL A;  1ZRD A;  4UUV A;  5LBQ A;  2AO9 A;  4F93 B;  2X6W A;  2KZG A;  5E17 F;  4A6D A;  4QIW N;  3GZ5 A;  2WV1 A;  3W3C A;  2DPU A;  1X4P A;  2KLO A;  1QZZ A;  2EPF A;  3LMM A;  4M3D A;  2VE9 A;  3JRG A;  4NQW A;  4HF2 A;  3RTR A;  1ZGW A;  1A04 A;  2GQQ A;  1GVJ A;  2F4I A;  1K83 J;  4XKW A;  2K3P A;  1RR7 A;  1MNM C;  1HQC A;  1R36 A;  5DD8 A;  5EF6 A;  4N0B A;  4G7O F;  3HGG A;  3CJQ B;  1Z3X A;  2DMN A;  2VJ4 A;  3W2W A;  2HWV A;  3O8H A;  5CVI A;  1MBH A;  1VND A;  2VXZ A;  4KFC A;  5ED4 A;  4KJZ A;  2VOP A;  2O5R A;  3LA3 A;  3GF2 A;  3FXO A;  3V7C A;  4ENN A;  3FXQ A;  6PAX A;  5E18 F;  1VF9 A;  3BTI A;  5LHI A;  2Y31 A;  1Z6R A;  3RZD J;  1ZLJ A;  1G3S A;  4LLG F;  3BG7 A;  3P9C A;  1QHH D;  5B3S H;  1OIS A;  1TWA J;  1POG A;  3ELK A;  4IXA A;  1IXC A;  2JTV A;  2W85 A;  4ZDP A;  1T33 A;  2DI3 A;  4O6J A;  2XB0 X;  2ISZ A;  1DGW Y;  2FBI A;  4P9F A;  4EJV A;  2OQG A;  5HLI A;  3LL7 A;  2KP6 A;  3CCE I;  4HQE A;  2M1B A;  4IOA F;  4BEH B;  2EV0 A;  2BY3 A;  2ZME A;  1HKS A;  1TNS A;  4BDY A;  4IJA A;  1DP7 P;  3E5X A;  4CXF A;  4XM3 A;  3PNV A;  2HZD A;  2DOA A;  3OY9 A;  1BOB A;  3VPR A;  1JUS A;  4P1W A;  4FAS D;  2X1D A;  2VKE A;  2CO5 A;  1YJN I;  4FTH A;  3EUH C;  1H0M A;  1HA8 A;  5F64 A;  5D5V B;  2M34 A;  2UV1 A;  3VOD A;  2JSP A;  3PNY A;  4R8H A;  2PMZ N;  2VJ5 A;  1BC8 C;  1R5G A;  1XCB A;  5CVR A;  4OIR F;  2P81 A;  1IRF A;  5D5W B;  2M8E A;  1Y8Q B;  3KX2 A;  5B1B H;  4XL9 A;  1SMT A;  3HZJ A;  5LRR A;  2MFZ A;  4U87 A;  2R5Z B;  3PQK A;  3KLO A;  4LOC A;  2L7M P;  1PUF B;  2R7Z J;  3A0H C;  4A5N A;  3SJM A;  2JN6 A;  3TDU C;  5LD2 C;  2V9P A;  2VJI A;  2F2E A;  3BJ6 A;  4DJA A;  1VQ4 I;  5IPA A;  2XPV A;  2FF4 A;  3ABK H;  2DMQ A;  2M8G X;  2F4M B;  3QPT A;  2VC1 A;  1KU7 A;  3HRT A;  1QRY A;  2IS1 A;  2EFP A;  1TWF J;  4I99 C;  3DU5 A;  4G6D A;  3ZOB A;  2F5V A;  1G8X A;  1RC9 A;  4XBF A;  2G0E A;  2LNB A;  5CVU A;  1R1T A;  5HDK A;  3IKT A;  2Y75 A;  4BXX J;  3E3V A;  1HF0 A;  1X19 A;  2B0L A;  2O03 A;  3LFU A;  3TED A;  2BW3 A;  2NS7 A;  4G6T B;  5DUI A;  1WFX A;  5FD5 A;  4B47 A;  1ZR4 A;  1E3H A;  2P7V B;  3W2V A;  3KYC B;  5M3F J;  1PVE A;  2O9L A;  4YIR X;  4MQ9 F;  5FJ8 J;  3CCR I;  2DPD A;  1HXD A;  1R58 A;  4E7I A;  2L01 A;  1RZ4 A;  3P9I A;  3K10 A;  4XON A;  3G1L A;  1WJC A;  2M9H A;  4PGH A;  3GLL A;  1UEL B;  2CJJ A;  3MCZ A;  3HUG B;  4HLY A;  2R7R A;  4X6A J;  4M3E A;  4Y3O A;  3L9F A;  3OYL A;  3S15 J;  4YII A;  3OR2 C;  4AID A;  4FT8 A;  2LOO A;  4BXU A;  1C0W A;  3H0G J;  4I76 A;  1Z05 A;  2ZXW H;  2ZXI A;  4GDF A;  3ZMS A;  3BR5 A;  3DV8 A;  3SEZ A;  4C3H J;  2XAS A;  5KAF C;  5K5O A;  4FE4 A;  2DJN A;  4U0V A;  4HQM A;  1EH7 A;  3G1O A;  4AYB A;  3N97 A;  2DFE A;  1YS7 A;  3I0T A;  1FMW A;  4EM0 B;  1YRN A;  5GTH C;  3GZN B;  3MKW B;  2XSD C;  3I9V 2;  1A36 A;  2EIN H;  1FSE A;  3V8K A;  5FO5 A;  1U3E M;  1MMA A;  2W4S A;  3FDY