4BZ1A

Structure of dengue virus ediii in complex with fab 3e31
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
96
structure length
96
Chain Sequence
MCSGKFSIDKEMAETQHGTTVVKVKYEGAGAPCKVPIEIRDVNKEKVVGRIISSTPFAEYTNSVTNIELEPPFGDSYIVIGVGDSALTLHWFRKHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ENVELOPE PROTEIN
publication title Structure of Dengue Virus Ediii in Complex with Fab 3E31
rcsb
source organism Dengue virus 4
molecule tags Immune system/viral protein
total genus 14
structure length 96
sequence length 96
ec nomenclature
pdb deposition date 2013-07-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.350 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4bz1A00
3UZVA 4FG0A 2JSFA 1RERA 4GSXA 1Z66A 4FFZA 5GZNA 5IZ7A 5LCVA 4BZ2A 4UTAA 3J2PA 3IRCA 2ALAA 3MUUA 2I69A 5JHLA 2P5PA 4X42A 2V33A 3VTTA 2JV6A 3N43F 3N42F 5LBVA 5B1CA 3C5XA 5JHMA 4ALAC 2H0PA 3UZEC 3J27A 3C6EA 4AL8C 2JQMA 4UTBA 2GG1A 5KVGE 3WE1A 4BZ1A 3N40F 3UYPB 2R69A 5AAMC 4UTCA 2HG0A 5AAWC 3P54A 4AM0Q 3N41F 1S6NA 5H37A 1UZGA 1URZA 1OK8A 1Z3RA 3N44F 4GT0A 5KVDE 3UAJA 1OKEA 5GZOA 3UZQB 4UT6A 2R29A 1TG8A 4L5FE 5KVFE 1PJWA 3G7TA 1OANA 4UT9A 5LBSA 5IREA 4FFYA 1SVBA 1ZTXE 5KVEE
chains in the Genus database with same CATH superfamily
5CCHE 1KTCA 3BZFB 1OP4A 1GRWA 4ATTA 3QDGB 4A6YH 4NC1C 1AMXA 2Z91B 3HZVA 4OTXH 2GQHA 4H1LH 1AQMA 3T0BA 1BFOB 2HFFA 4YHPB 2P9RA 2XIDA 2IGTA 2JE8A 1WFOA 3GO1H 5IVOA 1RIVH 5E6YA 5E03A 3LJ3A 2XG4B 3QYCA 4HF5L 4IMLA 3V5KA 1AZCA 3GMQA 1RZFH 2RQEA 5AVTB 5F7DB 3DBXA 4B3VA 1A3QA 3V8CA 4ZYKB 4X7TA 4FULA 4DK3A 3SOBH 2HVBA 3VFTA 1MHHB 2BXZA 2Z1PA 3MSPA 3OC8A 4MVBC 4O02L 4W9JC 3QRFM 3L17A 4HWBL 4YQXH 4U0QB 3UJIL 2FIKB 1NCDL 2CKBL 1MJ8H 3ZTCC 4CVZA 2XQBL 2OV0A 2KS0A 4FP8H 4TN9A 1KEML 3FCSA 2R69H 2W80C 1ZWIA 4N6QA 4G8GB 2IAMD 4DGYH 7CGTA 3LAFA 2X2UA 5AD0B 1JTTA 1KWKA 5D7IB 3LSOA 1XGUA 2FSEA 1KBKA 2X6CA 3RTLA 4Y5XB 4A2HA 4YEFA 2BY3A 2YPKB 2GIMA 3UACA 1E4KA 2MWCA 2FLMA 3U7YL 1PYWB 1S6NA 2JKLA 3IXTB 1F11B 4LB8A 4PI0A 2MH4A 3R7RA 4NQEB 4H26B 4GXUM 8FABB 1JHLL 4Z7NF 1NFDB 5KSBA 3IAPA 5C0AA 4XCFL 5J8OA 1JWUB 2MSPA 4GT0A 5KVDE 1T7YA 1JF5A 2W38A 3KDMB 3EYUH 4XP6L 2VDPB 1I3RB 3DHUA 3MCLH 1XCTA 3WCYA 2GK0A 2AVFA 4I0PD 2EIZB 4YC2C 4MMXC 1H8NA 4D0BA 3V4LA 2Z35A 4XX5A 5ESVA 3KGRA 2HXAA 3BAWA 1FJ1B 3L3IB 2A38A 2EDNA 3QZWG 4MNQE 4MYWB 2JKJA 1THCA 2EILB 2VAJA 3CSTA 5E6IB 3WTVA 3X11A 4WJG3 3BFQG 3CVHB 1G0YR 3QUXD 4K8RC 4RDBA 3CLEH 4ZS7H 4P5TB 5IMOA 3A4FA 1D6VL 2MJWA 3DMMC 4FNLL 4NWUL 4BFFA 1MFUA 3TNNB 1M56B 4QHMB 5KVEH 2Y5TB 1S2EA 1L5GA 3BZEA 2BW5A 3MLSH 5D96C 2G5BB 1T83A 3U4BL 