4BY9D

The structure of the box cd enzyme reveals regulation of rrna methylation
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
121
structure length
121
Chain Sequence
KPSYVKFEVPKELAEKALQAVEIARDTGKIRKGTNETTKAVERGQAKLVIIAEDVDPEEIVAHLPPLCEEKEIPYIYVPSKKELGAAAGIEVAAASVAIIEPGKARDLVEEIAMKVKELMK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Structure of the Box C/D Enzyme Reveals Regulation of RNA Methylation.
pubmed doi rcsb
source organism Pyrococcus furiosus
molecule tags Transferase/rna
molecule keywords SSR26
total genus 36
structure length 121
sequence length 121
chains with identical sequence G, J, M
ec nomenclature
pdb deposition date 2013-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 4by9D00
1X7OA 2VGNA 4TZZA 3LFOA 2QI2A 3N4ZA 3VMFB 2JNBA 1DT9A 2KG4A 1CK2A 1SDSA 3CCJF 5GIPC 1XBIA 1Q81H 3FFMA 1YJ9F 3VI6A 4X3LA 3NMUC 3NVKE 3CCVF 1KQSF 1X52A 5DCVA 5EO3A 1KD1H 1ZWZA 1IPAA 3CCSF 3G4SF 3CCLF 1YJNF 1W42A 4NUTA 2KTVA 3CCEF 3G71F 3JCMM 5FLXM 3PLAC 3I56F 5EWRA 2OHWA 3LWVC 1YIJF 3V7QA 3CPWF 1K8AH 3CG6A 3CC7F 5FJ4C 1W3EX 3CPQA 3PAFA 4BW0B 1H7MA 3AGKA 3OBYA 1Q86H 1CN7A 1S72F 5GAPK 3HAXD 3RA5A 5A2QM 1RA4A 1VQ6F 3WXMB 3O85A 3I55F 1VQ5F 3IR9A 3N4YA 3LWRC 1VQ7F 3CC4F 3V7EA 1K73H 1GO0A 5G4VC 2AIFA 1VQLF 2CZWA 1VQPF 1PXWA 3CCMF 3LWQC 2VGMA 2I6DA 3GYQA 1T0KB 5IT9M 1GO1A 3SIUA 1VQMF 3NK7A 3MCAB 1W40A 2BO1A 1YI2F 2QEXF 1M1KH 1X7PA 2FC3A 3HJWC 3J81M 1KC8H 5GIOC 1QVFF 3NK6A 3CMAF 3RA6A 3CD6F 2OTJF 3CC2F 3OBWA 2LBWA 5GINC 1K9MH 2WALA 1W2BF 2ALEA 3J7AR 2HVYD 1YITF 5G4UC 4X3MA 1M90H 1VQ4F 2QA4F 1Q82H 3J80M 1NMUB 5GANK 4LCKA 1GZ0A 1VQ9F 1VQKF 1W41A 1VQNF 1NJIH 1VQ8F 3G6EF 3CCQF 1JJ2F 1E7KA 3NVIB 3JAMM 3E20B 1YHQF 3LWOC 3SIVA 1Q7YH 2OZBA 3OW2F 1QVGF 1YJWF 4C4WC 3CXCF 3CCUF 3ON1A 4BY9D 2KTUA 1RLGA 2OTLF 3E1YA 2LBXA 3LWPC 3CMEF 1VQOF 3CCRF 1N8RH
chains in the Genus database with same CATH superfamily
