4BYHA

Crystal structure of sialylated igg fc
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
207
structure length
207
Chain Sequence
PSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal Structure of Sialylated Igg Fc: Implications for the Mechanism of Intravenous Immunoglobulin Therapy.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords IG GAMMA-1 CHAIN C REGION
total genus 39
structure length 207
sequence length 207
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4byhA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4byhA01
4N9OB 3EYUL 4PRHA 3ULUH 4NT6B 4Y19D 3S3PA 3VH8A 3T0EE 4RAUA 3NZHL 5FKAA 5TJWK 3JWNC 5JXAL 4JB9L 4WUUD 1Q9OB 1QACA 1NFDB 3PGCB 2W0FA 1U8IA 4W4OC 5B8CC 4F33B 2VABA 3IF1A 4M93B 2CIIA 4MYWB 1NAKH 4YPGA 4XCNA 2PO6B 4BFIB 3DYOA 4XHJD 1DANU 1EFQA 4NKIH 2VB5A 3VXSE 5FDYA 3T0ED 1QRNE 3VXUE 4PJ9C 2VN4A 3PWPB 3JV4A 4U3HA 5D7KD 5T1KB 4BSWB 4RFOL 5I18H 3OXSA 3DRQA 4UIKH 3N1QC 3RAJH 3C60A 2HH0H 2AXGA 2DQJH 3RX5A 5D6CB 1Z0MA 2CLZA 3SKJL 5GS0D 5D9SA 1RULL 3I84A 4Q9RH 1NEZG 3FCTA 4G42A 2JKXA 2PF6A 2P8MB 4PJHB 5CKGA 2YWZA 3GSNB 3O2DL 5GGUB 3QAZC 3MCKA 2GJ6B 4XVTL 3DYPA 3WFCH 1KFAL 4LNRA 4YHLH 2G2RA 1LQSR 3MLWL 2P48B 1H3VA 4N1CA 1SJEB 4LLDB 5FO9A 4YHNA 1RK0B 4WW2B 3RUGF 1BP3B 1MIEL 4MJ5A 5MEND 1XF3B 2NYYC 5C6TH 5BZDA 3RWIA 1WLHA 2DI8A 2AJSH 5D6DA 3WHXA 2APVA 3BISA 2VLKB 1U36A 4UDTB 2D4FA 4NFDA 5MHSD 1ZWIA 3TA3B 2P49B 3KPSE 4UBDC 4S1SL 4TSAH 5EIIB 4HIHB 2MQCA 2MJWA 3N1MC 2V2WB 1TCRB 3N9GH 4OAWA 4PRBB 4XNMA 2EDFA 4HUXB 3P11L 1BF8A 4RGOH 5CWSA 3C9NB 4KKAD 4ZODA 4PG9A 2EDNA 1IC7H 3RZCD 2CGRH 1FGNH 4XNZC 1QHOA 5JOPD 2XNAB 1I75A 1K6QH 1U8QA 1LILA 1IGCL 3JTTA 1ZEAL 2F58H 4QRPB 1WWCA 5C0ND 4HZLB 2APTA 1AD9A 2XFXB 2NY0B 4RSVA 5E4EC 4ZXBC 5DJAB 5C0CD 3ZDZE 1T83C 1KB5A 4F7PB 2FBJL 3KLDA 5CJQL 4HV8B 4NIKB 1WTLA 1JTPA 3AFLA 2BVOB 4P4RB 3GUTB 4RA0C 1BOGA 4PJHA 2BRRL 3U0WL 4QRSB 3QJHB 4KC3B 4F37K 3I02A 1QFWH 5ENWA 3QZWB 4ZG1A 5HYQB 3EDDA 3TGXA 3A67L 2OTUA 1N5YH 2CIKB 4I2XE 1S7TA 4ELMF 2FECL 3U0PB 4PR5A 3MOQA 3B9AA 1RJCA 4KK6D 4K3EL 4UIMA 2PXYD 4XHJC 5DQDH 4F7EA 1CDIA 4R4BA 4P5TA 3DETD 1OW0A 3QQ4B 3BX7C 3HE6D 4CADA 5JW3H 1DVFA 3U9UA 4NOFA 1KIPA 4MQXD 3HI1A 1PG7W 4IRJA 3X11B 3PWJB 4PBWD 5D7JA 4ONHB 2DKMA 4FTVA 2O26U 1LEIB 3F62A 4DZBA 2C1PB 3HRZB 4U33A 5BV7C 3GSOA 3H9SE 3ARDD 2FSEA 4LP5A 1TJIH 5FA3A 2HWZL 3QQ4A 2WUBL 4M48H 4JQIH 3FO2B 3BMVA 3RHWF 5GRWA 2X4SB 4KTEL 3RVUC 1YEGL 5D7JD 3B8SA 4UIMB 1S9XA 4KI5C 5D5ME 4P2OC 1H5BC 3IDUA 1H0DB 2PCPA 2XTJB 1IGJA 1RVFL 3TO2B 5T5FH 4PLOB 1N4XL 5EOQL 3WFDL 4TSBL 2X4RB 1MCQA 1S78D 3LQZB 1AQKL 3RPIA 4KZEH 1NCNA 4DUVA 4Z7VA 1JZ7A 1V3KA 4WV1B 5J11C 1T1YB 1AE6L 3G6JA 3ARBB 2CRZA 3PGFH 3NABH 3LZFL 4JFPA 4MSWA 5LVEA 4X6DA 4OB5L 2WAHA 1OP3K 3SDDD 1FN4A 3VFTB 2H2SC 5C3TA 2ZKHH 3LRGA 1BJ8A 3ARYA 3M17B 4OZGF 4KK5D 4U4BA 2VLLB 3BXNB 1AKJA 2JJSC 1JGLL 1DBBH 1V5JA 1S9WA 3VRIB 4JFFE 1DBAH 2NY5C 2P46B 2FSEB 2Z93A 4DKAA 2WZPD 4XVSL 1HXMA 1JWSA 5GGTL 3RY6C 4EVNA 1AE6H 4QRUA 3MRKA 2W91A 1ZHNA 5FAAA 3TYGH 1JGEB 4U7KA 2BNRA 1IC4H 1CIDA 3QP3A 3HHRB 5FUZH 2NY0D 3K4DA 4HUXA 1OSPH 4HGWB 1TCRA 4ZPVA 3WFDH 3N50A 3EJYC 2X89D 4QRTB 3D69A 4TN9A 1E4XL 3SDAD 4OZFH 3UTTD 1JN6B 4G8EA 4UDTA 5J1AB 2ZUTA 2VN7A 3Q0HA 2FIKB 4U0QB 4AEHH 5F71A 3OKNB 4G8GB 1JK8B 1IAKB 3PGFL 4XXDA 5DQJB 4NWTL 4UU9B 3O8XD 2VOTA 2XA8H 1C16B 1OVZA 1XF3A 3V6FB 4XP5L 5HYQA 2OI9B 4PJXB 2DLGA 4OSUL 5MENA 5JXEC 1QYGH 3MV9A 2VAAA 4HH8A 5J12C 4ODVL 2F19H 4KKCD 1A7NH 2VLJB 2VDKH 4UAOB 4RGOL 4WGWB 3ZYIA 4PLKD 5F7UA 4QHLB 2DIBA 5FA4A 5DVLA 3ZE2E 1S7RA 2GJ6E 1KCRH 1RUAH 4I4WA 4JFDE 3VRLE 1ZEAH 2F58L 3GMLA 4KMLB 1PD6A 4AEIL 4UAOC 4RISL 4V2CB 4V1DA 1FFPA 5FYJH 4LLVB 3QCUL 1FPTH 3R4DA 1XH3A 5T3ZH 5CSBA 3U4BH 5ESAB 3QWRA 5IHBA 4JG1L 4QGTA 2GFBB 3TT1H 3CLEH 1T20A 1HIMH 1KEGL 3OKEA 3MV9E 3B6SA 1OWRM 4AENA 1G84A 1IEHA 3WN5C 4E42A 2EO1A 1MLCB 2O5XL 3NZ8A 1ONQB 1U8IB 5CLWA 4LAQH 5EU6D 3O6KH 3E2HB 3BZFB 3RU8L 1U6AH 2ADJA 1Z5LB 5IJVA 3P0VH 4JY5L 1AXTL 4MS8D 1BBJA 5J3HC 3QXVA 1FDLH 1U8MB 3MRGB 3QWQB 4YJZL 3HAEB 4PJAE 3WNLA 3C5ZB 3IVKA 5F89B 3RQ3A 3GI9L 1IAII 2KQNA 4WO4C 1XGQB 1YEIH 4I3RH 1S5HB 3BP4A 4E0RA 3O0RH 5ETUB 1QO3A 1UZ8A 1V05A 3MLVH 3RUGA 1FN4B 4YQXL 3T0WA 1TETH 4LPTA 1S7QB 3B2UD 1NGYA 3KG5A 4JFQB 3WV0A 1URLA 5LJYH 3BRGC 2UZIH 2ATKB 2YOCA 4U2YA 4ZS6D 3DECA 3OJDB 5J4MA 5LCVL 3RNQA 3ARWA 2CLZB 3HNSL 4L3CB 2VZTA 4NYLA 1FFNB 1J1OL 2XTJD 3OXSB 5D7LE 3OAYH 3SY0A 4NJ9L 3D0VA 5JTWA 3HZYA 4G9FE 2ZCHH 2OSLA 5GZOC 1A22B 2FX9L 3NACH 1FIGH 2J2ZA 3ARPA 1N59A 4KZDH 5BJTA 4LPWA 4Z7VE 1EERB 1H3UA 2PUQT 1U8KA 1VACB 1A1NA 3GBNL 1ZA6A 4N8CH 5CP3A 4LLUB 4NWUH 5C8JA 3RL2B 1IARB 1DCLA 1BD2E 3GO1L 3NFPB 4XBPB 3WXWL 3X3FH 4GKSA 1ZV5A 1LO0H 5F9JA 5E6ID 3KR3H 1T2QL 2V7HA 3X11A 4MNGE 4NKIL 1EH9A 5CUSH 2H32A 4GKOA 4OTXH 5IB3A 1N7MH 1P7KB 2H1PH 4WW1A 4M9OA 4WEBL 3EDEA 5I71B 3HE7D 3IU3A 4XP9H 4XPFH 3F7VB 3EBAA 3QCVH 4FFWC 4JM2B 4TTDD 4NZJA 4APQD 1G1CA 1T03L 5DJDB 3KPRA 4IS6A 1D5XA 5GGVY 3BI9X 3ULUL 4X6EB 4ETYA 5ADPL 4HK3J 3W82A 4AEEA 4QXTB 4XWGL 3JWDC 2AK4D 5GQBA 4DEPC 1KJMA 5EBLA 1N64L 3KXFE 