A;  3OWT A;  4QPO A;  3GTQ J;  1FIA A;  2E60 A;  3JW4 A;  2EFW A;  4XRF A;  1O3R A;  3M9A A;  1XTA A;  3WE2 A;  5J4Y A;  5LLQ A;  2W25 A;  3NAR A;  3BR6 A;  1BC7 C;  3JAM Z;  3UR3 C;  3Q9S A;  5ERI A;  5IT3 A;  1NG6 A;  2A69 F;  2XSJ C;  2A3S A;  4A93 J;  4G7H F;  3JRD A;  3KP5 A;  4G8X A;  2HYF A;  1OCT C;  2QA4 I;  4J00 A;  1MBF A;  5CVV A;  1ETW A;  5A2Q K;  3RQI A;  3WTX C;  1JHH A;  2PFB A;  4JK1 X;  2DT5 A;  4OWR B;  3BDD A;  3AAF A;  1WPK A;  3OIQ A;  1JT6 A;  3SXY A;  4GYI A;  1MIJ A;  3DEU A;  1U5T B;  2IS4 A;  2FA5 A;  5HS7 A;  4ZYE A;  2Y30 A;  3HKZ N;  3HB9 A;  2AQE A;  3AKZ A;  3DBH B;  4BH9 A;  3HOX J;  1N78 A;  1D1A A;  2ADU A;  4OMZ A;  2BY2 A;  1PP8 F;  2CSO A;  4L5J A;  3K70 D;  4ZZD A;  4AIJ A;  3FWE A;  3D0S A;  4KIG A;  1ORK A;  2LG4 A;  2LH9 A;  2DXI A;  2TCT A;  4L9T A;  3CUO A;  3V8J A;  4OU0 A;  3WU0 A;  1LFU P;  2P5K A;  2GIZ A;  2BY0 A;  3WOD F;  1B8I B;  3BZK A;  3MKZ A;  2ID6 A;  3M1E A;  1IRZ A;  3HOS A;  2R5Y B;  3BCB A;  4D5F A;  3OSF A;  1ONV A;  2KIM A;  3SEQ A;  2MH9 A;  2HQN A;  3I4P A;  4B1R A;  1ETY A;  3CME I;  3AG3 H;  4RDU A;  3OL4 A;  2CW0 F;  2GA1 A;  2P5V A;  4HLX A;  2CQX A;  3ZMD A;  4Y52 J;  5JR3 A;  4XKV A;  4GRI A;  3ULQ B;  1WZ2 A;  1YO5 C;  2N8G A;  3GTP J;  1WCM J;  3OYI A;  3DLL F;  2V4J C;  3JSO A;  1LB2 A;  4AU7 A;  4P5O A;  2A6T A;  3FBI B;  3BWG A;  3DF8 A;  3CCS I;  3F6O A;  2E1M C;  4L9J A;  1YW7 A;  1D8J A;  1ZKG A;  2VI6 A;  1TBX A;  4B3X A;  1HKT A;  2HU9 A;  4RB3 C;  4ENJ A;  2IBD A;  3QPS A;  4AYB N;  3M8J A;  1Y1V J;  4A3F J;  4QWQ A;  4ITV A;  1KYZ A;  2CG4 A;  2LRD A;  2Y9Y A;  3RZO J;  2D2W A;  2X4H A;  4B8X A;  2DMU A;  3WTY C;  2L9R A;  3L09 A;  3P7N A;  2RAE A;  2IAI A;  3I56 I;  1VQ8 I;  1B1B A;  2H09 A;  5EGO B;  5HLH A;  2HKX A;  4LK1 F;  2JA7 J;  1W7P A;  4V2F A;  4BQA A;  3PSF A;  3BOQ A;  3U1D A;  2ACJ A;  2L4A A;  2NS0 A;  3MN2 A;  1OPC A;  3LSH A;  9ANT A;  1T2K A;  1Y0U A;  2VKH A;  1I6X A;  2IGO A;  4IEJ A;  5KHD A;  2FJ1 A;  1WVR A;  3F6V A;  4BY1 J;  1QVT A;  1K78 B;  5EG0 B;  1P92 A;  4KIF A;  3H92 A;  1B4A A;  2XGX A;  4XKC A;  1IF1 A;  2ZNY A;  4MTE A;  1RKW A;  1GXQ A;  2DAO A;  5B1A H;  1GV5 A;  2Q2E A;  3Q3S A;  2UXN A;  2DT6 A;  1LFB A;  3F23 A;  3TDZ C;  1A35 A;  1DPU A;  5FLM J;  4D1Q A;  4HYE A;  3PIO F;  3HGY A;  3BC8 A;  4AM3 A;  2WAF A;  3SZG A;  3LSI A;  1JKQ C;  1GLN A;  1UHS A;  3KZY A;  1FTZ A;  3QAH A;  4CO8 A;  1FBS A;  2CQK A;  1GT0 C;  1YLF A;  3G73 A;  2P7C B;  4HDV A;  1S5L C;  1R9T J;  2PBI A;  4AIH A;  1FYK A;  2O61 A;  2RV8 A;  3S2H J;  2DOD A;  1ZAR A;  2VBZ A;  5L3G A;  1P2F A;  4BE0 A;  1BR1 A;  5TIS C;  2FD5 A;  4MHG A;  3TP0 A;  3VEP A;  1SD4 A;  3HKZ A;  4WK8 F;  4E7H A;  4C2T A;  4OIQ F;  4XN0 A;  4XLC A;  5H6R A;  4HZF A;  1ODD A;  2KIQ A;  3L2W A;  4A3J J;  1H88 C;  5IYB J;  5J4V A;  5CVJ A;  5E20 A;  2HOS A;  4XRM A;  3WTT C;  1S9H A;  1V5F A;  