4ZHWA 3RYIA 2H6LA 2VAWA 5CA1B 2IG8A 1SDSA 3KE1A 5LXTA 4X20B 5EB1B 3FFMA 1YJ9F 3VI6A 4X3LA 3NMUC 3JATA 4U39A 2BTUA 3K14A 1X52A 4O4HA 5EO3A 1Z5VA 4YJ3A 3VTIC 5ITZA 3IEWA 4E6EA 3CYPB 1W5BA 4RQOA 1W42A 1Q8RA 4O4JB 5CA0B 5FLXM 4O2AB 2FGYA 5B8FA 5CB4A 3LWVC 5FNVA 1JFFB 3F6MA 2VAMA 3N2KA 3CC7F 1H48A 5FJ4C 1H7MA 5LP6A 3HWUA 3IEQA 1CN7A 5J2TB 1Z5WA 3C9SA 4BVRA 3JVHA 5EYPB 3LDTA 3WJPA 3S03A 3U0OA 1VQ7F 5HY4A 2H8EA 5G4VC 1VQLF 3JAKB 2UYNA 3LWQC 2HS0A 3GYQA 4HNAB 2KGWA 1T0KB 5HXZA 5KMGA 1RQ2A 2B33A 4F6RB 2Z01A 1XRGA 1YI2F 2K1SA 5ITZB 3WGLA 1W5EA 3K12A 3FD5A 1QVFF 3CMAF 3RA6A 5IJ9A 2HRUA 5HY2A 3J7AR 4ZHVA 4B62A 1YITF 4I55A 1IV1A 4ZHQA 2HP0B 1VQ4F 5MN4A 5LYJB 4ZHYB 1VQ9F 1NJIH 1VQ8F 1DBFA 2ZF8A 4LNUA 5BMVA 4C8EA 1U43A 5C8YB 5GONA 3LWOC 3JAWB 2UYNB 2R6R1 4C4WC 3C9UA 3CYQA 3CCUF 3HKDB 4HNAA 4X1YA 1QD9A 1RLGA 2Z1EA 3KJKA 3V3TA 5JQGA 1X7OA 3S06A 3N4ZA 4BT4A 2MQEA 1FNKA 1DT9A 2KG4A 1CK2A 4BVTA 3WPWA 3CCJF 5GIPC 1NQ3A 1COMA 3E22A 4BVQA 5EAZA 1VQVA 2UZHA 3RYCA 2NMUA 4C82A 3VIUA 3VYUC 1VH8A 4TV8B 1H47A 1IPAA 4FFBB 3CCSF 3BYQA 2UYJA 2N48A 1IV4A 1YJNF 4NUTA 3G71F 2PHNA 3I56F 4O2BB 5HP7A 1SA0A 4O2BA 1K8AH 5FNVB 4X1KB 2Z1TA 3CPQA 4DXDA 3ZP7A 4X1IB 4IHJA 4DRXB 3HAXD 1TUBA 4G88A 5A2QM 5LA6B 4WBNA 1VQ6F 3WXMB 3IR9A 3V7EA 3JAKA 2LBTA 2CHTA 1K73H 3MBMA 1PF5A 4EI9A 4M8IA 1ONIA 2HRYA 3DDNA 5HXUA 5HWEA 1VQPF 1PXWA 5LXTB 5LP6C 3WJRA 3UT5A 3D54A 2ZODA 4G4XA 2GVIA 1W55A 4C81A 1GO1A 3RYHB 1W57A 3SIUA 3JATB 3NK7A 1OFUA 2CWJA 4TUYA 2UYKA 2P6YA 3JALA 2QEXF 1W581 3RYIB 1IV3A 3LYBA 3J81M 2DYYA 5EZYB 4BT5A 3TD4A 1UFYA 4BT6A 2ZVYA 2IQQA 3F0GA 3CC2F 1RQ7A 1W2BF 3S0WA 4IIJB 1JY8A 3MQWA 4G4YA 1W5FA 3T80A 1W59A 4NQ3A 5G4UC 5MN5A 1QU9A 2HX0A 2HP0A 5GANK 4DRXA 1VQKF 1W41A 3Q8HA 3FD6A 3CCQF 3K0TA 4KWEA 4BT7A 3ELCA 3RE3A 2Z1FA 3M84A 1QVGF 3CXCF 3WPXA 1TVKB 2KTUA 3P0ZA 5JVDB 2OTLF 3E1YA 3HKDA 3I3FA 3IKEA 1VQOF 3ZP4A 4ZK7A 3S02A 5JCOA 4EB6A 1CLIA 3CC4F 2HP3A 3RYFA 3JARA 1FNJA 5HY0A 2RHJA 2HQSC 2JNBA 1KNKA 1XBIA 3GHZA 4TV9B 1Q81H 3VYTC 3HKCA 3NVKE 3CCVF 2W8BC 1KQSF 3JALB 1KD1H 2CVLA 3WGKA 5IJ0A 4O4JA 3KHNA 5CA0A 3D00A 3G4SF 3CCLF 1U40A 4BT3A 4U3JB 3N2GA 3V7QA 5KX5B 3CPWF 4X1KA 3V4DA 2CSLA 3CG6A 3HTNA 3OONA 1SA0B 2YYEA 4BT2A 3AGKA 4G4ZA 5JCOC 4ZOLA 2AMTA 1S72F 3ZO8A 2DT4A 3QUWA 2RHHA 4ZOLB 3RA5A 1RA4A 5JQGB 4LNUB 3F0FA 3O85A 3I55F 1VQ5F 3N4YA 3LWRC 5LA6A 4WBNB 2H8CA 3UT5B 5CA1A 