4BY1X

Elongating rna polymerase ii-bye1 tld complex soaked with ampcpp
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
134
structure length
116
Chain Sequence
EKEHKLRYNAEKMFSTLSKFIVPETIEAVISISQEFAHNLEEELYKACLNVEKIYTEKVRSLYSNLKDKKNLELKAHVVELPLNKLVNMNASELANPDLQEFKEKRDKIILENFIV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
publication title Structures of RNA Polymerase II Complexes with Bye1, a Chromatin-Binding Phf3/Dido1 Homologue
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
total genus 21
structure length 116
sequence length 134
ec nomenclature
pdb deposition date 2013-07-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF07500 TFIIS_M Transcription factor S-II (TFIIS), central domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.30 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Transcription elongation factor S-II, central domain 4by1X00
2LW4A 4BY1X 4BY7X 1ENWA 3NDQA 3PO3S 4BXXX 3GTMS 2DMEA
chains in the Genus database with same CATH superfamily
2W9ZA 1JKWA 1PKDB 4OB2B 4HLQA 1GUXA 2CZ0B 4OB3B 2CCHB 2ZCFB 4TTHA 4EC8B 5HNBB 3HBLA 2WXVB 4BY1X 3VKGA 5HBEB 4MIMA 1ZP2A 2PHGA 1IREB 4KRCB 1XO2A 3BHTB 4ELLA 2PK2A 3BG9A 4JX5A 1OL2B 3GTMS 3DDPB 4ROEA 2C6TB 3K7AM 4CFWB 3MY5B 2C4GB 3VYGB 2V22B 4BCND 2BS4A 1TD6A 2AHJB 4NC6A 5BNJB 4YC3B 2PMIB 3POMA 1UNHD 4HNVA 2QDJA 2WEVB 4BY7X 3A8HB 4G6LB 5LMKB 4BCMB 4CFUD 4BCFB 1GY3B 4M6VA 3QYBA 2ZZDB 2EUFA 4II5B 4EOKB 4CFNB 2BS2A 4AKGA 2W96A 2DD5B 1OKWB 5LQFB 2WFYB 5IHYA 1BU2A 4CXAB 3G33B 4ZGJB 5CYIB 5EFQB 4F7SB 4MFEA 4FX3B 1OI9B 3X24B 2X1NB 2DMEA 4EC9B 2B9RA 1V29B 4AI6A 4CFVB 3X28B 4EONB 2ZPIB 4F6SB 2DD4B 2R7GA 4Y72B 2IW9B 4UN0A 1UNLD 1H27B 2JGZB 3EOCB 4KRDB 2UUEB 4EOJB 4AKHA 2PJQA 2DXBB 2W99A 2I40B 4F6UB 3O0GD 4HNUA 3HZJA 3X20B 3WVDB 5IDPB 4BCJB 3EIDB 4FM4B 2CJMB 4BCMD 1KXUA 4JX4A 3TNWB 2QQ8A 1H1SB 3DDQB 3BLHB 1H24B 3B57A 4BCIB 5ICPB 1UNGD 4ZGEB 1FINB 4Z6YA 1FVVB 4NSTB 3BG3A 2IW8B 1H1PB 1O9KB 1E7PA 4BCQB 2CYZB 4AKIA 4BCKB 5IDNB 3TNIB 4EOOB 3TNHB 4OR5B 2LW4A 3QYGB 5ACBA 2C5OB 1UGRB 1F5QB 4YOZA 4F7JB 3DJBA 2ZPEB 4YOSA 4HNTA 3TN8B 1JSTB 4F7LB 4F70B 1H25B 2KMGA 3BLRB 2IN3A 1GH6B 1H28B 1VOLA 2CZ1B 5DQWA 2WMAB 3A8LB 3EJ1B 4IMYB 5HVYB 4F7NB 1UGPB 4HL4A 4BCPB 1TFBA 1URCB 2ZPGB 4I3ZB 4BCHB 5I5ZB 4BCGB 4MFDA 3F5XB 4ROCA 4YOOA 4BCQD 4EOMB 