4CZC A;  1W1W E;  1AHD P;  2XF6 A;  4B3A A;  3DBR B;  4HV6 A;  1VQ7 I;  3K69 A;  1EH8 A;  3GBG A;  1Z3Y A;  2QYO A;  1MH3 A;  5GPA A;  2L3D A;  1PUE E;  1FOK A;  4UVA A;  4Q4Z F;  4CSW A;  2EIJ H;  2M0M A;  3WTS C;  4RA2 A;  5DS9 A;  1FYM A;  3JSP A;  2DW4 A;  2JA6 J;  3BY6 A;  5DM6 F;  5F6F A;  3OR1 C;  2HOA A;  2OZ6 A;  1ETK A;  4XLH A;  3W6J B;  1GVD A;  2XGD A;  2W1O A;  5F1J A;  3TW7 A;  1JKO C;  2CW7 A;  1UG2 A;  5F1R A;  1I50 J;  2ZBK A;  5D5U B;  2E1C A;  3H36 A;  3LNQ A;  3JRH A;  5M3M J;  2XAF A;  5AIQ A;  3K4L A;  2QUF A;  4B43 A;  2BGC A;  4UNO A;  1SMY F;  1U5T C;  1KYW A;  3M3Y J;  3VDX A;  4MO7 A;  4UB8 C;  2HVR A;  1MJB A;  2KIU A;  1H8A C;  5LFA A;  2DFH A;  1HLV A;  2IGM A;  2R7D A;  4UXN A;  2CW8 A;  1O3T A;  3CD6 I;  3HEF A;  3SQN A;  3A01 A;  1Q1V A;  3C2G A;  2B63 J;  3PO2 J;  3B73 A;  1OMI A;  3U9G A;  3DKY A;  1P7J A;  2IVM A;  3LSJ A;  4BYY A;  2CWE A;  2UWM A;  3K2A A;  2AQF A;  3HIF A;  4L9V A;  2VJJ A;  4XIC A;  2K40 A;  4A0Z A;  4AD9 A;  1BI3 A;  2HDW A;  3ZMV A;  1MSF C;  3TO6 A;  3F22 A;  2OA4 A;  1X3U A;  3GTO J;  5E3M A;  1YOV B;  1W7P B;  5DV5 A;  5DTD A;  1K4T A;  1OCR H;  4XR6 A;  3SFI A;  2H1K A;  4XLF A;  5HNF A;  1GXP A;  1ETV A;  1RI7 A;  1REP C;  1K4S A;  2X48 A;  3CJR B;  3OOP A;  2G7H A;  3Q9V A;  4XN3 A;  2IRF G;  3FM5 A;  2JSC A;  2K85 A;  2GOX B;  3TOA A;  1WJB A;  3FM3 A;  4LIT A;  2OQR A;  1WWX A;  1HC8 A;  2DYR H;  4N9I A;  4ZDO A;  3KP7 A;  3RPU D;  1W7P D;  4S0H B;  2VBW A;  2ZXH A;  3GCM A;  3WU1 B;  4GYG A;  4KYW A;  1KZH A;  1L0O C;  1R1U A;  1WJ5 A;  2QQB A;  4C3J J;  1F5T A;  3P5J A;  3G1M A;  1IG7 A;  4ZYG A;  4UB6 C;  4IOC F;  1FX7 A;  2L5Q A;  2LYC A;  3RI4 A;  3QOE A;  4KMF A;  3ZR8 X;  3EYI A;  2W7N A;  1Z77 A;  2VQC A;  2V6C A;  1FLI A;  2R4G A;  1JHF A;  3NEU A;  5F27 A;  4BBR J;  1HW2 A;  2KZV A;  2JVH A;  3I71 A;  4DNC A;  3M8F A;  1RNL A;  2LC2 A;  4M74 A;  5GTI C;  2CH0 A;  1V54 H;  2UXX A;  5BOX A;  2WA0 A;  2VIX A;  3S3N A;  2DU9 A;  4BGD A;  3ABL H;  3NRV A;  5J40 A;  4CA0 A;  2XGE A;  4D7M A;  2MA3 A;  4UVB A;  4BAC A;  1T56 A;  4ZDL A;  3HYI A;  2HPI A;  4E4H A;  2B7E A;  3E5U A;  5JVG F;  4ZYH A;  3J7A O;  4EGZ A;  3L00 A;  3FMR A;  3K1M A;  5IP7 J;  1N77 A;  2ISY A;  5FKL A;  3VWB A;  5J8F A;  3O8G A;  1EKE A;  1HW1 A;  2W48 A;  4BQN A;  2XAH A;  4ZZL A;  4HDU A;  4YFK F;  1WH5 A;  1GUU A;  3KIO A;  2CV1 A;  2STT A;  2VQL A;  3KEO A;  1PDN C;  2K7L A;  1H9G A;  3CC4 I;  3ERM A;  3H5N A;  4JP0 A;  4A6E A;  4UY8 I;  5BPD A;  3ZQQ A;  2HQA A;  2L54 A;  2R92 J;  1MSE C;  3KZI C;  3GXO A;  4F55 A;  1JI8 A;  3FKJ A;  3OS0 A;  3KZZ A;  2OU2 A;  2H94 A;  2W24 A;  1ZGA A;  2DDB A;  4HX4 A;  3HTS B;  3LA7 A;  2FU4 A;  3Q0V A;  2HPM A;  2H8R A;  3MKY B;  3ZGK A;  3HBL A;  4II3 A;  1OJL A;  2KHM A;  3QOP A;  2JQ7 A;  1A6I A;  2WAQ A;  3L2V A;  4XLP F;  1J7K A;  5D6E A;  3F8B A;  1G2H A;  4Y4R A;  1W4M A;  