4BY1J

Elongating rna polymerase ii-bye1 tld complex soaked with ampcpp
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
65
structure length
65
Chain Sequence
MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
publication title Structures of RNA Polymerase II Complexes with Bye1, a Chromatin-Binding Phf3/Dido1 Homologue
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
total genus 16
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2013-07-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF01194 RNA_pol_N RNA polymerases N / 8 kDa subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 4by1J00
4D7NA 2E2HJ 1ETXA 4HNVA 3MKLA 3S16J 5E3OA 2EH3A 5IYBJ 9ANTA 1YRNA 4A3FJ 1F36A 2JK3A 5EGOA 4ABZA 5M5WJ 3B6AA 4V2GA 3GBGA 2DMQA 4IHYA 5JLXA 1ETKA 5EDNA 1FJLA 1IRZA 2CJJA 1U9OA 2XB5A 5F27A 1T56A 2LTPA 1JGGA 1FIPA 1RESA 4FCYA 5JLWA 1GV2A 2N8GA 3FK7A 4BKXA 5IP7J 2DMNA 3SDGA 1MH4A 2DA6A 3BR3A 3MN2A 3WHBA 4BY7J 3GTGJ 2CUEA 4EEFG 4CYCA 2COBA 1DU0A 2NOGA 3C2BA 2LK2A 1JUMA 1S7EA 1AKHB 4A3CJ 4AC0A 3BTCA 5F0CA 4BY1J 1IDZA 2WB1N 2EZHA 1U8BA 1GT0C 2R5YB 2DA2A 3HOZJ 1TWGJ 3DCFA 1HOMA 1XG1A 2R0QC 4A3JJ 1BJZA 2K9SA 2G0EA 3M4OJ 1HDPA 3ZQLA 2L7MP 2DA5A 3Q0UA 4A3BJ 3MVPA 5M5YJ 2K9NA 1B8IB 3QPLA 4A3IJ 4BXXJ 5EG0B 2DTZA 4L5EA 1MSEC 3FK6A 1TWAJ 1MNMC 3G1OA 2HOAA 2R5YA 1X2NA 4M6VA 3IH3A 1FEXA 3BT9A 2EQRA 3OIOA 4C3IJ 1NK3P 4XRMA 1W0TA 1F43A 5DS9A 5BNGA 2X48A 4B3AA 2HYJA 1B8IA 1K83J 5EG0A 4UUTA 3HEFA 3GTQJ 5E3NA 2E1OA 3O8GA 3ZQIA 2HQ5A 4DYRA 5FLVA 5EZGA 3HOVJ 1BL0A 2DA3A 1I6HJ 2TCTA 1MBGA 1APLC 2CU7A 5FJ8J 2DA1A 5C4XJ 1MH3A 2DA7A 3JRGA 5K7HA 4JX6A 3LSGA 4M3GA 5HODA 3LSRA 2VUMJ 1ZK8A 2LY9A 3BR0A 3RZDJ 1IUFA 5FKOA 1JUSA 3QPSA 4D5CA 2OPTA 3B6CA 4JP0A 1HLVA 5C4JJ 1U9NA 5IP9J 1Z0XA 2FQ4A 1VFCA 5E3MA 2JA6J 3IH2A 1LFBA 3JRCA 3HGYA 4MO7A 3ZQFA 2M0CA 5J3LA 2Y0SN 4AUXA 3TW6A 1IV6A 4V2FA 3BR2A 3M3YJ 2JJ7A 2JWTA 3HB9A 2H1KA 5IYDJ 3LSJA 5GPAA 1ORKA 3LNQA 2VI6A 1X58A 1FTZA 3GTOJ 2L9RA 3JRAA 2WAQN 1TWHJ 1VI0A 2ECBA 3HM5A 3DEWA 2ELKA 3SJMA 1Z77A 2FD5A 4AYBN 2L7ZA 4IHVA 3OSFA 3BG3A 1O4XA 3FISA 2CRGA 2HXIA 2ID3A 3GTPJ 3HDDA 3CDLA 3HBLA 1E3OC 2NVYJ 3BR6A 4C3JJ 1LFUP 5IYCJ 1RKTA 3BR1A 3S1QJ 2AHQA 4XRSA 1FIAA 2K40A 3A01B 3GTKJ 3S14J 5DTDA 3HOYJ 4D5FA 3VPRA 3S2HJ 1BA5A 2AO9A 4XIDA 2DA4A 3S2DJ 2LP0A 1XS9A 4A3EJ 1MBJA 3JREA 3JRIA 3S1NJ 2L7FP 3SFIA 1MBHA 3RQIA 2M2EA 1B72B 2R5ZB 2O9LA 4X6AJ 1JJ6C 2R7ZJ 1WPKA 3BTJA 2NVXJ 4X1EA 4D7MA 1MSFC 5K7FA 2ME6A 1ETVA 1AKHA 3GTJJ 3LSPA 3H3VK 1QVTA 1IC8A 1ZR2A 3A01A 2DMPA 1Y1WJ 1JTYA 1NK2P 2JA7J 2HI3A 2HOTA 4G12A 1WI3A 3CMYA 5M3FJ 2KDZA 3Q0WA 2NS8A 2LR8A 2CQQA 4FISA 2DJNA 1UG2A 1ZTRA 3HOWJ 1MBKA 4A69C 1QPIA 1NTCA 2R5ZA 1DU6A 2I10A 4C3HJ 3S15J 1UHSA 2MW8A 3A02A 3D1NI 3F0CA 4A3LJ 1TC3C 1XC5A 5F0FA 1TWFJ 1OFCX 2LFBA 4MLOA 3HOXJ 2MGQA 3ZQCA 4XK4A 1A5JA 1G2HA 2E19A 3IH4A 5FLMJ 2GBYA 2HOSA 2R92J 3S1RJ 2EZLA 4M3EA 3S17J 3HOUJ 1HCRA 2IBDA 3JRHA 1UMQA 3BQZA 1SANA 2DN0A 2JA5J 2XGCA 3RZOJ 4M3BA 5IP6A 1ZR4A 3BG9A 4FTHA 2XPWA 1WGXA 1FTTA 1HDDC 1GV5A 5C3EJ 4NDLA 3G1LA 1POGA 1X2MA 4Y7NJ 1JTXA 1JUPA 2MG4A 3TEDA 1ZQ3P 4GFBA 2M34A 3JRBA 2XGEA 1BW6A 5M5XJ 2HDDA 2QF7A 3CQZJ 2X9DA 1A6IA 2Y2ZA 2TRTA 2ZB9A 3BR5A 3E7LA 4Y52J 2VKEA 1OCPA 2FJ1A 2O8KA 4CYCB 1ENHA 1GVDA 4A3DJ 3Q0VA 1I50J 1IJWC 5K7ZA 1MBEA 1IGNA 1YRNB 1R9TJ 4FE4A 3L1PA 4C2MJ 1GDTA 4JYKA 4A3KJ 3UKGA 1AU7A 2JMWA 2LLKA 1T33A 4DZJA 5FKMA 5C44J 2R93J 1Y1VJ 2WV1A 2E2JJ 2Y30A 1BW5A 3OSGA 1HF0A 2B63J 2VKVA 5J1RA 3HKZN 4J19A 3NAUA 1ITYA 1P7IA 2Y9YA 4LOCA 2GM4A 2M9HA 5FKKA 2Y9ZA 2FX0A 4A3MJ 5EEAA 5EYRA 5F04A 5IOYA 4DYQA 3IV5A 4FE7A 2CQXA 2NVTJ 2YUSA 2L0KA 2KT0A 1PUFB 1LE8B 1ZGWA 1ETQA 2X6OA 2XB0X 2NS7A 3JR9A 2K9QA 1GUUA 3K2AA 4JX5A 4A93J 1ETWA 2E2IJ 5J1YA 3PM1A 3GTLJ 3HGGA 2IAIA 4I6ZA 1WCMJ 4MFDA 3G1MA 3W6VA 2YU9J 2LKXA 1WH5A 2IEKA 4XRSG 4W97A 2XGDA 4UUSB 1I3QJ 5IPAA 2QCOA 1TWCJ 4M3DA 4DZPA 4RDUA 3TP0A 3K7AJ 5FKLA 1PUFA 1LE8A 3I4MJ 5GP9A 3LOCA 5IOZA 3TW7A 1IG7A 1JT6A 3S1MJ 1B72A 5J1UA 1IDYA 2LD5A 3I4NJ 3O8HA 2Y31A 1VNDA 4B4CA 1JJ8C 3ZQGA 4BBRJ 4I76A 2XRLA 1ETYA 4UUSA 4RBOA 2VPRA 2YS9A 2JA8J 2PMZN 4MFEA 3BTLA 4QTRA 2RAEA 3ZOBA 5F08A 3Q3SA 2D5VA 4M3FA 3WHCA 1U78A 3TP3A 3ZQHA 5M3MJ 1QVUA 5E3LA 2MSYA 4XICA 1W0UA 3BTIA 5EF6A 4MIMA 2GLOA 3PO2J 3JRDA 2ID6A 5GPCA 1AHDP 4A3GJ 3OOUA 1JKOC 1OCTC 3A03A 1WH7A 1H89C 1H88C 1JT0A 3NARA 1JKQC 4W1UA 2ECCA 2CUFA 5EZHA 1OJLA 2ME0A 1RKWA 1D5YA 4QSHA 3GTMJ 3BQYA 2XSDC 2EZKA 1JKPC 3PO3J 2M8GX 2DMUA 2EBIA 4S0HB 1P7JA 3JRFA 1K61A 2LVSA 2W48A 1ETOA 1SFOJ 4DYCA 1QRYA 3BG5A 1RETA 2XPUA 1JKRC 1RPWA 5F1JA 1H8AC 2OF7A 2EZIA 3H0GJ 4IHXA 3FIWA 1RR7A 2XPVA 4BBSJ 2HXOA 5FKNA 3CCYA 2JN6A 4QIWN 2H8RA 3FKIJ 5EGOB 1Q1VA 1MBFA 1CQTA 1EF4A 2O7OA 3QQAA 4B1RA 2NVQJ 5F0HA 4IEJA 3RKQA 1VF9A 2DMTA 4IHWA 2P81A 1ZKGA 4DW6A 4JX4A
chains in the Genus database with same CATH superfamily
1YX5A 1ETXA 4HNVA 2FF4A 3MKLA 5E3OA 5CQGA 3OYFA 3BJ6A 3M7GA 4A3FJ 1E3HA 3WTYC 3KX2A 5M5WJ 3RPUD 3B6AA 4YRVA 4LIUA 4V2GA 1UELB 2W4SA 1HSTA 4G7OF 4M72A 2FBIA 1LDDA 1X19A 1FJLA 1IRZA 2CJJA 1MIJA 1U9OA 4UB8C 2LF8A 2LTPA 1JGGA 2OQGA 4QLCU 1RESA 2VLAA 2EFPA 2N8GA 2IP2A 4BKXA 1ON2A 2DA6A 3I4PA 4M9SA 2RQQA 1PUEE 3GTGJ 3CJRB 2OV7A 2IJLA 4M74A 4IJAA 4MHGA 1MDMA 1E3PA 2ZSHB 2KLOA 4PGHA 3H9GA 1Y0NA 3W2WA 2O03A 3K4MA 4HX7A 1TWGJ 1HOMA 1DGRM 1XG1A 3GWZA 4RB0A 1XSXA 4A3JJ 1XMKA 4XLNF 4XLHA 3CMEI 4U7DA 2K9SA 1EH7A 1LDJA 3FXKA 1WJBA 4JK1X 2WAFA 2L7MP 1OYYA 1RRJA 4A3BJ 2HYFA 4LK0F 4AD9A 3MVPA 3K70D 2EFQA 2E60A 2EFOA 5HS8A 2VC0A 1Q1HA 1TT0A 3G1OA 1Y8RB 2HOAA 3GZNB 4OU0A 2L02A 1S6LA 4BQNA 2GOXB 2COMA 4OINF 1FEXA 4RGXA 5BS6A 2VB6A 3UNGC 3LQQA 5F64A 2LBFB 1OCOH 4LG0A 4C3IJ 1W0TA 1F43A 5BNGA 3PQJA 4B3AA 2AQFA 2HYJA 1B8IA 1HQCA 4XKBA 1KA8A 2MABA 5EG0A 2QKMB 3GTQJ 1HXDA 4UNOA 3ABKH 1DPRA 4DYRA 1Z3YA 1W36D 3GVAA 3PUBA 1I6HJ 3PQKA 3FXOA 1APLC 2DA1A 1FOXA 3QYEA 1MH3A 4WWCA 2DFHA 1ZH5A 2V26A 4JX6A 3LSGA 3U9GA 5HODA 3LSRA 2R7UA 4MTDA 1P4AA 2LY9A 3M9AA 3WTXC 1UFMA 4Q5SF 3BROA 1LDKB 2FBHA 4MQ9F 3IAM2 5H6RA 1YITI 4HPQA 1ERDA 2MH2A 4IF4A 1TZLA 2FQ4A 2X6YA 3IP4B 3CP2A 5K5OA 1BBYA 2Y0SA 3JRCA 2NNYA 2M0CA 4KN4X 3B73A 4KIGA 1R00A 2X85A 2Q1ZB 5JHUA 2NOJB 3PNVA 3J80K 2FRHA 3GEZA 2LREA 3E5XA 3CDIA 3BR2A 2P6TA 1D1BA 3ZPLA 3HB9A 2H1KA 4ESJA 1O3RA 2CUZA 4XR6A 2R7WA 3LSJA 4PFPA 4I02A 1ORKA 1JXSA 2VI6A 1HBXG 1V54H 2BXZA 3GTOJ 4OAZA 4PJLA 4UVAA 2WAQN 2IGKA 4L9JA 5JHFA 1R58A 3IUOA 2XF6A 3SJMA 1S3JA 1Z77A 2FD5A 3IWZA 4AYBN 2K27A 2LOOA 2W24A 3I0TA 3OSFA 4YIRX 2CMPA 3E6CC 5JVTA 1USSA 3S8PA 5DUIA 1KQ8A 3VB2A 3WTTC 1RUNA 1XPXA 1S29A 3HBLA 2XKPA 3BR6A 3KYCB 4C3JJ 1LFUP 2CUJA 3HSEA 3I5UA 1AWCA 1RKTA 2QUFA 3S1QJ 3QODA 3K4CA 1I39A 4P9FA 4CYDA 3A01B 2K40A 3ASNH 3QP6A 3GTKJ 2TDXA 4C30A 5LGUA 4P5OA 3MAJA 2Z2SB 4BE2A 4I99C 1IRXA 1USTA 3S2DJ 3QPTA 1TL8A 4ITVA 4A3EJ 1IF1A 3HUGA 3H9JA 2GOMA 4XLCA 3HRUA 3RQIA 3FDYA 1FC3A 2R5ZB 2DK8A 2ISYA 1R1VA 2EV5A 1J75A 3HC7A 1VQ7I 3JCUC 1S7OA 5HLIA 3RPUA 4D7MA 2VBXA 4RB2C 1MSFC 2ZO4A 3IC7A 4HDUA 3HHGA 1IC8A 1BN5A 3K4NA 3R0JA 1ZR2A 4G94A 5LGNA 2HI3A 4LB5A 4ZYEA 1VQ8I 3CDHA 2GA1A 1XMAA 4UHTA 3DFGA 3K10A 5KCMA 1ZTRA 2DAOA 1U3EM 1MBKA 1ODDA 4CDGA 1YYVA 2EIMH 4ZYGA 3BLYA 4LIVA 2ICWG 3V7SA 1X1DA 4C3HJ 1ULYA 1GVJA 3LSMA 3S15J 2VKHA 1IN7A 1K78A 2K7LA 4KIFA 1CF7B 3HJEA 3D1NI 3SZGA 4F92B 1D3YA 2DQRA 3DU6A 5BQTA 1T39A 4DQ2A 4MLOA 3ZQCA 2HFHA 3WGHA 3HL2A 2QENA 1A5JA 1G2HA 1NG7A 5L3CA 3RTRA 2CW8A 2FXAA 1ZRDA 6PAXA 3S1RJ 4M3EA 4HNUA 5HOOA 1HCRA 3HOUJ 3JRHA 2E1MC 3COAC 1GXPA 3OYHA 3D0SA 3KP5A 1UZCA 4L5JA 5LEJA 2R7TA 3GZ6A 3RZOJ 2VT3A 3KETA 3WTWC 2XPWA 1JGSA 5GADJ 4KITB 1T95A 1YW9A 2EK5A 2MC4A 3V7RA 2LDUA 4ESFA 2IS4A 3BP8A 3LAJA 3QU3A 3I9V2 3DP7A 5FFXA 5J4YA 1O7LA 1IXCA 4HOBA 5FRNA 1FLIA 3P7NA 2KIMA 2LF7A 2MG4A 4BHPA 3AFHA 2E5NA 3TDZC 3ZGKA 1WKMA 4P55A 4GFBA 2Z3YA 1D0YA 1STZA 2EA2A 2LMDA 1B9NA 1Y8QB 3CQZJ 1A6IA 4IRGA 1B9MA 4G8XA 1H0MA 2UUZA 2VONA 1FP1D 5KVRA 1IZ1A 3HSFA 3V4GA 4HSTA 4B48A 1GVDA 1U8RA 3Q0VA 1IJWC 2LRDA 5F6FA 1J09A 1MBEA 3TQNA 2K85A 4BE0A 2E7XA 2KISA 3ESWB 1MJBA 1I6XA 3M8FA 1R9TJ 3V42A 3ZP5A 2JT1A 1GDTA 4JYKA 2PMHA 1D5VA 3KZYA 1WI9A 4XORA 5FROA 1T33A 3GUDA 2YSRA 4DGWB 3MKYB 4B8XA 2R93J 3W6JB 2PEXA 3MQ0A 3GMEA 4Y13A 2Y30A 1FT9A 4IOAF 2XUBA 1Z3XA 1XX5A 1BOAA 2OBPA 1A04A 5L3EA 2L01A 4CGZA 3S32A 3ZXSA 3MWMA 1VTNC 2GM4A 2M9HA 1HKTA 3JAMZ 2EFNA 3E5QA 5EYRA 1FWZA 3IV5A 3L2CA 3HYIA 2CQXA 2DQLA 2W1OA 3BDDA 4RM3A 3DTIA 4ENKA 2JSPA 3VYSB 4M6YA 2IA1A 1ETQA 2V6CA 2R7QA 4QWQA 4XSZF 2XB0X 3OL3A 2K9QA 1GUUA 3LSHA 4JX5A 1ETWA 1T98A 2MLKA 1E0EA 2E2IJ 3A4CA 3GFLA 3JTHA 4HLXA 4MNUA 4XKWA 4MFDA 2LKPA 3TGNA 2ISZA 2KZVA 3W6VA 4PSWA 2VIXA 1ZN2A 2LKXA 3BPXA 4W97A 1PP8F 2RREA 1BC8C 3M8EA 4I01A 2QCOA 