4FQIH 1ZGLB 4YC2C 3NA9H 4J6RH 5E7FA 1GGCH 3V0WL 3BZEB 3C5ZA 3IVKB 3QQNA 1IAOB 5L2JA 3G6JE 1B4JL 1H15B 1RHHB 3EOBB 3KPMB 4R90H 3JTSB 4G3YH 4PTUA 4YAQB 3QIBC 4R2GD 4F57H 3PHSA 1Y6KR 1PYWA 3LPFA 2NR6D 2PYFA 1EXUB 1GHFL 2EDJA 5DRZB 4WFHD 5MEQA 1JI2A 1UFUA 3ESUF 1JTOA 1T1ZA 1I3RA 1FG2B 3J7HA 1EVTC 4PGCB 1YYLL 2AK4A 4WUKH 4XPFL 1SVZA 1DJSA 1YPZB 1K85A 1M6OA 5D1XD 5CUSL 4DOHB 3H9SA 2PO6C 3WUWB 3QO0B 5HDQH 3OX8B 4H8WL 4GG8A 4G8IB 2UUDH 3BN3B 2VDOH 5EOCH 4TTGA 4EJ1C 5DK3A 1MHEA 4UTAL 2EEAA 1DDHB 1CFVL 1WEJL 3ROLA 5IW6B 4JM4L 1UKSA 4X5WB 4MQTB 2J8OA 4W70A 3QUYC 1A8JH 3OKKB 3PWNA 4NUGL 2D31A 4YHNB 5EC1B 2CO6B 2FEDD 3B43A 4LQFL 4DGYH 2LABA 3AAZB 4PGEB 3PXJA 4UUJB 1YEGH 3MRJA 4P46B 3EDKA 4PJFB 3ROOA 3RY4A 4X4XB 3L5JA 1G7QB 1A5FH 3TNMB 3CFKB 4PBXA 4UU9A 5EU7E 5CJ5A 1JTTA 2BOBB 2DQFA 1UM5L 1YNTB 3O81A 3QEHA 3VFUB 2BMKB 4I2XA 2Q7YA 4Q74A 4YBQD 2DQHL 4ODSH 1F3DH 4FP8H 3OWEA 5DK2B 1RD6A 1NLBL 4H1LB 3O11A 1KTRL 1VFMA 5JW3L 3ILQD 5ALBL 3SJVB 1P7QA 3UTQA 4MA7H 1I1CA 2Q87A 5EU3B 5DA4A 5F9AC 3D18A 3VFVA 5MEPA 2VXUH 4EDXA 2W0FB 1QFWM 5ERWA 4WCYL 1IC1A 1K3IA 3S36X 1D5MB 5EG6C 2E7LC 5CJXA 1YEJL 2PW1B 5DLMH 1REIA 4OFYA 1UZ6E 2YKLH 3N0PB 4D8PB 1F4WH 4QXTA 4Y4FA 5T1MA 4P3CH 5C0DB 4L4TA 2B5IB 1BD2A 4DGVH 4HMCA 3OB0K 1SEQL 5B4MD 1VPOH 4MD5A 4X6EA 3BRFA 2YPLD 1GC1L 1FQ9C 3H6JA 3QQ3B 4OCMC 5DJDA 2W0KA 5F1IB 3SN6N 3RIAK 3O6FD 4KK6C 2X4SA 1N6QL 1DQML 5FA3B 1BGXL 3KJ6H 4HD9A 1RUMH 5D7KE 2J5LC 3C5ZC 4Q0XH 4NZUL 4CVUA 3QRGH 4KJWD 2V7HB 3QIWB 1MHPL 4MNGB 3VWKB 5HI3C 3VI3E 3BKYL 4ALAL 3BO8B 3TIEB 2FR4B 1GAFL 4HXAH 3U30B 3P4MA 3VXMA 3D39D 5H37H 1QVOA 1EGJA 2VDOL 3NIDE 1CF8H 1IKNC 3MRDB 3U9PH 5JIPA 4MDIB 4HPYH 4KKCC 4Q9CA 2OK0L 3TV3H 2MCPH 2P45B 1ZLUK 3VFNB 3QXAA 1GIGL 1JZ8A 3L7EA 2X4NB 5IWLC 5C6TL 4HBQA 4OCXL 5CHNB 3DLQR 4JM2C 4ZNEA 4ZD3L 4IOFC 3UJTH 4HFWA 5JO5B 5HDBE 4Z7UA 1BOGB 4KKBC 3VXRB 1HEZB 3VDCA 4PJ8A 3IDMA 1GHFH 4BK4A 4G6FD 4JO4H 4M4RA 4LCUA 1IC5L 3FT2B 1O0VA 2DQJL 1MRFL 5DT1L 5J8OA 4OD1L 2YMXL 3MRPA 4LGSB 2R2EB 4MZ3A 5C08B 1UWXK 2D0FA 4JJ5B 2X89A 3H42L 1JV5A 2QHLA 3EDJA 3G6DH 5JHDD 5FGBC 3QHFH 3S97C 2EC8A 3PP4H 1MCWW 4GKZA 5DUPL 3STBA 1HYSD 4HZLA 4XWGH 1Z9SA 2F54E 1RUQH 4LLAA 4E41A 4G7YL 3G5YA 3GBMH 3GIZH 1IGFL 3T4AB 2ATPB 3RZCC 5DWUL 1OD7A 3K0WA 3B6SB 2GW5A 4MAYC 4K7PH 5IW1A 1N4XH 4RGNC 5EOQH 3HPJA 4K71C 4YDIH 2CK2A 3KDMB 5INDA 5I1CH 5EU5B 4OZGA 5CBEB 1CDUA 4WEMB 1KC5L 4WU7A 4XCCH 3EFDL 4JM2F 4AM0B 3VA2C 4XNUL 1DSFH 3U83A 1S7VA 1IL1B 1E6JH 3ISWA 4JO1H 2GK2A 4K94L 3CDYA 1G7HB 4XVUC 4RWYH 3KPLA 5B22A 2GI7A 3MXWL 3HG1E 4XRCB 5I1EH 2JB6A 1SJEA 1IEAB 4PGEA 5ILTH 4WV1C 1NGQL 3OPZL 4KAQH 3TZVA 1JPFA 4BUHA 5K9JH 1JIBA 2UWEF 3GSNA 4N1EA 3D6GA 2BXYA 5F7EL 3NGBC 3LHPH 3HI5H 5FO9B 2VXTH 4QHMB 2NTFB 5B4MC 1LNUB 3V0AC 1EEZA 1W0VA 1T6VN 1UVQB 3L3IB 1OW0C 2FGZA 3PDOB 3QIUD 4GKNB 3GSWA 3O6FC 3AS1A 1UJTA 1YA5A 2EYTB 3MROA 3QPXH 2Z31C 3ARRA 1VFBA 4HUUB 5E2WH 3LH2H 1MAMH 4KXZH 1YEKH 3A6BH 5KG9B 3VI3F 1FVEA 2ZCHL 3KHOA 3VXRD 5BO1L 4BSVA 1K2DB 2DF3A 5I8CB 5DQDL 3QT2A 3L7FA 1G7LB 2YD7A 5D1XA 4NT6A 1I9JH 4PJDA 4GUPB 1NGZA 5F7KC 3K81A 5IEKA 3W9EB 2BSRB 4LF3B 4GSDL 3GBNH 1CYGA 3I75B 4LLYA 1AR2A 3H7LA 4PY7B 4OFDA 3TJHC 1CFBA 1FNEB 3HC4L 5D5MA 1UYWL 3I6KA 4OBRA 4JRYE 2IPKB 3DV6B 3R06B 2W0PA 1KCVH 2G75A 2FB4H 5CJOL 4MQXC 4FA8A 1HHJB 5D72H 2D03H 1FG9C 3VA6A 4X4YA 3WFCL 1EO8H 5JA9A 4OV5B 3AREA 3LEXA 4TUKH 4LCCA 2QKIB 1RULH 4OUUA 1TVDA 1BQSA 1Y6MR 3VD3A 3O41B 1INQB 4JG1H 4MJ6B 4NC1C 4U1JA 4XH2A 1DE4B 1B9ZA 1I85A 1NCWH 3UAJD 1F58H 5GSRA 3TVMD 3L6FA 1MFAH 3HNTL 5K9OB 5GGRY 5D72L 2E9JA 4JO3L 1L0YA 3OKYA 1MFEH 4JZJC 4GRWB 2AJSL 5E6IC 3AXLB 4BQCA 2ICCA 1ACYL 2BVUA 2GITA 2WBKA 2RR3A 4P2QA 2X5PA 3U0TA 4Z0XB 1NAKL 2NY5H 1PZUB 1FDLL 1LEKB 1NEUA 1TJGH 5KBNC 3EAKA 4HC1A 1HQ4A 5FYKD 4LPXA 1T0MA 1T21B 3FQUA 2R1WB 5C8JB 3EZJB 1HH9B 3SGJA 4PJ5B 3NCJL 1U8KB 3O0RL 1XGYH 1QLFB 5HYSG 1J8HB 2C5DC 3QFJB 4H0IA 1KENL 2R0LH 1CLZH 1DFBH 2DM3A 2RCSL 4CADB 4WWKD 4G8FB 4GW5A 1P9MA 3UZVB 2E3VA 5HGAA 4G43A 1YYLH 1Q72L 3H3PH 4LVOB 1M71B 5DUBB 3BKCH 1FLRL 4HK0A 4KTDL 4QXUH 3OGCB 3VFNA 1JF1B 3QDME 4R7DA 5I1LA 3RWHA 1JZ5A 4MCYB 3RVTD 3QHZL 3G08A 2H3NA 1DUZA 1UCTA 5GJTL 5H2BA 5ENWB 3I3DA 5E03A 2HKHH 1RUQL 3S4SA 5CEZE 1IFHL 4RGNB 1VGKA 1NGYB 1AD0B 4WHYG 3OAUH 3BE1L 3MFFA 1AGDB 1T2XA 3THMH 5GS3A 1UG9A 1KC5H 5GGRA 1OAUH 3GM0A 1HDMB 2CKBL 2GSGB 3SPVB 4ZO9A 1UJ3B 4S1RL 5I15H 2X09A 5IHLB 1SJHB 3B9KA 4OFKA 5HHVL 1U8NA 3OB8A 4KV5E 4KQ4H 3GSXA 3L3JA 4CN6A 4M7JH 2XY2A 5IBTL 1CL7H 2WV3A 5FGSA 1DBKH 4APQC 1TPXB 3S7GA 3CZFB 3CH1B 1XFPA 4UDUA 2I9LA 4Y19A 2G5RA 4LCIL 1OM3H 5DRWA 2R69H 1Y18A 3HI5L 1YNLL 4HKBA 1XH3B 5F6IC 3MNZB 3RI5K 4PG2A 1S8DA 1BQLH 4K7PL 2UUDK 1N2RB 4JVUA 4WFHE 1BF2A 2FX8L 1NC4B 3VJ6B 4ETQB 4G9DB 3E1F1 5JQHC 3I3EA 1MCFA 3KWWA 4G7YH 5DGQA 2Y9RT 1JJUA 2Z9TA 2GSIB 3KLAB 4G8GD 4NNXB 1CVSC 5DFWH 3L3KB 4TPRL 2VXVL 3A6CH 4QRPE 2EIDA 3PHQB 1LE5B 3TV3L 5AD0B 4HC1H 1A7RH 3UPRA 4ELMB 4Q2ZB 5D1QB 1AQKH 5M95B 1I8MA 3B83A 2CDGA 1EIBA 1WIOA 4G6KL 4HKZB 2ZKHL 3NFNB 2YK1L 2AVGA 1I8MB 4L4TE 1G9NL 5DJ8A 4X4XA 4Q9QH 3NABL 2CJUH 1MJ7H 3OG4B 