2AIFA 3DC2A 5C8YA 2RHLA 2CZWA 3WGMA 1YQNA 3P10A 2VGMA 4F6RA 5IT9M 2EWCA 3RYCB 3C9RA 1VQMF 2QTPA 5KMGB 1W40A 2BO1A 2BTOA 3GTZA 3ZOPA 4TUYB 2FC3A 1KC8H 2AIZP 1JD1A 4X20A 3NK6A 4O4IA 3FPIA 5EZYA 5HP8A 1T0AA 2OTJF 1FFXA 2LBWA 1K9MH 2WALA 2ALEA 2HVYD 3N2KB 3TD3A 5JH7B 4XCQA 2ZOVA 3IKFA 3VOBA 4ZI7B 1M90H 1QAHA 4I50B 2QA4F 5JH7A 1NMUB 4LCKA 5MN6A 5IYZA 3WJQA 1JJ2F 5IYZB 2BTQB 4O4LA 3HKBA 3NVIB 3JAMM 3E20B 1YHQF 3SIVA 4B5CA 1Q7YH 2YXZA 2OZBA 5JVDA 3C9TA 1YJWF 3WGNA 3ON1A 3F0EA 4G4VA 4IHJB 1YGYA 2LBXA 4I4TA 3LWPC 4YJ2B 1TVKA 2G9IA 3MDOA 3CCRF 2HS4A 2LCAA 3VOAA 3WGJA 4YJ2A 1N8RH 4EI8A 2VGNA 4TZZA 3LFOA 5EB0A 2QI2A 3VMFB 3VYSC 2IAFA 3JARB 3K2XA 1R1MA 3TD5A 4R40B 1OAPA 2F9ZC 1VHAA 3RYHA 4O4HB 1GX1A 4IIJA 4FFBA 3IMPA 3B6NA 5DCVA 1ZWZA 2I6RA 2PMPA 4ZHQB 4RHAA 4NWOB 4YJ3B 3KJJA 1U3LA 2KTVA 5IJ0B 3CCEF 2Z1UA 4O4IB 3D01A 3C8LA 3JCMM 3JASB 3PLAC 5EWRA 2OHWA 1YIJF 2ZAUA 5KX5A 4X1IA 1SZQA 1W3EX 2VAPA 3PAFA 4BW0B 3F0DA 3OBYA 1Q86H 4I50A 1TUBB 2R751 5EYPA 5GAPK 5LP6B 1U3PA 1W5AA 3FBAA 3LMEA 3ESJA 3S0YA 5LOVB 3M1XA 1XV2A 3RYFB 3HKBB 1X25A 2GLZA 2GZLA 4C8IA 5LOVA 3QHDA 1GO0A 4ERHA 2CHSA 1VK3A 3JAWA 1J7HA 3VCZA 3CCMF 5J2UA 4TV9A 2I6DA 2HS3A 2RB9A 2Q1XA 1JN1A 1XHOA 1FSZA 2CW4A 3MCAB 3ERNA 3KIZA 1M1KH 2L26A 1X7PA 2RHOA 3HJWC 5EIBD 3MCQA 5IJ9B 5GIOC 1FFXB 3E22B 3CD6F 2VXYA 1ODEA 4B46A 5EIBC 3JASA 4G4WA 5CB4B 3EORA 3OBWA 5GINC 4U3JA 3HKCB 3S0HA 3VO8A 4PWTA 4I55B 2OTMA 4C8GA 4TV8A 1IV2A 5LYJA 4X3MA 4BVSA 1UI9A 2Q1YA 1Q82H 3L7QA 3J80M 5J2TA 4ZI7A 3I7TA 1GZ0A 1VQNF 4O4LB 5BMVB 3G6EF 4B45A 4O2AA 3QTYA 3N2GB 5GONB 1E7KA 3M4SA 1JFFA 2UYPA 3HKEA 1KNJA 2V9YA 3R0PA 1RLUA 3HKEB 5J2UB 3OW2F 4BY9D 4I4TB 2ZVZA 3CB2A 3P4EA 3CMEF 4EB6B 4X1YB 4EI7A 5HY1A 5AVMA
chains in the Genus database with same CATH topology
1X7OA 4EI8A 2VGNA 4TZZA 3LFOA 2QI2A 3N4ZA 3VMFB 5HY0A 2JNBA 1DT9A 2KG4A 1CK2A 1SDSA 4BVTA 3CCJF 5GIPC 1XBIA 1Q81H 3FFMA 4BVQA 1YJ9F 2F9ZC 3VI6A 4X3LA 3NMUC 3NVKE 3CCVF 1KQSF 1X52A 5DCVA 5EO3A 1KD1H 1ZWZA 1IPAA 3CCSF 3G4SF 3D00A 3CCLF 1YJNF 1W42A 4NUTA 2KTVA 3CCEF 3G71F 3JCMM 5FLXM 3PLAC 3I56F 2FGYA 5EWRA 2OHWA 3LWVC 1YIJF 3V7QA 3CPWF 1K8AH 3CG6A 