4DZPA 1G3YA 3CCEI 4BAYA 1IXSB 1TT5B 1YOVB 4IVNA 1TP4A 2LYCA 1G3WA 2ZJPF 1VQOI 3I4MJ 2YR2A 4HF0A 4AM3A 1IG7A 4Y3OA 3CESA 1SD4A 2UZKA 1FNNA 1U5TC 4ZH4F 4MTEA 3O8HA 1X3WB 4B4CA 4CCJA 1UHWA 2LSOA 3F8BA 4CUGA 3BC8A 5E17F 2BBYA 1OR7A 4I76A 2DJIA 4UUSA 1W5SA 2VPRA 2RQPA 4HLYA 2RNJA 1SC7A 2RAEA 3E3VA 5F08A 2F5CA 3CJQB 3WTVC 2E34A 2BW3B 2EJRA 2H6CA 1QVUA 2GZWA 3MZ8A 2EINH 1BI2A 1UCRA 2OZ6A 4XICA 4N0BA 1EV7A 5EF6A 2KHMA 3CCQI 5D5VB 3WE2A 1FMVA 1SVLA 3PO2J 1AHDP 2PMUA 2WADA 5EJCA 3C2HA 1JKQC 4W1UA 5IT9K 1Z6TA 2ECCA 4A0YA 2CUFA 2MA3A 3FXMA 1OJLA 1RC9A 2ME0A 1D5YA 2D45A 3GTMJ 2XSDC 2IA0A 1WVRA 5LFAA 3CUQA 2RKHA 1X4OA 5EEGA 3MFKA 3Q5FA 1P7JA 1YS7A 3LMMA 1J9IA 1ETOA 5HLGA 2OC6A 5D5WB 1SMTA 3CC7I 5HNHA 4R1HA 4FHTA 1YIJI 2XPUA 2DU9A 3KFWX 4S04A 4NHJA 2OF7A 2DODA 2H8WA 2HDWA 4IHXA 1P6RA 1R22A 5ILUA 2P0WA 3QRFF 1FYKA 1QZYA 3DF8A 4EGZA 3FBIB 1MJ9A 2PX9A 4XKVA 4ESBA 4KN7X 5E1WA 2ZNZA 2JN6A 4X0GA 4QIWN 2H8RA 2EIJH 1TNTA 2K9LA 3FKIJ 3SQNA 1O3TA 5CVIA 1MBFA 4JQFA 2B7EA 2A6TA 2HQAA 3O3KA 5HDGA 3TL4X 4B1RA 4CA0A 4A6DA 4FQGA 1F4KA 2DMTA 1Y6IA 2P81A 2HVRA 4RB1A 4YFNF 4DW6A 2R7RA 2M5WA 1RUOA 3BPVA 1MD0A 9ANTA 4E7KA 1MDMB 3DTKA 3DPTA 4WXDA 2JK3A 4I09A 5EGOA 4ABZA 4JOMA 4NNJA 2DMQA 5JLXA 5EDNA 1IN8A 2XB5A 5F27A 2ZXWH 2DDBA 3LL7A 4NQWA 1FIPA 4E7ZA 4XKCA 1N25A 3WHBA 4BY7J 2CUEA 3M8JA 1BR1A 2WB1A 3DEUA 1T38A 2LK2A 3M07A 2M1BA 3G4SI 5TJJA 5CVRA 4IOCF 5F0CA 1XSDA 1IDZA 3KP7A 2K02A 1LEAA 4RAGA 4YFXF 2EZHA 5CLSA 4LFUA 3LWFA 1MMAA 2DA2A 3IAS2 4PGGA 4ZJZA 4MQVA 1JHFA 1FSHA 3CJNA 4L9VA 3HIFA 2HQRA 4RGRA 1BJZA 3IL2A 3LA3A 4CH7A 1R5ID 2ACJA 2L7KA 2EFWA 2G0EA 2Q2EB 2QQ8A 4XLPF 2A07F 4LG0B 1K4TA 2AQEA 5K5QA 5ILVA 1FZPB 4OAYA 5M5YJ 2K9NA 1W7PB 1B8IB 3N97A 2KMUA 2HYGD 5EG0B 1K6YA 1UG0A 3CCSI 1VQ9I 4RB3C 5GAEJ 2LH9A 2L9NA 4XOPA 3AL0B 2R7VA 2O61A 2BVMA 4HRIA 2EIKH 2VJ5A 4AIJA 2O5RA 3VYUB 2EQRA 4XRMA 1J2XA 2X48A 4Q48A 1R71A 2CW7A 3ZMUA 3J7AY 1R1TA 3HEFA 4BACA 4ENMA 5E3NA 2NXNB 2E1OA 3O8GA 3ZQIA 1K6OA 4CZZA 2HQ5A 5J47A 2D2WA 1VQLI 3HOVJ 4F93B 1WSUA 2QQAA 3WGIA 3K1PA 2CU7A 5FJ8J 5C4XJ 5HDNA 2DA7A 2MD5A 5K7HA 1EJ9A 2ESHA 2PQ8A 1J59A 3KLOA 2KP6A 1QBJA 4BEHB 1W5CC 3RZDJ 1SD6A 2VE8A 2QWWA 5CPRB 3QPSA 4NBQA 1RNLA 3HOSA 1MW7A 3V8LA 3OYLA 2NRAC 2OPTA 2QVOA 2X0LA 4JP0A 1OMIA 3MD2A 5C4JJ 1U9NA 2VQCA 1XTAA 5E3MA 4RLFA 3BG6A 1LFBA 4IXAA 3DKWA 1SEUA 3HGYA 3HG9A 4MO7A 3HSRA 3RQ4A 3F72A 2Y0SN 4AUXA 3TW6A 2A5YB 4D0PA 3VWBA 2B0LA 4V2FA 4HF2A 3M3YJ 1ZELA 3FXQA 3I54A 3I64A 2L3DA 3K9TA 1LPQA 5IYDJ 3DLLF 5JVGF 3CO7C 4ZZDA 2JRTA 5FB2A 2QSGX 5KK1A 3G73A 3FXRA 1ZHFA 2FA5A 3VYTB 1MMSA 3JRAA 1TWHJ 2ECBA 3DEWA 4ZYDA 1RI7A 2ETHA 1REPC 5CVJA 1FY7A 2YU3A 2X6XA 2CV1A 1BR2A 3F8CA 3HUGB 1SAUA 4PJ0C 3BG3A 1O4XA 3QOPA 2CRGA 3OYGA 2DPDA 2R3SA 3K2ZA 3KLNA 3J7ZI 4A6EA 3WU0A 1I5ZA 2ELHA 1ZAOA 5BPDA 2CWEA 1WJCA 3BR1A 3EYYA 5FLXK 1GLNA 4BDZA 2BY1A 1FIAA 2VOOA 2VJIA 3IKTA 3HOYJ 3LFKA 1A36A 2F4MB 1BA5A 4XIDA 2LP0A 1XS9A 1MBJA 2VQGA 3S3NA 3S1NJ 3GO5A 3SFIA 2M2EA 2O9LA 3CCJI 1H9GA 4LG3A 1WPKA 4G9YA 1JJ6C 1V5FA 1YE9A 4WXHA 2PBIA 3QPHA 2L9VA 4EJWA 1K78B 2DO7A 4KT5C 1ETVA 3L00A 3GTJJ 1QVTA 1UB9A 3DEEA 1IXRC 1JTYA 3GXOA 2NS0A 4KA4A 1WI3A 3C7JA 1QA6A 3IKVA 1G6NA 2CQQA 2DJNA 2NS8A 3Q0WA 4FISA 1UG2A 4XM3A 3HOWJ 5H20A 5BOXA 2ADUA 5LRSA 2CFOA 2Q2EA 2A68F 3CLOA 3HXLA 1DU6A 3BZ6A 1QO0D 4LITA 5FFZA 1UHSA 2WWYA 2VT2A 4UB6C 1OLTA 1W7PA 3F23A 3OYIA 3ZMSA 4XL9A 2WY8Q 1XC5A 1OCZH 5F0FA 1TWFJ 2BY2A 2HKOA 2JA2A 3PL8A 3TO7A 3C18A 2CQKA 4KDPA 1EH8A 4EJVA 5LEKA 2P6SA 4I0AA 2EZLA 2H09A 4KJZA 4GO1A 3EUHA 1D8KA 2MD0A 3RIRA 4BUPA 3G2BA 2L4MA 2FNPA 5D4RA 3ELKA 2AS5F 1UJ8A 1SANA 2CS3A 2DN0A 3OMYA 3EETA 3KEQA 4RAFA 1CGPA 2BVLA 4FTHA 5A2QZ 2X1CA 1SAXA 3ABMH 4HX4A 1ZLJA 2DI3A 2GAUA 1FYLA 5C3EJ 2QBYA 3HTSB 3LFUA 3G1LA 3LQRA 5L3GA 3PIPF 1WJDA 1UAAA 3KZIC 3IRRA 3K4BA 1ZQ3P 2EPFA 1EKEA 5K5RA 2M34A 3AG3H 3JRBA 2XAJA 4BEHA 5M5XJ 5AONA 2QF7A 3LSIA 1V5GA 2TRTA 2Y2ZA 4M71A 3E7LA 3ZR8X 4CCKA 2IA2A 1L3LA 2LKSA 3ZQQA 1OCPA 4KYWA 4R8HA 1BOBA 4CYCB 3FXUA 1FPQA 3WTSC 2EA4A 2H27A 1R36A 1Z6RA 5D6FA 1YRNB 3W6KB 3DV8A 1KU2A 5TRDA 1XDUA 4L9NA 3LSKA 5DCFA 1Y39A 4E7HA 2JPBA 4A3KJ 2YPRA 3DTEA 2LLKA 5FKMA 1ZREA 2WV1A 2E2JJ 2WAEA 1FP2A 2Y75A 1G4DA 1OPCA 5J1RA 3SZPA 2GA2A 4I7HA 2V4JC 3SXYA 3CCMI 4LOCA 3AG1H 4CCLA 3JSPA 5TISC 3GF2A 3I53A 3TO9A 5EEAA 2PLYA 5IOYA 1FX7A 3G6EI 2L0KA 1QNTA 2EWNA 2QA4I 3EPZA 1KU3A 4J00A 2V7FA 2V9KA 1FOKA 3QYBA 1SD5A 1ZGWA 1DPUA 2NS7A 1HW2A 4L5IA 4WX9A 3U1KA 1SFUA 5D6EA 4AIHA 5J1YA 1YIOA 2JPCA 2DDAA 4XRFA 2B9SA 2PG4A 3HGGA 1VQ5I 4I6ZA 3OYKA 3BJAA 2GQQA 3U1DA 2Z9OA 2IEKA 4CICA 1K7AA 1IO2A 3VYRB 2RVCA 4UUSB 1I3QJ 5IPAA 3L09A 3FM5A 1PUFA 4EJOA 1P92A 1VQKI 3MEXA 2NNNA 4N9HA 1LE8A 5B66C 1BI1A 5IOZA 3TW7A 4BJ5C 3G71I 2DYSH 3HPGA 5E20A 3S1MJ 3QU6A 2V1UA 4YELA 4U0WA 5DCMA 1JJ8C 2K3FA 2XRNA 1IAWA 2PMZA 1ETYA 2HWVA 4C9YA 1FYMA 2BEOA 1PP7U 3BTLA 2O6GE 2A61A 2VL8A 3ZOBA 4E4HA 4YIFA 2VXZA 3J81Z 3Q3SA 2D5VA 3D5RC 1U78A 1HC8A 4U0YA 3G3ZA 1YLFA 2VKDA 3CUOA 1E2XA 2HS5A 4GYIA 4AU7A 1Z91A 2ZC2A 3CUQB 2JUGA 1U5TA 1SVOA 4ASNA 4DJAA 2MSYA 4IRHA 1R6RA 4YG2F 4Z2YA 3TOBA 3VDXA 2FSWA 2IXSA 4QPOA 3JRDA 2E1NA 1QHGA 2ZMEC 2W85A 2XAFA 3OOUA 1QZZA 1S9HA 3N05A 3T8RA 3NARA 2BGCA 4PSXA 2W25A 5B1AH 1YX3A 3FZVA 2J5PA 4F91B 5B3SH 2FOKA 2PJRA 4AWXB 2XV4S 1Y0UA 5EZHA 2HU9A 4A12A 3OY9A 3PO3J 2DMUA 2EBIA 4BHBA 4NB5A 4NUBA 2LVSA 1BM9A 1SFOJ 4DYCA 2C6YA 3BG5A 2QEXI 1RETA 3SZTA 2BY3A 3WODF 5KAIC 2OTJI 3R6SA 4Y17A 5ICEA 3H0GJ 4CCNA 3WU2C 3ONQA 2PI0A 4KUMA 2JSCA 3RYRA 4PK4A 1Z9CA 2HXOA 5FKNA 3C1DA 1JHHA 1R7JA 2RC4A 2VJ4A 1S5LC 2LG4A 3BOQA 3J7AO 5J8FA 2BXYA 3T1BA 3J7YJ 2VBWA 4I98B 2W7NA 2HKXA 5EGOB 1X3UA 1G8XA 3FF5A 4A2UA 1R49A 1WJ5A 4DNCA 1ZARA 2OAZA 3FMQA 3I58A 1EF4A 2CQ7A 4Y15A 3QQAA 2Z33A 2NVQJ 3H3ZA 2VODA 4XONA 3RKQA 4IPAA 4NQWB 3WG7H 4A0ZA 1U2WA 3GCMA 5CJ9A 4IHWA 4UUVA 3DPLC 3H3UA 2WBMA 4JX4A 4CYCA 3H0DA 2FU4A 4D7NA 2QQ9A 4G6QA 2ZJQF 2A6HF 2F48A 1ZRCA 3W3CA 3S16J 2OJED 5GTHC 2EH3A 4BH9A 1YRNA 2P7VB 4O3MA 1F36A 2UXNA 5E79C 3S3MA 4KMUX 2W84A 3GBGA 3VODA 4N4NB 4BXFA 4IHYA 1ETKA 3KP2A 2FE3A 2RNGA 2ZXHA 1YS6A 4LK1F 4B43A 1H9TA 5J4VA 4EV0A 1T56A 1D0ZA 1MJAA 2KIUA 2UV1A 5JLWA 4FCYA 3K4LA 3FK7A 3EYIA 2KIFA 4A5MA 3A0BC 3I71A 4N4OB 5IP7J 3OIPA 3SDGA 1MH4A 4EEFG 4XMYA 1SVMA 4LJZF 3C2BA 2K9MA 1S7EA 4EVIA 3QOEA 5F1RA 4AC0A 1AKHB 4A3CJ 4CXFA 3BTCA 3NEUA 4BY1J 2WB1N 2Y48A 3GFJA 1YTYA 5J8CA 1GT0C 3GLLA 3HOZJ 1QHHD 4CCOA 3RYPA 4EM0B 2DT6A 1OCRH 4HDVA 1I1SA 4LD5A 3OR1C 4BNCA 4M9XA 1XB4A 2R0QC 5D8KB 5ICFA 3M4OJ 1X1CA 3ZQLA 2JTVA 3KIOA 4ZTJA 3ABTA 1BC7C 1I27A 1FMWA 1HW1A 4A3IJ 4BXXJ 1IN5A 2CV0A 1IUYA 2DTZA 3GX4X 1MSEC 1N75A 4KICA 3LA7A 1TWAJ 1WQ2A 2ZNYA 1MNMC 2E36A 4GDFA 2R5YA 5H2FC 1MKMA 1WWXA 1TW2A 3OS0A 2XC7A 1X2NA 3O6BB 2DXIA 2E1CA 4IQJA 2F5FA 3IH3A 2BYVE 3ZMDA 4RGUA 4IZZA 4G7HF 3PSIA 2KDOA 3GYHX 2A05A 3K70C 1RR8C 2NAZA 4AIKA 5DD8A 2M8EA 5KNLA 1KZHA 4D9JA 2F5EA 3E6BA 1SFKA 4UUTA 1GHCA 1ZLKA 3DPUA 1T0FC 2M4KA 3QP5A 4H0EA 4IKFA 2WV0A 3FWEA 5FLVA 5TGTA 2GIVA 2TCTA 1MBGA 2HNHA 4GRIA 4WXCA 2CV2A 2V9PA 3JRGA 2XHKA 5EEHA 4M3GA 2VUMJ 1BR4A 1LUJB 3BR0A 2I5UA 1MZBA 1XGMA 4TV7A 1JUSA 5DDGA 4C2UA 4EJUA 4D5CA 5IT9Z 1O3QA 3HTUA 3V8KA 2X51A 4ENNA 4IRIA 4EATA 5IP9J 3F8FA 2JA6J 3IH2A 4FETA 3BY6A 1B6AA 4RAZA 5J3LA 3BCAA 2OCCH 2G7HA 3WTUC 4PZJA 2JWTA 4BGDA 3ERMA 1FOYA 3HRMA 3REOA 3IRQA 1RIOH 2VQLA 2RGVA 2BY0A 4HZFA 4G7ZF 1M1EB 3H35A 5GPAA 2I8DA 2JZYA 1X58A 5JFRA 2ELJA 2H94A 1P2FA 1FTZA 3Q9SA 2V79A 4WK8F 1W5TA 1QQIA 4G6TB 1VI0A 2CO5A 2OUMA 4ZDOA 1T8IA 4YFKF 1YJNI 3OYDA 3SDBA 4IHVA 3GLXA 2Z1DA 4ZDLA 2ID3A 2K4BA 3ABUA 4R79A 3GTPJ 3HDDA 3CDLA 3HHHA 1F5TA 1IN4A 3NQOA 3OYEA 2AHQA 1LNWA 1YFHA 1HKSA 4IX7A 3BCBA 2OU2A 3S14J 5DTDA 3VPRA 3S2HJ 5CKTA 1IRGA 4XOTA 2M7BA 2HOEA 4BXUA 2AO9A 1DP3A 2DA4A 4L9TA 2CSOA 1KONA 5FD5A 1X1BA 2GXGA 2DFFA 1X1PA 4YEJA 3JREA 4NC7A 3ZMZA 1MBHA 4I0BA 4HAMA 3A0HC 4PJJA 2R7ZJ 3BTJA 3OYAA 4X1EA 2BHZA 5K7FA 5FO5A 2ME6A 4LLLA 2L9SA 1I1GA 3ML6A 1AKHA 3H3VK 1OCCH 1J7KA 3NRVA 2WC2A 1TBXA 4PJNA 1Y1WJ 3EUKL 3CCRI 3I59B 2ZSIB 2HOTA 3S3OA 3K1MA 5ICGA 2V9VA 1D8JA 3CMYA 4FX4A 1PDNC 3T8TA 2KDZA 2LR8A 3R0AA 1VQ6I 2MFZA 2P7CB 2CFXA 2QQBA 2HVSA 3ERED 4GYGA 1WJFA 2I10A 1KQ9A 2RV8A 1U6GA 4UVBA 3LA2A 5LHIA 1WHUA 4G6DA 4AIDA 1WJEA 2XAHA 2EV0A 3F0CA 1BIBA 4A3LJ 1ZRFA 2CGPA 4II2A 1QZEA 3KCCA 3L9FA 3KZZA 1OFCX 4XN3A 4HX8A 2QSHX 1XD7A 4XK4A 4HNTA 2QBYB 3OS2A 2E19A 2DOAA 4EQQA 5FLMJ 3PJRA 2BV6A 5E1XA 4F55A 2HOSA 1HW5A 2GXAA 3ABLH 2IT0A 2E1MB 3CCLI 3DKYA 2F5VA 4BE1A 5KHDA 4CHUA 1G59A 3S17J 3RPQA 2IBDA 3K4KA 3KEOA 1UMQA 2ZCWA 3R60A 2M87A 2G7UA 5JR3A 4XLAA 4XQFA 4U88A 5J6XA 4I2OA 2XGCA 2Q8KA 2EILH 3CF2A 1ZR4A 4E70A 1MMGA 1X4PA 5E18F 2OD5A 2Y69H 3E6MA 1FTTA 1HDDC 