5ICXA 1FZKB 3MRJB 3I3BA 3VGHA 3D69B 2YA0A 5DMJB 3JUZA 4ZPVB 5A16B 2AJVL 3CMGA 3PHOB 3MLVL 4XP6H 5E94A 4PJHF 1TQCC 3CSGA 3RWGB 2NXYB 2VNCA 1FORH 5DFTA 5KSAA 3MC0A 3EFFA 2B1AL 4Y16B 5DQ9B 3HPLB 2O93L 2ITCB 1G6VK 1HHHB 4HJ0C 1JPGB 5GJSH 2IAMA 4WDIA 4GRLD 5EIVA 5KSBF 1QLRB 4BSJA 4KRNA 4PB0L 8CGTA 1D9KC 2WBJB 5I0ZA 3MXVL 1NC2D 1XMWA 2F54B 4Z5RA 3L3GB 1NFIA 3UC0L 3BRDA 5IM7B 1N6QH 4K9EL 4RRPA 1F4XH 2AERT 2QADC 3OB0H 3UTOA 3MGTB 3W5MA 4EI5A 2IMNA 4MA1C 3UZEA 4BZ1H 3D39E 2JK5B 5JW5A 4XP4H 1GOGA 4F3FB 5F3HB 4EBQL 2JCCF 2V9RA 1PYWB 3B9KB 3FN0L 3MRFB 4U6XA 3Q6GH 1KENH 4Y5VC 1BAFL 4NQTA 4QRRB 2DQEH 1RUAL 5ALBH 4M62L 3C08L 1FYHB 4NNPH 1XIWA 4PJ5D 1SVCP 2EDWA 4POZD 5HHME 2GIYA 1FCCA 2IPUG 1PG7H 4FQLH 4HWBA 4J3XA 3MR9B 4Y5XC 3MQIA 1ZGLA 32C2A 3L5WA 5HJ3A 1R5IB 2R1YB 5H35B 3O4LD 2ERJC 4HF5L 3UBXI 4JM4H 4GAJH 4P3CL 4KV5F 4J23A 5EUOE 5HYJD 2WWKO 3NAAL 3P30L 3OKMB 4OD2A 3EYQD 3DWTA 3BGMA 4Z7OF 3TO4A 1JF1A 3QXUA 3BUYA 2HVJA 3BIBX 4JPWL 1AC6A 1A9BA 1TVBA 3STLA 2QL1A 4R96A 5DO2C 4IIQA 2NNAA 3CFEB 4Z9KB 4DAGH 4ODWA 4F58L 1NCAL 2Q6WB 2P5EB 2IBZY 4U1IA 2YN5A 5HHNB 1F02I 1S7TB 4FP8L 3VFPA 1F42A 3QDGA 2D9QB 2O5ZH 3W0WB 1MWAH 3GJEB 2C3VB 4MJ2A 4CVZB 3SKOA 1UEMA 5KZCD 3K80A 4ZTPH 4YXLH 1ZHBA 1GZPA 3RAJL 5EFIA 3K8MA 4NC2B 2JF1A 4L4VE 2EXYD 5KSBA 2Y25A 3MLRL 1UEYA 2BSED 4R8WH 5FYLL 5LBSH 4Z7WB 1R3JA 2BCKB 1VDGA 2YPVH 3RVXD 5ID0A 1B3JA 5HHOB 2NZ9D 4YHLL 1NGXA 4TULH 1QBMH 1OAYL 3DX8A 1MVFA 4DKEL 4RFEA 3U30C 1P84J 3ARUA 2EKSA 3ZYOA 3O41A 43C9B 3SE4A 3IB4A 4JB9H 5CIPA 3CUPB 1J0ZA 1MHHA 4IRZL 3LS5L 4LVHB 1S7QA 4CL7A 2MWCA 3T2OA 1P69B 2P8LA 1NGWA 2AJYL 3WCYA 4JHWL 3VW3H 3BPOC 4RRPG 1NBYB 1FNEA 4IDLA 1ZWIB 3TA3A 3SKUD 3VWJC 4G9DA 5DK0B 4PJ7A 4ONFH 4P59H 3ETBF 1YYML 2QQNL 3MV8B 3CFBA 3WXWH 3X3FL 4N0UB 1VKXB 4KRMB 4H1LH 4QHNB 1CE6A 3RZWA 4LQ1A 4XMKH 5C09D 1AHWC 3MXWH 4MQSB 3ZKQD 3ZTNH 2GAZB 1OT2A 4I3GA 1ZHKB 2YZ8A 4POZC 3S35L 4WEBH 3PWVA 2ICES 4E42B 2FEEI 4DUXA 1T80A 4YHOH 1C1EL 2V17H 3SKNB 2P5WD 1I9RH 2G5BB 5HYIA 2P8LB 5BVPL 1PBYA 2XWJB 3RWJA 1AY1H 5E99L 4DN4H 2DKSA 3O9WD 2R4SH 3QO1A 4DW2L 1UVQA 3L3IA 1KB9K 5F1NA 4N0FA 5E2TH 5SWSE 1GGIH 2R4RH 3QUKB 4JDTH 1QBML 3UJIH 5T1KA 1JHKL 5I8KL 2CKBB 5C0BB 1JGDA 5A2FA 5HHQB 3PWPA 1UH2A 3NA9L 5I1DA 4C56A 1N64H 4POUB 2NX5D 5I9QB 1IGIH 1T1WB 2C7UA 2EECA 4MMZC 3BDXA 2IANE 1I7RB 4LHUB 4F33A 1NMAH 4Z18A 4FOMA 4I9WE 1A9EB 5L2KB 4RIRB 2ED9A 4WNQB 2VL4A 1FO0B 3BKMH 5EFIB 5IJKC 5MERB 4HKXB 4H88H 4MCYA 2XKNB 4PJGA 3QDJB 3WD5L 3VXQA 1MLBA 2ADGA 2C3VA 3GIVA 1NMBL 3SOBL 3ARGC 3NA4A 3CFEA 2Q3ZA 3F58H 5DMKB 3W11D 4FQXB 4K8RL 3VFGL 3MA9L 2P5EA 3FRPA 1WAAF 1QG3A 3RP1A 4D9LH 2UZIL 3GNMH 1OY3B 1J8HA 2WINB 1M7DB 1OLLA 2KPNA 1TETL 2NY1C 3DMMB 5JW4R 3QPQC 2J8UE 3QUXC 3VGAB 4JAMA 1LO0L 2R1WA 3C8HA 5HYEA 1NCBH 4O9HL 3UTZB 3V5DB 4Y1AD 3TFKC 4GG6B 4Z0XA 4H20H 4JJ5A 1A7PH 3WNOA 2OZ4H 4XVJH 4YDJB 4DAGL 4FQQA 4GG6A 3Q5TA 4XP4L 1QTYT 4X7TB 3E3QC 2CUHA 3BN9D 4FHBD 5EZJA 3VCLA 3M07A 3V4PH 1FNFA 3LKSA 4HUVA 1LP9B 4GBXA 2EDRA 2HN7B 4ZXBD 2XZCL 5E9DE 2F19L 3FQWA 3IKCA 5CGMA 4ZUUA 2DQEL 1JYNA 3R8BB 5C0CA 4X8JA 1F2QA 5KSVA 3PDDA 1DQMH 4GXUN 3CFDB 4OIIL 3QNXB 4NZTH 1INQA 1S3KL 5IHUH 4EBQH 2V2XB 4HWZB 2A0LD 2JJTA 1WFNA 2DWEB 3QA3A 2DLFH 4PLJD 1HHKA 4J2XA 4NQCE 4UIKL 4BQBA 3WNKA 4NOBA 4U49A 1OCWH 3TESA 4PRIB 1MLBB 3LRHA 1IILE 3ULVD 1IKNA 4WNQA 3K7UA 1AQDB 1KTDA 3AS0A 1UKTA 3BW9B 3UTPE 4NQCD 2IGFL 3QEGH 4OLWH 4P9HC 3QI9B 3L9RB 5F44A 5IEHB 1BQUA 3IDGB 4Y0GA 3KGRA 5IWLA 4GAGL 4LEOB 1I9JL 2IPUK 2OL3B 4IRJC 4XCCL 5MP6H 1KB9J 4AEHL 1A6VL 3LV3A 3DX6A 3DXAD 1U6AL 1M7IB 2ITCA 3O6ML 5I71C 1UWGL 3AU1A 4Y4KB 4K9EH 4ODVH 2A6JB 2CKBA 1W72H 1FNHA 4H26A 5L2KD 2NQCA 3VXTB 5E2VH 1YY9D 3BP5B 3LZFH 2EYTA 3MROB 3QUMH 4KJQC 4L8SA 2VH5H 3LN4A 5ICXB 1RUKL 4ODTH 1NL0H 1Z9LA 4YWGH 2EC9U 3HCVB 5EA0L 5HHOD 1DBAL 3UPRB 3BD3A 4OD1H 5AZ2H 1ZVYA 5KN5B 4YBHA 1WQVT 3ARED 5DJYA 2AXJA 4X9HA 3TBSA 3E8UH 3PHQA 1LE5A 1X4YA 2BX5A 3DGGA 1U2HA 5JHLH 5LXGL 2OJEB 1CCZA 3T2NL 2WUBH 1BIIA 3LS4H 2BY2A 4P4KD 4MAYA 4S1QH 2HYMA 1A6ZB 5FUOH 3WO3B 1CFQA 3U82B 2FX7H 1OSPL 2SEBB 4C83A 2Q8BH 1D6EA 5E5UB 5IMMA 1YN7A 5FOBA 3LKOB 1Q9WA 4AM0A 3OGOE 5JR1L 4L4TD 1FCGA 3MRNA 4UQ3B 3TIDA 5IOPA 3EFDH 5FCUL 4LHUD 3EGSA 1G9ML 2BOCA 5DK0A 4PUBL 3SO3C 1AH1A 3T8XA 5HYSB 2Y07L 2UY7A 2VDML 3TVMC 4TUOB 1DUYA 3LQAC 4U1NB 3P73B 4ZFOA 4LCYA 5I76B 5DTFA 4DFHA 12E8L 4XC1H 3U4EA 3MJ9H 1JNHB 2GY7B 1I8KB 3DX8B 3ABZA 2XWBB 3TYFA 1MREH 4YLQT 1BREA 2YRPA 1PEWA 3MA7B 4H25B 2EDQA 2QSTA 3F7YA 5C0CE 2DI7A 3GHBL 3D85B 2GJZA 1H8OA 3FOLA 4JY6B 4YBLB 3FQNB 4LSVL 3C6LB 1F3JA 1T7WA 5E4IA 4UTBL 2ED7A 1KBGH 1SBSL 4R97B 2LAGB 2NMSA 2EE3A 4JLRA 4JRXD 3SKOB 5EN2A 1FLTX 1XF4B 3LD8C 1L7IL 1L4IA 3B5TA 4Z7WA 3QI9A 3MLPA 4XC3L 3A0OA 3H9HB 5BV7H 3R0MA 2NLJA 3AY4A 1RU9H 3IDGA 3HA0A 4ENED 4LVNB 1QRNA 5I15L 1BEYH 1M6OB 4P3WA 1VGKB 3DXAA 3LQAL 2NNAB 2QQLH 5CHNA 5BRZD 4ZD3H 2KL6A 2MHAA 5DUBA 5JMOC 4WGVB 2GUOB 3CD4A 3PUCA 3JV4B 4Y19E 3EKCA 4PRPA 3HFMH 4YK4C 1SM3L 2NY5L 5AAMA 3JWOL 3BWUC 5FEBA 1FV1A 2RCSH 4U0RB 3VXUD 2L7UA 1WICA 4YHPB 1HHKB 1MNUH 1T66D 3BT2L 3HNVL 4GAFB 4LP4A 1T2QH 