3CC7F 5FJ4C 1W3EX 3CPQA 3PAFA 4BW0B 1H7MA 3AGKA 3OBYA 1Q86H 1CN7A 1S72F 5GAPK 3HAXD 4BVRA 3RA5A 5A2QM 1RA4A 1VQ6F 3WXMB 3O85A 3I55F 1VQ5F 3IR9A 3N4YA 5HY4A 3LWRC 1VQ7F 3CC4F 3V7EA 2GLZA 1K73H 1GO0A 4EI9A 5G4VC 2AIFA 1VQLF 5HXUA 2CZWA 5HWEA 1PXWA 1VQPF 3CCMF 3LWQC 2VGMA 2I6DA 3GYQA 1T0KB 5IT9M 1GO1A 5HXZA 3SIUA 1VQMF 3NK7A 3MCAB 1W40A 2BO1A 1YI2F 2QEXF 1M1KH 1X7PA 2FC3A 3HJWC 3J81M 1KC8H 5GIOC 1QVFF 3NK6A 3CMAF 3RA6A 3CD6F 2OTJF 3CC2F 3OBWA 2LBWA 5GINC 5HY2A 1K9MH 2WALA 1W2BF 2ALEA 3J7AR 2HVYD 1YITF 4NQ3A 4XCQA 4X3MA 4BVSA 5G4UC 1M90H 1VQ4F 2QA4F 1Q82H 3J80M 1NMUB 5GANK 4LCKA 1GZ0A 1VQ9F 1VQKF 1W41A 1VQNF 1NJIH 1VQ8F 3G6EF 3CCQF 1JJ2F 1E7KA 3NVIB 3JAMM 3E20B 1YHQF 3LWOC 3SIVA 1Q7YH 2OZBA 3OW2F 1QVGF 1YJWF 4C4WC 3CXCF 3CCUF 3ON1A 4BY9D 2KTUA 1RLGA 2OTLF 3E1YA 2LBXA 3LWPC 3CMEF 1VQOF 4EI7A 3CCRF 3V3TA 5HY1A 1N8RH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1X7O A;  2VGN A;  4TZZ A;  3LFO A;  2QI2 A;  3N4Z A;  3VMF B;  2JNB A;  1DT9 A;  2KG4 A;  1CK2 A;  1SDS A;  3CCJ F;  5GIP C;  1XBI A;  1Q81 H;  3FFM A;  1YJ9 F;  3VI6 A;  4X3L A;  3NMU C;  3NVK E;  3CCV F;  1KQS F;  1X52 A;  5DCV A;  5EO3 A;  1KD1 H;  1ZWZ A;  1IPA A;  3CCS F;  3G4S F;  3CCL F;  1YJN F;  1W42 A;  4NUT A;  2KTV A;  3CCE F;  3G71 F;  3JCM M;  5FLX M;  3PLA C;  3I56 F;  5EWR A;  2OHW A;  3LWV C;  1YIJ F;  3V7Q A;  3CPW F;  1K8A H;  3CG6 A;  3CC7 F;  5FJ4 C;  1W3E X;  3CPQ A;  3PAF A;  4BW0 B;  1H7M A;  3AGK A;  3OBY A;  1Q86 H;  1CN7 A;  1S72 F;  5GAP K;  3HAX D;  3RA5 A;  5A2Q M;  1RA4 A;  1VQ6 F;  3WXM B;  3O85 A;  3I55 F;  1VQ5 F;  3IR9 A;  3N4Y A;  3LWR C;  1VQ7 F;  3CC4 F;  3V7E A;  1K73 H;  1GO0 A;  5G4V C;  2AIF A;  1VQL F;  2CZW A;  1VQP F;  1PXW A;  3CCM F;  3LWQ C;  2VGM A;  2I6D A;  3GYQ A;  1T0K B;  5IT9 M;  1GO1 A;  3SIU A;  1VQM F;  3NK7 A;  3MCA B;  1W40 A;  2BO1 A;  1YI2 F;  2QEX F;  1M1K H;  1X7P A;  2FC3 A;  3HJW C;  3J81 M;  1KC8 H;  5GIO C;  1QVF F;  3NK6 A;  3CMA F;  3RA6 A;  3CD6 F;  2OTJ F;  3CC2 F;  3OBW A;  2LBW A;  5GIN C;  1K9M H;  2WAL A;  1W2B F;  2ALE A;  3J7A R;  2HVY D;  1YIT F;  5G4U C;  4X3M A;  1M90 H;  