2F6CA 4OWRB 1GV5A 4NDLA 5GAGJ 2R7FA 2IGMA 4BS9A 4KMFA 1L0OC 3TEDA 1ZYRF 3MMYB 1LKXA 3V7CA 2XVCA 1BI0A 3ASOH 1I3AA 2YX4A 1Z7UA 1BW6A 2NVUB 3PFYA 1V3FA 3BR5A 2ZB9A 2WA0A 2VKEA 4HQMA 2VN2A 4Y52J 1J5YA 3BZKA 3WGGA 5BPIA 2O8KA 5L3BA 1BIAA 1YHQI 1ENHA 2JVGA 4PCQA 1P4WA 3F8NA 1IGNA 1SMYF 4E7SA 3CLQA 4FE4A 2VXDA 4C2MJ 4ENJA 1YI2I 4V19K 3KE2A 2OA4A 2JMWA 2XF7A 4UV9A 3MKWB 1OYIA 2HZTA 1JE8A 2F4OB 1Y1VJ 5IY5H 5B1BH 1ON1A 1TQMA 5LGTA 4HEA2 2H1LA 3S93A 3TDUC 3HKZA 2JQ7A 1LVAA 2VKVA 1WRJA 3CZ6A 3GZ5A 3L2WA 4J19A 3NAUA 1P7IA 1QGPA 4JBAA 3F21A 2Y9ZA 2L5QA 1FOWA 4A3MJ 1PYVA 1XGOA 3PNTA 1VZ0A 3TBIA 3K69A 3OR2C 2NVTJ 5LD2C 2YUSA 1PUFB 2KT0A 1R5HA 1V4RA 1LE8B 2A3SA 2X6OA 1LEBA 3OYBA 3K2AA 1N78A 5LRRA 3OYJA 2GXBA 4KFCA 3U21A 1Z05A 5E8IA 3PM1A 3OS1A 4HQEA 4U87A 1NHAA 2IAIA 2VBYA 4AVZA 5DCMB 3G1MA 5FLXZ 3PNYA 2ESNA 2O0YA 5D5XB 4D1QA 2AXTC 2O3FA 2OQRA 5DUKA 2XGDA 4ANJA 2Z5UA 4PUSA 2CYYA 3RCOA 3HRSA 1TWCJ 4M3DA 3U2RA 1YJ9I 1YQAA 4XLFA 2Z99A 3TKYA 4BQOA 1S7AA 3AAFA 3LOCA 2X1DA 3WE3A 5KAFC 1BI3A 1KYZA 1XCBA 1JT6A 1X1AA 1U5TB 2W00A 3KYDB 4ZDPA 5J1UA 3CCVI 2XAQA 1HKQA 3I4NJ 2Y31A 2ZFUA 3ZQGA 4Z6YA 3DKXA 4EM2A 3BJOA 4HSRA 4BBRJ 2BHYA 2ZJ2A 2VE9A 4RBOA 1O57A 1XGNA 2YS9A 2JA8J 2PMZN 3I59A 2HVQA 4MFEA 4PFOA 3I3LA 1R1UA 4H4KC 2PJRB 4M3FA 1PJRA 2J5OA 5AIQA 3ZQHA 5FD6A 3FXJA 5M3MJ 5E3LA 2X4HA 2VPLA 5HNFA 1OKRA 4LLNA 4QPQA 2EB7A 2ZXIA 3I55I 4WF2A 4ZYHA 2R4GA 5GPCA 1JKOC 5LLQA 3TO6A 1WH7A 5HDKA 3KP4A 1H89C 2UWMA 3BZCA 1XDSA 4FASD 4P1WA 3KP3A 5A2QK 2LC2A 1YW8A 3FBNB 3EQLF 2KPMA 2V6EA 2DBBA 4QSHA 3BQYA 4UV8A 1LVKA 2KJBA 1JKPC 2M8GX 2M3AA 5HS9A 4S0HB 3ZMTA 1W1WE 2GIZA 1K61A 3VSLA 2ZMEA 2BOLA 1QRYA 3FX3A 1D1CA 2DLLA 3A1YA 2XDVA 5F1JA 1H8AC 3ZN0A 5J40A 4B44A 4E7LA 3DXJF 1RR7A 2F5DA 2HPIA 3B02A 4NC6A 2XROA 1FBUA 3OYCA 3CCYA 3RKXA 1QU3A 2XKOA 1T08B 3JSOA 2EV6A 4S05A 2V1NA 4KT6A 3BWGA 1OISA 1KU9A 4P9UA 2PJPA 3J80Z 2A5WA 1ZG3A 3IHUA 1RZ4A 2O7OA 4DBRA 2JVHA 2IS6A 2K3PA 5F0HA 4XSXF 4IEJA 3I56I 1ONVA 2STWA 2R7OA 4HW0A 3PIOF 4ZC3A 4C2TA 4Q4ZF 3PSFA 3RI4A 1R4MB 2E2HJ 3TMOA 4EGYA 5IYBJ 4KIBA 5AIPA 4HV5A 5LBQA 2IS2A 1N77A 3JW4A 3DBLB 5FRMA 5D5UB 2HDCA 4E7IA 3H5RA 2R7SA 2ZBKA 4F7ZA 4RMNA 1P4XA 3L2RA 1T2KA 5LHGA 1GV2A 4UY8I 2QZ8A 1Z21A 2DMNA 1F9NA 3BR3A 3MN2A 2P5VA 4HA8A 5L3FA 2COBA 1DU0A 2NOGA 1ACIA 1XCVA 1F1ZA 1JUMA 3DBHB 1D0XA 1XGSA 3AG4H 2XAUA 1U8BA 2R5YB 4HG2A 3WG9A 3DCFA 1SD7A 2XAGA 3OWTA 3F3XA 3SEZA 1V55H 1DGWY 3DU5A 4F52A 5ICCA 4K2EA 3SEQA 1HDPA 3GFMA 1FBSA 2DA5A 3Q0UA 3CP8A 2Q0OA 2BE5F 2WY7Q 4IHTA 3QPLA 3OV8A 2KJCA 4L5EA 4PDKA 2IRFG 4OMYA 3FK6A 3SFZA 1KYWA 3C2GA 2XF5A 3KYLA 3H5NA 1K79A 1DDNA 1R23A 5HS7A 2PN6A 3J81K 3AL0C 3TOAA 4M6VA 3MZHA 5HLTA 2VC1A 1NG6A 3BT9A 2RN7A 2E5ZA 4FT8A 4E6KG 3OIOA 2KKOA 3QAHA 4DOZA 4GCVA 3FMSA 2MC3A 3PUFA 1NK3P 5DS9A 1LFPA 3CJTB 1YJWI 2DYRH 2XSJC 4OIRF 1Z7LA 2HQNA 2DFIA 3EUHC 2HPMA 1K83J 1KQ0A 1XSVA 3DQVC 4DBQA 2XGXA 2CH0A 1WJAA 4IHSA 4OIOF 1B1BA 5EZGA 4O5VA 4M6XA 4BJTA 3E1SA 4OOIA 2DT7B 3VSKA 1BL0A 2DA3A 3DWLE 3H9QA 2IS1A 4MGRA 1J0RA 2M4GA 4XN0A 2LBFA 5HLHA 3CD6I 2HTSA 3HRTA 1ZK8A 3BG7A 4B09A 2ZKZA 2DW4A 1IUFA 1VQPI 1T0FA 1G3SA 5FKOA 3KP6A 2UXXA 3FHZA 3S2WA 1IV8A 2X1EA 2V1DA 3B6CA 4XBFA 5ERIA 1HLVA 3X2QH 5DV5A 3E0JB 1Z0XA 3QWLA 1HA8A 3ZMVA 2DK5A 1VFCA 3FM3A 1B59A 3W2VA 2LNBA 1QPMA 2JRMA 3ZQFA 2M30A 3IWFA 3R4KA 1ZGAA 3DLAA 3P9KA 1IV6A 4KNYA 2RDPA 2R7DA 1WFXA 3K6GA 3KPHA 2JJ7A 3C3WA 2D1HA 5JI6A 1G3TA 4XLEA 3F6OA 3L2UA 3OIQA 1PVEA 3LNQA 1A6QA 3MZYA 4ETSA 2WAQA 2FQ3A 3E6DA 3CF5F 2L9RA 3FKJA 2K86A 4RAYA 4IO9F 3HM5A 4A0XA 4AYBA 3VOEA 3JAMK 2ELKA 3T0YA 3MCZA 1OQYA 3D5SC 4OMZA 1YO5C 2L7ZA 4UXNA 3CCUI 4LLGF 4ON0A 3L2VA 3FISA 1LB2A 2HXIA 3N4MA 2M45A 1E3OC 3H1CA 4IL6C 4XNFA 5IYCJ 5LHHA 3RDIA 3ZCOA 1YG2A 1A31A 4XRSA 3OYMA 1LQ1A 4WCGA 1XMXA 4D5FA 4OIQF 2YX7A 1FSEA 4YIIA 2H6BA 4LMYA 2VOPA 5ED4A 3CC4I 3ECHA 3JRIA 4RLQA 2L7FP 3K0LA 1MMDA 3ROUA 4ZZLA 1B72B 4MEYF 4X6AJ 2KFDA 1VQ4I 2NVXJ 2BZTA 1DUXC 3L7WA 1R4NB 2M0MA 3FXLA 3LSPA 3F22A 1Z67A 2IPQX 3HZJA 3A01A 4HV6A 2DMPA 1NK2P 2JA7J 3H36A 3K1NA 4G12A 2DOEA 3V8JA 4DIQA 1S8NA 4LB6B 5M3FJ 2F2EA 2XASA 3ZRGA 2R7XA 2M7AA 4A69C 1QPIA 1NTCA 2G9WA 4CO8A 4FX0A 2R5ZA 3CO6C 2IW5A 3OYNA 4BQQA 2DPUA 3EUAA 1B4AA 1DQUA 2MW8A 3A02A 5CVUA 2FMYA 2FUG2 1VQMI 4MEXF 4L0YB 2P5LC 3RKYA 1TW3A 4BHCA 1TC3C 4LGWA 2LFBA 3HOXJ 2MGQA 2STTA 3OL4A 5GAHJ 2KQRA 5D4SA 3IH4A 2QYOA 3M1EA 1ZGJA 2GBYA 2FOWA 4RGSA 1DP7P 5FGMA 2R92J 2P4WA 3GFIA 4M73A 1MGTA 1KGSA 3RSNA 3BQZA 3VFZA 1CF7A 2QGUA 2VBZA 4AVPA 2JA5J 2PFBA 4E7JA 5D8LB 4M3BA 3UR3C 5IP6A 1W36C 2GWRA 3BG9A 1WGXA 4N9IA 4ZYAA 3EDPA 3Q9VA 2HTJA 4BDYA 1V5EA 3RJPA 1POGA 1X2MA 4EM1A 2E35A 4Y7NJ 3O2PE 1JTXA 1SFEA 1TQIA 1JUPA 1X3ZB 5CVVA 4IQ4A 2MLGA 2IVMA 4BL0B 1JI8A 4BYYA 5H6QA 4EMSA 5GTIC 2NYXA 2XGEA 4RS8A 4U7BA 2HDDA 2DOFA 1C0WA 4Y33A 2X9DA 3L2QA 1MNEA 3NWSA 4GXOA 4KISA 2OCEA 2W82A 4EJTA 2FJ1A 3KEYA 3AG2H 1Z1DA 2DT5A 2P8TA 3P5JA 4A3DJ 2WTEA 1I50J 2HGCA 2MYSA 5K7ZA 1TLHB 2K4JA 4BQAA 2OTLI 2F4IA 3L1PA 2L2OA 2MH9A 2IGNA 1LJ9A 3ULQB 1MNDA 2KZGA 1AOYA 2QM3A 2LY1A 3DBRB 3UKGA 1AU7A 4DZJA 5C44J 4PJMA 2W57A 1EA3A 2LY2A 2ZFWA 2KIQA 1AA7A 4CZCA 1BW5A 1T6SA 3F9KA 1TNSA 2HEOA 3WU1B 3OSGA 2E7WA 3FMRA 2IGOA 1HF0A 2B63J 2HR3A 3CTAA 3ZN1A 4RM2A 4Q47A 1W4MA 3HKZN 1XN7A 5CYVA 1ITYA 2VASA 2Y9YA 2V1XA 5DM7F 3LAPA 2Y0MA 5FKKA 1WZ2A 2QLZA 2FX0A 2VJJA 3R61A 3PFIA 5F04A 4DYQA 5IT3A 4FE7A 5CQEA 3ECOA 2ZJRF 4BU2A 3FHNA 4A5NA 3JR9A 1IN6A 4A93J 1VQNI 1D1AA 3CMMA 1BJAA 3GW2A 3QYFA 3W2AA 3GTLJ 2VQHA 1WCMJ 2Z16A 2YU9J 1WH5A 1EH6A 4XRSG 1OYWA 3AKZA 3E5UA 3T5XA 1OR7C 1W7PD 1MMNA 4RDUA 3TP0A 2K5CA 3K7AJ 5FKLA 2OZUA 1HSJA 2D1VA 2FEZA 5GP9A 1R5GA 4ZTFA 4GGGA 5DYMA 3CMAI 3F8MA 5E8GA 3MKZA 1B72A 4HF1A 4M9ZA 5L3DA 2ZXJA 1IDYA 2LD5A 2DFEA 1VNDA 2DCEA 3ISPA 4L0ZB 2A69F 1SFXA 3NWTA 2P5KA 2XRLA 2FBKA 1UHMA 2FNAA 4BJ6C 1U0JA 4QTRA 1K4SA 2FMLA 4OIPF 2CG4A 3WHCA 4L18B 1O3SA 3A2KA 4RA2A 3TP3A 5HVQC 3H92A 1YW7A 1S72I 2DTRA 1A35A 1O7FA 1W0UA 2QKLB 2ZMEB 3BTIA 3CUQC 3OOPA 4MIMA 2L54A 2KL4A 2GLOA 1IRFA 3H5AA 2ID6A 2XIGA 4A3GJ 1ZKGA 1OCTC 1IW7F 1FBQA 3A03A 2AXLA 5B5EC 1H88C 1JT0A 5DD4A 1GXQA 3K4JA 4J01A 3D5LA 3F6VA 5BMZA 2MBFA 4CCMA 1Y56A 2HZDA 3JTGA 2O8XA 1RKWA 4P96A 3P9IA 2BW3A 2EZKA 2A6EF 3JRFA 2W48A 1ZG1A 4II3A 3HPHA 4NC8A 2L4AA 2E71A 4Y4RA 1JKRC 1RPWA 5DM6F 5E1ZB 2QSFX 2EZIA 3E97A 4U0VA 1E17A 3FIWA 3P9CA 2CW0F 5DEQA 2XPVA 4BBSJ 1P9QC 4O6JA 3RKWA 5K1YA 4B3XA 4HBLA 3ZQ7A 2JUCA 1ZG5A 4B47A 2CQNA 2KRCA 3CC2I 1Q1VA 3M1CA 1CQTA 4HYEA 3VEPA 1TQPA 4CSWA 1TTYA 4F3QA 3SYTA 4UVCA 5ILSA 3SHFA 1KU7A 3HOTA 1VF9A 3LSTA 1NH3A 2KRHA 3WTZA 2X6WA 2KRFA 2NVYJ
chains in the Genus database with same CATH topology
4D7NA 2E2HJ 1ETXA 4HNVA 3MKLA 3S16J 5E3OA 2EH3A 5IYBJ 9ANTA 1YRNA 4A3FJ 1F36A 2JK3A 5EGOA 4ABZA 5M5WJ 3B6AA 4V2GA 3GBGA 2DMQA 4IHYA 5JLXA 1ETKA 5EDNA 1FJLA 1IRZA 2CJJA 1U9OA 2XB5A 5F27A 1T56A 2LTPA 1JGGA 1FIPA 1RESA 4FCYA 5JLWA 1GV2A 2N8GA 3FK7A 4BKXA 5IP7J 2DMNA 3SDGA 1MH4A 2DA6A 3BR3A 3MN2A 3WHBA 4BY7J 3GTGJ 2CUEA 4EEFG 4CYCA 2COBA 1DU0A 2NOGA 3C2BA 2LK2A 1JUMA 1S7EA 1AKHB 4A3CJ 4AC0A 3BTCA 5F0CA 4BY1J 1IDZA 2WB1N 2EZHA 1U8BA 1GT0C 2R5YB 2DA2A 3HOZJ 1TWGJ 3DCFA 1HOMA 1XG1A 2R0QC 4A3JJ 1BJZA 2K9SA 2G0EA 3M4OJ 1HDPA 3ZQLA 2L7MP 2DA5A 3Q0UA 4A3BJ 3MVPA 5M5YJ 2K9NA 1B8IB 3QPLA 4A3IJ 4BXXJ 5EG0B 2DTZA 4L5EA 1MSEC 3FK6A 1TWAJ 1MNMC 3G1OA 2HOAA 2R5YA 1X2NA 4M6VA 3IH3A 1FEXA 3BT9A 2EQRA 3OIOA 4C3IJ 1NK3P 4XRMA 1W0TA 1F43A 5DS9A 5BNGA 2X48A 4B3AA 2HYJA 1B8IA 1K83J 5EG0A 4UUTA 3HEFA 3GTQJ 5E3NA 2E1OA 3O8GA 3ZQIA 2HQ5A 4DYRA 5FLVA 5EZGA 3HOVJ 1BL0A 2DA3A 1I6HJ 2TCTA 1MBGA 1APLC 2CU7A 5FJ8J 2DA1A 5C4XJ 1MH3A 2DA7A 3JRGA 5K7HA 4JX6A 3LSGA 4M3GA 5HODA 3LSRA 2VUMJ 1ZK8A 2LY9A 3BR0A 3RZDJ 1IUFA 5FKOA 1JUSA 3QPSA 4D5CA 2OPTA 3B6CA 4JP0A 1HLVA 5C4JJ 1U9NA 5IP9J 1Z0XA 2FQ4A 1VFCA 5E3MA 2JA6J 3IH2A 1LFBA 3JRCA 3HGYA 4MO7A 3ZQFA 2M0CA 5J3LA 2Y0SN 4AUXA 3TW6A 1IV6A 4V2FA 3BR2A 3M3YJ 2JJ7A 2JWTA 3HB9A 2H1KA 5IYDJ 3LSJA 5GPAA 1ORKA 3LNQA 2VI6A 1X58A 1FTZA 3GTOJ 2L9RA 3JRAA 2WAQN 1TWHJ 1VI0A 2ECBA 3HM5A 3DEWA 2ELKA 3SJMA 1Z77A 2FD5A 4AYBN 2L7ZA 4IHVA 3OSFA 3BG3A 1O4XA 3FISA 2CRGA 2HXIA 2ID3A 3GTPJ 3HDDA 3CDLA 3HBLA 1E3OC 2NVYJ 3BR6A 4C3JJ 1LFUP 5IYCJ 1RKTA 3BR1A 3S1QJ 2AHQA 4XRSA 1FIAA 2K40A 3A01B 3GTKJ 3S14J 5DTDA 3HOYJ 4D5FA 3VPRA 3S2HJ 1BA5A 2AO9A 4XIDA 2DA4A 3S2DJ 2LP0A 1XS9A 4A3EJ 1MBJA 3JREA 3JRIA 3S1NJ 2L7FP 3SFIA 1MBHA 3RQIA 2M2EA 1B72B 2R5ZB 2O9LA 4X6AJ 1JJ6C 2R7ZJ 1WPKA 3BTJA 2NVXJ 4X1EA 4D7MA 1MSFC 5K7FA 2ME6A 1ETVA 1AKHA 3GTJJ 3LSPA 3H3VK 1QVTA 1IC8A 1ZR2A 3A01A 2DMPA 1Y1WJ 1JTYA 1NK2P 2JA7J 2HI3A 2HOTA 4G12A 1WI3A 3CMYA 5M3FJ 2KDZA 3Q0WA 2NS8A 2LR8A 2CQQA 4FISA 2DJNA 1UG2A 1ZTRA 3HOWJ 1MBKA 4A69C 