2YU9 J;  3I64 A;  1IXR C;  3I59 A;  3S1R J;  2CYY A;  5FRO A;  1P4A A;  5D4S A;  2RRE A;  4EJU A;  2KDO A;  2BW3 B;  2QZ8 A;  4M3F A;  1XX5 A;  3OV8 A;  2DFF A;  4L9N A;  4DYQ A;  3CMY A;  3EDP A;  2LR8 A;  5J3L A;  5H2F C;  2KL4 A;  2HDC A;  4E7S A;  2FQ3 A;  1WGX A;  2VN2 A;  3R61 A;  3GTG J;  2MAB A;  3G4S I;  3OSG A;  2KRH A;  5LHH A;  2L7Z A;  1N25 A;  2GXG A;  1OYW A;  1JXS A;  3RJP A;  4NQW B;  2ZJQ F;  1ZRC A;  3CCY A;  1U2W A;  2PMZ A;  2FNA A;  3PFI A;  3R60 A;  3QWL A;  4B09 A;  2R5Y A;  5IYD J;  2ZC2 A;  4EGY A;  5ICG A;  2L9S A;  3S32 A;  1SFX A;  1LDK B;  1XD7 A;  3DTK A;  5BNG A;  3L2U A;  3ABM H;  1ITY A;  5IY5 H;  3H9G A;  2A5Y B;  2HQ5 A;  1UFM A;  3C2B A;  2DA4 A;  3H1C A;  3LSR A;  1E2X A;  1XCV A;  1IO2 A;  3D5R C;  4L5E A;  1B9M A;  4QTR A;  1LKX A;  2R7U A;  4X1E A;  3Q0W A;  1UHM A;  2LTP A;  3CMA I;  2E71 A;  1ZGJ A;  3ZQ7 A;  3ZMZ A;  2FML A;  2XKP A;  3PL8 A;  2LBF B;  3O2P E;  1MH4 A;  1BI1 A;  1LE8 B;  2V1X A;  3H5A A;  4BE1 A;  3UKG A;  3DPT A;  1SD6 A;  5K7Z A;  2CV2 A;  2DTZ A;  5L3F A;  4MEY F;  2YX4 A;  2VOO A;  3U21 A;  4G94 A;  2RNJ A;  4YFX F;  2HYJ A;  2E35 A;  4EM2 A;  1ZRE A;  4FX4 A;  3QRF F;  2F4O B;  3BJO A;  3JCU C;  4XQF A;  1MND A;  5E3N A;  1X4O A;  2DYS H;  4U7B A;  4M3G A;  5CPR B;  1S3J A;  2ELH A;  2DCE A;  2KPM A;  2M45 A;  4J01 A;  2V26 A;  1V55 H;  3AFH A;  5DM7 F;  1A6Q A;  1FBU A;  3AG2 H;  3W2A A;  1BW6 A;  3FIW A;  3K0L A;  2XF7 A;  3G6E I;  2O7O A;  1ZH5 A;  3OYH A;  2HS5 A;  4N4N B;  2HNH A;  2XF5 A;  1P9Q C;  2XAQ A;  5F04 A;  1NK2 P;  3DEW A;  4UUT A;  3CCJ I;  1RIO H;  3BPV A;  1R6R A;  1TL8 A;  4UV9 A;  2VXD A;  2KT0 A;  1O4X A;  1UCR A;  5E1Z B;  1SFE A;  2IW5 A;  2DJI A;  2BVL A;  4PSW A;  5C4X J;  2DOF A;  4CCN A;  3CUQ B;  4A2U A;  3CTA A;  5CLS A;  3PFY A;  4IHS A;  1HOM A;  1T95 A;  2RDP A;  4MEX F;  2X6O A;  4M72 A;  1BIA A;  1YIT I;  3B02 A;  3E97 A;  4R79 A;  1QA6 A;  1HCR A;  2RN7 A;  5FRM A;  2OCC H;  2MW8 A;  4U0Y A;  1VFC A;  2H8W A;  3FZV A;  2O8X A;  2ZB9 A;  4IO9 F;  2WY8 Q;  1R4N B;  1JKR C;  2BVM A;  3IKV A;  3KE2 A;  2VBY A;  1R4M B;  1CF7 A;  2OD5 A;  5IP9 J;  2WAQ N;  5JI6 A;  5KCM A;  5L3C A;  4U7D A;  5FRN A;  3K4C A;  4EM1 A;  3M1C A;  3H0D A;  1ULY A;  4A12 A;  1B8I A;  2A6H F;  2ESN A;  5K1Y A;  3ZPL A;  2M87 A;  3B6C A;  2IPQ X;  3F8N A;  4RGR A;  4KIS A;  2QVO A;  2V1N A;  1RUO A;  2X6Y A;  2XC7 A;  4NUB A;  4KNY A;  3FXM A;  5C4J J;  1ZR2 A;  1SAN A;  1TQM A;  1X1P A;  1YTY A;  1JJ8 C;  1I39 A;  2CUZ A;  3PQJ A;  4YG2 F;  3PNT A;  3J7A Y;  1IV6 A;  5EEH A;  3SDG A;  5D8L B;  3FMQ A;  4DIQ A;  2EB7 A;  3FXR A;  1VQP I;  4WXD A;  1U9O A;  2IJL A;  2JA5 J;  1X3Z B;  2ZSI B;  4GGG A;  1MKM A;  3TBI A;  3ESW B;  3TKY A;  3E6M A;  2MD0 A;  1YYV A;  2QM3 A;  2E34 A;  1VQL I;  5EZG A;  1WI9 A;  3BTC A;  3H5R A;  1JGG A;  4WXC A;  1O7L A;  2GAU A;  2LF7 A;  4CUG A;  4Y15 A;  3DQV C;  