1VQ4 F;  2QA4 F;  1Q82 H;  3J80 M;  1NMU B;  5GAN K;  4LCK A;  1GZ0 A;  1VQ9 F;  1VQK F;  1W41 A;  1VQN F;  1NJI H;  1VQ8 F;  3G6E F;  3CCQ F;  1JJ2 F;  1E7K A;  3NVI B;  3JAM M;  3E20 B;  1YHQ F;  3LWO C;  3SIV A;  1Q7Y H;  2OZB A;  3OW2 F;  1QVG F;  1YJW F;  4C4W C;  3CXC F;  3CCU F;  3ON1 A;  4BY9 D;  2KTU A;  1RLG A;  2OTL F;  3E1Y A;  2LBX A;  3LWP C;  3CME F;  1VQO F;  3CCR F;  1N8R H; 
#chains in the Genus database with same CATH topology
 4ZHW A;  3RYI A;  2H6L A;  2VAW A;  5CA1 B;  2IG8 A;  1SDS A;  3KE1 A;  5LXT A;  4X20 B;  5EB1 B;  3FFM A;  1YJ9 F;  3VI6 A;  4X3L A;  3NMU C;  3JAT A;  4U39 A;  2BTU A;  3K14 A;  1X52 A;  4O4H A;  5EO3 A;  1Z5V A;  4YJ3 A;  3VTI C;  5ITZ A;  3IEW A;  4E6E A;  3CYP B;  1W5B A;  4RQO A;  1W42 A;  1Q8R A;  4O4J B;  5CA0 B;  5FLX M;  4O2A B;  2FGY A;  5B8F A;  5CB4 A;  3LWV C;  5FNV A;  1JFF B;  3F6M A;  2VAM A;  3N2K A;  3CC7 F;  1H48 A;  5FJ4 C;  1H7M A;  5LP6 A;  3HWU A;  3IEQ A;  1CN7 A;  5J2T B;  1Z5W A;  3C9S A;  4BVR A;  3JVH A;  5EYP B;  3LDT A;  3WJP A;  3S03 A;  3U0O A;  1VQ7 F;  5HY4 A;  2H8E A;  5G4V C;  1VQL F;  3JAK B;  2UYN A;  3LWQ C;  2HS0 A;  3GYQ A;  4HNA B;  2KGW A;  1T0K B;  5HXZ A;  5KMG A;  1RQ2 A;  2B33 A;  4F6R B;  2Z01 A;  1XRG A;  1YI2 F;  2K1S A;  5ITZ B;  3WGL A;  1W5E A;  3K12 A;  3FD5 A;  1QVF F;  3CMA F;  3RA6 A;  5IJ9 A;  2HRU A;  5HY2 A;  3J7A R;  4ZHV A;  4B62 A;  1YIT F;  4I55 A;  1IV1 A;  4ZHQ A;  2HP0 B;  1VQ4 F;  5MN4 A;  5LYJ B;  4ZHY B;  1VQ9 F;  1NJI H;  1VQ8 F;  1DBF A;  2ZF8 A;  4LNU A;  5BMV A;  4C8E A;  1U43 A;  5C8Y B;  5GON A;  3LWO C;  3JAW B;  2UYN B;  2R6R 1;  4C4W C;  3C9U A;  3CYQ A;  3CCU F;  3HKD B;  4HNA A;  4X1Y A;  1QD9 A;  1RLG A;  2Z1E A;  3KJK A;  3V3T A;  5JQG A;  1X7O A;  3S06 A;  3N4Z A;  4BT4 A;  2MQE A;  1FNK A;  1DT9 A;  2KG4 A;  1CK2 A;  4BVT A;  3WPW A;  3CCJ F;  5GIP C;  1NQ3 A;  1COM A;  3E22 A;  4BVQ A;  5EAZ A;  1VQV A;  2UZH A;  3RYC A;  2NMU A;  4C82 A;  3VIU A;  3VYU C;  1VH8 A;  4TV8 B;  1H47 A;  1IPA A;  4FFB B;  3CCS F;  3BYQ A;  2UYJ A;  2N48 A;  1IV4 A;  1YJN F;  4NUT A;  3G71 F;  2PHN A;  