1QPIA 1NTCA 2R5ZA 1DU6A 2I10A 4C3HJ 3S15J 1UHSA 2MW8A 3A02A 3D1NI 3F0CA 4A3LJ 1TC3C 1XC5A 5F0FA 1TWFJ 1OFCX 2LFBA 4MLOA 3HOXJ 2MGQA 3ZQCA 4XK4A 1A5JA 1G2HA 2E19A 3IH4A 5FLMJ 2GBYA 2HOSA 2R92J 3S1RJ 2EZLA 4M3EA 3S17J 3HOUJ 1HCRA 2IBDA 3JRHA 1UMQA 3BQZA 1SANA 2DN0A 2JA5J 2XGCA 3RZOJ 4M3BA 5IP6A 1ZR4A 3BG9A 4FTHA 2XPWA 1WGXA 1FTTA 1HDDC 1GV5A 5C3EJ 4NDLA 3G1LA 1POGA 1X2MA 4Y7NJ 1JTXA 1JUPA 2MG4A 3TEDA 1ZQ3P 4GFBA 2M34A 3JRBA 2XGEA 1BW6A 5M5XJ 2HDDA 2QF7A 3CQZJ 2X9DA 1A6IA 2Y2ZA 2TRTA 2ZB9A 3BR5A 3E7LA 4Y52J 2VKEA 1OCPA 2FJ1A 2O8KA 4CYCB 1ENHA 1GVDA 4A3DJ 3Q0VA 1I50J 1IJWC 5K7ZA 1MBEA 1IGNA 1YRNB 1R9TJ 4FE4A 3L1PA 4C2MJ 1GDTA 4JYKA 4A3KJ 3UKGA 1AU7A 2JMWA 2LLKA 1T33A 4DZJA 5FKMA 5C44J 2R93J 1Y1VJ 2WV1A 2E2JJ 2Y30A 1BW5A 3OSGA 1HF0A 2B63J 2VKVA 5J1RA 3HKZN 4J19A 3NAUA 1ITYA 1P7IA 2Y9YA 4LOCA 2GM4A 2M9HA 5FKKA 2Y9ZA 2FX0A 4A3MJ 5EEAA 5EYRA 5F04A 5IOYA 4DYQA 3IV5A 4FE7A 2CQXA 2NVTJ 2YUSA 2L0KA 2KT0A 1PUFB 1LE8B 1ZGWA 1ETQA 2X6OA 2XB0X 2NS7A 3JR9A 2K9QA 1GUUA 3K2AA 4JX5A 4A93J 1ETWA 2E2IJ 5J1YA 3PM1A 3GTLJ 3HGGA 2IAIA 4I6ZA 1WCMJ 4MFDA 3G1MA 3W6VA 2YU9J 2LKXA 1WH5A 2IEKA 4XRSG 4W97A 2XGDA 4UUSB 1I3QJ 5IPAA 2QCOA 1TWCJ 4M3DA 4DZPA 4RDUA 3TP0A 3K7AJ 5FKLA 1PUFA 1LE8A 3I4MJ 5GP9A 3LOCA 5IOZA 3TW7A 1IG7A 1JT6A 3S1MJ 1B72A 5J1UA 1IDYA 2LD5A 3I4NJ 3O8HA 2Y31A 1VNDA 4B4CA 1JJ8C 3ZQGA 4BBRJ 4I76A 2XRLA 1ETYA 4UUSA 4RBOA 2VPRA 2YS9A 2JA8J 2PMZN 4MFEA 3BTLA 4QTRA 2RAEA 3ZOBA 5F08A 3Q3SA 2D5VA 4M3FA 3WHCA 1U78A 3TP3A 3ZQHA 5M3MJ 1QVUA 5E3LA 2MSYA 4XICA 1W0UA 3BTIA 5EF6A 4MIMA 2GLOA 3PO2J 3JRDA 2ID6A 5GPCA 1AHDP 4A3GJ 3OOUA 1JKOC 1OCTC 3A03A 1WH7A 1H89C 1H88C 1JT0A 3NARA 1JKQC 4W1UA 2ECCA 2CUFA 5EZHA 1OJLA 2ME0A 1RKWA 1D5YA 4QSHA 3GTMJ 3BQYA 2XSDC 2EZKA 1JKPC 3PO3J 2M8GX 2DMUA 2EBIA 4S0HB 1P7JA 3JRFA 1K61A 2LVSA 2W48A 1ETOA 1SFOJ 4DYCA 1QRYA 3BG5A 1RETA 2XPUA 1JKRC 1RPWA 5F1JA 1H8AC 2OF7A 2EZIA 3H0GJ 4IHXA 3FIWA 1RR7A 2XPVA 4BBSJ 2HXOA 5FKNA 3CCYA 2JN6A 4QIWN 2H8RA 3FKIJ 5EGOB 1Q1VA 1MBFA 1CQTA 1EF4A 2O7OA 3QQAA 4B1RA 2NVQJ 5F0HA 4IEJA 3RKQA 1VF9A 2DMTA 4IHWA 2P81A 1ZKGA 4DW6A 4JX4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4D7N A;  2E2H J;  1ETX A;  4HNV A;  3MKL A;  3S16 J;  5E3O A;  2EH3 A;  5IYB J;  9ANT A;  1YRN A;  4A3F J;  1F36 A;  2JK3 A;  5EGO A;  4ABZ A;  5M5W J;  3B6A A;  4V2G A;  3GBG A;  2DMQ A;  4IHY A;  5JLX A;  1ETK A;  5EDN A;  1FJL A;  1IRZ A;  2CJJ A;  1U9O A;  2XB5 A;  5F27 A;  1T56 A;  2LTP A;  1JGG A;  1FIP A;  1RES A;  4FCY A;  5JLW A;  1GV2 A;  2N8G A;  3FK7 A;  4BKX A;  5IP7 J;  2DMN A;  3SDG A;  1MH4 A;  2DA6 A;  3BR3 A;  3MN2 A;  3WHB A;  4BY7 J;  3GTG J;  2CUE A;  4EEF G;  4CYC A;  2COB A;  1DU0 A;  2NOG A;  3C2B A;  2LK2 A;  1JUM A;  1S7E A;  1AKH B;  4A3C J;  4AC0 A;  3BTC A;  5F0C A;  4BY1 J;  1IDZ A;  2WB1 N;  2EZH A;  1U8B A;  1GT0 C;  2R5Y B;  2DA2 A;  3HOZ J;  1TWG J;  3DCF A;  1HOM A;  1XG1 A;  2R0Q C;  4A3J J;  1BJZ A;  2K9S A;  2G0E A;  3M4O J;  1HDP A;  3ZQL A;  2L7M P;  2DA5 A;  3Q0U A;  4A3B J;  3MVP A;  5M5Y J;  2K9N A;  1B8I B;  3QPL A;  4A3I J;  4BXX J;  5EG0 B;  2DTZ A;  4L5E A;  1MSE C;  3FK6 A;  1TWA J;  1MNM C;  3G1O A;  2HOA A;  2R5Y A;  1X2N A;  4M6V A;  3IH3 A;  1FEX A;  3BT9 A;  2EQR A;  3OIO A;  4C3I J;  1NK3 P;  4XRM A;  1W0T A;  1F43 A;  5DS9 A;  5BNG A;  2X48 A;  4B3A A;  2HYJ A;  1B8I A;  1K83 J;  5EG0 A;  4UUT A;  3HEF A;  3GTQ J;  5E3N A;  2E1O A;  3O8G A;  3ZQI A;  2HQ5 A;  4DYR A;  5FLV A;  5EZG A;  3HOV J;  1BL0 A;  2DA3 A;  1I6H J;  2TCT A;  1MBG A;  1APL C;  2CU7 A;  5FJ8 J;  2DA1 A;  5C4X J;  1MH3 A;  2DA7 A;  3JRG A;  5K7H A;  4JX6 A;  3LSG A;  4M3G A;  5HOD A;  3LSR A;  2VUM J;  1ZK8 A;  2LY9 A;  3BR0 A;  3RZD J;  1IUF A;  5FKO A;  1JUS A;  3QPS A;  4D5C A;  2OPT A;  3B6C A;  4JP0 A;  1HLV A;  5C4J J;  1U9N A;  5IP9 J;  1Z0X A;  2FQ4 A;  1VFC A;  5E3M A;  2JA6 J;  3IH2 A;  1LFB A;  3JRC A;  3HGY A;  4MO7 A;  3ZQF A;  2M0C A;  5J3L A;  2Y0S N;  4AUX A;  3TW6 A;  1IV6 A;  4V2F A;  3BR2 A;  3M3Y J;  2JJ7 A;  2JWT A;  3HB9 A;  2H1K A;  5IYD J;  3LSJ A;  5GPA A;  1ORK A;  3LNQ A;  2VI6 A;  1X58 A;  1FTZ A;  3GTO J;  2L9R A;  3JRA A;  2WAQ N;  1TWH J;  1VI0 A;  2ECB A;  3HM5 A;  3DEW A;  2ELK A;  3SJM A;  1Z77 A;  2FD5 A;  4AYB N;  2L7Z A;  4IHV A;  3OSF A;  3BG3 A;  1O4X A;  3FIS A;  2CRG A;  2HXI A;  2ID3 A;  3GTP J;  3HDD A;  3CDL A;  3HBL A;  1E3O C;  2NVY J;  3BR6 A;  4C3J J;  1LFU P;  5IYC J;  1RKT A;  3BR1 A;  3S1Q J;  2AHQ A;  4XRS A;  1FIA A;  2K40 A;  3A01 B;  3GTK J;  3S14 J;  5DTD A;  3HOY J;  4D5F A;  3VPR A;  3S2H J;  1BA5 A;  2AO9 A;  4XID A;  2DA4 A;  3S2D J;  2LP0 A;  1XS9 A;  4A3E J;  1MBJ A;  3JRE A;  3JRI A;  3S1N J;  2L7F P;  3SFI A;  1MBH A;  3RQI A;  2M2E A;  1B72 B;  2R5Z B;  2O9L A;  4X6A J;  1JJ6 C;  2R7Z J;  1WPK A;  3BTJ A;  2NVX J;  4X1E A;  4D7M A;  1MSF C;  5K7F A;  2ME6 A;  1ETV A;  1AKH A;  3GTJ J;  3LSP A;  3H3V K;  1QVT A;  1IC8 A;  1ZR2 A;  3A01 A;  2DMP A;  1Y1W J;  1JTY A;  1NK2 P;  2JA7 J;  2HI3 A;  2HOT A;  4G12 A;  1WI3 A;  3CMY A;  5M3F J;  2KDZ A;  3Q0W A;  2NS8 A;  2LR8 A;  2CQQ A;  4FIS A;  2DJN A;  1UG2 A;  1ZTR A;  3HOW J;  1MBK A;  4A69 C;  1QPI A;  1NTC A;  2R5Z A;  1DU6 A;  2I10 A;  4C3H J;  3S15 J;  1UHS A;  2MW8 A;  3A02 A;  3D1N I;  3F0C A;  4A3L J;  1TC3 C;  1XC5 A;  5F0F A;  1TWF J;  1OFC X;  2LFB A;  4MLO A;  3HOX J;  2MGQ A;  3ZQC A;  4XK4 A;  1A5J A;  1G2H A;  2E19 A;  3IH4 A;  5FLM J;  2GBY A;  2HOS A;  2R92 J;  3S1R J;  2EZL A;  4M3E A;  3S17 J;  3HOU J;  1HCR A;  2IBD A;  3JRH A;  1UMQ A;  3BQZ A;  1SAN A;  2DN0 A;  2JA5 J;  2XGC A;  3RZO J;  4M3B A;  5IP6 A;  1ZR4 A;  3BG9 A;  4FTH A;  2XPW A;  1WGX A;  1FTT A;  1HDD C;  1GV5 A;  5C3E J;  4NDL A;  3G1L A;  1POG A;  1X2M A;  4Y7N J;  1JTX A;  1JUP A;  2MG4 A;  3TED A;  1ZQ3 P;  4GFB A;  2M34 A;  3JRB A;  2XGE A;  1BW6 A;  5M5X J;  2HDD A;  2QF7 A;  3CQZ J;  2X9D A;  1A6I A;  2Y2Z A;  2TRT A;  2ZB9 A;  3BR5 A;  3E7L A;  4Y52 J;  2VKE A;  1OCP A;  2FJ1 A;  2O8K A;  4CYC B;  1ENH A;  1GVD A;  4A3D J;  3Q0V A;  1I50 J;  1IJW C;  5K7Z A;  1MBE A;  1IGN A;  1YRN B;  1R9T J;  4FE4 A;  3L1P A;  4C2M J;  1GDT A;  4JYK A;  4A3K J;  3UKG A;  1AU7 A;  2JMW A;  2LLK A;  1T33 A;  4DZJ A;  5FKM A;  5C44 J;  2R93 J;  1Y1V J;  2WV1 A;  2E2J J;  2Y30 A;  1BW5 A;  3OSG A;  1HF0 A;  2B63 J;  2VKV A;  5J1R A;  3HKZ N;  4J19 A;  3NAU A;  1ITY A;  1P7I A;  2Y9Y A;  4LOC A;  2GM4 A;  2M9H A;  5FKK A;  2Y9Z A;  2FX0 A;  4A3M J;  5EEA A;  5EYR A;  5F04 A;  5IOY A;  4DYQ A;  3IV5 A;  4FE7 A;  2CQX A;  2NVT J;  2YUS A;  2L0K A;  2KT0 A;  1PUF B;  1LE8 B;  1ZGW A;  1ETQ A;  2X6O A;  2XB0 X;  2NS7 A;  3JR9 A;  2K9Q A;  1GUU A;  3K2A A;  4JX5 A;  4A93 J;  1ETW A;  2E2I J;  5J1Y A;  3PM1 A;  3GTL J;  3HGG A;  2IAI A;  4I6Z A;  1WCM J;  4MFD A;  3G1M A;  3W6V A;  2YU9 J;  2LKX A;  1WH5 A;  2IEK A;  4XRS G;  4W97 A;  2XGD A;  4UUS B;  1I3Q J;  5IPA A;  2QCO A;  1TWC J;  4M3D A;  4DZP A;  4RDU A;  3TP0 A;  3K7A J;  5FKL A;  1PUF A;  1LE8 A;  3I4M J;  5GP9 A;  3LOC A;  5IOZ A;  3TW7 A;  1IG7 A;  1JT6 A;  3S1M J;  1B72 A;  5J1U A;  1IDY A;  2LD5 A;  3I4N J;  3O8H A;  2Y31 A;  1VND A;  4B4C A;  1JJ8 C;  3ZQG A;  4BBR J;  4I76 A;  2XRL A;  1ETY A;  4UUS A;  4RBO A;  2VPR A;  2YS9 A;  2JA8 J;  2PMZ N;  4MFE A;  3BTL A;  4QTR A;  2RAE A;  3ZOB A;  5F08 A;  3Q3S A;  2D5V A;  4M3F A;  3WHC A;  1U78 A;  3TP3 A;  3ZQH A;  5M3M J;  1QVU A;  5E3L A;  2MSY A;  4XIC A;  1W0U A;  3BTI A;  5EF6 A;  4MIM A;  2GLO A;  3PO2 J;  3JRD A;  2ID6 A;  5GPC A;  1AHD P;  4A3G J;  3OOU A;  1JKO C;  1OCT C;  3A03 A;  1WH7 A;  1H89 C;  1H88 C;  1JT0 A;  3NAR A;  1JKQ C;  4W1U A;  2ECC A;  2CUF A;  5EZH A;  1OJL A;  2ME0 A;  1RKW A;  1D5Y A;  4QSH A;  3GTM J;  3BQY A;  2XSD C;  2EZK A;  1JKP C;  3PO3 J;  2M8G X;  2DMU A;  2EBI A;  4S0H B;  1P7J A;  3JRF A;  1K61 A;  2LVS A;  2W48 A;  1ETO A;  1SFO J;  4DYC A;  1QRY A;  3BG5 A;  1RET A;  2XPU A;  1JKR C;  1RPW A;  5F1J A;  1H8A C;  2OF7 A;  2EZI A;  3H0G J;  4IHX A;  3FIW A;  1RR7 A;  2XPV A;  4BBS J;  2HXO A;  5FKN A;  3CCY A;  2JN6 A;  4QIW N;  2H8R A;  3FKI J;  5EGO B;  1Q1V A;  1MBF A;  1CQT A;  1EF4 A;  2O7O A;  3QQA A;  4B1R A;  2NVQ J;  5F0H A;  4IEJ A;  3RKQ A;  1VF9 A;  2DMT A;  4IHW A;  2P81 A;  1ZKG A;  4DW6 A;  4JX4 A; 
#chains in the Genus database with same CATH topology