2V2XA 3GB7B 3TM6A 4MX7B 3VXMB 3EOBA 2FO4B 2IAMD 5DEGA 3T0BA 3KJ4C 4AQ1B 3FO1A 1KLFA 4U7SA 3TC9A 3BD5A 5HHPA 5JHDA 5IG7A 3DO7A 1T22A 4XCYB 1MHPH 4Z0BL 4RMSA 3CVHL 4ZAKB 2R0WL 4PJBA 1I1YA 3SGKA 3G04B 1U3HC 5KVEL 5BQ7B 4P2RB 4XZUA 1KJVB 1U92A 2ESVB 4LPUA 5DD5L 4P2QB 1R5VA 4U1KB 5F1IA 4M1CC 3SHSA 1S9VA 1J1OH 2PTVA 1QSFB 3WFBL 3L6FB 2NY0C 1QOKA 1E6OH 3D25B 3BQUC 1NKOA 4LSDA 1IJ9A 1W0WA 5C0DA 3DPBA 5GXBB 1FV1B 3HI6H 5EWIL 4TNVF 4X4YB 3TWCL 4N8VA 4XPAL 4LGRB 4X98B 3F7RA 4LCCB 4HIEB 3BZ4B 1DQQB 5IMLB 2M8XA 3KPOA 3MUHL 3I6KB 4WFEE 2HLFD 4I3RL 1YEIL 5DURB 4JE4B 3BKML 2A9NH 4LOUD 3L3HA 2JIXB 4LIQL 1A9EA 4C56B 1HHHA 1BVKA 3F58L 4TQEH 3VMOA 2NW3A 1WITA 2EH8L 4XX1E 4ZS7L 3ARFC 3EYFA 4FQ2L 3MLWH 3HE7B 2CLVA 3HZYB 4PJGF 2DAVA 4M7ZB 2B1HL 4ZOCA 2BMKA 2CGRL 3D0VB 4I2XB 5HDLA 5DC0A 5KVFL 4XTRC 4N0FB 1MCKA 3C6LA 2V9TA 1ZVSB 3RTQA 1ZKAA 1X5LA 3OKDA 1P4IH 1MAJA 3L3DA 3CFKA 3OJDA 2C3XA 2CUIA 1JRHL 1SY6H 2JJTC 5DO2D 5D71L 4DW2H 4P46D 5CEYB 1KJ3H 5GRZA 4LFHG 4N68A 4OZHB 3TLRA 2XWBA 3TYFB 4ODBD 3DNKA 1AFVL 2W9LA 2DL2A 3IDJA 3HRPA 2Q7NA 1ZHKA 1FFQA 2ITDB 2EE2A 1IGML 2NTFA 1IEBB 4PRPD 4A6YA 3FT4B 1JE6A 3EGSB 1J1PH 2ADFH 5I73C 4H5SA 1KIUA 3L3KA 1U93B 1KULA 3LIZL 1MIMH 2P5WA 2YRLA 4KVCH 5D2NA 4U1MB 3O6LL 3UBXA 3SO5A 1QEWB 4TNVK 3CZJA 4XCFL 2MNUA 3CFBB 1JHTA 3T04D 1VEOA 1X6NA 5DRWB 2OP4H 3U7YL 3DGGB 2NY4B 3QIBA 3MNZA 1KCSH 4FFZH 1OPGH 4Y8AA 1MFCL 2A77L 3MZGB 4D94A 2W1NA 2APFA 2EKSB 5L8JB 4YO0B 4PGZA 4NM4H 4QCIA 1N0XL 3QXDB 1F8TH 3CMOL 4I0CC 5C09E 1QQDA 1K8DB 1PSKH 2A1WL 4G5ZH 3AM8A 4HS6B 4QT5B 5JW4N 1AXIB 3QH3B 4LEXL 4MJID 3GSXB 4E41B 3EO1B 2WWKT 4ONGH 1YECH 3OL2A 1KJVA 3MJ9L 1AGDA 2HAZA 2DMBA 1KEML 5DJXB 5EBWA 5I8EA 3T0EB 1UJ3A 5KW9L 3GGWA 5DS8B 5DT1H 3OHXB 5TDPA 2R2EA 5C08A 5KJRH 1FZOB 3ZHKA 3GJEA 2OXGA 5BMFL 2ZNXA 5DURD 5D70H 3P0GB 4XMPL 5DHYA 1SMAA 4J3WA 4UV4H 3PP4L 1YQVL 1GPOH 3IJSB 1NUDA 3K8KA 3GZKA 1NAML 4DN3H 2VQ1A 1K8IA 4RA3A 1WZ1L 5LXGH 1P2CB 1OCWL 4CMMA 4PJXE 5K93A 1KN4L 3HR5B 4O2FB 4R96B 5I19H 2DKUA 3ALPA 1AJ7H 3KPQB 4NQEE 4NQDE 2PETA 2UYLA 1X6LA 4PJHE 4CN4A 4IJ3C 1ED3A 3ZHDA 1D5IL 3DXAB 3OF6A 2BK8A 2EDBA 2C4XA 1J5OL 1XGTA 4J3SA 5T33H 4Y16C 2ADIA 1D6VL 3CPLA 4P2RD 3MV7B 5DR5H 3SE3A 3QFJA 2VLLA 1R5IA 1KACB 2AK1H 3TNNB 4PJ8D 3C2SA 2EDKA 4YPJA 2FX9H 2B4CC 5ESVB 4FTVD 3VFRA 3DUSB 4HCRL 4AQOA 4RGNE 1NGPH 4X7TA 1MELA 2OZ4L 4XVJL 3U7WH 3INUL 4LL9A 4KK8C 2X4UA 4PP1D 3RWEA 4EUPA 1HSBA 4N0YH 4AEIH 1QZ1A 4Z6AT 3AXLA 3NH7L 3F7YB 3TT3H 2QKIA 1UQSB 4PD4J 4OFYD 2X9YA 3ARSA 1PFCA 1KPVA 4HXAL 1OAZL 1OTSD 3I6GB 3QCTH 3SEPA 2WINA 3UXFA 4D9LL 5E6IB 1NFIB 1MFBH 4GXUM 3ZDXE 3FB6B 3SCMC 4DCQA 4CNIA 2YUXA 3AUVA 3QWRD 4CW1A 1ES0A 2MPAL 4XMLL 2C1PA 4PJDB 5BV7L 1P4BH 1YUHA 3S5LB 1GSMA 1FE8H 2F8VA 3B2VL 1D5MA 1L7IH 4MJIA 3MV01 5DQ9A 1U0QA 1MCEA 2P24A 4QRPD 3VDAA 5IHUL 5E94B 3ZT5A 3DVFA 3U9UB 3MXVH 1A7RL 5IVXF 1P7QB 3UTQB 1OTUC 4XB8A 3VD5A 4EOWH 1LK2B 4JKPH 4Y2DB 4QO1A 1DL7H 3KPPA 4DQOH 3C87A 3QCTL 2QQQA 2BNRD 3IFLH 1PX3A 2YC1B 3H0TB 4OI8A 4NCC1 3M8OH 1AO7E 3WEXA 4HSQA 4PYGA 35C8L 3HMXH 1OGAE 3ARQA 3PDGA 4U6VH 4QYOA 4AL8L 2Z91A 1R3HA 4D0CA 2J88L 3N1FC 4X9FA 5EZIL 2XIDA 4DZ8B 1I9RL 1BVLA 2XQYK 5DMYA 5F96H 4WU5A 4JGUA 3QG7H 4OF7A 4P23A 1YNLH 5J0BA 3OJ2C 2D3VA 2UWEB 4S2SB 4PJEF 3HB3C 2UZYB 2VLRA 2DM4A 3SDYL 2D31B 2WMPA 2PXYB 3OXRA 3V7MA 4EQ3A 2P24B 4HXBH 5DR5L 2AS5M 4J3OC 3DX6B 2X70A 3MGOB 5C0AB 2DJ4A 4NDMA 3O9WB 5I16B 1XT5A 4PJ7B 4XRCA 3RY6A 4R6UA 5IVXB 5B38A 3RWCB 4CNIB 4F2MA 1AQDA 4XPTH 1MI5B 2PN5A 5E9DD 4R0LB 3ARBD 1IL1A 2IQAA 3MNVB 3WNPA 1RSFA 1LWRA 4MQ7B 3NIDF 5ACZB 2MOVA 3LIZH 1KPVB 1TTGA 4LSRL 4UV4L 4XMPH 2ZG3A 1X4XA 2H41A 5IBUB 3QDGE 1KXVC 4DJMA 3T4AA 4U1HA 4I18C 1OAYH 1F45A 4PJEA 1MCLA 4LMQE 1JGLH 1FC1A 1NFKA 1N8ZB 1VSCA 1P5UA 4N0CC 5FF6B 3GM8A 3DSNA 1PKQA 2I27N 2CDEA 4QHKJ 1A7QH 1NANI 2OTWB 4QEGA 3TCXA 4PYHA 3T0VA 3PABB 3GSUA 5FYKE 4WVRA 4NZRL 4EIZC 5DVNA 1FC2D 4JG0L 5AYUH 1F8TL 3CMOH 3UTTB 5H2BB 3R1GH 4PJCA 4M6AA 4UILH 3V52H 1M7DA 1PDKA 2WWMC 4RZCA 4JM2A 2YRZA 3MV7E 5D71H 1KTLB 4XAWH 3TWCH 1E4XI 4EXPX 3HI6L 1OAXH 4L4JA 3LKRA 4L1HA 4K8RC 5MEOA 4QRQB 4B5EA 5DMKA 1DBJH 5I1JH 1A14H 3NVQA 4M5ZH 3CVIL 5I1AA 3KYKH 3TO4B 1A47A 4P5TC 1EJOL 1JZ3A 1CIUA 4IJ3B 4KTDH 3DV4A 4XGZA 5A2LH 3V4UL 4EI6A 1DEDA 2Z35A 1IT9L 4LLUA 5ESQB 1T89A 1T4KA 1DVFB 3CCHB 1HHGA 2V9QA 1A3LH 3RBGA 3GMPA 4TUKL 3BEVB 2E27L 2VSCA 4WWKA 4R4BB 2X4TA 3MFGB 4KKAC 4QF1B 4YE4L 1PG7L 3Q5OA 4FQLL 4S11A 1KSRA 4NJ9H 4YX2H 3VWKA 3FFCA 3V6OC 4XH2B 3JVGC 1XIWB 4JQVA 1NCCH 3DX7A 2VL5B 5K9OA 3SY0B 3BT2H 1JRHH 1SY6L 5L8KB 4CUCA 1CE1L 5HYJE 1A3LL 3KPRE 3I02B 2JJSA 4TUJB 4PJEE 4MHHG 5E00B 5SWSB 3QR2A 3MGTA 5D96B 4MD5B 4LPVA 2VDNH 1ERNA 2DBJA 1U8LA 1AP2A 3DVIA 3GI8H 5J3HD 1P1ZB 4YK4B 1PX4A 3QRFM 4PY7A 5T3ZE 3TBTA 2WBJA 1RHFA 4PJ8C 5CZXD 2BC4B 3D48R 1PAMA 3FJTA 4FZEH 4FNLH 4LSSH 2B5IC 3GHEH 3JTTB 4HG4J 3HFML 4GW1A 1J0HA 2BNQE 5ERWB 5IQ9A 1FORL 5E8PB 4PJDF 1QLEH 2D7QA 4X6BA 3O2WL 4HPOL 4WO4B 4HIIA 4UTBH 3QEHB 4JREB 3RWGA 4OCWL 3EJZC 3FB5B 3MLZL 4XNMB 3LQAH 5GRXG 5J06A 4HUUA 5JPMB 3L95A 5D5MF 4Y2DC 5LGHL 5KVGL 1MI5A 2R2CA 4DTGH 