3I56 F;  4O2B B;  5HP7 A;  1SA0 A;  4O2B A;  1K8A H;  5FNV B;  4X1K B;  2Z1T A;  3CPQ A;  4DXD A;  3ZP7 A;  4X1I B;  4IHJ A;  4DRX B;  3HAX D;  1TUB A;  4G88 A;  5A2Q M;  5LA6 B;  4WBN A;  1VQ6 F;  3WXM B;  3IR9 A;  3V7E A;  3JAK A;  2LBT A;  2CHT A;  1K73 H;  3MBM A;  1PF5 A;  4EI9 A;  4M8I A;  1ONI A;  2HRY A;  3DDN A;  5HXU A;  5HWE A;  1VQP F;  1PXW A;  5LXT B;  5LP6 C;  3WJR A;  3UT5 A;  3D54 A;  2ZOD A;  4G4X A;  2GVI A;  1W55 A;  4C81 A;  1GO1 A;  3RYH B;  1W57 A;  3SIU A;  3JAT B;  3NK7 A;  1OFU A;  2CWJ A;  4TUY A;  2UYK A;  2P6Y A;  3JAL A;  2QEX F;  1W58 1;  3RYI B;  1IV3 A;  3LYB A;  3J81 M;  2DYY A;  5EZY B;  4BT5 A;  3TD4 A;  1UFY A;  4BT6 A;  2ZVY A;  2IQQ A;  3F0G A;  3CC2 F;  1RQ7 A;  1W2B F;  3S0W A;  4IIJ B;  1JY8 A;  3MQW A;  4G4Y A;  1W5F A;  3T80 A;  1W59 A;  4NQ3 A;  5G4U C;  5MN5 A;  1QU9 A;  2HX0 A;  2HP0 A;  5GAN K;  4DRX A;  1VQK F;  1W41 A;  3Q8H A;  3FD6 A;  3CCQ F;  3K0T A;  4KWE A;  4BT7 A;  3ELC A;  3RE3 A;  2Z1F A;  3M84 A;  1QVG F;  3CXC F;  3WPX A;  1TVK B;  2KTU A;  3P0Z A;  5JVD B;  2OTL F;  3E1Y A;  3HKD A;  3I3F A;  3IKE A;  1VQO F;  3ZP4 A;  4ZK7 A;  3S02 A;  5JCO A;  4EB6 A;  1CLI A;  3CC4 F;  2HP3 A;  3RYF A;  3JAR A;  1FNJ A;  5HY0 A;  2RHJ A;  2HQS C;  2JNB A;  1KNK A;  1XBI A;  3GHZ A;  4TV9 B;  1Q81 H;  3VYT C;  3HKC A;  3NVK E;  3CCV F;  2W8B C;  1KQS F;  3JAL B;  1KD1 H;  2CVL A;  3WGK A;  5IJ0 A;  4O4J A;  3KHN A;  5CA0 A;  3D00 A;  3G4S F;  3CCL F;  1U40 A;  4BT3 A;  4U3J B;  3N2G A;  3V7Q A;  5KX5 B;  3CPW F;  4X1K A;  3V4D A;  2CSL A;  3CG6 A;  3HTN A;  3OON A;  1SA0 B;  2YYE A;  4BT2 A;  3AGK A;  4G4Z A;  5JCO C;  4ZOL A;  2AMT A;  1S72 F;  3ZO8 A;  2DT4 A;  3QUW A;  2RHH A;  4ZOL B;  3RA5 A;  1RA4 A;  5JQG B;  4LNU B;  3F0F A;  3O85 A;  3I55 F;  1VQ5 F;  3N4Y A;  3LWR C;  5LA6 A;  4WBN B;  2H8C A;  3UT5 B;  5CA1 A;  2AIF A;  3DC2 A;  5C8Y A;  2RHL A;  2CZW A;  3WGM A;  1YQN A;  3P10 A;  2VGM A;  4F6R A;  5IT9 M;  2EWC A;  3RYC B;  3C9R A;  1VQM F;  2QTP A;  5KMG B;  1W40 A;  2BO1 A;  2BTO A;  3GTZ A;  3ZOP A;  4TUY B;  2FC3 A;  1KC8 H;  2AIZ P;  1JD1 A;  