 1YX5 A;  1ETX A;  4HNV A;  2FF4 A;  3MKL A;  5E3O A;  5CQG A;  3OYF A;  3BJ6 A;  3M7G A;  4A3F J;  1E3H A;  3WTY C;  3KX2 A;  5M5W J;  3RPU D;  3B6A A;  4YRV A;  4LIU A;  4V2G A;  1UEL B;  2W4S A;  1HST A;  4G7O F;  4M72 A;  2FBI A;  1LDD A;  1X19 A;  1FJL A;  1IRZ A;  2CJJ A;  1MIJ A;  1U9O A;  4UB8 C;  2LF8 A;  2LTP A;  1JGG A;  2OQG A;  4QLC U;  1RES A;  2VLA A;  2EFP A;  2N8G A;  2IP2 A;  4BKX A;  1ON2 A;  2DA6 A;  3I4P A;  4M9S A;  2RQQ A;  1PUE E;  3GTG J;  3CJR B;  2OV7 A;  2IJL A;  4M74 A;  4IJA A;  4MHG A;  1MDM A;  1E3P A;  2ZSH B;  2KLO A;  4PGH A;  3H9G A;  1Y0N A;  3W2W A;  2O03 A;  3K4M A;  4HX7 A;  1TWG J;  1HOM A;  1DGR M;  1XG1 A;  3GWZ A;  4RB0 A;  1XSX A;  4A3J J;  1XMK A;  4XLN F;  4XLH A;  3CME I;  4U7D A;  2K9S A;  1EH7 A;  1LDJ A;  3FXK A;  1WJB A;  4JK1 X;  2WAF A;  2L7M P;  1OYY A;  1RRJ A;  4A3B J;  2HYF A;  4LK0 F;  4AD9 A;  3MVP A;  3K70 D;  2EFQ A;  2E60 A;  2EFO A;  5HS8 A;  2VC0 A;  1Q1H A;  1TT0 A;  3G1O A;  1Y8R B;  2HOA A;  3GZN B;  4OU0 A;  2L02 A;  1S6L A;  4BQN A;  2GOX B;  2COM A;  4OIN F;  1FEX A;  4RGX A;  5BS6 A;  2VB6 A;  3UNG C;  3LQQ A;  5F64 A;  2LBF B;  1OCO H;  4LG0 A;  4C3I J;  1W0T A;  1F43 A;  5BNG A;  3PQJ A;  4B3A A;  2AQF A;  2HYJ A;  1B8I A;  1HQC A;  4XKB A;  1KA8 A;  2MAB A;  5EG0 A;  2QKM B;  3GTQ J;  1HXD A;  4UNO A;  3ABK H;  1DPR A;  4DYR A;  1Z3Y A;  1W36 D;  3GVA A;  3PUB A;  1I6H J;  3PQK A;  3FXO A;  1APL C;  2DA1 A;  1FOX A;  3QYE A;  1MH3 A;  4WWC A;  2DFH A;  1ZH5 A;  2V26 A;  4JX6 A;  3LSG A;  3U9G A;  5HOD A;  3LSR A;  2R7U A;  4MTD A;  1P4A A;  2LY9 A;  3M9A A;  3WTX C;  1UFM A;  4Q5S F;  3BRO A;  1LDK B;  2FBH A;  4MQ9 F;  3IAM 2;  5H6R A;  1YIT I;  4HPQ A;  1ERD A;  2MH2 A;  4IF4 A;  1TZL A;  2FQ4 A;  2X6Y A;  3IP4 B;  3CP2 A;  5K5O A;  1BBY A;  2Y0S A;  3JRC A;  2NNY A;  2M0C A;  4KN4 X;  3B73 A;  4KIG A;  1R00 A;  2X85 A;  2Q1Z B;  5JHU A;  2NOJ B;  3PNV A;  3J80 K;  2FRH A;  3GEZ A;  2LRE A;  3E5X A;  3CDI A;  3BR2 A;  2P6T A;  1D1B A;  3ZPL A;  3HB9 A;  2H1K A;  4ESJ A;  1O3R A;  2CUZ A;  4XR6 A;  2R7W A;  3LSJ A;  4PFP A;  4I02 A;  1ORK A;  1JXS A;  2VI6 A;  1HBX G;  1V54 H;  2BXZ A;  3GTO J;  4OAZ A;  4PJL A;  4UVA A;  2WAQ N;  2IGK A;  4L9J A;  5JHF A;  1R58 A;  3IUO A;  2XF6 A;  3SJM A;  1S3J A;  1Z77 A;  2FD5 A;  3IWZ A;  4AYB N;  2K27 A;  2LOO A;  2W24 A;  3I0T A;  3OSF A;  4YIR X;  2CMP A;  3E6C C;  5JVT A;  1USS A;  3S8P A;  5DUI A;  1KQ8 A;  3VB2 A;  3WTT C;  1RUN A;  1XPX A;  1S29 A;  3HBL A;  2XKP A;  3BR6 A;  3KYC B;  4C3J J;  1LFU P;  2CUJ A;  3HSE A;  3I5U A;  1AWC A;  1RKT A;  2QUF A;  3S1Q J;  3QOD A;  3K4C A;  1I39 A;  4P9F A;  4CYD A;  3A01 B;  2K40 A;  3ASN H;  3QP6 A;  3GTK J;  2TDX A;  4C30 A;  5LGU A;  4P5O A;  3MAJ A;  2Z2S B;  4BE2 A;  4I99 C;  1IRX A;  1UST A;  3S2D J;  3QPT A;  1TL8 A;  4ITV A;  4A3E J;  1IF1 A;  3HUG A;  3H9J A;  2GOM A;  4XLC A;  3HRU A;  3RQI A;  3FDY A;  1FC3 A;  2R5Z B;  2DK8 A;  2ISY A;  1R1V A;  2EV5 A;  1J75 A;  3HC7 A;  1VQ7 I;  3JCU C;  1S7O A;  5HLI A;  3RPU A;  4D7M A;  2VBX A;  4RB2 C;  1MSF C;  2ZO4 A;  3IC7 A;  4HDU A;  3HHG A;  1IC8 A;  1BN5 A;  3K4N A;  3R0J A;  1ZR2 A;  4G94 A;  5LGN A;  2HI3 A;  4LB5 A;  4ZYE A;  1VQ8 I;  3CDH A;  2GA1 A;  1XMA A;  4UHT A;  3DFG A;  3K10 A;  5KCM A;  1ZTR A;  2DAO A;  1U3E M;  1MBK A;  1ODD A;  4CDG A;  1YYV A;  2EIM H;  4ZYG A;  3BLY A;  4LIV A;  2ICW G;  3V7S A;  1X1D A;  4C3H J;  1ULY A;  1GVJ A;  3LSM A;  3S15 J;  2VKH A;  1IN7 A;  1K78 A;  2K7L A;  4KIF A;  1CF7 B;  3HJE A;  3D1N I;  3SZG A;  4F92 B;  1D3Y A;  2DQR A;  3DU6 A;  5BQT A;  1T39 A;  4DQ2 A;  4MLO A;  3ZQC A;  2HFH A;  3WGH A;  3HL2 A;  2QEN A;  1A5J A;  1G2H A;  1NG7 A;  5L3C A;  3RTR A;  2CW8 A;  2FXA A;  1ZRD A;  6PAX A;  3S1R J;  4M3E A;  4HNU A;  5HOO A;  1HCR A;  3HOU J;  3JRH A;  2E1M C;  3COA C;  1GXP A;  3OYH A;  3D0S A;  3KP5 A;  1UZC A;  4L5J A;  5LEJ A;  2R7T A;  3GZ6 A;  3RZO J;  2VT3 A;  3KET A;  3WTW C;  2XPW A;  1JGS A;  5GAD J;  4KIT B;  1T95 A;  1YW9 A;  2EK5 A;  2MC4 A;  3V7R A;  2LDU A;  4ESF A;  2IS4 A;  3BP8 A;  3LAJ A;  3QU3 A;  3I9V 2;  3DP7 A;  5FFX A;  5J4Y A;  1O7L A;  1IXC A;  4HOB A;  5FRN A;  1FLI A;  3P7N A;  2KIM A;  2LF7 A;  2MG4 A;  4BHP A;  3AFH A;  2E5N A;  3TDZ C;  3ZGK A;  1WKM A;  4P55 A;  4GFB A;  2Z3Y A;  1D0Y A;  1STZ A;  2EA2 A;  2LMD A;  1B9N A;  1Y8Q B;  3CQZ J;  1A6I A;  4IRG A;  1B9M A;  4G8X A;  1H0M A;  2UUZ A;  2VON A;  1FP1 D;  5KVR A;  1IZ1 A;  3HSF A;  3V4G A;  4HST A;  4B48 A;  1GVD A;  1U8R A;  3Q0V A;  1IJW C;  2LRD A;  5F6F A;  1J09 A;  1MBE A;  3TQN A;  2K85 A;  4BE0 A;  2E7X A;  2KIS A;  3ESW B;  1MJB A;  1I6X A;  3M8F A;  1R9T J;  3V42 A;  3ZP5 A;  2JT1 A;  1GDT A;  4JYK A;  2PMH A;  1D5V A;  3KZY A;  1WI9 A;  4XOR A;  5FRO A;  1T33 A;  3GUD A;  2YSR A;  4DGW B;  3MKY B;  4B8X A;  2R93 J;  3W6J B;  2PEX A;  3MQ0 A;  3GME A;  4Y13 A;  2Y30 A;  1FT9 A;  4IOA F;  2XUB A;  1Z3X A;  1XX5 A;  1BOA A;  2OBP A;  1A04 A;  5L3E A;  2L01 A;  4CGZ A;  3S32 A;  3ZXS A;  3MWM A;  1VTN C;  2GM4 A;  2M9H A;  1HKT A;  3JAM Z;  2EFN A;  3E5Q A;  5EYR A;  1FWZ A;  3IV5 A;  3L2C A;  3HYI A;  2CQX A;  2DQL A;  2W1O A;  3BDD A;  4RM3 A;  3DTI A;  4ENK A;  2JSP A;  3VYS B;  4M6Y A;  2IA1 A;  1ETQ A;  2V6C A;  2R7Q A;  4QWQ A;  4XSZ F;  2XB0 X;  3OL3 A;  2K9Q A;  1GUU A;  3LSH A;  4JX5 A;  1ETW A;  1T98 A;  2MLK A;  1E0E A;  2E2I J;  3A4C A;  3GFL A;  3JTH A;  4HLX A;  4MNU A;  4XKW A;  4MFD A;  2LKP A;  3TGN A;  2ISZ A;  2KZV A;  3W6V A;  4PSW A;  2VIX A;  1ZN2 A;  2LKX A;  3BPX A;  4W97 A;  1PP8 F;  2RRE A;  1BC8 C;  3M8E A;  4I01 A;  2QCO A;  4DZP A;  1G3Y A;  3CCE I;  4BAY A;  1IXS B;  1TT5 B;  1YOV B;  4IVN A;  1TP4 A;  2LYC A;  1G3W A;  2ZJP F;  1VQO I;  3I4M J;  2YR2 A;  4HF0 A;  4AM3 A;  1IG7 A;  4Y3O A;  3CES A;  1SD4 A;  2UZK A;  1FNN A;  1U5T C;  4ZH4 F;  4MTE A;  3O8H A;  1X3W B;  4B4C A;  4CCJ A;  1UHW A;  2LSO A;  3F8B A;  4CUG A;  3BC8 A;  5E17 F;  2BBY A;  1OR7 A;  4I76 A;  2DJI A;  4UUS A;  1W5S A;  2VPR A;  2RQP A;  4HLY A;  2RNJ A;  1SC7 A;  2RAE A;  3E3V A;  5F08 A;  2F5C A;  3CJQ B;  3WTV C;  2E34 A;  2BW3 B;  2EJR A;  2H6C A;  1QVU A;  2GZW A;  3MZ8 A;  2EIN H;  1BI2 A;  1UCR A;  2OZ6 A;  4XIC A;  4N0B A;  1EV7 A;  5EF6 A;  2KHM A;  3CCQ I;  5D5V B;  3WE2 A;  1FMV A;  1SVL A;  3PO2 J;  1AHD P;  2PMU A;  2WAD A;  5EJC A;  3C2H A;  1JKQ C;  4W1U A;  5IT9 K;  1Z6T A;  2ECC A;  4A0Y A;  2CUF A;  2MA3 A;  3FXM A;  1OJL A;  1RC9 A;  2ME0 A;  1D5Y A;  2D45 A;  3GTM J;  2XSD C;  2IA0 A;  1WVR A;  5LFA A;  3CUQ A;  2RKH A;  1X4O A;  5EEG A;  3MFK A;  3Q5F A;  1P7J A;  1YS7 A;  3LMM A;  1J9I A;  1ETO A;  5HLG A;  2OC6 A;  5D5W B;  1SMT A;  3CC7 I;  5HNH A;  4R1H A;  4FHT A;  1YIJ I;  2XPU A;  2DU9 A;  3KFW X;  4S04 A;  4NHJ A;  2OF7 A;  2DOD A;  2H8W A;  2HDW A;  4IHX A;  1P6R A;  1R22 A;  5ILU A;  2P0W A;  3QRF F;  1FYK A;  1QZY A;  3DF8 A;  4EGZ A;  3FBI B;  1MJ9 A;  2PX9 A;  4XKV A;  4ESB A;  4KN7 X;  5E1W A;  2ZNZ A;  2JN6 A;  4X0G A;  4QIW N;  2H8R A;  2EIJ H;  1TNT A;  2K9L A;  3FKI J;  3SQN A;  1O3T A;  5CVI A;  1MBF A;  4JQF A;  2B7E A;  2A6T A;  2HQA A;  3O3K A;  5HDG A;  3TL4 X;  4B1R A;  4CA0 A;  4A6D A;  4FQG A;  1F4K A;  2DMT A;  1Y6I A;  2P81 A;  2HVR A;  4RB1 A;  4YFN F;  4DW6 A;  2R7R A;  2M5W A;  1RUO A;  3BPV A;  1MD0 A;  9ANT A;  4E7K A;  1MDM B;  3DTK A;  3DPT A;  4WXD A;  2JK3 A;  4I09 A;  5EGO A;  4ABZ A;  4JOM A;  4NNJ A;  2DMQ A;  5JLX A;  5EDN A;  1IN8 A;  2XB5 A;  5F27 A;  2ZXW H;  2DDB A;  3LL7 A;  4NQW A;  1FIP A;  4E7Z A;  4XKC A;  1N25 A;  3WHB A;  4BY7 J;  2CUE A;  3M8J A;  1BR1 A;  2WB1 A;  3DEU A;  1T38 A;  2LK2 A;  3M07 A;  2M1B A;  3G4S I;  5TJJ A;  5CVR A;  4IOC F;  5F0C A;  1XSD A;  1IDZ A;  3KP7 A;  2K02 A;  1LEA A;  4RAG A;  4YFX F;  2EZH A;  5CLS A;  4LFU A;  3LWF A;  1MMA A;  2DA2 A;  3IAS 2;  4PGG A;  4ZJZ A;  4MQV A;  1JHF A;  1FSH A;  3CJN A;  4L9V A;  3HIF A;  2HQR A;  4RGR A;  1BJZ A;  3IL2 A;  3LA3 A;  4CH7 A;  1R5I D;  2ACJ A;  2L7K A;  2EFW A;  2G0E A;  2Q2E B;  2QQ8 A;  4XLP F;  2A07 F;  4LG0 B;  1K4T A;  2AQE A;  5K5Q A;  5ILV A;  1FZP B;  4OAY A;  5M5Y J;  2K9N A;  1W7P B;  1B8I B;  3N97 A;  2KMU A;  2HYG D;  5EG0 B;  1K6Y A;  1UG0 A;  3CCS I;  1VQ9 I;  4RB3 C;  5GAE J;  2LH9 A;  2L9N A;  4XOP A;  3AL0 B;  2R7V A;  2O61 A;  2BVM A;  4HRI A;  2EIK H;  2VJ5 A;  4AIJ A;  2O5R A;  3VYU B;  2EQR A;  4XRM A;  1J2X A;  2X48 A;  4Q48 A;  1R71 A;  2CW7 A;  3ZMU A;  3J7A Y;  1R1T A;  3HEF A;  4BAC A;  4ENM A;  5E3N A;  2NXN B;  2E1O A;  3O8G A;  3ZQI A;  1K6O A;  4CZZ A;  2HQ5 A;  5J47 A;  2D2W A;  1VQL I;  3HOV J;  4F93 B;  1WSU A;  2QQA A;  3WGI A;  3K1P A;  2CU7 A;  5FJ8 J;  5C4X J;  5HDN A;  2DA7 A;  2MD5 A;  5K7H A;  1EJ9 A;  2ESH A;  2PQ8 A;  1J59 