4BY7X

Elongating rna polymerase ii-bye1 tld complex
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
134
structure length
119
Chain Sequence
b'EKEHKLRYNAEKMFSTLFSKFIVPETIEAVISISQEFAHNLEEELYKACLNVEKIYTEKVRSLYSNLKDKKNLELKAHVVEGKLPLNKLVNMNASELANPDLQEFKEKRDKIILENFIV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
publication title Structures of RNA polymerase II complexes with Bye1, a chromatin-binding PHF3/DIDO homologue.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
total genus 28
structure length 119
sequence length 134
ec nomenclature
pdb deposition date 2013-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF07500 TFIIS_M Transcription factor S-II (TFIIS), central domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.30 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Transcription elongation factor S-II, central domain 4by7X00
3GTMS 1ENWA 3PO3S 4BY7X 2DMEA 3NDQA 2LW4A 4BY1X 4BXXX
chains in the Genus database with same CATH superfamily
2DPPB 2CJMB 5HVYB 2CYZB 2CCIB 2WMAB 3O0GD 2CCHB 2WJ9A 3HBLA 4F6WB 1H26B 1JSTB 3X24B 4EOSB 2QFZA 3QXEB 1N4MA 1UNGD 1JKWA 2G9XB 2QDJA 5FGKB 1VOLA 1H1RB 5CEIB 1OGUB 5HQ0B 4KRDB 5ACBA 5IDNB 4CXAB 2PJQA 2QF7A 3QZ5B 1QMZB 1OKVB 1H1PB 3QYHB 2DMEA 4TTHA 3F5XB 3BHTB 1H24B 2UZLB 4OB0B 5LQFB 1UGPB 2ZPHB 3EOCB 4BCNB 3QZ9B 2W96A 1OIUB 3VYGB 2CZ6B 1W98B 2WFYB 4AKGA 5HBJB 3DDPB 3WVDB 2PMIB 4CFMB 2ZPFB 2CZ0B 4MIMA 4EOQB 4ZGDB 1OIYB 3WVEB 2ZPEB 3BLHB 2KMGA 4Y72B 3K7AM 3X28B 3TNWB 1PKDB 1AD6A 1UNLD 1TD6A 2IW8B 1FINB 2ZCFB 4EC9B 1H27B 4ZGJB 1H1QB 1URCB 4I3ZB 1FKMA 2ZZDB 1GH6B 4EC8B 2C5NB 3POMA 4OB2B 5DQVA 2DD4B 3TNIB 1D3UB 1JOWA 3B57A 3MIAB 3M03A 2WMBB 2C5OB 1UNHD 4AI6A 2QDYB 4BCGB 1GY3B 4CFVB 1XO2A 5IDPB 3DOGB 4F7JB 2AHJB 4LOCA 4BCQB 2PK9B 4CFUD 4BCJB 4CFWB 3A8OB 2G77A 4BCKB 2EUFA 2ZPBB 5HBHB 4F6UB 3HO8A 4OR5B 4BXXX 2PHGA 2QQ8A 4EOOB 1VINA 2ZPGB 1E9HB 2B9RA 3TW7A 3QYBA 5HBEB 3H4CA 5LMKB 4EOJB 4BCHB 4F7SB 4AKIA 3BG9A 4BCIB 4QSHA 1ZP2A 2UZBB 4BCMB 3A8GB 4BCQD 4EORB 2WPAB 2W2HA 5EFQB 3X25B 1VYWB 4M6VA 2WHBB 3VYHB 1O9KB 1OKWB 3BLRB 2C6TB 1C9BA 4NC6A 1AHJB 4IMYB 2WEVB 3BHUB 3HB9A 2IW9B 3QYGB 4G6LB 2PK2A 3BLQB 4II5B 4YOSA 3HHTB 1E7PA 3EJ1B 4BCMD 2CZ1B 4Z6YA 3QYEA 2BKZB 4BCND 1IREB 2DD5B 3TN8B 1H1SB 4OGRB 4BCFB 1BU2A 2R7GA 2BPMB 3A8MB 4HLQA 3EIDB 