4NNJ A;  4IX7 A;  4AWX B;  1OQY A;  2FOW A;  3F21 A;  3GME A;  3WU2 C;  3OYM A;  2I10 A;  1RES A;  2E5N A;  4ETS A;  2Z33 A;  3E5Q A;  2M4K A;  2RNG A;  1YX3 A;  3MD2 A;  4PJL A;  1QBJ A;  1EJ9 A;  2NOJ B;  5BS6 A;  1U8R A;  3Q5F A;  1ZG5 A;  1O3S A;  3DP7 A;  3R0A A;  2YU3 A;  2QEX I;  1W36 D;  1BJA A;  3HDD A;  4MIM A;  1DU6 A;  3VOE A;  3HSE A;  4MGR A;  4A0Y A;  2EFO A;  2CUF A;  5E1X A;  4CCJ A;  2M7B A;  3ABT A;  4G7Z F;  2QSH X;  1FBQ A;  3TOB A;  2R5Z A;  2M7A A;  3S17 J;  3D1N I;  2M0C A;  1WJF A;  2X1C A;  2A61 A;  3HPH A;  4PDK A;  4UVC A;  3LSG A;  4RAY A;  3GFI A;  5LHG A;  2FNP A;  4M9S A;  3OYA A;  3NWS A;  3CO6 C;  2NS8 A;  1I1G A;  1JJ6 C;  2HOE A;  3VB2 A;  3LQQ A;  2LLK A;  3J81 Z;  3F72 A;  1AKH B;  3H35 A;  1D0Y A;  2GA2 A;  3BG9 A;  1F9N A;  1IJW C;  2VON A;  4LGW A;  1RRJ A;  2K9Q A;  4ANJ A;  4C3I J;  3PUB A;  4KN4 X;  2G9W A;  3ECH A;  1AKH A;  4F7Z A;  2WAE A;  4HEA 2;  3PM1 A;  3CZ6 A;  2NVX J;  2Q0O A;  4PCQ A;  4BAY A;  4LIU A;  4I7H A;  2DDA A;  3TQN A;  4BDZ A;  4KA4 A;  2H27 A;  2ID3 A;  3E0J B;  1O57 A;  3MEX A;  4UUS A;  2PMU A;  4F3Q A;  2H6C A;  1MJA A;  1QPI A;  5AIP A;  1IDY A;  2ELK A;  4HW0 A;  2QBY B;  1TWH J;  4YFN F;  4LIV A;  2G7U A;  3UNG C;  2E2I J;  5E1W A;  3MVP A;  2LDU A;  5TJJ A;  3JTG A;  2XPW A;  1YIO A;  2DA3 A;  3JAM K;  2C6Y A;  2Y48 A;  4P55 A;  5DCM B;  5KNL A;  4M71 A;  2X85 A;  4DZP A;  3I5U A;  2W82 A;  2DO7 A;  2Y2Z A;  3V7S A;  2EZL A;  1SFO J;  1E3O C;  2L9V A;  4YIF A;  1D1B A;  2CQN A;  4Q47 A;  4XSX F;  5M5Y J;  3ISP A;  4E7L A;  1TW3 A;  4E6K G;  3QU6 A;  1JE8 A;  3IHU A;  3O3K A;  1IAW A;  2EIK H;  2WC2 A;  1X58 A;  5LGT A;  2VT3 A;  4II2 A;  4RGS A;  2ZJP F;  1W0U A;  1STZ A;  2PN6 A;  2E7X A;  2KJB A;  4XRS A;  3C18 A;  1ZG3 A;  2NVT J;  4G12 A;  1LE8 A;  1TC3 C;  5FKO A;  4WCG A;  4H4K C;  5LGN A;  1APL C;  5BMZ A;  1XGS A;  5HDG A;  2W84 A;  2BZT A;  2WBM A;  3LFK A;  2E19 A;  4XK4 A;  2DN0 A;  1QVU A;  4AVP A;  3S8P A;  1I3A A;  2IEK A;  3IH4 A;  2IP2 A;  4I02 A;  4DYR A;  2JT1 A;  2M3A A;  3WGH A;  2P6S A;  1FP2 A;  4RGX A;  1VQ5 I;  1ZYR F;  2BOL A;  4PJJ A;  3I58 A;  1NHA A;  1D1C A;  1E0E A;  2K4B A;  4BUP A;  3BP8 A;  2XDV A;  3CCL I;  2FEZ A;  4M6V A;  3S2D J;  3QYF A;  3PSI A;  2EQR A;  2FX0 A;  2ZO4 A;  1HW5 A;  3HTU A;  2E1O A;  2NOG A;  3DXJ F;  3IP4 B;  1VQ9 I;  5IT9 K;  1P7I A;  1FC3 A;  1KU3 A;  4ESB A;  3OIP A;  1QHG A;  3CJN A;  2HZT A;  3IC7 A;  3QYB A;  2MD5 A;  1J2X A;  3A2K A;  1OR7 A;  3R4K A;  1R00 A;  3HXL A;  4PZJ A;  4EVI A;  3DTE A;  2R93 J;  2KRC A;  3EUH A;  4IHX A;  1TP4 A;  1IN7 A;  4O5V A;  1GDT A;  1B9N A;  2EA2 A;  4C9Y A;  2K86 A;  2IGN A;  3H3U A;  3GEZ A;  2MGQ A;  1XPX A;  2Z1D A;  5CJ9 A;  3L2Q A;  3CF2 A;  4W97 A;  4IPA A;  1F36 A;  3RYP A;  2V79 A;  2LKP A;  1RR8 C;  4HA8 A;  1XGN A;  3AL0 C;  3H9J A;  3ZMU A;  2CS3 A;  3MFK A;  3CO7 C;  1VQM I;  3HJE A;  