A;  3KLO A;  2KP6 A;  1QBJ A;  4BEH B;  1W5C C;  3RZD J;  1SD6 A;  2VE8 A;  2QWW A;  5CPR B;  3QPS A;  4NBQ A;  1RNL A;  3HOS A;  1MW7 A;  3V8L A;  3OYL A;  2NRA C;  2OPT A;  2QVO A;  2X0L A;  4JP0 A;  1OMI A;  3MD2 A;  5C4J J;  1U9N A;  2VQC A;  1XTA A;  5E3M A;  4RLF A;  3BG6 A;  1LFB A;  4IXA A;  3DKW A;  1SEU A;  3HGY A;  3HG9 A;  4MO7 A;  3HSR A;  3RQ4 A;  3F72 A;  2Y0S N;  4AUX A;  3TW6 A;  2A5Y B;  4D0P A;  3VWB A;  2B0L A;  4V2F A;  4HF2 A;  3M3Y J;  1ZEL A;  3FXQ A;  3I54 A;  3I64 A;  2L3D A;  3K9T A;  1LPQ A;  5IYD J;  3DLL F;  5JVG F;  3CO7 C;  4ZZD A;  2JRT A;  5FB2 A;  2QSG X;  5KK1 A;  3G73 A;  3FXR A;  1ZHF A;  2FA5 A;  3VYT B;  1MMS A;  3JRA A;  1TWH J;  2ECB A;  3DEW A;  4ZYD A;  1RI7 A;  2ETH A;  1REP C;  5CVJ A;  1FY7 A;  2YU3 A;  2X6X A;  2CV1 A;  1BR2 A;  3F8C A;  3HUG B;  1SAU A;  4PJ0 C;  3BG3 A;  1O4X A;  3QOP A;  2CRG A;  3OYG A;  2DPD A;  2R3S A;  3K2Z A;  3KLN A;  3J7Z I;  4A6E A;  3WU0 A;  1I5Z A;  2ELH A;  1ZAO A;  5BPD A;  2CWE A;  1WJC A;  3BR1 A;  3EYY A;  5FLX K;  1GLN A;  4BDZ A;  2BY1 A;  1FIA A;  2VOO A;  2VJI A;  3IKT A;  3HOY J;  3LFK A;  1A36 A;  2F4M B;  1BA5 A;  4XID A;  2LP0 A;  1XS9 A;  1MBJ A;  2VQG A;  3S3N A;  3S1N J;  3GO5 A;  3SFI A;  2M2E A;  2O9L A;  3CCJ I;  1H9G A;  4LG3 A;  1WPK A;  4G9Y A;  1JJ6 C;  1V5F A;  1YE9 A;  4WXH A;  2PBI A;  3QPH A;  2L9V A;  4EJW A;  1K78 B;  2DO7 A;  4KT5 C;  1ETV A;  3L00 A;  3GTJ J;  1QVT A;  1UB9 A;  3DEE A;  1IXR C;  1JTY A;  3GXO A;  2NS0 A;  4KA4 A;  1WI3 A;  3C7J A;  1QA6 A;  3IKV A;  1G6N A;  2CQQ A;  2DJN A;  2NS8 A;  3Q0W A;  4FIS A;  1UG2 A;  4XM3 A;  3HOW J;  5H20 A;  5BOX A;  2ADU A;  5LRS A;  2CFO A;  2Q2E A;  2A68 F;  3CLO A;  3HXL A;  1DU6 A;  3BZ6 A;  1QO0 D;  4LIT A;  5FFZ A;  1UHS A;  2WWY A;  2VT2 A;  4UB6 C;  1OLT A;  1W7P A;  3F23 A;  3OYI A;  3ZMS A;  4XL9 A;  2WY8 Q;  1XC5 A;  1OCZ H;  5F0F A;  1TWF J;  2BY2 A;  2HKO A;  2JA2 A;  3PL8 A;  3TO7 A;  3C18 A;  2CQK A;  4KDP A;  1EH8 A;  4EJV A;  5LEK A;  2P6S A;  4I0A A;  2EZL A;  2H09 A;  4KJZ A;  4GO1 A;  3EUH A;  1D8K A;  2MD0 A;  3RIR A;  4BUP A;  3G2B A;  2L4M A;  2FNP A;  5D4R A;  3ELK A;  2AS5 F;  1UJ8 A;  1SAN A;  2CS3 A;  2DN0 A;  3OMY A;  3EET A;  3KEQ A;  4RAF A;  1CGP A;  2BVL A;  4FTH A;  5A2Q Z;  2X1C A;  1SAX A;  3ABM H;  4HX4 A;  1ZLJ A;  2DI3 A;  2GAU A;  1FYL A;  5C3E J;  2QBY A;  3HTS B;  3LFU A;  3G1L A;  3LQR A;  5L3G A;  3PIP F;  1WJD A;  1UAA A;  3KZI C;  3IRR A;  3K4B A;  1ZQ3 P;  2EPF A;  1EKE A;  5K5R A;  2M34 A;  3AG3 H;  3JRB A;  2XAJ A;  4BEH A;  5M5X J;  5AON A;  2QF7 A;  3LSI A;  1V5G A;  2TRT A;  2Y2Z A;  4M71 A;  3E7L A;  3ZR8 X;  4CCK A;  2IA2 A;  1L3L A;  2LKS A;  3ZQQ A;  1OCP A;  4KYW A;  4R8H A;  1BOB A;  4CYC B;  3FXU A;  1FPQ A;  3WTS C;  2EA4 A;  2H27 A;  1R36 A;  1Z6R A;  5D6F A;  1YRN B;  3W6K B;  3DV8 A;  1KU2 A;  5TRD A;  1XDU A;  4L9N A;  3LSK A;  5DCF A;  1Y39 A;  4E7H A;  2JPB A;  4A3K J;  2YPR A;  3DTE A;  2LLK A;  5FKM A;  1ZRE A;  2WV1 A;  2E2J J;  2WAE A;  1FP2 A;  2Y75 A;  1G4D A;  1OPC A;  5J1R A;  3SZP A;  2GA2 A;  4I7H A;  2V4J C;  3SXY A;  3CCM I;  4LOC A;  3AG1 H;  4CCL A;  3JSP A;  5TIS C;  3GF2 A;  3I53 A;  3TO9 A;  5EEA A;  2PLY A;  5IOY A;  1FX7 A;  3G6E I;  2L0K A;  1QNT A;  2EWN A;  2QA4 I;  3EPZ A;  1KU3 A;  4J00 A;  2V7F A;  2V9K A;  1FOK A;  3QYB A;  1SD5 A;  1ZGW A;  1DPU A;  2NS7 A;  1HW2 A;  4L5I A;  4WX9 A;  3U1K A;  1SFU A;  5D6E A;  4AIH A;  5J1Y A;  1YIO A;  2JPC A;  2DDA A;  4XRF A;  2B9S A;  2PG4 A;  3HGG A;  1VQ5 I;  4I6Z A;  3OYK A;  3BJA A;  2GQQ A;  3U1D A;  2Z9O A;  2IEK A;  4CIC A;  1K7A A;  1IO2 A;  3VYR B;  2RVC A;  4UUS B;  1I3Q J;  5IPA A;  3L09 A;  3FM5 A;  1PUF A;  4EJO A;  1P92 A;  1VQK I;  3MEX A;  2NNN A;  4N9H A;  1LE8 A;  5B66 C;  1BI1 A;  5IOZ A;  3TW7 A;  4BJ5 C;  3G71 I;  2DYS H;  3HPG A;  5E20 A;  3S1M J;  3QU6 A;  2V1U A;  4YEL A;  4U0W A;  5DCM A;  1JJ8 C;  2K3F A;  2XRN A;  1IAW A;  2PMZ A;  1ETY A;  2HWV A;  4C9Y A;  1FYM A;  2BEO A;  1PP7 U;  3BTL A;  2O6G E;  2A61 A;  2VL8 A;  3ZOB A;  4E4H A;  4YIF A;  2VXZ A;  3J81 Z;  3Q3S A;  2D5V A;  3D5R C;  1U78 A;  1HC8 A;  4U0Y A;  3G3Z A;  1YLF A;  2VKD A;  3CUO A;  1E2X A;  2HS5 A;  4GYI A;  4AU7 A;  1Z91 A;  2ZC2 A;  3CUQ B;  2JUG A;  1U5T A;  1SVO A;  4ASN A;  4DJA A;  2MSY A;  4IRH A;  1R6R A;  4YG2 F;  4Z2Y A;  3TOB A;  3VDX A;  2FSW A;  2IXS A;  4QPO A;  3JRD A;  2E1N A;  1QHG A;  2ZME C;  2W85 A;  2XAF A;  3OOU A;  1QZZ A;  1S9H A;  3N05 A;  3T8R A;  3NAR A;  2BGC A;  4PSX A;  2W25 A;  5B1A H;  1YX3 A;  3FZV A;  2J5P A;  4F91 B;  5B3S H;  2FOK A;  2PJR A;  4AWX B;  2XV4 S;  1Y0U A;  5EZH A;  2HU9 A;  4A12 A;  3OY9 A;  3PO3 J;  2DMU A;  2EBI A;  4BHB A;  4NB5 A;  4NUB A;  2LVS A;  1BM9 A;  1SFO J;  4DYC A;  2C6Y A;  3BG5 A;  2QEX I;  1RET A;  3SZT A;  2BY3 A;  3WOD F;  5KAI C;  2OTJ I;  3R6S A;  4Y17 A;  5ICE A;  3H0G J;  4CCN A;  3WU2 C;  3ONQ A;  2PI0 A;  4KUM A;  2JSC A;  3RYR A;  4PK4 A;  1Z9C A;  2HXO A;  5FKN A;  3C1D A;  1JHH A;  1R7J A;  2RC4 A;  2VJ4 A;  1S5L C;  2LG4 A;  3BOQ A;  3J7A O;  5J8F A;  2BXY A;  3T1B A;  3J7Y J;  2VBW A;  4I98 B;  2W7N A;  2HKX A;  5EGO B;  1X3U A;  1G8X A;  3FF5 A;  4A2U A;  1R49 A;  1WJ5 A;  4DNC A;  1ZAR A;  2OAZ A;  3FMQ A;  3I58 A;  1EF4 A;  2CQ7 A;  4Y15 A;  3QQA A;  2Z33 A;  2NVQ J;  3H3Z A;  2VOD A;  4XON A;  3RKQ A;  4IPA A;  4NQW B;  3WG7 H;  4A0Z A;  1U2W A;  3GCM A;  5CJ9 A;  4IHW A;  4UUV A;  3DPL C;  3H3U A;  2WBM A;  4JX4 A;  4CYC A;  3H0D A;  2FU4 A;  4D7N A;  2QQ9 A;  4G6Q A;  2ZJQ F;  2A6H F;  2F48 A;  1ZRC A;  3W3C A;  3S16 J;  2OJE D;  5GTH C;  2EH3 A;  4BH9 A;  1YRN A;  2P7V B;  4O3M A;  1F36 A;  2UXN A;  5E79 C;  3S3M A;  4KMU X;  2W84 A;  3GBG A;  3VOD A;  4N4N B;  4BXF A;  4IHY A;  1ETK A;  3KP2 A;  2FE3 A;  2RNG A;  2ZXH A;  1YS6 A;  4LK1 F;  4B43 A;  1H9T A;  5J4V A;  4EV0 A;  1T56 A;  1D0Z A;  1MJA A;  2KIU A;  2UV1 A;  5JLW A;  4FCY A;  3K4L A;  3FK7 A;  3EYI A;  2KIF A;  4A5M A;  3A0B C;  3I71 A;  4N4O B;  5IP7 J;  3OIP A;  3SDG A;  1MH4 A;  4EEF G;  4XMY A;  1SVM A;  4LJZ F;  3C2B A;  2K9M A;  1S7E A;  4EVI A;  3QOE A;  5F1R A;  4AC0 A;  1AKH B;  4A3C J;  4CXF A;  3BTC A;  3NEU A;  4BY1 J;  2WB1 N;  2Y48 A;  3GFJ A;  1YTY A;  5J8C A;  1GT0 C;  3GLL A;  3HOZ J;  1QHH D;  4CCO A;  3RYP A;  4EM0 B;  2DT6 A;  1OCR H;  4HDV A;  1I1S A;  4LD5 A;  3OR1 C;  4BNC A;  4M9X A;  1XB4 A;  2R0Q C;  5D8K B;  5ICF A;  3M4O J;  1X1C A;  3ZQL A;  2JTV A;  3KIO A;  4ZTJ A;  3ABT A;  1BC7 C;  1I27 A;  1FMW A;  1HW1 A;  4A3I J;  4BXX J;  1IN5 A;  2CV0 A;  1IUY A;  2DTZ A;  3GX4 X;  1MSE C;  1N75 A;  4KIC A;  3LA7 A;  1TWA J;  1WQ2 A;  2ZNY A;  1MNM C;  2E36 A;  4GDF A;  2R5Y A;  5H2F C;  1MKM A;  1WWX A;  1TW2 A;  3OS0 A;  2XC7 A;  1X2N A;  3O6B B;  2DXI A;  2E1C A;  4IQJ A;  2F5F A;  3IH3 A;  2BYV E;  3ZMD A;  4RGU A;  4IZZ A;  4G7H F;  3PSI A;  2KDO A;  3GYH X;  2A05 A;  3K70 C;  1RR8 C;  2NAZ A;  4AIK A;  5DD8 A;  2M8E A;  5KNL A;  1KZH A;  4D9J A;  2F5E A;  3E6B A;  1SFK A;  4UUT A;  1GHC A;  1ZLK A;  3DPU A;  1T0F C;  2M4K A;  3QP5 A;  4H0E A;  4IKF A;  2WV0 A;  3FWE A;  5FLV A;  5TGT A;  2GIV A;  2TCT A;  1MBG A;  2HNH A;  4GRI A;  4WXC A;  2CV2 A;  2V9P A;  3JRG A;  2XHK A;  5EEH A;  4M3G A;  2VUM J;  1BR4 A;  1LUJ B;  3BR0 A;  2I5U A;  1MZB A;  1XGM A;  4TV7 A;  1JUS A;  5DDG A;  4C2U A;  4EJU A;  4D5C A;  5IT9 Z;  1O3Q A;  3HTU A;  3V8K A;  2X51 A;  4ENN A;  4IRI A;  4EAT A;  5IP9 J;  3F8F A;  2JA6 J;  3IH2 A;  4FET A;  3BY6 A;  1B6A A;  4RAZ A;  5J3L A;  3BCA A;  2OCC H;  2G7H A;  3WTU C;  4PZJ A;  2JWT A;  4BGD A;  3ERM A;  1FOY A;  3HRM A;  3REO A;  3IRQ A;  1RIO H;  2VQL A;  2RGV A;  2BY0 A;  4HZF A;  4G7Z F;  1M1E B;  3H35 A;  5GPA A;  2I8D A;  2JZY A;  1X58 A;  5JFR A;  2ELJ A;  2H94 A;  1P2F A;  1FTZ A;  3Q9S A;  2V79 A;  4WK8 F;  1W5T A;  1QQI A;  4G6T B;  1VI0 A;  2CO5 A;  2OUM A;  4ZDO A;  1T8I A;  4YFK F;  1YJN I;  3OYD A;  3SDB A;  4IHV A;  3GLX A;  2Z1D A;  4ZDL A;  2ID3 A;  2K4B A;  3ABU A;  4R79 A;  3GTP J;  3HDD A;  3CDL A;  3HHH A;  1F5T A;  1IN4 A;  3NQO A;  3OYE A;  2AHQ A;  1LNW A;  1YFH A;  1HKS A;  4IX7 A;  3BCB A;  2OU2 A;  3S14 J;  5DTD A;  3VPR A;  3S2H J;  5CKT A;  1IRG A;  4XOT A;  2M7B A;  2HOE A;  4BXU A;  2AO9 A;  1DP3 A;  2DA4 A;  4L9T A;  2CSO A;  1KON A;  5FD5 A;  1X1B A;  2GXG A;  2DFF A;  1X1P A;  4YEJ A;  3JRE A;  4NC7 A;  3ZMZ A;  1MBH A;  4I0B A;  4HAM A;  3A0H C;  4PJJ A;  2R7Z J;  3BTJ A;  3OYA A;  4X1E A;  2BHZ A;  5K7F A;  5FO5 A;  2ME6 A;  4LLL A;  2L9S