4EOLB 4F6SB 4FM4B 3G33B 4YOZA 3QHWB 2UUEB 4EOMB 4OB3B 3X20B 2KR6A 2BS3A 5CYIB 4BY7X 2WXVB 1GUXB 4MFDA 2WIHB 2I40B 3MY1B 4CRLB 4NSTB 5IHYA 2C5VB 4HL4A 4MFEA 4ZGEB 3BG5A 1OI9B 2UZEB 4F70B 4BCOB 4ELLA 4FX3B 5I5ZB 4BBRM 3NDQA 2IN3A 1UGRB 3HZJA 1O9KA 4EONB 2C4GB 1JSUB 3A8HB 1OL2B 4EOIB 4ELJA 4JX4A 2F2CA 1UGSB 5L2WB 4JX5A 1ENWA 5HNBB 2W99A 4ROEA 5EJCA 1AISB 2W9ZA 4RODA 3DL1A 2BS2A 1FVVB 3MI9B 3RGFB 3PO3S 2I53A 1F5QB 1H28B 2QGSA 3KHIA 2V22B 2CZ7B 4CFXB 2IVXA 3TNHB 4HNUA 1OL1B 3TW6A 4HNTA 1GUXA 2DXBB 2W9FA 2DXCB 3QHRB 2D0QB 4BBSM 4HNVA 4F7LB 1UGQB 4BCPB 3DDQB 3DJBA 1V29B 1G3NC 3MY5B 3X26B 4OB1B 4F7NB 3GTMS 4BY1X 3A8LB 3BG3A 2X1NB 4ROCA 3DTOA 2LW4A 4YOOA 4KRCB 1H4LD 2WIPB 4EOKB 4AKHA 3BHVB 4EOPB 2C5XB 4CFUB 2ZPIB 1KXUA 3QWLA 4JX6A 2BS4A 1TFBA 5BNJB 4CFNB 5IF1B 2UZDB 5DQWA 5ICPB 1QLBA 3LQ5B 2IW6B 3VKGA 4YC3B 1H25B 1P5EB 2JGZB 4UN0A 3VKHA
chains in the Genus database with same CATH topology
3GTMS 1ENWA 3PO3S 4BY7X 2DMEA 3NDQA 2LW4A 4BY1X 4BXXX
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GTM S;  1ENW A;  3PO3 S;  4BY7 X;  2DME A;  3NDQ A;  2LW4 A;  4BY1 X;  4BXX X; 
#chains in the Genus database with same CATH topology
 2DPP B;  2CJM B;  5HVY B;  2CYZ B;  2CCI B;  2WMA B;  3O0G D;  2CCH B;  2WJ9 A;  3HBL A;  4F6W B;  1H26 B;  1JST B;  3X24 B;  4EOS B;  2QFZ A;  3QXE B;  1N4M A;  1UNG D;  1JKW A;  2G9X B;  2QDJ A;  5FGK B;  1VOL A;  1H1R B;  5CEI B;  1OGU B;  5HQ0 B;  4KRD B;  5ACB A;  5IDN B;  4CXA B;  2PJQ A;  2QF7 A;  3QZ5 B;  1QMZ B;  1OKV B;  1H1P B;  3QYH B;  2DME A;  4TTH A;  3F5X B;  3BHT B;  1H24 B;  2UZL B;  4OB0 B;  5LQF B;  1UGP B;  2ZPH B;  3EOC B;  4BCN B;  3QZ9 B;  2W96 A;  1OIU B;  3VYG B;  2CZ6 B;  1W98 B;  2WFY B;  4AKG A;  5HBJ B;  3DDP B;  3WVD B;  2PMI B;  4CFM B;  2ZPF B;  2CZ0 B;  4MIM A;  4EOQ B;  4ZGD B;  1OIY B;  3WVE B;  2ZPE B;  3BLH B;  2KMG A;  4Y72 B;  3K7A M;  3X28 B;  3TNW B;  1PKD B;  1AD6 A;  1UNL D;  1TD6 A;  2IW8 B;  1FIN B;  2ZCF B;  4EC9 B;  1H27 B;  4ZGJ B;  1H1Q B;  1URC B;  4I3Z B;  1FKM A;  2ZZD B;  1GH6 B;  4EC8 B;  2C5N B;  3POM A;  4OB2 B;  5DQV A;  2DD4 B;  3TNI B;  1D3U B;  1JOW A;  3B57 A;  3MIA B;  3M03 A;  2WMB B;  2C5O B;  1UNH D;  4AI6 A;  2QDY B;  4BCG B;  1GY3 B;  4CFV B;  1XO2 A;  5IDP B;  3DOG B;  4F7J B;  2AHJ B;  4LOC A;  4BCQ B;  