3QWLA 1O9KA 3MY1B 2I53A 2C5NB 4QSHA 3HB9A 3KHIA 5FGKB 4F6WB 2WIHB 1H26B 2D0QB 1OGUB 3QHRB 5DQVA 4EOIB 3MIAB 3MI9B 3LQ5B 3QZ5B 1N4MA 1D3UB 1H4LD 1G3NC 2BKZB 4ELJA 2WJ9A 3DTOA 2ZPFB 3HHTB 3A8GB 3QZ9B 1H1RB 1AD6A 4LOCA 4OGRB 3NDQA 4RODA 2W9FA 5EJCA 4EORB 2WHBB 4CFUB 2G9XB 1AISB 4BXXX 2DPPB 3BHUB 1UGQB 2BPMB 2UZDB 2ZPHB 3RGFB 3X25B 2C5VB 1OKVB 4EOQB 3WVEB 1JSUB 2QDYB 4EOSB 2CCIB 2QF7A 3DL1A 5HQ0B 1H1QB 3BG5A 5HBJB 4CFMB 4BBRM 1VINA 2PK9B 1OIYB 3QYHB 4EOPB 3DOGB 3QHWB 3QXEB 1GUXB 3PO3S 2WMBB 3A8OB 2UZBB 2ZPBB 3X26B 3M03A 1OIUB 4OB1B 2W2HA 1QMZB 1C9BA 4ZGDB 2WIPB 2F2CA 2C5XB 2IVXA 4BBSM 3HO8A 3TW7A 4OB0B 4BCOB 1ENWA 1AHJB 2KR6A 1FKMA 3A8MB 4EOLB 3QYEA 1UGSB 1QLBA 2BS3A 1W98B 2WPAB 2G77A 4JX6A 4CFXB 2IW6B 1VYWB 3VYHB 3VKHA 3TW6A 2UZEB 1E9HB 5CEIB 2UZLB 1JOWA 3H4CA 4BCNB 5L2WB 2CZ7B 2QFZA 5HBHB 1P5EB 3BLQB 1OL1B 5IF1B 2CZ6B 2QGSA 3BHVB 4CRLB 2DXCB
chains in the Genus database with same CATH topology
2LW4A 4BY1X 4BY7X 1ENWA 3NDQA 3PO3S 4BXXX 3GTMS 2DMEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LW4 A;  4BY1 X;  4BY7 X;  1ENW A;  3NDQ A;  3PO3 S;  4BXX X;  3GTM S;  2DME A; 
#chains in the Genus database with same CATH topology
 2W9Z A;  1JKW A;  1PKD B;  4OB2 B;  4HLQ A;  1GUX A;  2CZ0 B;  4OB3 B;  2CCH B;  2ZCF B;  4TTH A;  4EC8 B;  5HNB B;  3HBL A;  2WXV B;  4BY1 X;  3VKG A;  5HBE B;  4MIM A;  1ZP2 A;  2PHG A;  1IRE B;  4KRC B;  1XO2 A;  3BHT B;  4ELL A;  2PK2 A;  3BG9 A;  4JX5 A;  1OL2 B;  3GTM S;  3DDP B;  4ROE A;  2C6T B;  3K7A M;  4CFW B;  3MY5 B;  2C4G B;  3VYG B;  2V22 B;  4BCN D;  2BS4 A;  1TD6 A;  2AHJ B;  4NC6 A;  5BNJ B;  4YC3 B;  2PMI B;  3POM A;  1UNH D;  4HNV A;  2QDJ A;  2WEV B;  4BY7 X;  3A8H B;  4G6L B;  5LMK B;  4BCM B;  4CFU D;  4BCF B;  1GY3 B;  4M6V A;  3QYB A;  2ZZD B;  2EUF A;  4II5 B;  4EOK B;  4CFN B;  2BS2 A;  4AKG A;  2W96 A;  2DD5 B;  1OKW B;  5LQF B;  2WFY B;  5IHY A;  1BU2 A;  4CXA B;  3G33 B;  4ZGJ B;  5CYI B;  5EFQ B;  4F7S B;  4MFE A;  4FX3 B;  1OI9 B;  3X24 B;  2X1N B;  2DME A;  4EC9 B;  2B9R A;  1V29 B;  4AI6 A;  4CFV B;  3X28 B;  4EON B;  2ZPI B;  4F6S B;  2DD4 B;  2R7G A;  4Y72 B;  2IW9 B;  4UN0 A;  1UNL D;  1H27 B;  2JGZ B;  3EOC B;  4KRD B;  2UUE B;  4EOJ B;  4AKH A;  2PJQ A;  2DXB B;  2W99 A;  2I40 B;  4F6U B;  3O0G D;  4HNU A;  3HZJ A;  3X20 B;  3WVD