4MQV A;  1SVL A;  4DOZ A;  3DKX A;  1V5G A;  3W6K B;  3V7R A;  1PYV A;  1CQT A;  3IRR A;  3RDI A;  2KMU A;  4AIK A;  1R7J A;  1WQ2 A;  5J6X A;  1X1B A;  4MNU A;  3H3V K;  1OCZ H;  1W5T A;  2ZJ2 A;  4A3M J;  5ICF A;  3CC2 I;  4M9Z A;  1WHU A;  1R5I D;  3IH2 A;  3L2C A;  4PFO A;  2R7T A;  5IOZ A;  2YS9 A;  1J75 A;  3E1S A;  2D45 A;  4I0A A;  3BQY A;  4M6X A;  4QLC U;  3PO3 J;  2XAU A;  2E2J J;  1D0Z A;  4NDL A;  4RB2 C;  1S7A A;  2R7X A;  1IZ1 A;  2OV7 A;  4EV0 A;  2JA8 J;  1EH6 A;  1XSX A;  1HSJ A;  5HNH A;  3WHC A;  2GM4 A;  1QNT A;  1PUF A;  4KT6 A;  2EWN A;  4AUX A;  2GIV A;  1KQ8 A;  3F8C A;  3S1N J;  2TRT A;  4DGW B;  4KIB A;  1YG2 A;  2QQA A;  2ZSH B;  3P9K A;  3MQ0 A;  1U5T A;  2F5D A;  4PJ0 C;  1FIP A;  4IRI A;  3ZQG A;  3QQA A;  5B5E C;  3S3O A;  1LFP A;  4ZTJ A;  2VOD A;  2Y69 H;  1XN7 A;  1EV7 A;  2ME0 A;  2QGU A;  5EDN A;  3KYL A;  1MBE A;  4F52 A;  4KIT B;  2HEO A;  1T39 A;  2HQR A;  3LA2 A;  4Z2Y A;  1VTN C;  4RGU A;  2VT2 A;  4E7J A;  1MGT A;  3CDI A;  3L2R A;  3T0Y A;  4CDG A;  4PUS A;  5FD6 A;  4JX5 A;  2K9S A;  1I1S A;  1TLH B;  3DPL C;  5DDG A;  4BE2 A;  4EMS A;  1IRX A;  3VFZ A;  2FRH A;  5K5Q A;  1MJ9 A;  1X2M A;  2M30 A;  3G3Z A;  3QYE A;  4BHB A;  2P6T A;  2LY9 A;  5DD4 A;  1TW2 A;  1U6G A;  4R1H A;  1X2N A;  3HUG A;  4DW6 A;  4JYK A;  1K78 A;  4JBA A;  3DWL E;  2MYS A;  4OIN F;  1YW9 A;  2AHQ A;  3FXJ A;  1FMV A;  2DLL A;  2EZH A;  4CCL A;  2EIM H;  3AG4 H;  5HS8 A;  2R3S A;  1NK3 P;  2BXY A;  4CZZ A;  4V2G A;  1Z7U A;  2Z16 A;  5LGU A;  4CCK A;  3WTW C;  1SEU A;  1JGS A;  1LVK A;  2L02 A;  2Y0S A;  3OIO A;  1YX5 A;  3X2Q H;  3IRQ A;  3VSL A;  1LQ1 A;  3GTJ J;  1E3P A;  1ETO A;  3HHG A;  3GVA A;  2JJ7 A;  3FXL A;  2MSY A;  2Z3Y A;  3ZCO A;  4RAG A;  5CYV A;  3LSK A;  2YUS A;  3WHB A;  3ASN H;  3ASO H;  3GO5 A;  3S14 J;  3ZQH A;  4B48 A;  4D0P A;  4Z6Y A;  3SYT A;  1F4K A;  3K4K A;  1SD7 A;  1MDM B;  1YE9 A;  1XB4 A;  2QWW A;  3R0J A;  4A3G J;  2E1M B;  3OS1 A;  3HSF A;  1MMN A;  1U8B A;  3CCM I;  4ENK A;  3K4N A;  3E6D A;  1G3T A;  3BQZ A;  4X0G A;  3PIP F;  2ECB A;  4KMU X;  1T98 A;  3ZMT A;  4LG3 A;  5E3O A;  5BPI A;  1NG7 A;  2PMH A;  4ESF A;  3IAM 2;  2Y0M A;  3A4C A;  2A68 F;  3G71 I;  1RKT A;  3LAP A;  2QSF X;  4UV8 A;  2IXS A;  2CMP A;  3TO7 A;  1AWC A;  5HVQ C;  4CHU A;  1WKM A;  2RQP A;  5HDN A;  2MH2 A;  3LSP A;  1IW7 F;  1TQP A;  2BE5 F;  2XHK A;  1I6H J;  1UB9 A;  2IGK A;  2LVS A;  2K5C A;  2Z99 A;  2JRM A;  2XVC A;  4HV5 A;  1IDZ A;  2EV6 A;  2QQ9 A;  3RKY A;  4A3D J;  1BJZ A;  1U0J A; 
#chains in the Genus database with same CATH homology