4X20 A;  3NK6 A;  4O4I A;  3FPI A;  5EZY A;  5HP8 A;  1T0A A;  2OTJ F;  1FFX A;  2LBW A;  1K9M H;  2WAL A;  2ALE A;  2HVY D;  3N2K B;  3TD3 A;  5JH7 B;  4XCQ A;  2ZOV A;  3IKF A;  3VOB A;  4ZI7 B;  1M90 H;  1QAH A;  4I50 B;  2QA4 F;  5JH7 A;  1NMU B;  4LCK A;  5MN6 A;  5IYZ A;  3WJQ A;  1JJ2 F;  5IYZ B;  2BTQ B;  4O4L A;  3HKB A;  3NVI B;  3JAM M;  3E20 B;  1YHQ F;  3SIV A;  4B5C A;  1Q7Y H;  2YXZ A;  2OZB A;  5JVD A;  3C9T A;  1YJW F;  3WGN A;  3ON1 A;  3F0E A;  4G4V A;  4IHJ B;  1YGY A;  2LBX A;  4I4T A;  3LWP C;  4YJ2 B;  1TVK A;  2G9I A;  3MDO A;  3CCR F;  2HS4 A;  2LCA A;  3VOA A;  3WGJ A;  4YJ2 A;  1N8R H;  4EI8 A;  2VGN A;  4TZZ A;  3LFO A;  5EB0 A;  2QI2 A;  3VMF B;  3VYS C;  2IAF A;  3JAR B;  3K2X A;  1R1M A;  3TD5 A;  4R40 B;  1OAP A;  2F9Z C;  1VHA A;  3RYH A;  4O4H B;  1GX1 A;  4IIJ A;  4FFB A;  3IMP A;  3B6N A;  5DCV A;  1ZWZ A;  2I6R A;  2PMP A;  4ZHQ B;  4RHA A;  4NWO B;  4YJ3 B;  3KJJ A;  1U3L A;  2KTV A;  5IJ0 B;  3CCE F;  2Z1U A;  4O4I B;  3D01 A;  3C8L A;  3JCM M;  3JAS B;  3PLA C;  5EWR A;  2OHW A;  1YIJ F;  2ZAU A;  5KX5 A;  4X1I A;  1SZQ A;  1W3E X;  2VAP A;  3PAF A;  4BW0 B;  3F0D A;  3OBY A;  1Q86 H;  4I50 A;  1TUB B;  2R75 1;  5EYP A;  5GAP K;  5LP6 B;  1U3P A;  1W5A A;  3FBA A;  3LME A;  3ESJ A;  3S0Y A;  5LOV B;  3M1X A;  1XV2 A;  3RYF B;  3HKB B;  1X25 A;  2GLZ A;  2GZL A;  4C8I A;  5LOV A;  3QHD A;  1GO0 A;  4ERH A;  2CHS A;  1VK3 A;  3JAW A;  1J7H A;  3VCZ A;  3CCM F;  5J2U A;  4TV9 A;  2I6D A;  2HS3 A;  2RB9 A;  2Q1X A;  1JN1 A;  1XHO A;  1FSZ A;  2CW4 A;  3MCA B;  3ERN A;  3KIZ A;  1M1K H;  2L26 A;  1X7P A;  2RHO A;  3HJW C;  5EIB D;  3MCQ A;  5IJ9 B;  5GIO C;  1FFX B;  3E22 B;  3CD6 F;  2VXY A;  1ODE A;  4B46 A;  5EIB C;  3JAS A;  4G4W A;  5CB4 B;  3EOR A;  3OBW A;  5GIN C;  4U3J A;  3HKC B;  3S0H A;  3VO8 A;  4PWT A;  4I55 B;  2OTM A;  4C8G A;  4TV8 A;  1IV2 A;  5LYJ A;  4X3M A;  4BVS A;  1UI9 A;  2Q1Y A;  1Q82 H;  3L7Q A;  3J80 M;  5J2T A;  4ZI7 A;  3I7T A;  1GZ0 A;  1VQN F;  4O4L B;  5BMV B;  3G6E F;  4B45 A;  4O2A A;  3QTY A;  3N2G B;  5GON B;  1E7K A;  3M4S A;  1JFF A;  2UYP A;  3HKE A;  1KNJ A;  2V9Y A;  3R0P A;  1RLU A;  3HKE B;  5J2U B;  3OW2 F;  4BY9 D;  4I4T B;  2ZVZ A;  3CB2 A;  3P4E A;  3CME F;  4EB6 B;  4X1Y B;  4EI7 A;  5HY1 A;  5AVM A; 