2H6PA 4GXVH 5E2TL 5FDWB 4HIHA 1A2YA 4GRLA 4NQXA 2A74A 2C4FU 4UINL 2GTZB 3QPXL 5T3ZL 2IF7A 3HE7C 3IDXH 4LBEB 4L4VD 5A2JH 4XBGA 2WLYA 4NJAH 5C92A 1MCRA 2ARWA 2DQFB 1I1AB 1HK6A 3VMNA 1HXYA 2CXGA 4HC1L 6CGTA 2VITB 2PW2B 2NY3B 4DKDC 5JZ7C 2HMIC 4LMQI 1MHEB 1XGPB 5F7EH 3KYNB 4OCYH 2VLMD 1BM3L 4MNQD 4OF6A 1C7TA 2FWOB 2VZ3A 5IHZA 1AO7A 2OCFD 4X6CB 3S4SG 3DROA 1YN6A 4JZNB 4XX1G 4N0RA 4WI2A 4XPHL 2J6EA 1WC7A 4DZ8A 4YGVB 3BH8B 1ZLSL 3O2DH 2CKNA 2X6MA 1B6UA 2P8PA 2BRQA 2ICWB 2Z91B 5HD8C 5JOPE 4KKLC 1UM6L 1YZZA 4NO2A 1ZVHA 5J89A 4GG8B 3LKPB 4ZOAA 4ZSOE 5IMKA 4XBGB 4HIXH 5T1LA 5F7WC 5C0GB 4JDZB 1A6AB 2B1AH 2PNDA 3PWPD 4ZNEE 5MEQB 2VDKL 2B2XL 1R3KA 4K8RD 1IAKA 1MJUL 2F5AH 1A4KB 5E8NB 1J9CT 2VDRL 2D7MA 1WZ1H 2DQIH 5IESL 3FOMA 2Z4QB 4UILL 3V52L 4HHAA 2FX7L 1FFRA 5GS0H 1MCNA 2KBGA 1I3UA 3ARGD 3Q3GB 4HUWA 4TVSa 4NHCL 5EUKA 3P3YA 4YUEH 4WO4A 5FUZL 4YDLB 2OR8A 5IQ7L 1MCHA 4JO4L 3ZE0E 3FO0L 2AJ3A 3DHMA 1BMGA 4JVWA 4RAUB 2YUZA 3WL9A 4S1RH 3UJTL 2V7NA 3M17A 5HBBA 3VXNA 2GJ6D 4OZIE 3ZT6A 5HHPB 3FMGH 5IGXH 5H8DA 1YECL 3L5WB 2IQ9H 4LARH 3MRIA 3IDMB 5ISZD 4YHKL 4O00A 1ZOXA 1CQKA 4LCUB 2FO4A 3I6GA 3UTSD 4K3JL 1PGRB 1CBVL 4WI3A 3ES6B 4WTZG 3ARDA 3MCLL 4I13B 1HEZA 4UT9L 4XP1L 3BP7A 1RZ8B 2OI9C 1DQJA 4QHUB 4YH6A 4M43H 2EEBA 4R7DB 1D5BA 1CDGA 1OTUD 1ND0B 2EYRB 1JZ2A 4U1GC 5FUCC 5IW3A 3WKNA 3MOAH 3FHQA 2MPAH 5FYJD 2XN9B 2CK0H 5IBUG 2QQKH 2PR4L 1ZA6B 4QWWD 4M7KH 3MJ9A 3RNKA 1U41A 4JGMA 1DVFD 2WP3O 4K3EH 1QVOB 1RZKH 1TENA 4KVCL 1ITCA 4GKSB 1BM3H 4OT1L 1VPOL 1I9IL 5GGVL 1DN2A 2HLAB 4JKLA 1EK3A 5IQ7H 4YZFE 3PF2A 4LDOB 3U1SL 5KSAC 1N5YL 5LGJA 4HW6A 3IGAA 4U7MA 4I48A 1KLUA 4PJ9A 1WJ3A 5CSZB 4D0DA 4NSKA 1D5BB 3HI1B 5CAYB 5A3IC 1EAJA 1KPUA 5IR1B 1UXSA 4PR5B 1TZGH 4D0BB 1FZKA 1MI5E 3WJJA 3MA7A 4FFYL 3HAEH 5D7SH 2ENYA 3O2DA 3PWLA 4GAGH 2XZCH 1X7QB 2CMRH 2OTUB 2VH5L 2DWDB 5C71A 5KVGH 3VXOB 2ZG2A 4OZ4B 3NFNA 1XGUB 3CGTA 4WI5A 1J11A 1R5WA 2CR3A 3CU1A 4WHYH 1ULVA 5CJQH 1I8LA 1BBJB 5GJSL 3GUTA 4EUPG 2GSIA 3KLAA 4NNXA 1CI5A 2ADJB 5I75C 3EOTH 4UINH 1MF2L 1SEQH 4J3TA 3HN3A 1TVHA 5F9WB 1S5IH 4P5KA 3QH3A 4K23H 3TT3L 1PY9A 4J4PA 2E5EA 3GI8L 3O4LA 4N5ED 2ZUWA 1MHCA 3P9LB 1XGRB 4LSUL 3V7AG 3T1WA 3D3VA 2FJGB 5DJCA 2MKLC 4HHAB 5ACZA 5T1DL 1GPOL 3WLWD 3MACH 4DGIL 1RIUH 2JCCA 3TBYB 3V6OA 2NY3D 1J0IA 1EHLH 3B9KC 4F8TA 5E1AA 1IM9D 1TNMA 3ALXA 4J1UA 3U7AA 5KG9A 1YEHH 1N26A 2BOBA 5IIEB 1MI5D 2RQ8A 2V2WA 3IRPX 2DYPB 1T5XB 1SJVA 5BVJB 1VEPA 1JHTB 2FATL 5HI5D 1BFTA 4BFEA 4QHLA 2NY3C 2NY6C 4Y4KC 1R3LA 5DD6A 5B39A 5IV2A 4DK6A 2ZSWB 5FFLA 2R0WH 2VAAB 3U36B 4RX4D 1DQLL 1HNGA 1YEFL 1IGIL 5GGRB 1IQWL 4NM4L 4K3DH 4JKWA 1HXYB 4RCAA 4AG4L 3SDXF 1BVLB 5FHBH 1N5AA 2BSSB 5DJ2B 3DVNB 1YJDL 4MA8H 1TZHB 5FKPA 5I30L 4YE4H 4LQFH 1XGPA 3SBWA 5J6HB 4MXVE 3GKWL 2HVKB 4E9LA 4ZUTA 1HZHH 3ULUE 2PXYC 1RFDL 5EZLB 2P8MA 5BMFH 4NN7C 4MD4A 1S7VB 3V0WH 3L95B 2Y6SD 3RTQB 1EGJH 3IFPA 1VB9A 5IKCA 4N9GA 2FGWH 4G8EB 1VEMA 1MHCB 3FQXA 4M5ZL 3KPMA 3LN9A 5F9OH 2MMXA 1CZ8L 1IAOA 3BPOB 5E2WL 5DHVA 3H2WA 4BFIA 1XIWD 4PJ5A 4IEFB 1KJMB 1ZHNB 2OMBA 5TE7H 1C12B 4K9EC 3T3ME 4DVBB 1EO7A 4TSCL 1CLOL 3LKSB 1ZANH 2DS4A 3ARBA 5ITBL 3EYVB 4WV1A 3P77B 4O2CA 1DLFL 5FGCE 1UWEH 3S36L 5HVFB 3VFTA 1TFHA 4X4ME 3Q5YA 4MB5A 1P1ZA 3MV8D 1YQ2A 4G9FB 1YEDA 1V7ML 5AWNH 5FB8B 4NN5C 4GH7B 3SCMA 2R2BA 3NZHH 4GG6E 4K71B 4XB7A 3QAZB 4TRPH 4OQTH 4BH7A 3MNWA 5FO7A 1L0QA 4GS7C 2XKUA 4OUUB 3CXHJ 1HSBB 2Z92B 3LEVH 2R0KH 5FYJU 2KQMA 2A9NL 4OI9A 2NY7L 2HRLA 3VMPA 5ALCH 3CCHA 1CVRA 1I1YB 2AABH 4LNVA 2H32B 2PCPB 3OZ9L 1LEGA 4IOIA 3ZTJH 3ARGA 2F53A 2XOTA 3UJJH 4Z76B 4ESKA 2IPKA 1HOCB 3V0VA 4U1SA 4J4PD 3TF7C 3FO1B 4I3SL 1U2CA 4RIRA 3JSSA 4P0DA 3MLRH 2JJVA 2UV3A 3QUMB 4ZYKA 1RZGB 1DEEB 4MX7A 2Q3AA 1RZGA 2RFXB 3CVHA 1ED3B 3QG7L 1BLNB 1KOAA 3PJSA 5FYLD 5JOFB 1I8IA 3ME0A 1TZIA 4KJYA 2XICA 4LVEA 3ARGB 2F8XC 1EPFA 6FABL 2H26B 4ZFOL 5J13C 4ODXB 1F13A 2IG2H 5IF0A 5IVZB 2ATKA 4P5TB 1S7UB 4A6YH 5ABDE 1P4IL 5MEOB 2YS4A 3WFBH 4WENB 1FIGL 1EHLL 1BWWA 5J13B 4FQCL 15C8H 4JFFB 2G5BA 3GMNA 4GMSL 4YXHL 1F3DJ 3PV6B 3WS6A 3LQMA 4M8QA 4NRXB 1CTNA 1H3TA 3B3IA 5GSVB 2EDXA 5DD0L 4R8WL 4L3EE 5FYLH 4KI1A 4ZTOH 4ELKB 4EZMA 4PJIE 2ZSWA 3HC4H 4JZJA 2IPTH 3WSQH 4NN6C 4MXVF 2EO9A 3TH2T 4N0CD 4OZIB 4BZ1L 1MCJA 5FM5O 4FFYH 4BUGA 1CQYA 4H25A 3HUJB 4U6HA 2X4QB 3UTSB 1MEXL 5EUKB 1LHZA 3MLTB 1NQBA 4K3DL 2V5RA 2N1KA 4ERSH 1OTSC 4JHZA 5GZOD 2OM5A 4CBPA 5E4EB 2YD9A 5DK2A 5DXWA 4PG9B 1FHGA 1OARL 3C9NA 3PGDB 2HFFB 3MMEB 5F1KC 4P2YA 4Y5YB 1Q9WB 4WUUB 5DRXB 3WHE0 1LMKA 3TEUA 2VZ1A 3E6FB 2ICWA 2O5XH 4G80A 1FFPB 1OWWA 3INUH 5C0BD 1WC7B 5I75B 4MJ5B 1S5IL 3ROOB 2EDLA 4QNPF 3OXRB 3BZDA 2VLKA 4C54A 3TH3T 2VLRB 1NLDL 4KK5C 4NDMB 1V7NL 5TPWL 1MJ7L 5AG8A 3GKZA 2XZAL 1FVCB 1Q0XL 2CLRA 5DDHA 4KI5E 3RWIB 2X70B 3DI3B 3MRPB 4XHQA 43CAB 1VHPA 4NO0A 4QXGL 3MREA 3C08H 2YEZA 5LQBL 5D7IF 2PYEB 4NPYA 4QYOB 1B0RB 5CD3A 4WHCA 4WI7A 4GG6F 4KJWC 4RWYL 3C2AL 3IDJB 4KMQA 2I9TA 1B6DA 1I1AA 5HDQL 5IV2B 3QWOB 2BP3A 3O4LE 3QO0A 5SWSD 5F3BA 2A6IA 3QDGB 4WU5B 5C2BH 1LGVA 1G7IB 1OAZH 4Q58C 1CFTA 2XG4A 2A74B 1QBAA 4OKVB 2K1MA 5ELIA 4D0CB 2V5TA 2Q6WA 4PGBA 