 1ETW A;  3S1Q J;  3RQI A;  1VI0 A;  3BR1 A;  2D5V A;  2E2H J;  2HYJ A;  1WPK A;  4J19 A;  1FEX A;  2DA5 A;  4QSH A;  1JT6 A;  3TW6 A;  5E3N A;  2Y30 A;  4M3G A;  3HKZ N;  3HB9 A;  1U78 A;  1RPW A;  1GV2 A;  5FKK A;  5C44 J;  3HOX J;  1BW6 A;  3FIW A;  2NVQ J;  4BBS J;  2O7O A;  4FIS A;  5F08 A;  4CYC B;  1W0T A;  2EH3 A;  5F04 A;  2CUE A;  1NK2 P;  4UUT A;  2JMW A;  3DEW A;  1ORK A;  3S16 J;  1U9N A;  2TCT A;  3JRC A;  2KT0 A;  1O4X A;  1ZQ3 P;  1LFU P;  5C4X J;  1B8I B;  3BG5 A;  3ZQF A;  2WB1 N;  2ID6 A;  2DMT A;  3BR3 A;  1IRZ A;  2R5Y B;  1HOM A;  4D5F A;  3OSF A;  3RKQ A;  2X6O A;  2DA1 A;  4B1R A;  1A5J A;  1ETY A;  2HI3 A;  1HCR A;  4RDU A;  2MW8 A;  1VFC A;  2CQX A;  2KDZ A;  4Y52 J;  2ZB9 A;  1JKR C;  1MBK A;  1ZK8 A;  2OF7 A;  2N8G A;  5HOD A;  1WCM J;  4A3I J;  3GTP J;  1WH7 A;  4IHW A;  3ZQI A;  1WI3 A;  4M3B A;  5IP9 J;  2WAQ N;  5M5W J;  1RET A;  4ABZ A;  1B8I A;  4B4C A;  3LOC A;  2XPU A;  3B6C A;  5JLX A;  1TWC J;  1ZKG A;  3FK6 A;  2VI6 A;  1K61 A;  2XB5 A;  1D5Y A;  1Y1W J;  5GPC A;  2IBD A;  3QPS A;  1NTC A;  2L7F P;  1Y1V J;  4AYB N;  4A3F J;  5C4J J;  1ZR2 A;  1YRN B;  1SAN A;  2XRL A;  2Y9Y A;  1JJ8 C;  1HDP A;  3ZQL A;  4GFB A;  3RZO J;  4XRS G;  3I4N J;  2CRG A;  2DMU A;  1B72 B;  1IV6 A;  2L9R A;  2O8K A;  2RAE A;  2IAI A;  3SDG A;  5EGO B;  2EZI A;  2JA7 J;  2XGC A;  1U9O A;  5FKM A;  3CDL A;  4V2F A;  2JA5 J;  1EF4 A;  4IHX A;  3IH3 A;  5IYC J;  5EZG A;  4A3C J;  3MN2 A;  4UUS B;  9ANT A;  3BTC A;  1JUP A;  1JGG A;  4IEJ A;  2JK3 A;  1JTX A;  5EEA A;  4A3B J;  2FJ1 A;  1H89 C;  4BY1 J;  1QVT A;  5EG0 B;  2I10 A;  4MFD A;  1RES A;  1JKP C;  4DYC A;  2DA7 A;  1RKW A;  5EYR A;  4XID A;  1GV5 A;  3Q3S A;  1LFB A;  2OPT A;  3GTM J;  5FLM J;  1MBJ A;  2Y9Z A;  4W1U A;  3HGY A;  1HDD C;  3HOV J;  3HDD A;  4MIM A;  1DU6 A;  3HOW J;  2CUF A;  2Y0S N;  1JKQ C;  2M2E A;  3HM5 A;  1UHS A;  2R5Z A;  1F43 A;  3Q0U A;  5IP6 A;  4BKX A;  3CQZ J;  1FTZ A;  3JRF A;  3S17 J;  3D1N I;  2LFB A;  2M0C A;  3I4M J;  1JT0 A;  3S1M J;  1GT0 C;  2VUM J;  3LSG A;  1R9T J;  3S2H J;  1JTY A;  3F0C A;  5JLW A;  3K7A J;  2FD5 A;  2NS8 A;  1JJ6 C;  3TP0 A;  2LLK A;  5J1R A;  5FLV A;  1AKH B;  4IHY A;  3BG9 A;  2K9N A;  3FKI J;  3TP3 A;  1Z0X A;  1IJW C;  3HOY J;  1XS9 A;  2K9Q A;  4A3J J;  1H88 C;  5IYB J;  4C3I J;  2VPR A;  3W6V A;  1B72 A;  2HOS A;  4XRM A;  1AHD P;  5C3E J;  4B3A A;  4A69 C;  2QF7 A;  1AKH A;  2COB A;  5EGO A;  3PM1 A;  2NVX J;  3HOU J;  3FIS A;  5K7F A;  1MBG A;  3GBG A;  5GPA A;  1MH3 A;  4DZJ A;  2ID3 A;  1ETQ A;  5J1Y A;  3E7L A;  3BR2 A;  4UUS A;  5DS9 A;  1BA5 A;  1QPI A;  2JA6 J;  1XG1 A;  5F0H A;  1IDY A;  2ELK A;  1TWH J;  2ECC A;  2HOA A;  1ETK A;  2E2I J;  3MVP A;  1GVD A;  4D7N A;  4EEF G;  2XGD A;  2XPW A;  1BL0 A;  2DA3 A;  2LP0 A;  3BTL A;  5F1J A;  3TW7 A;  2X9D A;  1JKO C;  4DZP A;  1UG2 A;  3JR9 A;  2Y2Z A;  1I50 J;  1S7E A;  1OFC X;  2EZL A;  4D5C A;  3IV5 A;  1SFO J;  4I6Z A;  4C2M J;  1E3O C;  3LNQ A;  3JRH A;  5M3M J;  5M5Y J;  3JRI A;  4MLO A;  4A3L J;  3M3Y J;  1X58 A;  1TWG J;  3GTL J;  4MO7 A;  1W0U A;  1H8A C;  3JRB A;  2LKX A;  4XRS A;  1I3Q J;  2NVT J;  4G12 A;  4JX6 A;  1HLV A;  1LE8 A;  1TC3 C;  5FKO A;  2HOT A;  