#chains in the Genus database with same CATH homology
 1X7O A;  4EI8 A;  2VGN A;  4TZZ A;  3LFO A;  2QI2 A;  3N4Z A;  3VMF B;  5HY0 A;  2JNB A;  1DT9 A;  2KG4 A;  1CK2 A;  1SDS A;  4BVT A;  3CCJ F;  5GIP C;  1XBI A;  1Q81 H;  3FFM A;  4BVQ A;  1YJ9 F;  2F9Z C;  3VI6 A;  4X3L A;  3NMU C;  3NVK E;  3CCV F;  1KQS F;  1X52 A;  5DCV A;  5EO3 A;  1KD1 H;  1ZWZ A;  1IPA A;  3CCS F;  3G4S F;  3D00 A;  3CCL F;  1YJN F;  1W42 A;  4NUT A;  2KTV A;  3CCE F;  3G71 F;  3JCM M;  5FLX M;  3PLA C;  3I56 F;  2FGY A;  5EWR A;  2OHW A;  3LWV C;  1YIJ F;  3V7Q A;  3CPW F;  1K8A H;  3CG6 A;  3CC7 F;  5FJ4 C;  1W3E X;  3CPQ A;  3PAF A;  4BW0 B;  1H7M A;  3AGK A;  3OBY A;  1Q86 H;  1CN7 A;  1S72 F;  5GAP K;  3HAX D;  4BVR A;  3RA5 A;  5A2Q M;  1RA4 A;  1VQ6 F;  3WXM B;  3O85 A;  3I55 F;  1VQ5 F;  3IR9 A;  3N4Y A;  5HY4 A;  3LWR C;  1VQ7 F;  3CC4 F;  3V7E A;  2GLZ A;  1K73 H;  1GO0 A;  4EI9 A;  5G4V C;  2AIF A;  1VQL F;  5HXU A;  2CZW A;  5HWE A;  1PXW A;  1VQP F;  3CCM F;  3LWQ C;  2VGM A;  2I6D A;  3GYQ A;  1T0K B;  5IT9 M;  1GO1 A;  5HXZ A;  3SIU A;  1VQM F;  3NK7 A;  3MCA B;  1W40 A;  2BO1 A;  1YI2 F;  2QEX F;  1M1K H;  1X7P A;  2FC3 A;  3HJW C;  3J81 M;  1KC8 H;  5GIO C;  1QVF F;  3NK6 A;  3CMA F;  3RA6 A;  3CD6 F;  2OTJ F;  3CC2 F;  3OBW A;  2LBW A;  5GIN C;  5HY2 A;  1K9M H;  2WAL A;  1W2B F;  2ALE A;  3J7A R;  2HVY D;  1YIT F;  4NQ3 A;  4XCQ A;  4X3M A;  4BVS A;  5G4U C;  1M90 H;  1VQ4 F;  2QA4 F;  1Q82 H;  3J80 M;  1NMU B;  5GAN K;  4LCK A;  1GZ0 A;  1VQ9 F;  1VQK F;  1W41 A;  1VQN F;  1NJI H;  1VQ8 F;  3G6E F;  3CCQ F;  1JJ2 F;  1E7K A;  3NVI B;  3JAM M;  3E20 B;  1YHQ F;  3LWO C;  3SIV A;  1Q7Y H;  2OZB A;  3OW2 F;  1QVG F;  1YJW F;  4C4W C;  3CXC F;  3CCU F;  3ON1 A;  4BY9 D;  2KTU A;  1RLG A;  2OTL F;  3E1Y A;  2LBX A;  3LWP C;  3CME F;  1VQO F;  4EI7 A;  3CCR F;  3V3T A;  5HY1 A;  1N8R H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...