1CICC 5DHVH 5C0AE 4UQ2B 4TVPD 4PRIE 2R56H 5T3XE 3UC0H 4NN7B 1QSEA 1W2KT 4HFUL 4Q97A 3WEXB 3V4VH 1LO4L 1RU9L 3IF1B 1F6LL 1YC8A 3GJFH 5EU4B 5IROA 5FCUH 4KDTC 2E7BA 3SDAC 4PJCE 15C8L 5D70L 2MCG1 2NW3B 4BQ6A 2DMCA 1PSKL 1F4HA 2A1WH 1QP1A 1S9WB 3VRIA 5I2IA 5DJCB 1YUHB 2JIXA 3P40A 1SHMA 4GBXC 1XEDA 3MX0A 1E4XH 1K5NA 1W8NA 4OI7A 2QQKL 1CL7I 3IRZA 3PGCA 5I1GH 3MJ8B 2FEEL 1RUKH 2W9DL 2AI0H 1A6TB 2EXWD 4KQ4L 4PRIA 4R0LC 4Z7VB 1I4FB 5DRNA 4OT1H 1IQDB 1KB5H 3MUZ1 1T04B 5IGXL 3BP7B 2FLRT 3ES6A 4HMEA 4OZGE 1FL5A 1T03H 3W39B 4IDJH 3T2NH 4JHAL 1QA9B 2E7LA 4PV9A 1NC2B 2A38A 2F54D 2VIRB 3GSNL 4QXWA 2OLDA 3FQWB 3IKCB 2ZWLT 3OR6B 5DZNA 2VLJE 1BHGA 1UXSB 4Y4FB 5T1MB 4JO2H 4PJ9D 3WFEH 4AH2B 2P5WE 4LLQA 5GJTH 2EIZA 3IDYB 4OJFL 3RFZC 4WDIB 4NQSB 4Q6IA 2F15A 3MV7A 2I60L 4YHYC 2EIBA 3LD8B 3WNMA 1TQCB 2WUCL 4AK1A 4LKCB 1J1PL 2ADFL 1TJGL 1UA6L 1V7NH 3TPUB 4PFEA 3FB8B 3GB7A 3M1BB 5GGSA 4XVUD 4L8CB 1FNSL 3T77A 4NZUH 3I50H 5BW7A 2R23B 5ITFA 2AV7A 3CSBA 1S3KH 4NHUB 3OQ3B 1X5ZA 3BEWA 4HS3B 4GLRI 4IOSD 2VAJA 4HH9B 1NL0L 2B2XH 3UYRH 2CIKA 3VXPA 3TH4T 4F7CB 1XF2A 2EH8H 4R3SA 4RGND 3MJ7A 4UBDD 1ND0A 1GC1C 4NKOA 5D1QD 5JHDE 1OGAA 3UX9B 3LRSA 1QRNB 2EDEA 3TNMA 4OCLC 4YUEL 1J18A 3PWPE 3U2SA 2QR0B 4F15C 3OHXA 5D7IB 1FNLA 1FSKC 1JBJA 2ESVD 2LFGA 3DVNA 4MVBD 1DVFC 3RA7L 2D0GA 2VXQL 1N8ZA 1AD9B 2K7PA 5LAXB 3QDJE 3AY4C 4HV8A 5HI4D 3THML 2OZ4A 1S5HA 1NCWL 1JGUL 3RVVD 2F53D 5FO8A 1QPXA 4NCDA 2GJZB 4JY6A 2AW2A 1IM9A 2AQ3A 1BPVA 1S8DB 3Q1SL 2EDTA 2HFFA 3MMEA 3MV9D 5T5NF 3WUWA 4ZTOL 4ZQKB 1NBZA 5B38G 1A0QH 1NMBH 4KVNL 2J8HA 2BVQA 4GRLB 4Y4KD 5FYKU 2EH7H 3V8CA 2AJZA 1FRGL 4JPVL 5HDOA 3CC5B 1OF2B 1QFWI 1UC6A 3SKNA 4MA1B 3QEQD 5E8OA 4FNLL 2AK4B 3I9GL 3OKEB 1UM5H 2D4DA 3MYJB 3MJ6A 5E1AB 3D5OF 5L0QB 5C9KA 3V95A 4HIIB 3UTSA 2I07B 1RMFH 3SOBH 3QUYD 2DM2A 4KVNH 1FPTL 5AG9A 4YHZH 4LK4A 4OLXH 2XQBL 4WHTA 4TQEL 5F88B 1TITA 4V1DB 5T1LB 4PJBF 3W2DL 3WS6C 2P5WB 3S9DB 3U6RA 3HZVB 4MA3B 1CDBA 5AUMA 2W38A 4H5SB 2FZ3B 4DTGL 1GGIL 4P5KB 3D9AL 3LH2L 3B3IB 3BP6A 3PQYB 4ODUA 1DBMH 3MACL 1ZHLA 1BOYA 3GSRA 1A0QL 2VLJA 4RMRA 3DUUB 2Z8RA 3OR7B 4L4VB 4ZO6A 4OCSH 1PY4A 4JR9H 4G6JL 3WKML 3OKOA 1XR9B 5C0EB 3U2SB 4YNYB 1QSVA 1ZS8B 5D6DC 5IBLD 5D9SB 5CEZL 5KSBE 4R2GC 4TRPL 5K9JL 1OAQL 4X4MA 1M71A 2IJ0C 2WP3T 4NRZA 2VDNL 2G9HA 1SBSH 3KYKL 3F7VA 3FRUA 4BZYA 1KCVL 1F00I 2L7JA 4H26B 3BIKB 3W0WE 2BY3A 5D4QA 5E8EA 3MRMB 2VSDA 2HJKB 2C9AA 3C5JB 3GMQA 3FB5A 4HG4K 2DQGH 2P7TA 4JFED 5EU6E 3ZE1E 5BOZG 5BW7C 3KLHD 5E8PA 3S5LA 4LEOA 4M7LT 1FAIL 4KGJA 2VC2H 4PBVC 5SWQA 3RL2A 3VWJD 4EVNB 4U3XA 4F7TA 3DIFB 1VFUA 4I0PB 1LEKA 4OLUL 3WUZA 1II4E 2JB5L 3GRWH 4YX2L 4FFZL 1KCSL 2E6QA 3IFOA 4HS8H 1JPSH 1MFNA 3BGFB 4DCQB 2Z92A 1JF6A 3JWDL 4AH2A 4JHWH 2D7TH 4YDVA 5HSFA 1YMHB 2DLTA 3DX9B 5DJ0B 4ZUSB 1I9IH 4JFPB 5GGVH 1JWUB 1I1AC 4DEPB 4AIZA 3LS5H 3T4YA 2H2PC 4HIEA 3WO4C 1ODAA 2ORBH 1S9VB 2UZXB 2AK4E 2DI9A 2NW2A 5IVOA 4L3CA 3T3MF 2P44B 1AR1C 4MD0B 3EYUH 3MRLB 2X4RA 4X6DF 3VWJA 2HA1A 5KS9A 3LEXB 2XN9D 4WUUE 4R97C 4P2RA 4XZUB 5DJ6A 1BWMA 3I50L 4NQEA 3S35H 1MFDH 3EYQC 3W11C 3JWOC 5F7DA 1T22B 4XCYA 1S9XB 1MCPL 1S7XA 4KDTA 1CFSB 2W9DH 2IFGA 3AS3A 5EZJB 3AM8C 1R5VB 3SDDB 3CFCL 1EVUA 1HE7A 4PJEB 3U79A 2X44D 2YMXH 1KCLA 3GIZL 3QDMD 4YWGL 1A1OB 1EMTL 3HRZA 3LPWA 5J12B 4P3DB 1J87A 5I2IB 5JHDB 1KGCD 2D7OA 3BKYH 4ALAH 3O6FA 5DUPH 2HT2D 1NBQA 4N9GB 3S3SA 1MH5B 1ZTXL 4LSQH 4P4KC 4OLYL 3SDDC 1ORSB 1W8OA 4HWBL 1BQHA 1HYRC 2FJHB 3RIFK 4MD4B 1Z9OA 1F2XK 4R0LA 2IADA 3SE3C 4IRZH 4GAYB 4KJPC 4ZFFB 3FO9B 1MWAA 2VKXA 4P9MH 4OF0A 3OV6A 4XPTL 1OD9A 3L3GA 3QUYB 5D2LE 1KGCE 3KJ4B 5CEXB 4LSTL 3VFMA 1GIGH 1N5AB 1A6AA 2NXZB 3CX5J 3T0EC 3MGOA 4HKXA 5HVHB 1W0VB 3RWFA 1QFWL 2P42B 2YZ1A 3HPLA 4HUMB 4UV7L 5CZXC 2Q76B 2FIRT 1KXTB 2YXFA 4X6CF 4XPAH 5AZ2L 9CGTA 3O3EA 5DZOA 3BH8A 4F9PA 2QJDA 5C86A 5L7XL 2P1YA 4YXLL 4LSPH 5E5RB 1FVCA 2CLRB 4I8DA 4OD3L 1G9MC 1UCBL 4JFYB 1T5XA 3O8XC 4M62H 3KPLB 2D9CA 4QRPA 4J1UB 1I8KA 1ZLSH 2VITA 3DURB 4PJGE 3V7AE 1W72L 5I76A 3NOIA 5D7LA 5IB4B 1HIML 3QB7C 5TDOA 3S5LG 5T3ZD 3OKNA 4G8GA 3O3AA 3HZMB 1QBLH 3ILPA 1I9EA 4H8WC 1GGUA 4OZGB 2VR5A 5HTSA 3SDXA 2V5MA 1CD0A 1ZK9A 5GGSY 1XGRA 1J10A 4XMLH 4PRBA 1YN7B 5FOBB 1AHWA 2APBA 3H7BA 3H8NA 2F5BL 1WAAA 4KJQD 5JUEH 2YBRA 4MJIB 4PPTA 4KQ3H 2YPLA 4GJTB 1L7TL 4JEGB 3BKJL 4QXGH 5IP4A 4GKZB 1L9MA 2BOCB 3MRKB 1NMCB 3RVVC 4OD3H 1LDSA 1ZSDA 1OP9A 4Q9QL 3FT4A 3S98A 4C83B 4FFVD 3O3DA 1R5WB 4JY4A 3LCYA 2F74A 4EDWL 4OZ4A 4UV7H 5E2JA 5HY9B 1MFBL 2UWEA 2O61A 1X7QA 3TN0C 1T1YA 3G6JB 3P2TA 3WIHL 3UAJC 4XPGH 3GNML 3MCKB 1FZJB 3HZMA 3GHEL 3T1FA 4NQCB 3LMJL 3S88H 4R2GB 3RGVD 2EYSB 3KYMB 2VLME 1QRND 1MPAH 4D0DB 2X4UB 4PTTA 3NFSH 5HVWA 2NY6B 2EDYA 1H8NA 3PG2A 3EIFA 4JN1L 3W5NA 1HINL 5HHOA 4JFYA 4X7SL 2VZOA 1FO0H 2NX5A 3TJEH 5I8KH 4YHKH 5DVMA 1LK2A 3QDMA 1JUFA 2H2SD 4Z7WE 4ZAKD 2B7DT 4PY8J 5KSBB 3U4AA 1G9NH 5C6WH 1XGTB 5I66A 5IFHH 2XPGB 3BO8A 4Z78A 1WWWX 3DV4B 4XGZB 1MFCH 3MTRA 3H3BC 3RWHB 4Z76A 4JM2D 1T0NB 4MMXC 2VDPH 5TFSL 2YSSB 5FV1L 3I6LE 3P0YL 2R69L 1DLHA 4C59B 1IT9H 3D25A 3MUJA 3FO9A 2DWEA 5ADPH 4TNWF 2FD6L 2X42A 2BERA 2IH1A 