B;  5IDP B;  4BCJ B;  3EID B;  4FM4 B;  2CJM B;  4BCM D;  1KXU A;  4JX4 A;  3TNW B;  2QQ8 A;  1H1S B;  3DDQ B;  3BLH B;  1H24 B;  3B57 A;  4BCI B;  5ICP B;  1UNG D;  4ZGE B;  1FIN B;  4Z6Y A;  1FVV B;  4NST B;  3BG3 A;  2IW8 B;  1H1P B;  1O9K B;  1E7P A;  4BCQ B;  2CYZ B;  4AKI A;  4BCK B;  5IDN B;  3TNI B;  4EOO B;  3TNH B;  4OR5 B;  2LW4 A;  3QYG B;  5ACB A;  2C5O B;  1UGR B;  1F5Q B;  4YOZ A;  4F7J B;  3DJB A;  2ZPE B;  4YOS A;  4HNT A;  3TN8 B;  1JST B;  4F7L B;  4F70 B;  1H25 B;  2KMG A;  3BLR B;  2IN3 A;  1GH6 B;  1H28 B;  1VOL A;  2CZ1 B;  5DQW A;  2WMA B;  3A8L B;  3EJ1 B;  4IMY B;  5HVY B;  4F7N B;  1UGP B;  4HL4 A;  4BCP B;  1TFB A;  1URC B;  2ZPG B;  4I3Z B;  4BCH B;  5I5Z B;  4BCG B;  4MFD A;  3F5X B;  4ROC A;  4YOO A;  4BCQ D;  4EOM B;  3QWL A;  1O9K A;  3MY1 B;  2I53 A;  2C5N B;  4QSH A;  3HB9 A;  3KHI A;  5FGK B;  4F6W B;  2WIH B;  1H26 B;  2D0Q B;  1OGU B;  3QHR B;  5DQV A;  4EOI B;  3MIA B;  3MI9 B;  3LQ5 B;  3QZ5 B;  1N4M A;  1D3U B;  1H4L D;  1G3N C;  2BKZ B;  4ELJ A;  2WJ9 A;  3DTO A;  2ZPF B;  3HHT B;  3A8G B;  3QZ9 B;  1H1R B;  1AD6 A;  4LOC A;  4OGR B;  3NDQ A;  4ROD A;  2W9F A;  5EJC A;  4EOR B;  2WHB B;  4CFU B;  2G9X B;  1AIS B;  4BXX X;  2DPP B;  3BHU B;  1UGQ B;  2BPM B;  2UZD B;  2ZPH B;  3RGF B;  3X25 B;  2C5V B;  1OKV B;  4EOQ B;  3WVE B;  1JSU B;  2QDY B;  4EOS B;  2CCI B;  2QF7 A;  3DL1 A;  5HQ0 B;  1H1Q B;  3BG5 A;  5HBJ B;  4CFM B;  4BBR M;  1VIN A;  2PK9 B;  1OIY B;  3QYH B;  4EOP B;  3DOG B;  3QHW B;  3QXE B;  1GUX B;  3PO3 S;  2WMB B;  3A8O B;  2UZB B;  2ZPB B;  3X26 B;  3M03 A;  1OIU B;  4OB1 B;  2W2H A;  1QMZ B;  1C9B A;  4ZGD B;  2WIP B;  2F2C A;  2C5X B;  2IVX A;  4BBS M;  3HO8 A;  3TW7 A;  4OB0 B;  4BCO B;  1ENW A;  1AHJ B;  2KR6 A;  1FKM A;  3A8M B;  4EOL B;  3QYE A;  1UGS B;  1QLB A;  2BS3 A;  1W98 B;  2WPA B;  2G77 A;  4JX6 A;  4CFX B;  2IW6 B;  1VYW B;  3VYH B;  3VKH A;  3TW6 A;  2UZE B;  1E9H B;  5CEI B;  2UZL B;  1JOW A;  3H4C A;  4BCN B;  5L2W B;  2CZ7 B;  2QFZ A;  5HBH B;  1P5E B;  3BLQ B;  1OL1 B;  5IF1 B;  2CZ6 B;  2QGS A;  3BHV B;  4CRL B;  2DXC B; 
#chains in the Genus database with same CATH homology
 2LW4 A;  4BY1 X;  4BY7 X;  1ENW A;  3NDQ A;  3PO3 S;  4BXX X;  3GTM S;  2DME A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...