2PK9 B;  4CFU D;  4BCJ B;  4CFW B;  3A8O B;  2G77 A;  4BCK B;  2EUF A;  2ZPB B;  5HBH B;  4F6U B;  3HO8 A;  4OR5 B;  4BXX X;  2PHG A;  2QQ8 A;  4EOO B;  1VIN A;  2ZPG B;  1E9H B;  2B9R A;  3TW7 A;  3QYB A;  5HBE B;  3H4C A;  5LMK B;  4EOJ B;  4BCH B;  4F7S B;  4AKI A;  3BG9 A;  4BCI B;  4QSH A;  1ZP2 A;  2UZB B;  4BCM B;  3A8G B;  4BCQ D;  4EOR B;  2WPA B;  2W2H A;  5EFQ B;  3X25 B;  1VYW B;  4M6V A;  2WHB B;  3VYH B;  1O9K B;  1OKW B;  3BLR B;  2C6T B;  1C9B A;  4NC6 A;  1AHJ B;  4IMY B;  2WEV B;  3BHU B;  3HB9 A;  2IW9 B;  3QYG B;  4G6L B;  2PK2 A;  3BLQ B;  4II5 B;  4YOS A;  3HHT B;  1E7P A;  3EJ1 B;  4BCM D;  2CZ1 B;  4Z6Y A;  3QYE A;  2BKZ B;  4BCN D;  1IRE B;  2DD5 B;  3TN8 B;  1H1S B;  4OGR B;  4BCF B;  1BU2 A;  2R7G A;  2BPM B;  3A8M B;  4HLQ A;  3EID B;  4EOL B;  4F6S B;  4FM4 B;  3G33 B;  4YOZ A;  3QHW B;  2UUE B;  4EOM B;  4OB3 B;  3X20 B;  2KR6 A;  2BS3 A;  5CYI B;  4BY7 X;  2WXV B;  1GUX B;  4MFD A;  2WIH B;  2I40 B;  3MY1 B;  4CRL B;  4NST B;  5IHY A;  2C5V B;  4HL4 A;  4MFE A;  4ZGE B;  3BG5 A;  1OI9 B;  2UZE B;  4F70 B;  4BCO B;  4ELL A;  4FX3 B;  5I5Z B;  4BBR M;  3NDQ A;  2IN3 A;  1UGR B;  3HZJ A;  1O9K A;  4EON B;  2C4G B;  1JSU B;  3A8H B;  1OL2 B;  4EOI B;  4ELJ A;  4JX4 A;  2F2C A;  1UGS B;  5L2W B;  4JX5 A;  1ENW A;  5HNB B;  2W99 A;  4ROE A;  5EJC A;  1AIS B;  2W9Z A;  4ROD A;  3DL1 A;  2BS2 A;  1FVV B;  3MI9 B;  3RGF B;  3PO3 S;  2I53 A;  1F5Q B;  1H28 B;  2QGS A;  3KHI A;  2V22 B;  2CZ7 B;  4CFX B;  2IVX A;  3TNH B;  4HNU A;  1OL1 B;  3TW6 A;  4HNT A;  1GUX A;  2DXB B;  2W9F A;  2DXC B;  3QHR B;  2D0Q B;  4BBS M;  4HNV A;  4F7L B;  1UGQ B;  4BCP B;  3DDQ B;  3DJB A;  1V29 B;  1G3N C;  3MY5 B;  3X26 B;  4OB1 B;  4F7N B;  3GTM S;  4BY1 X;  3A8L B;  3BG3 A;  2X1N B;  4ROC A;  3DTO A;  2LW4 A;  4YOO A;  4KRC B;  1H4L D;  2WIP B;  4EOK B;  4AKH A;  3BHV B;  4EOP B;  2C5X B;  4CFU B;  2ZPI B;  1KXU A;  3QWL A;  4JX6 A;  2BS4 A;  1TFB A;  5BNJ B;  4CFN B;  5IF1 B;  2UZD B;  5DQW A;  5ICP B;  1QLB A;  3LQ5 B;  2IW6 B;  3VKG A;  4YC3 B;  1H25 B;  1P5E B;  2JGZ B;  4UN0 A;  3VKH A; 
#chains in the Genus database with same CATH homology
 3GTM S;  1ENW A;  3PO3 S;  4BY7 X;  2DME A;  3NDQ A;  2LW4 A;  4BY1 X;  4BXX X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...