3IJSA 1UKQA 1RZJL 3ARBC 1IM3A 5F70A 3RI5F 2ZUVA 1RIVL 1QLFA 3MYZA 5JHLL 4AY0A 1U92B 2K3TA 2FRGP 3LN5A 3UTTA 4O02H 4PRHD 5DVOA 5TH2A 3GMRA 1H3XA 4NQDA 1FYTB 1IFHH 3ULSB 4CU7A 3BYYA 4QRSA 4WWID 3U0TB 4J8RA 4XAWL 4O5LL 4LHJB 4J6RL 3VGBA 4XBEL 5HJ3B 2BY0A 3EYVA 4GBXD 4JRXB 5HGHA 2ZPKH 1BBDH 2IBGA 1PVHA 3EO1A 5GIRA 5I17A 4FQ1L 5AYQA 3R1GL 2AKRA 3DRTA 4ISVA 3D0LA 5I1KH 1TNNA 4OKDA 4M1GH 3RGVB 2ZCLH 3P0YH 2OP4L 2W07A 2OBGA 1E6JL 4JO1L 4E5XB 2ADIB 2F9BT 4HJJL 4LLMA 3KR3L 2X7LB 1DBKL 3UP1A 1CL7L 3IYLW 1T1XB 1AGBB 3SGKC 4NO2B 4ONFL 5D1QC 1V3LA 4G9FD 5TF1H 3GBML 5EUOF 1EV2E 5GGTA 2LU3A 4BA8A 4EI5C 1J1XL 1EO5A 4R4FH 1PZ5B 2NLJB 2HKHL 4F2MB 4PJFA 4RMTA 3WS3A 1U8PB 3MJGX 4HS8L 3WHXB 1J88A 4P46A 5GRUL 2JB5H 4NNYA 1XF4A 4M93C 1GH7A 2N4IA 1ZANL 4YIQB 1CLOH 3H9ZA 1MCOH 2XKNA 4PJGB 4MCZA 2HRPH 1YPZE 3D9AH 2Q86A 4P4KB 4F58H 2PW2A 4L8DB 4B7LA 1MOEA 1NSNH 5DS8A 1IGTB 2ZSVB 3FTGA 4YBQC 2AJYH 4C56D 3FQRB 3EOAA 3JV0A 1EFXA 1RIHL 4G6JH 1G6RA 3WKMH 1HNFA 3O45A 4JO3H 4NRZB 3QO1B 4X0KB 2CRMA 4XNYL 4CKVX 2VKWA 5IB2B 1I7TA 1RMFL 1X5HA 1XAUA 5AAWA 4ZS7H 5HHQA 3B9KD 4P5MA 5GISL 3BAEL 4PG2C 5CEZH 3OKLB 5ID1B 1QUNA 1GGBL 4XP9L 3N9GL 4W6YB 4Q9BA 5GRVL 7CGTA 4TULL 3FFDA 2VISA 3ZL4H 4YHIB 2FB4L 2H2PD 4HEPG 1JVKA 2WQRA 3PP3K 1QNZL 1EBPA 3FKUS 3LB6C 4WFGE 4HIJB 3DYMA 2EXWC 3M45A 2E9IA 4HAFA 5AUMB 5CKAA 1J05A 4ELME 1MIEH 1U91B 1JGUH 2BXZA 1Z3GH 4IMKC 1Q9OA 5DMIL 1U8LB 1LO5B 3VWKC 5I74B 5BZWA 3DBXA 3W2DH 1EUTA 5IMLA 3QEQA 2EH7L 4U1MA 4FQJH 3NCYP 3U4BL 2VTFA 2VISB 4X99B 3MV8A 3BWAA 4RNRA 3VG9C 1NCAH 3ULUC 4XP5H 4JREC 3UDWC 3Q2CA 3FN0H 4A6YB 2NX5E 4W68A 3CZFA 5BOPA 4ZXBA 5HHOE 3X12A 1QHPA 4XNZB 2EIEA 1KF9B 4N1HB 5D2LB 3RZCA 5HPMB 3O6KL 1T66C 2AXHA 3STZA 1X44A 4QF1A 3BOVA 4R26L 4YEEA 1MHHB 1S7SB 4HJ0D 3KPSA 4U3CA 4WW1B 5KVDH 4Y5XB 2OR9L 4PLJC 1HDMA 4J3UA 2Z35B 1MNUL 3HNVH 2A6JA 2CH8A 3DO7B 3TCLA 1HKLH 2AJXH 3T0AA 2CDFA 1A3RL 3TYGL 3A6BL 1U3YA 3D87B 1HILB 5IB5B 4MCZB 1NGXB 2R4SL 2FJFA 2VERN 1EHAA 1MREL 1CICA 2AEQL 1U3HD 3WMSA 3FQTB 4QTHB 3HR6A 1MRDH 1A1NB 4RDQG 4ZUVA 5HI4C 5D2NC 3S4SB 3WS3B 2FH8A 5HHNA 3L3HB 5JLZA 4Y4HD 4C4KT 5I1LB 2VJXA 2VXSH 3U1SH 4OLYH 4NO3A 3MLSL 4M1GL 3QJFA 3MJ7B 4FG6D 4X7FC 4G43B 3L7EB 5EUOB 3HR5A 4O2FA 1Q9KB 3CSPA 4WHDA 5C7XL 4OSUH 5FM5M 4X80H 5TGBA 1FBIL 4P59L 3SDXE 1FL6A 4LASH 3W81A 2R8SH 1MRFH 5DC4B 3LHPL 4F7MA 2Y07H 2CDEB 1WZKA 3FQTA 4QTHA 1A6WL 1TJHL 1ROWA 2W0LA 1T21A 1QRKA 3DARA 2W65A 5IK3B 3ESVF 1QFUH 3ARDC 1L0XA 2CJUL 1OL0A 1U42A 2D7PA 2QSQA 2LU7A 3BP4B 2VLRE 2E6JA 4IRJD 1ORQA 3O4OC 3WHE1 1Q8MA 3FOLB 3MRGA 4OIBA 4JG0H 5AYUL 4Y5XA 1FYTA 4TOYH 4IIQC 4BQ8A 4KDVA 5C0JB 4S1QL 1SEBB 4P23D 1S7SA 3WL9B 5IJVB 3DMMA 3KPRD 5C0FA 4Y16D 1T2JA 4F3FA 4YR6A 4PJAB 5ICZA 2EZ0C 5K59F 4NHCH 3K8LA 4LCYB 4J3VA 3BDYH 1DUYB 4M48L 2Y6SC 4U6XB 3FZUC 5T5FL 4OM1L 2ZUYA 4XNQA 1FL6B 1RZKC 2Y36H 3SDAA 1IQDA 5E8NA 5DI8B 2CO7B 3PQYD 2B4CH 1VCAA 3PL6B 5C0GA 3VG0H 3QIBB 3MJ8A 1FO0L 1MAKA 1A7OH 1CR9L 2DBLL 2IBBA 3SE8H 2YXMA 1P4LA 4NN5B 1NKRA 1OM3L 4CJ1A 5EO0A 3F5WA 4HIJA 1S7RB 5FUCE 3ZKXC 2A83B 1EHXA 2A9MH 2YD3A 4HLJA 3OTTA 4LVNC 1CGTA 5DSCB 3MRBA 2BY1A 3QIUB 1R0AL 4FQXD 5C0BA 1CDJA 3LSOB 2HFEB 4HQQH 2GKIA 4Q0XL 1F6FB 2LTQC 4OLWL 5EOTB 4HLZG 1QSEB 5DJ8B 1IGCH 4OLEA 5E8EB 2FL5A 1U8JB 1K6QL 4ZMAT 3H0TA 4JCLA 4OQTA 4BYHA 4YFLI 1KUMA 4IMLB 3BPNC 4ELMA 3O6MH 1MJJA 2AJUL 3CXDL 4OGYL 2XYCA 1VADB 3SGDH 1MJJB 2XZQL 5MENE 1LNUA 4JFDB 3BUTA 5FDWA 1J0KA 1TTUA 1JYXA 4LKXA 1QPPA 2F74B 3OKKA 2J8UF 4L8DA 1AGCB 4KK9C 1CE6B 4NBXB 1JPFB 4ODTL 3EO9L 2O5YH 1NJ9B 4LCWA 5CCKL 3NGBB 4HCRH 1FGNL 1HXMB 4PGDA 4HUKB 3TA3C 2Z93B 5I1IH 1G9NC 4ODUB 1AKJB 5KZCB 1QSZA 4GRWF 5D96C 4LGPB 2FZ3A 5DRXA 1SYSA 4OZFB 1Q94B 3V9FA 5F1SA 4MSWB 3U6RB 5TQ2L 4WU7B 3PGDA 4LCCC 3SE9L 1YEJH 3GMOB 1WTGT 1GZQA 3ILPB 4HDIA 5I19L 4V1DD 1ZT7A 5LCVH 1P4BL 2Y5TB 1KN2L 1NCUA 1KN4H 1P7HL 1ZT4A 4TUJA 2I07A 4CVXB 1NDGA 4XNQB 1U3JA 4X9IA 5BXFA 4H20L 1UB6A 2IG2L 4NBYB 1X5IA 2HRPL 1TIUA 5E8OB 3QEUB 3D0LB 4ERSL 3SPVA 2BRRH 4FXGA 3HUJA 3O2WH 4HPOH 4U6HB 5DA0B 3WDHA 3CK0H 1MFAL 3HNTH 5IMOB 4GMSH 3P11H 1FGVL 1K4DA 4FQQB 1NBZB 2LQRA 4WWKB 1G6RB 1H9VA 2R4RL 3MFFB 4O58H 3O3UN 4NC0B 4JFXB 3ZKMC 1IBGH 1T4KB 4AIOA 1MCDA 2V2TA 1U3ZA 1KEMH 5KW9H 5GSVA 4GRWE 4FTVB 5BVPH 3MOBH 4U1IB 2VE6B 1FAKT 5EIQA 5I1AB 1G0XA 4FN0A 1CG9B 4R4NC 1U8PA 3I9GH 4FQXA 4L9LA 3VFGH 5TE6H 4TYUA 4Z7WF 3IAPA 3SBWC 4G6AD 3HC3L 2H26A 5DHYB 1CD1A 3SQOH 1SYVA 3CFIC 2OTPA 5KOMC 1OOAA 1RURH 3PJSB 3ULVH 1UB5B 4Z78B 1X4ZA 1JGVH 4K7PX 1CGSL 5BS0D 5JA8B 5CZVH 5E24E 1NMAL 5I66B 2XXMB 3QJHA 4W4OA 2FR4A 5D2LF 4PLKC 2R1YA 5H35A 3UBXG 1MCOL 4JHAH 2APXA 1AY1L 4JRWA 2HN7A 1X5AA 1KCUH 4FXGB 4HS6A 4QT5A 5F7DB 4AYFA 1HQ4B 1X5FA 2HJLB 4QOKA 1CDHA 3CFJA 5BS0A 1RIHH 2AABL 3HZKA 4JRXA 5HGHB 2GT9A 4JDTL 3VRLF 4F57L 3B9DA 1YC7A 1NSNL 2FGWL 4HDIB 5I18L 3HAEG 4L3EB 3MRHA 3VFWA 3QXTA 3CLFH 5SX4I 5I1GL 1PKOA 3MLYL 1JYVA 3F65A 1B0WA 1BZ9A 1SYSB 4OZFA 1YDPA 4BQ9A 3C6LD 4C56E 5KAQG 2Y5TA 2E7CA 3QXWA 5IB1A 3KVQA 2PW1A 3G6AA 2RIKA 4JGJA 2ZUXA 1IC4L 5B38B 4JKKA 2J1KA 3UTSE 3I75A 1CLYH 1HHJA 1G7MA 1Q0YL 4EDXB 1NJ9A 