3HEF A;  1APL C;  3A01 A;  1Q1V A;  2QCO A;  2B63 J;  1FJL A;  3PO2 J;  2EBI A;  4RBO A;  4XK4 A;  2E19 A;  2DN0 A;  1JUM A;  1QVU A;  1P7J A;  3LSJ A;  4FE7 A;  2IEK A;  5F0C A;  3IH4 A;  3BTJ A;  3K2A A;  4DYR A;  2GLO A;  4XIC A;  2K40 A;  5IOY A;  4A3K J;  2GBY A;  5GP9 A;  1MSF C;  3HOZ J;  3GTO J;  5E3M A;  5DTD A;  2LK2 A;  4M6V A;  1IGN A;  2AO9 A;  2HXI A;  3S2D J;  2EQR A;  2FX0 A;  1XC5 A;  3SFI A;  2H1K A;  2E1O A;  4QIW N;  2NOG A;  1ETV A;  2JWT A;  2WV1 A;  1P7I A;  4M3D A;  1BW5 A;  2X48 A;  3A01 B;  3JRG A;  1ZGW A;  3M4O J;  1K83 J;  1MNM C;  1RR7 A;  5EF6 A;  3HGG A;  2DMN A;  1ENH A;  2R93 J;  3O8H A;  1MBH A;  1VND A;  4S0H B;  3A03 A;  1GDT A;  2VKV A;  2ME6 A;  2MGQ A;  4C3J J;  4W97 A;  4CYC A;  1VF9 A;  1F36 A;  3ZQC A;  3G1M A;  1IG7 A;  3BTI A;  2Y31 A;  3RZD J;  1UMQ A;  4HNV A;  1TWA J;  5M5X J;  1POG A;  1Z77 A;  4FCY A;  3BR0 A;  1IUF A;  2R0Q C;  1T33 A;  1CQT A;  2XB0 X;  5F27 A;  4BBR J;  2DA6 A;  3JRE A;  5J1U A;  3QPL A;  3H3V K;  4AC0 A;  4A3M J;  2HDD A;  3IH2 A;  3FK7 A;  5IOZ A;  2XGE A;  2YS9 A;  4D7M A;  2DA2 A;  3BQY A;  1T56 A;  3VPR A;  1JUS A;  1IC8 A;  3PO3 J;  2E2J J;  2VKE A;  4NDL A;  3NAU A;  5F0F A;  4FTH A;  2JA8 J;  2M34 A;  2LD5 A;  2DMP A;  3WHC A;  2CU7 A;  2GM4 A;  2PMZ N;  1PUF A;  5IP7 J;  3DCF A;  4AUX A;  2P81 A;  5FKL A;  3O8G A;  3S1N J;  2TRT A;  2W48 A;  4BY7 J;  1WH5 A;  2R5Z B;  1GUU A;  4LOC A;  1PUF B;  1FIP A;  2L7M P;  2R7Z J;  3ZQG A;  3SJM A;  2JN6 A;  3QQA A;  5EZH A;  2ME0 A;  4JP0 A;  5IPA A;  5EDN A;  1MBE A;  2R92 J;  1MSE C;  2XPV A;  3A02 A;  1ETX A;  2DMQ A;  2CQQ A;  2M8G X;  1ZTR A;  1QRY A;  1TWF J;  4JX5 A;  2K9S A;  3ZOB A;  1AU7 A;  3Q0V A;  2H8R A;  3JRA A;  2L0K A;  2G0E A;  3HBL A;  1X2M A;  1OJL A;  4BXX J;  1HF0 A;  1A6I A;  3TED A;  2NS7 A;  1G2H A;  2LY9 A;  3BT9 A;  1ZR4 A;  2YU9 J;  3OOU A;  4Y7N J;  5M3F J;  1X2N A;  3B6A A;  4JYK A;  4DW6 A;  3S1R J;  2O9L A;  5FJ8 J;  3L1P A;  5FKN A;  5E3L A;  2AHQ A;  2NVY J;  3G1L A;  2M9H A;  4M3F A;  2CJJ A;  2EZH A;  4DYQ A;  4X6A J;  3CMY A;  2LR8 A;  4M3E A;  3S15 J;  5J3L A;  1NK3 P;  2EZK A;  4MFE A;  4V2G A;  5K7H A;  3H0G J;  4I76 A;  1WGX A;  3OIO A;  3GTG J;  3GTK J;  3OSG A;  3GTJ J;  3BR5 A;  2L7Z A;  1ETO A;  4C3H J;  2MG4 A;  4FE4 A;  2DJN A;  1FTT A;  2JJ7 A;  2MSY A;  3G1O A;  3WHB A;  2YUS A;  3CCY A;  1YRN A;  3S14 J;  3ZQH A;  5IYD J;  2R5Y A;  2XSD C;  4IHV A;  3MKL A;  5BNG A;  1ITY A;  4A3G J;  1U8B A;  2FQ4 A;  2HQ5 A;  3C2B A;  5EG0 A;  3BQZ A;  2DA4 A;  3LSR A;  2ECB A;  4L5E A;  5E3O A;  3GTQ J;  4QTR A;  1FIA A;  4X1E A;  3Q0W A;  2LTP A;  1DU0 A;  4JX4 A;  3NAR A;  3BR6 A;  1RKT A;  1MH4 A;  1LE8 B;  3BG3 A;  3UKG A;  1OCP A;  5K7Z A;  3LSP A;  4A93 J;  3JRD A;  1I6H J;  2LVS A;  2DTZ A;  1OCT C;  1IDZ A;  2HXO A;  1MBF A;  4A3D J;  1BJZ A;  4A3E J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...