A;  1I1G A;  3ML6 A;  1AKH A;  3H3V K;  1OCC H;  1J7K A;  3NRV A;  2WC2 A;  1TBX A;  4PJN A;  1Y1W J;  3EUK L;  3CCR I;  3I59 B;  2ZSI B;  2HOT A;  3S3O A;  3K1M A;  5ICG A;  2V9V A;  1D8J A;  3CMY A;  4FX4 A;  1PDN C;  3T8T A;  2KDZ A;  2LR8 A;  3R0A A;  1VQ6 I;  2MFZ A;  2P7C B;  2CFX A;  2QQB A;  2HVS A;  3ERE D;  4GYG A;  1WJF A;  2I10 A;  1KQ9 A;  2RV8 A;  1U6G A;  4UVB A;  3LA2 A;  5LHI A;  1WHU A;  4G6D A;  4AID A;  1WJE A;  2XAH A;  2EV0 A;  3F0C A;  1BIB A;  4A3L J;  1ZRF A;  2CGP A;  4II2 A;  1QZE A;  3KCC A;  3L9F A;  3KZZ A;  1OFC X;  4XN3 A;  4HX8 A;  2QSH X;  1XD7 A;  4XK4 A;  4HNT A;  2QBY B;  3OS2 A;  2E19 A;  2DOA A;  4EQQ A;  5FLM J;  3PJR A;  2BV6 A;  5E1X A;  4F55 A;  2HOS A;  1HW5 A;  2GXA A;  3ABL H;  2IT0 A;  2E1M B;  3CCL I;  3DKY A;  2F5V A;  4BE1 A;  5KHD A;  4CHU A;  1G59 A;  3S17 J;  3RPQ A;  2IBD A;  3K4K A;  3KEO A;  1UMQ A;  2ZCW A;  3R60 A;  2M87 A;  2G7U A;  5JR3 A;  4XLA A;  4XQF A;  4U88 A;  5J6X A;  4I2O A;  2XGC A;  2Q8K A;  2EIL H;  3CF2 A;  1ZR4 A;  4E70 A;  1MMG A;  1X4P A;  5E18 F;  2OD5 A;  2Y69 H;  3E6M A;  1FTT A;  1HDD C;  2F6C A;  4OWR B;  1GV5 A;  4NDL A;  5GAG J;  2R7F A;  2IGM A;  4BS9 A;  4KMF A;  1L0O C;  3TED A;  1ZYR F;  3MMY B;  1LKX A;  3V7C A;  2XVC A;  1BI0 A;  3ASO H;  1I3A A;  2YX4 A;  1Z7U A;  1BW6 A;  2NVU B;  3PFY A;  1V3F A;  3BR5 A;  2ZB9 A;  2WA0 A;  2VKE A;  4HQM A;  2VN2 A;  4Y52 J;  1J5Y A;  3BZK A;  3WGG A;  5BPI A;  2O8K A;  5L3B A;  1BIA A;  1YHQ I;  1ENH A;  2JVG A;  4PCQ A;  1P4W A;  3F8N A;  1IGN A;  1SMY F;  4E7S A;  3CLQ A;  4FE4 A;  2VXD A;  4C2M J;  4ENJ A;  1YI2 I;  4V19 K;  3KE2 A;  2OA4 A;  2JMW A;  2XF7 A;  4UV9 A;  3MKW B;  1OYI A;  2HZT A;  1JE8 A;  2F4O B;  1Y1V J;  5IY5 H;  5B1B H;  1ON1 A;  1TQM A;  5LGT A;  4HEA 2;  2H1L A;  3S93 A;  3TDU C;  3HKZ A;  2JQ7 A;  1LVA A;  2VKV A;  1WRJ A;  3CZ6 A;  3GZ5 A;  3L2W A;  4J19 A;  3NAU A;  1P7I A;  1QGP A;  4JBA A;  3F21 A;  2Y9Z A;  2L5Q A;  1FOW A;  4A3M J;  1PYV A;  1XGO A;  3PNT A;  1VZ0 A;  3TBI A;  3K69 A;  3OR2 C;  2NVT J;  5LD2 C;  2YUS A;  1PUF B;  2KT0 A;  1R5H A;  1V4R A;  1LE8 B;  2A3S A;  2X6O A;  1LEB A;  3OYB A;  3K2A A;  1N78 A;  5LRR A;  3OYJ A;  2GXB A;  4KFC A;  3U21 A;  1Z05 A;  5E8I A;  3PM1 A;  3OS1 A;  4HQE A;  4U87 A;  1NHA A;  2IAI A;  2VBY A;  4AVZ A;  5DCM B;  3G1M A;  5FLX Z;  3PNY A;  2ESN A;  2O0Y A;  5D5X B;  4D1Q A;  2AXT C;  2O3F A;  2OQR A;  5DUK A;  2XGD A;  4ANJ A;  2Z5U A;  4PUS A;  2CYY A;  3RCO A;  3HRS A;  1TWC J;  4M3D A;  3U2R A;  1YJ9 I;  1YQA A;  4XLF A;  2Z99 A;  3TKY A;  4BQO A;  1S7A A;  3AAF A;  3LOC A;  2X1D A;  3WE3 A;  5KAF C;  1BI3 A;  1KYZ A;  1XCB A;  1JT6 A;  1X1A A;  1U5T B;  2W00 A;  3KYD B;  4ZDP A;  5J1U A;  3CCV I;  2XAQ A;  1HKQ A;  3I4N J;  2Y31 A;  2ZFU A;  3ZQG A;  4Z6Y A;  3DKX A;  4EM2 A;  3BJO A;  4HSR A;  4BBR J;  2BHY A;  2ZJ2 A;  2VE9 A;  4RBO A;  1O57 A;  1XGN A;  2YS9 A;  2JA8 J;  2PMZ N;  3I59 A;  2HVQ A;  4MFE A;  4PFO A;  3I3L A;  1R1U A;  4H4K C;  2PJR B;  4M3F A;  1PJR A;  2J5O A;  5AIQ A;  3ZQH A;  5FD6 A;  3FXJ A;  5M3M J;  5E3L A;  2X4H A;  2VPL A;  5HNF A;  1OKR A;  4LLN A;  4QPQ A;  2EB7 A;  2ZXI A;  3I55 I;  4WF2 A;  4ZYH A;  2R4G A;  5GPC A;  1JKO C;  5LLQ A;  3TO6 A;  1WH7 A;  5HDK A;  3KP4 A;  1H89 C;  2UWM A;  3BZC A;  1XDS A;  4FAS D;  4P1W A;  3KP3 A;  5A2Q K;  2LC2 A;  1YW8 A;  3FBN B;  3EQL F;  2KPM A;  2V6E A;  2DBB A;  4QSH A;  3BQY A;  4UV8 A;  1LVK A;  2KJB A;  1JKP C;  2M8G X;  2M3A A;  5HS9 A;  4S0H B;  3ZMT A;  1W1W E;  2GIZ A;  1K61 A;  3VSL A;  2ZME A;  2BOL A;  1QRY A;  3FX3 A;  1D1C A;  2DLL A;  3A1Y A;  2XDV A;  5F1J A;  1H8A C;  3ZN0 A;  5J40 A;  4B44 A;  4E7L A;  3DXJ F;  1RR7 A;  2F5D A;  2HPI A;  3B02 A;  4NC6 A;  2XRO A;  1FBU A;  3OYC A;  3CCY A;  3RKX A;  1QU3 A;  2XKO A;  1T08 B;  3JSO A;  2EV6 A;  4S05 A;  2V1N A;  4KT6 A;  3BWG A;  1OIS A;  1KU9 A;  4P9U A;  2PJP A;  3J80 Z;  2A5W A;  1ZG3 A;  3IHU A;  1RZ4 A;  2O7O A;  4DBR A;  2JVH A;  2IS6 A;  2K3P A;  5F0H A;  4XSX F;  4IEJ A;  3I56 I;  1ONV A;  2STW A;  2R7O A;  4HW0 A;  3PIO F;  4ZC3 A;  4C2T A;  4Q4Z F;  3PSF A;  3RI4 A;  1R4M B;  2E2H J;  3TMO A;  4EGY A;  5IYB J;  4KIB A;  5AIP A;  4HV5 A;  5LBQ A;  2IS2 A;  1N77 A;  3JW4 A;  3DBL B;  5FRM A;  5D5U B;  2HDC A;  4E7I A;  3H5R A;  2R7S A;  2ZBK A;  4F7Z A;  4RMN A;  1P4X A;  3L2R A;  1T2K A;  5LHG A;  1GV2 A;  4UY8 I;  2QZ8 A;  1Z21 A;  2DMN A;  1F9N A;  3BR3 A;  3MN2 A;  2P5V A;  4HA8 A;  5L3F A;  2COB A;  1DU0 A;  2NOG A;  1ACI A;  1XCV A;  1F1Z A;  1JUM A;  3DBH B;  1D0X A;  1XGS A;  3AG4 H;  2XAU A;  1U8B A;  2R5Y B;  4HG2 A;  3WG9 A;  3DCF A;  1SD7 A;  2XAG A;  3OWT A;  3F3X A;  3SEZ A;  1V55 H;  1DGW Y;  3DU5 A;  4F52 A;  5ICC A;  4K2E A;  3SEQ A;  1HDP A;  3GFM A;  1FBS A;  2DA5 A;  3Q0U A;  3CP8 A;  2Q0O A;  2BE5 F;  2WY7 Q;  4IHT A;  3QPL A;  3OV8 A;  2KJC A;  4L5E A;  4PDK A;  2IRF G;  4OMY A;  3FK6 A;  3SFZ A;  1KYW A;  3C2G A;  2XF5 A;  3KYL A;  3H5N A;  1K79 A;  1DDN A;  1R23 A;  5HS7 A;  2PN6 A;  3J81 K;  3AL0 C;  3TOA A;  4M6V A;  3MZH A;  5HLT A;  2VC1 A;  1NG6 A;  3BT9 A;  2RN7 A;  2E5Z A;  4FT8 A;  4E6K G;  3OIO A;  2KKO A;  3QAH A;  4DOZ A;  4GCV A;  3FMS A;  2MC3 A;  3PUF A;  1NK3 P;  5DS9 A;  1LFP A;  3CJT B;  1YJW I;  2DYR H;  2XSJ C;  4OIR F;  1Z7L A;  2HQN A;  2DFI A;  3EUH C;  2HPM A;  1K83 J;  1KQ0 A;  1XSV A;  3DQV C;  4DBQ A;  2XGX A;  2CH0 A;  1WJA A;  4IHS A;  4OIO F;  1B1B A;  5EZG A;  4O5V A;  4M6X A;  4BJT A;  3E1S A;  4OOI A;  2DT7 B;  3VSK A;  1BL0 A;  2DA3 A;  3DWL E;  3H9Q A;  2IS1 A;  4MGR A;  1J0R A;  2M4G A;  4XN0 A;  2LBF A;  5HLH A;  3CD6 I;  2HTS A;  3HRT A;  1ZK8 A;  3BG7 A;  4B09 A;  2ZKZ A;  2DW4 A;  1IUF A;  1VQP I;  1T0F A;  1G3S A;  5FKO A;  3KP6 A;  2UXX A;  3FHZ A;  3S2W A;  1IV8 A;  2X1E A;  2V1D A;  3B6C A;  4XBF A;  5ERI A;  1HLV A;  3X2Q H;  5DV5 A;  3E0J B;  1Z0X A;  3QWL A;  1HA8 A;  3ZMV A;  2DK5 A;  1VFC A;  3FM3 A;  1B59 A;  3W2V A;  2LNB A;  1QPM A;  2JRM A;  3ZQF A;  2M30 A;  3IWF A;  3R4K A;  1ZGA A;  3DLA A;  3P9K A;  1IV6 A;  4KNY A;  2RDP A;  2R7D A;  1WFX A;  3K6G A;  3KPH A;  2JJ7 A;  3C3W A;  2D1H A;  5JI6 A;  1G3T A;  4XLE A;  3F6O A;  3L2U A;  3OIQ A;  1PVE A;  3LNQ A;  1A6Q A;  3MZY A;  4ETS A;  2WAQ A;  2FQ3 A;  3E6D A;  3CF5 F;  2L9R A;  3FKJ A;  2K86 A;  4RAY A;  4IO9 F;  3HM5 A;  4A0X A;  4AYB A;  3VOE A;  3JAM K;  2ELK A;  3T0Y A;  3MCZ A;  1OQY A;  3D5S C;  4OMZ A;  1YO5 C;  2L7Z A;  4UXN A;  3CCU I;  4LLG F;  4ON0 A;  3L2V A;  3FIS A;  1LB2 A;  2HXI A;  3N4M A;  2M45 A;  1E3O C;  3H1C A;  4IL6 C;  4XNF A;  5IYC J;  5LHH A;  3RDI A;  3ZCO A;  1YG2 A;  1A31 A;  4XRS A;  3OYM A;  1LQ1 A;  4WCG A;  1XMX A;  4D5F A;  4OIQ F;  2YX7 A;  1FSE A;  4YII A;  2H6B A;  4LMY A;  2VOP A;  5ED4 A;  3CC4 I;  3ECH A;  3JRI A;  4RLQ A;  2L7F P;  3K0L A;  1MMD A;  3ROU A;  4ZZL A;  1B72 B;  4MEY F;  4X6A J;  2KFD A;  1VQ4 I;  2NVX J;  2BZT A;  1DUX C;  3L7W A;  1R4N B;  2M0M A;  3FXL A;  3LSP A;  3F22 A;  1Z67 A;  2IPQ X;  3HZJ A;  3A01 A;  4HV6 A;  2DMP A;  1NK2 P;  2JA7 J;  3H36 A;  3K1N A;  4G12 A;  2DOE A;  3V8J A;  4DIQ A;  1S8N A;  4LB6 B;  5M3F J;  2F2E A;  2XAS A;  3ZRG A;  2R7X A;  2M7A A;  4A69 C;  1QPI A;  1NTC A;  2G9W A;  4CO8 A;  4FX0 A;  2R5Z A;  3CO6 C;  2IW5 A;  3OYN A;  4BQQ A;  2DPU A;  3EUA A;  1B4A A;  1DQU A;  2MW8 A;  3A02 A;  5CVU A;  2FMY A;  2FUG 2;  1VQM I;  4MEX F;  4L0Y B;  2P5L C;  3RKY A;  1TW3 A;  4BHC A;  1TC3 C;  4LGW A;  2LFB A;  3HOX J;  2MGQ A;  2STT A;  3OL4 A;  5GAH J;  2KQR A;  5D4S A;  3IH4 A;  2QYO A;  3M1E A;  1ZGJ A;  2GBY A;  2FOW A;  4RGS A;  1DP7 P;  5FGM A;  2R92 J;  2P4W A;  3GFI A;  4M73 A;  1MGT A;  1KGS A;  3RSN A;  3BQZ A;  3VFZ A;  1CF7 A;  2QGU A;  2VBZ A;  4AVP A;  2JA5 J;  2PFB A;  4E7J A;  5D8L B;  4M3B A;  3UR3 C;  5IP6 A;  1W36 C;  2GWR A;  3BG9 A;  1WGX A;  4N9I A;  4ZYA A;  3EDP A;  3Q9V A;  2HTJ A;  4BDY A;  1V5E A;  3RJP A;  1POG A;  1X2M A;  4EM1 A;  2E35 A;  4Y7N J;  3O2P E;  1JTX A;  1SFE A;  1TQI A;  1JUP A;  1X3Z B;  5CVV A;  4IQ4 A;  2MLG A;  2IVM A;  4BL0 B;  1JI8 A;  4BYY A;  5H6Q A;  4EMS A;  5GTI C;  2NYX A;  2XGE A;  4RS8 A;  4U7B A;  2HDD A;  2DOF A;  1C0W A;  4Y33 A;  2X9D A;  3L2Q A;  1MNE A;  3NWS A;  4GXO A;  4KIS A;  2OCE A;  2W82 A;  4EJT A;  2FJ1 A;  3KEY A;  3AG2 H;  1Z1D A;  2DT5 A;  2P8T A;  3P5J A;  4A3D J;  2WTE A;  1I50 J;  2HGC A;  2MYS A;  5K7Z A;  1TLH B;  2K4J A;  4BQA A;  2OTL I;  2F4I A;  3L1P A;  2L2O A;  2MH9 A;  2IGN A;  1LJ9 A;  3ULQ B;  1MND A;  2KZG