4YFDB 5IMMB 1KCUL 4U6YB 2LVCA 4XBEH 5BS0E 2SEBA 1FO0A 1AGCA 4PRPE 1Y0LA 5HHMB 3MRCB 1ONQA 1I1FB 5D1ZB 1RK0A 4LHUA 1LE9B 2KKQA 4AENB 5JIHA 5CZVL 3X14A 1E4KA 4JFDA 1Q9LA 4PB9H 5JR1H 4XNXL 4XCFH 1ZLVH 4JDVB 1XGYL 1MWAL 2GJ6A 2X1PA 3KYOA 1LK3H 5I9QC 3O3AB 3C2AH 1R3HB 3FCTB 5LBSL 43C9A 5IB4A 3GSWB 4LKXB 4UNTA 1JWMB 5B3NA 4JQVC 1C5DB 3S96B 4OFIA 5TE6L 1N7ML 2H1PL 2FCBA 3IFLL 1KN2H 2UY6A 3C60C 2HFEA 2R39A 2D7NA 4IOFD 4IMLA 2CD0A 3KPPB 4M6ML 2BSSA 5DJ2A 3SE9H 1U8JA 1T83A 2A6IB 3PP3H 2Z31B 2C1OA 1X5JA 1HYSC 3NFSL 3R0NA 1GL4B 2ZSVA 5C0IB 4CVZA 1CK0H 1NFDA 3RVUD 4NKMB 4PY8I 4NQDD 1T7YA 1EZVX 1DQQA 3TZVB 5DSCA 1ZT1B 5F7LB 3CK0L 1G7MB 2A83A 2ZP0T 1MY5A 1F6AA 3QUZA 1J12A 3QUXB 3G5ZB 3KLHC 3BESR 5K9QG 2QTEA 1F4WL 5EU5A 2QSCL 2W9EH 3MBEC 5IFAL 5MI0C 3STLB 3CH1A 3GI9H 4JN2A 3RVWD 3E2HC 3PL6A 5KVMC 3TT1L 2OXHA 1EEQA 1QSED 2E8ZA 1GC1H 2CMRL 5F9DC 4Z95L 4U1KA 3EZ8A 5CBEA 1A3RH 2O5ZL 4GRLC 3QYCA 4KK8D 2L0DA 2ICEA 25C8L 4KRPC 5BQ7A 2QBWA 5I8OH 2DL9A 4LLMB 3ZKND 2VR4A 1AXSA 4EDWH 2W9EL 3X3GH 3CDCA 1U9KA 5KSUB 3TN0A 4FMKA 3G5YB 1TVHB 4N5EC 4X6FB 1JI1A 3CFJB 1MQKH 5LAXA 3QEQE 3VXMD 3MR9A 2X4QA 3RWDB 3HKFA 3V8OA 4JRYA 4P99A 1KYOJ 5ID0B 2CRIA 4KHXL 1XZ0B 1VA9A 1H5BA 1RK1A 4WW2F 3RKPA 1V8HA 4M7KL 1JNNL 4LVOC 2XXCB 2QSCH 3QFDB 4XI5C 5DD5H 2B39A 4Z7UB 3WXVH 3JZ7A 4N0UE 2ZG1A 1D5IH 3FB7B 4MD0A 3QG6B 4PD4K 3OGCA 3HS0B 2IBZX 2IAMC 3IDNB 4F7MB 3EHBD 1K3ZA 1CXKA 4NUGH 5DFVD 5HGAB 1CD1B 3VGGA 1RZJC 4JFZH 1WEJH 4FRWA 1NCDH 3F12A 3IAQA 4ZUWB 4Y1AB 4NSKB 5JUEL 1FVDA 4BH8A 4CRPA 1DLHB 2GCYA 3IFOB 4JPIB 3T77B 4FZ8H 1U8HB 1YQVH 2OJZL 4H0GA 4WWKC 1MCIA 1MUJA 1HH9A 3TPKA 1T0NA 5EN2B 3HE6A 4W4NA 4AEFA 5IROC 1G1YA 1OGAD 3MPCA 2IPTL 3PWJA 3D39A 5D7JB 5DD1L 3N85L 1IZKA 2A73A 5FOJA 3VXRE 4XT1C 4PRAA 4JFXA 5DWUH 5I8EB 3SDCC 2BVYA 3FRUB 3OR6A 4XAKD 4ODSL 1I7ZB 4KXZI 4XVTH 1MCPH 3O2VL 3VRJB 5D7LD 2K7QA 5GSRB 3QIWA 4MNGA 1JGDB 4U1JB 5C07B 2YD2A 3WLBA 3O4OB 3ZE1F 3IS0X 4ZFZA 5TDNA 1KLGA 4GLRH 1RZ8A 1CGVA 5F1NB 4PJDE 4OCRH 4OV6F 1FP5A 4QCIB 5F3HA 2DDQL 5E7BA 2ZOKA 5LWYL 2DLIA 1N0LA 3PV7A 3DUUA 1G7JA 5CJBA 4OB5H 4DGYL 1TLKA 5EO9B 3DV6A 3R06A 4XNXH 1O5DT 4IRSB 1R6VA 3QIUC 1WWAX 3D2UB 3E6HB 2F54A 4Z5RB 4YDVB 4C4KO 3VXNB 2XFXA 3WJJC 3JBG7 4GUPA 4KY1H 3K74B 2E9BA 3UBXB 3O6LH 5F88A 3L7FB 4YHYB 1VKXA 1EGJL 3V79C 1HH6B 3ARVA 3PL6C 4N90E 3L5HA 3EYSL 1MFDL 2Y4SA 1MCCA 4E41D 2R0KL 1X5YA 4HULB 1T20B 2PTUA 3SJVA 1I1AD 3BIKA 5KOVC 4UZGA 1YMME 4H1LA 1UZ6F 5FHBL 1OAUL 1G7QA 4JHBA 3C6LC 1NUFA 4YHML 4JKMA 1MSPA 1WBZA 4N8CL 5IMKB 4UUJA 4M1DH 3K2UH 2R8SL 4P5MB 4NO0D 3NACL 1JGVL 5E9DA 1I7TB 2FEDC 3MREB 1TXKA 2HVKA 4P2CG 4X0KA 3LKQB 3L3OB 3DROB 3O45B 5ECJE 4LU5L 4NWUL 5IBTH 2BCKA 4Y4HC 3RDTD 4XPBH 3MV9B 4AMKH 3PWNB 4LNRB 3PIQB 5GGQH 3NN8B 1WIPA 3ARFD 5F9OL 1IGYB 5TFSH 3REWA 4BZ2H 3X3GL 3WIIL 3MOBL 1EDQA 1RJLB 1HI6B 5I74C 4NNYB 2Q1EA 2HT4C 2E8YA 5GZNC 4QXUL 4L3ED 1MRDL 2NXYC 3BZ4A 5D8JH 2VC2L 2DQCH 2X7LA 5A43C 4EIGB 5JDSB 1MJ8L 1OP3H 1FNGA 1EXUA 1RZFH 2DYPA 5CEXA 5CFHA 1A02N 4KKBD 2DIAA 5E5MA 5JPMA 3NMEA 4MZ2A 4PRHE 5GZND 1JMXA 2GK0A 2HVJB 1KG0B 4OCSL 1OQXA 1RPQA 4ZPTB 3ZDXF 1I8LC 1QSFA 5DUMH 3NCCB 1NEZA 4HUVB 4AG4H 5BO1H 3FAWA 4PJAA 1VENA 4MNQE 4JN1H 1MH5A 2E27H 2BNUB 4Q6IB 4MLSA 1F11B 4LRIC 4XWOD 2VMFA 1E6OL 5BS0B 5C0JA 2VDLL 2JLLA 1ZAGA 4MAUH 4PJBB 2YPLE 4GRMA 5EPMA 3FT2A 2FYYB 4JY5H 2MFNA 3BZEA 1HHIA 1FGVH 4IMKA 4EI5D 3D2UD 3PV6A 4PJ8B 3NCJH 3PWUB 5CJOH 1P5VA 1FZMB 3REVA 1IM3B 1T7VA 5TF0A 4Y5VB 4QOKE 4MB4A 2ZOKB 4JRXE 4IBLT 3BH9A 4U1LA 3AMKA 3CVHH 3VU2A 3LN5B 5JZ7D 1J86A 3NIGF 3UYPA 5K9KA 4Z7QF 3IU3B 2H3NB 3VH8G 1C7SA 2VL5A 1P7KA 5GGQL 4Y7MA 4TTDC 1OGAB 5C07A 2ADGB 3FONB 2Y06L 5E99H 4P23C 3VRJA 5E95B 2ICWI 5KSAD 4RBPH 4QHKI 4IHOA 3VI4E 1CT8A 4YFEA 3MOAL 2WNGA 1QLRA 4M8VA 4MAUL 2VE6A 4HKJB 2R23A 3GSNH 3ZHLA 3QDMB 4X9GA 5KAQF 1OAXL 4U05A 1RZ7L 5GGSB 2IMMA 5BCAA 4P2OB 5DJZB 4Y16A 5HPOA 2GQHA 1E27B 4JQXA 3TA3D 1Q0YH 3BGFC 5I1JL 2QHRL 3RIAF 3TCLB 3RNKB 3L5IA 3C5SA 1N59B 4K94H 5A16A 1AGEA 4ZUWA 4PGBB 2NX5B 1AGFA 2FHFA 1UA6H 1KTLA 5J11B 3U0PA 1J0JA 1G7IA 1MRCH 3MO1A 5CSGA 4C58B 4PJIB 3IDNA 4GT7A 3T09A 1UB6B 4S0TD 5D2LA 4JFHD 4QLRA 5HY9A 3PWVB 5HGDA 3ZMRA 4HKZA 3IJHB 3RNQB 1QO3B 1UZ8B 5C0RL 4NCC2 4NPYB 4B41A 3GSUB 1AKJD 4YGAB 4PV8B 3O3DB 1PEZA 3DSFH 1HN1A 4MNQB 4DKEH 5TF1L 1CTOA 1E0OB 1H5BB 1RK1B 1VESA 4JFQA 4OGYH 4OV5A 1OSZB 1ZGLM 5GGTH 1QFPA 4L4VA 3BPCA 4JRYB 2XT1B 3FRPG 2G75B 3QEQB 3QHFL 1B0GA 4HFUH 5LWYH 2YPLB 1NBYA 3WJLC 2KZ1B 5F89A 1H3GA 5F21B 4U1HB 4G7VH 3C6SA 2F5AL 3G6JF 4WUUA 3K2UL 5E8DH 1DSFL 1YY8B 5HGBB 2EE6A 4NP4L 3GKWH 4OGAD 3IDIA 4BJLA 5D1XB 2VLJD 4QRRD 3V6ZA 2C26A 3VFUA 4FZ8L 4P2RE 2LV4A 1UM6H 3FFDB 1FJ1A 2MQ3A 2WSKA 5F8QC 4L5FL 5D7LB 4GS7B 4LASL 4KUZH 5CMAA 5D93C 4WI9A 1FBIH 1GJIA 3JVGA 2I9LB 4Y19B 3SGDI 3B2UC 3IXAB 1N3NB 2JE8A 2Z4QA 3QUZD 1JPST 1H3PH 3SDCD 1A6WH 1TJHH 4PJFE 3EJYD 1JHLH 3ZKMD 3PDOA 3ET9F 3FMGL 4PP2A 5F3BB 2HWZH 5I1CL 2FATH 3BSZH 3UPCA 2Y23A 4LCIH 1MVUB 1DDHA 2PXYA 5MENB 2RHEA 4JFHE 4PGJA 3QIBD 4Y4KA 3LS4L 5FA4B 5T1KD 4BKLA 4NGHL 2C1OB 3W0WA 4U1GB 43CAA 4P4KA 4Y89A 3MCG1 3NIGE 1WBYA