A;  1AOY A;  2QM3 A;  2LY1 A;  3DBR B;  3UKG A;  1AU7 A;  4DZJ A;  5C44 J;  4PJM A;  2W57 A;  1EA3 A;  2LY2 A;  2ZFW A;  2KIQ A;  1AA7 A;  4CZC A;  1BW5 A;  1T6S A;  3F9K A;  1TNS A;  2HEO A;  3WU1 B;  3OSG A;  2E7W A;  3FMR A;  2IGO A;  1HF0 A;  2B63 J;  2HR3 A;  3CTA A;  3ZN1 A;  4RM2 A;  4Q47 A;  1W4M A;  3HKZ N;  1XN7 A;  5CYV A;  1ITY A;  2VAS A;  2Y9Y A;  2V1X A;  5DM7 F;  3LAP A;  2Y0M A;  5FKK A;  1WZ2 A;  2QLZ A;  2FX0 A;  2VJJ A;  3R61 A;  3PFI A;  5F04 A;  4DYQ A;  5IT3 A;  4FE7 A;  5CQE A;  3ECO A;  2ZJR F;  4BU2 A;  3FHN A;  4A5N A;  3JR9 A;  1IN6 A;  4A93 J;  1VQN I;  1D1A A;  3CMM A;  1BJA A;  3GW2 A;  3QYF A;  3W2A A;  3GTL J;  2VQH A;  1WCM J;  2Z16 A;  2YU9 J;  1WH5 A;  1EH6 A;  4XRS G;  1OYW A;  3AKZ A;  3E5U A;  3T5X A;  1OR7 C;  1W7P D;  1MMN A;  4RDU A;  3TP0 A;  2K5C A;  3K7A J;  5FKL A;  2OZU A;  1HSJ A;  2D1V A;  2FEZ A;  5GP9 A;  1R5G A;  4ZTF A;  4GGG A;  5DYM A;  3CMA I;  3F8M A;  5E8G A;  3MKZ A;  1B72 A;  4HF1 A;  4M9Z A;  5L3D A;  2ZXJ A;  1IDY A;  2LD5 A;  2DFE A;  1VND A;  2DCE A;  3ISP A;  4L0Z B;  2A69 F;  1SFX A;  3NWT A;  2P5K A;  2XRL A;  2FBK A;  1UHM A;  2FNA A;  4BJ6 C;  1U0J A;  4QTR A;  1K4S A;  2FML A;  4OIP F;  2CG4 A;  3WHC A;  4L18 B;  1O3S A;  3A2K A;  4RA2 A;  3TP3 A;  5HVQ C;  3H92 A;  1YW7 A;  1S72 I;  2DTR A;  1A35 A;  1O7F A;  1W0U A;  2QKL B;  2ZME B;  3BTI A;  3CUQ C;  3OOP A;  4MIM A;  2L54 A;  2KL4 A;  2GLO A;  1IRF A;  3H5A A;  2ID6 A;  2XIG A;  4A3G J;  1ZKG A;  1OCT C;  1IW7 F;  1FBQ A;  3A03 A;  2AXL A;  5B5E C;  1H88 C;  1JT0 A;  5DD4 A;  1GXQ A;  3K4J A;  4J01 A;  3D5L A;  3F6V A;  5BMZ A;  2MBF A;  4CCM A;  1Y56 A;  2HZD A;  3JTG A;  2O8X A;  1RKW A;  4P96 A;  3P9I A;  2BW3 A;  2EZK A;  2A6E F;  3JRF A;  2W48 A;  1ZG1 A;  4II3 A;  3HPH A;  4NC8 A;  2L4A A;  2E71 A;  4Y4R A;  1JKR C;  1RPW A;  5DM6 F;  5E1Z B;  2QSF X;  2EZI A;  3E97 A;  4U0V A;  1E17 A;  3FIW A;  3P9C A;  2CW0 F;  5DEQ A;  2XPV A;  4BBS J;  1P9Q C;  4O6J A;  3RKW A;  5K1Y A;  4B3X A;  4HBL A;  3ZQ7 A;  2JUC A;  1ZG5 A;  4B47 A;  2CQN A;  2KRC A;  3CC2 I;  1Q1V A;  3M1C A;  1CQT A;  4HYE A;  3VEP A;  1TQP A;  4CSW A;  1TTY A;  4F3Q A;  3SYT A;  4UVC A;  5ILS A;  3SHF A;  1KU7 A;  3HOT A;  1VF9 A;  3LST A;  1NH3 A;  2KRH A;  3WTZ A;  2X6W A;  2KRF A;  2NVY J; 
#chains in the Genus database with same CATH homology
 4D7N A;  2E2H J;  1ETX A;  4HNV A;  3MKL A;  3S16 J;  5E3O A;  2EH3 A;  5IYB J;  9ANT A;  1YRN A;  4A3F J;  1F36 A;  2JK3 A;  5EGO A;  4ABZ A;  5M5W J;  3B6A A;  4V2G A;  3GBG A;  2DMQ A;  4IHY A;  5JLX A;  1ETK A;  5EDN A;  1FJL A;  1IRZ A;  2CJJ A;  1U9O A;  2XB5 A;  5F27 A;  1T56 A;  2LTP A;  1JGG A;  1FIP A;  1RES A;  4FCY A;  5JLW A;  1GV2 A;  2N8G A;  3FK7 A;  4BKX A;  5IP7 J;  2DMN A;  3SDG A;  1MH4 A;  2DA6 A;  3BR3 A;  3MN2 A;  3WHB A;  4BY7 J;  3GTG J;  2CUE A;  4EEF G;  4CYC A;  2COB A;  1DU0 A;  2NOG A;  3C2B A;  2LK2 A;  1JUM A;  1S7E A;  1AKH B;  4A3C J;  4AC0 A;  3BTC A;  5F0C A;  4BY1 J;  1IDZ A;  2WB1 N;  2EZH A;  1U8B A;  1GT0 C;  2R5Y B;  2DA2 A;  3HOZ J;  1TWG J;  3DCF A;  1HOM A;  1XG1 A;  2R0Q C;  4A3J J;  1BJZ A;  2K9S A;  2G0E A;  3M4O J;  1HDP A;  3ZQL A;  2L7M P;  2DA5 A;  3Q0U A;  4A3B J;  3MVP A;  5M5Y J;  2K9N A;  1B8I B;  3QPL A;  4A3I J;  4BXX J;  5EG0 B;  2DTZ A;  4L5E A;  1MSE C;  3FK6 A;  1TWA J;  1MNM C;  3G1O A;  2HOA A;  2R5Y A;  1X2N A;  4M6V A;  3IH3 A;  1FEX A;  3BT9 A;  2EQR A;  3OIO A;  4C3I J;  1NK3 P;  4XRM A;  1W0T A;  1F43 A;  5DS9 A;  5BNG A;  2X48 A;  4B3A A;  2HYJ A;  1B8I A;  1K83 J;  5EG0 A;  4UUT A;  3HEF A;  3GTQ J;  5E3N A;  2E1O A;  3O8G A;  3ZQI A;  2HQ5 A;  4DYR A;  5FLV A;  5EZG A;  3HOV J;  1BL0 A;  2DA3 A;  1I6H J;  2TCT A;  1MBG A;  1APL C;  2CU7 A;  5FJ8 J;  2DA1 A;  5C4X J;  1MH3 A;  2DA7 A;  3JRG A;  5K7H A;  4JX6 A;  3LSG A;  4M3G A;  5HOD A;  3LSR A;  2VUM J;  1ZK8 A;  2LY9 A;  3BR0 A;  3RZD J;  1IUF A;  5FKO A;  1JUS A;  3QPS A;  4D5C A;  2OPT A;  3B6C A;  4JP0 A;  1HLV A;  5C4J J;  1U9N A;  5IP9 J;  1Z0X A;  2FQ4 A;  1VFC A;  5E3M A;  2JA6 J;  3IH2 A;  1LFB A;  3JRC A;  3HGY A;  4MO7 A;  3ZQF A;  2M0C A;  5J3L A;  2Y0S N;  4AUX A;  3TW6 A;  1IV6 A;  4V2F A;  3BR2 A;  3M3Y J;  2JJ7 A;  2JWT A;  3HB9 A;  2H1K A;  5IYD J;  3LSJ A;  5GPA A;  1ORK A;  3LNQ A;  2VI6 A;  1X58 A;  1FTZ A;  3GTO J;  2L9R A;  3JRA A;  2WAQ N;  1TWH J;  1VI0 A;  2ECB A;  3HM5 A;  3DEW A;  2ELK A;  3SJM A;  1Z77 A;  2FD5 A;  4AYB N;  2L7Z A;  4IHV A;  3OSF A;  3BG3 A;  1O4X A;  3FIS A;  2CRG A;  2HXI A;  2ID3 A;  3GTP J;  3HDD A;  3CDL A;  3HBL A;  1E3O C;  2NVY J;  3BR6 A;  4C3J J;  1LFU P;  5IYC J;  1RKT A;  3BR1 A;  3S1Q J;  2AHQ A;  4XRS A;  1FIA A;  2K40 A;  3A01 B;  3GTK J;  3S14 J;  5DTD A;  3HOY J;  4D5F A;  3VPR A;  3S2H J;  1BA5 A;  2AO9 A;  4XID A;  2DA4 A;  3S2D J;  2LP0 A;  1XS9 A;  4A3E J;  1MBJ A;  3JRE A;  3JRI A;  3S1N J;  2L7F P;  3SFI A;  1MBH A;  3RQI A;  2M2E A;  1B72 B;  2R5Z B;  2O9L A;  4X6A J;  1JJ6 C;  2R7Z J;  1WPK A;  3BTJ A;  2NVX J;  4X1E A;  4D7M A;  1MSF C;  5K7F A;  2ME6 A;  1ETV A;  1AKH A;  3GTJ J;  3LSP A;  3H3V K;  1QVT A;  1IC8 A;  1ZR2 A;  3A01 A;  2DMP A;  1Y1W J;  1JTY A;  1NK2 P;  2JA7 J;  2HI3 A;  2HOT A;  4G12 A;  1WI3 A;  3CMY A;  5M3F J;  2KDZ A;  3Q0W A;  2NS8 A;  2LR8 A;  2CQQ A;  4FIS A;  2DJN A;  1UG2 A;  1ZTR A;  3HOW J;  1MBK A;  4A69 C;  1QPI A;  1NTC A;  2R5Z A;  1DU6 A;  2I10 A;  4C3H J;  3S15 J;  1UHS A;  2MW8 A;  3A02 A;  3D1N I;  3F0C A;  4A3L J;  1TC3 C;  1XC5 A;  5F0F A;  1TWF J;  1OFC X;  2LFB A;  4MLO A;  3HOX J;  2MGQ A;  3ZQC A;  4XK4 A;  1A5J A;  1G2H A;  2E19 A;  3IH4 A;  5FLM J;  2GBY A;  2HOS A;  2R92 J;  3S1R J;  2EZL A;  4M3E A;  3S17 J;  3HOU J;  1HCR A;  2IBD A;  3JRH A;  1UMQ A;  3BQZ A;  1SAN A;  2DN0 A;  2JA5 J;  2XGC A;  3RZO J;  4M3B A;  5IP6 A;  1ZR4 A;  3BG9 A;  4FTH A;  2XPW A;  1WGX A;  1FTT A;  1HDD C;  1GV5 A;  5C3E J;  4NDL A;  3G1L A;  1POG A;  1X2M A;  4Y7N J;  1JTX A;  1JUP A;  2MG4 A;  3TED A;  1ZQ3 P;  4GFB A;  2M34 A;  3JRB A;  2XGE A;  1BW6 A;  5M5X J;  2HDD A;  2QF7 A;  3CQZ J;  2X9D A;  1A6I A;  2Y2Z A;  2TRT A;  2ZB9 A;  3BR5 A;  3E7L A;  4Y52 J;  2VKE A;  1OCP A;  2FJ1 A;  2O8K A;  4CYC B;  1ENH A;  1GVD A;  4A3D J;  3Q0V A;  1I50 J;  1IJW C;  5K7Z A;  1MBE A;  1IGN A;  1YRN B;  1R9T J;  4FE4 A;  3L1P A;  4C2M J;  1GDT A;  4JYK A;  4A3K J;  3UKG A;  1AU7 A;  2JMW A;  2LLK A;  1T33 A;  4DZJ A;  5FKM A;  5C44 J;  2R93 J;  1Y1V J;  2WV1 A;  2E2J J;  2Y30 A;  1BW5 A;  3OSG A;  1HF0 A;  2B63 J;  2VKV A;  5J1R A;  3HKZ N;  4J19 A;  3NAU A;  1ITY A;  1P7I A;  2Y9Y A;  4LOC A;  2GM4 A;  2M9H A;  5FKK A;  2Y9Z A;  2FX0 A;  4A3M J;  5EEA A;  5EYR A;  5F04 A;  5IOY A;  4DYQ A;  3IV5 A;  4FE7 A;  2CQX A;  2NVT J;  2YUS A;  2L0K A;  2KT0 A;  1PUF B;  1LE8 B;  1ZGW A;  1ETQ A;  2X6O A;  2XB0 X;  2NS7 A;  3JR9 A;  2K9Q A;  1GUU A;  3K2A A;  4JX5 A;  4A93 J;  1ETW A;  2E2I J;  5J1Y A;  3PM1 A;  3GTL J;  3HGG A;  2IAI A;  4I6Z A;  1WCM J;  4MFD A;  3G1M A;  3W6V A;  2YU9 J;  2LKX A;  1WH5 A;  2IEK A;  4XRS G;  4W97 A;  2XGD A;  4UUS B;  1I3Q J;  5IPA A;  2QCO A;  1TWC J;  4M3D A;  4DZP A;  4RDU A;  3TP0 A;  3K7A J;  5FKL A;  1PUF A;  1LE8 A;  3I4M J;  5GP9 A;  3LOC A;  5IOZ A;  3TW7 A;  1IG7 A;  1JT6 A;  3S1M J;  1B72 A;  5J1U A;  1IDY A;  2LD5 A;  3I4N J;  3O8H A;  2Y31 A;  1VND A;  4B4C A;  1JJ8 C;  3ZQG A;  4BBR J;  4I76 A;  2XRL A;  1ETY A;  4UUS A;  4RBO A;  2VPR A;  2YS9 A;  2JA8 J;  2PMZ N;  4MFE A;  3BTL A;  4QTR A;  2RAE A;  3ZOB A;  5F08 A;  3Q3S A;  2D5V A;  4M3F A;  3WHC A;  1U78 A;  3TP3 A;  3ZQH A;  5M3M J;  1QVU A;  5E3L A;  2MSY A;  4XIC A;  1W0U A;  3BTI A;  5EF6 A;  4MIM A;  2GLO A;  3PO2 J;  3JRD A;  2ID6 A;  5GPC A;  1AHD P;  4A3G J;  3OOU A;  1JKO C;  1OCT C;  3A03 A;  1WH7 A;  1H89 C;  1H88 C;  1JT0 A;  3NAR A;  1JKQ C;  4W1U A;  2ECC A;  2CUF A;  5EZH A;  1OJL A;  2ME0 A;  1RKW A;  1D5Y A;  4QSH A;  3GTM J;  3BQY A;  2XSD C;  2EZK A;  1JKP C;  3PO3 J;  2M8G X;  2DMU A;  2EBI A;  4S0H B;  1P7J A;  3JRF A;  1K61 A;  2LVS A;  2W48 A;  1ETO A;  1SFO J;  4DYC A;  1QRY A;  3BG5 A;  1RET A;  2XPU A;  1JKR C;  1RPW A;  5F1J A;  1H8A C;  2OF7 A;  2EZI A;  3H0G J;  4IHX A;  3FIW A;  1RR7 A;  2XPV A;  4BBS J;  2HXO A;  5FKN A;  3CCY A;  2JN6 A;  4QIW N;  2H8R A;  3FKI J;  5EGO B;  1Q1V A;  1MBF A;  1CQT A;  1EF4 A;  2O7O A;  3QQA A;  4B1R A;  2NVQ J;  5F0H A;  4IEJ A;  3RKQ A;  1VF9 A;  2DMT A;  4IHW A;  2P81 A;  1ZKG A;  4DW6 A;  4JX4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...