1SPDA 5F44A 4MNHA 1EMTL 1NCGA 4HS6A 2VDRL 4D9RE 1FO0L 3UTSA 4JPWL 5F88A 5ADPL 1F4XL 5C0BE 1WHPA 1RJLB 1MI5B 1BBJB 3FNKA 2YRLA 3ARGC 3PNRB 4HJTA 3C6LB 5MEOB 2I9TA 3JTBA 2BJML 2ATPB 2AV7A 1PZSA 2OTUB 3H53A 5JOEA 1W0YT 3N5AA 3FHQA 2DQIL 4UTBH 3FT0A 2CLRB 4HPOL 4KFZC 3F04A 4B0MB 1D7DA 4BHUI 4KKLC 4C56D 4YO0A 4FA8A 5KSAB 2YKLH 1IX2A 2CBQA 3WSQH 4JJOA 4DOHE 1CFVL 3E2HC 3GSOA 4U1KA 1AGCA 1UXSB 1HHKB 1KIQB 2JKRM 2XN1A 3RUGE 4C59B 2VL4A 2DWSA 3ZDZB 4L3AA 2JCCB 2WLYA 1XGTB 3ALPA 1IRAY 3MTXA 4AI7A 5B8CC 4HJ0C 2IO5A 4WJKB 2R39A 4OFPA 5JPNC 3REVA 3T6VA 1FZOB 1Y7VA 1FPTH 3RURA 3NBNA 1A4BA 3ULVD 5EOQL 3MRQB 4MQ7B 4EN3A 5J9PB 2ZE0A 2SODB 2FH6A 1NBVL 4GRLD 4AT6B 5FOJA 5DTFB 3KLDA 3K6SB 1T03L 1HFUA 2IALA 4FN0A 5IEKA 4Y4KB 1OGTB 5H35A 1A7OL 1NFIB 2Q9OA 3T3MF 3PL6D 3ECQA 3WO4B 2X4OB 4UT7L 4LPXA 2MNJB 5CEXA 3QJUB 1Q1JL 2J8UF 5IB2A 4YLBA 3RVTC 4Z7UF 1MDAA 5F3HB 2DDQL 2WM0A 3MRDA 1WITA 4P3CL 3GB7B 1EHNA 3CXDH 3QJZA 1KCBA 2BVUA 5HYJE 2V8LA 3H55A 3BN3B 1IKOP 4PJ8A 3SE3C 4QIRA 4UM8B 1F3RB 1ZLUH 1MF2L 2A73A 2F1BA 1WFMA 1E2WA 3VX1A 1IM9A 1E50A 4HX1B 3V0GA 3EDKA 4I18B 3D9AL 2K45A 3H3BC 4O02H 3W2DL 2VUOA 5H4ZA 4PJ7F 3SDYL 3TJEL 5IF0A 2ICCA 5HHQB 2D7OA 1VFBB 4I2XE 4EIZC 4QLWA 5ALCH 3RVUC 3JUYA 2XQ0A 1DLHB 2PR4H 4IHOB 4JQVA 1ZLVK 4ZOAA 1PCXA 2IWGA 4JQXA 4QRRD 2GBUA 2X9YA 4XCYB 4XAKD 3V4VB 4EI6A 5E6SB 2OR8A 2P5WD 4XXWC 1BVLB 1KEMH 3QEQE 2JJTC 1LWJA 2Y7SA 3Q8EA 2QGEA 4JFOB 4XC1H 2FQFA 2P80A 2CIIB 2XTSA 1GY1A 5GPRA 2NOYA 2XBTA 2QHRL 3DXAE 3O11A 2OMUA 1J9RA 3KPSE 2DJUA 4BKSC 4GS7C 2BC4B 4JFFA 4WW2B 2P5EB 5KYYB 5DC9B 3CX5K 4Y2OB 1RPKA 3ULVF 4NDMA 1OGAA 1ZJAA 3R0NA 4ZAKB 3G5XA 4DEUA 2FK9A 5IMLB 3RGVA 2A6IB 4EVNB 1WPCA 3NYKA 4YXLH 2CR6A 1H5BA 2XWTA 3BH9A 3O0RH 3BPNC 4OCWL 4XNMB 1KB3A 3KL0A 3X2QB 4JGMA 4DJMA 2CDFA 4PYHA 5HI4D 4XCFH 3KPNA 3GRWL 4PRHB 2QR0B 4M7JH 3JTTB 4QXTA 3TO4B 3V0HA 5JW3H 2VMFA 5EUOE 1TZAA 4YBQD 3CVHL 4HXAL 1R3IL 2Y1ZA 3MLVL 4QRPE 4MDIB 1C5BL 3LIUA 4OGYL 2ZUQB 1MRDL 3EO0B 4FMVA 4WU5B 4H8WC 4E5XG 4JNXA 3LV3A 1HWHB 4ERSL 4EZMA 2Y9RT 3LDBC 2ISDA 5AW0B 3RZCD 1OP5H 2BNQE 2DTML 3G3LA 3IETB 3Q2CA 3VXUD 5AW2B 3S4SB 3P3YA 1A6ZB 3DECA 3FCUB 3KVQA 2DLGA 2XCMC 3IBEA 4NC1E 4ZMOA 2WV3A 1D6VH 3ARDC 5T33L 5E7FA 1XGRB 2GJJA 1VEOA 4G2AA 4HK3J 4JY4B 5DA0B 1P5VB 1J8SA 3IDNA 3NRFA 1UCBH 1ZLWK 1KZQA 5IGXH 5DUMH 5B21A 4QXGH 3VFNB 2BOBB 4QXVA 4E41B 1CN4A 5JPMA 3T4AC 3T6ZA 4R8WL 4KPHL 4G1EA 3R18A 4LL1A 3HCVA 4LRNL 5E2JA 5B3SB 2CG9X 1AIZA 1KPRB 5LVEA 3D0AA 1EMTH 1FH5L 5FOBA 2VDRH 1RAMA 2Q3XA 1H0DA 4Q97A 1I8LA 3QUYC 5CSGA 5DLLA 4F7CA 1R3JB 4YFEA 5ADPH 1X5XA 4M4RA 4UU9A 5TE7L 1LEGB 2Q2LA 4U6VL 4BK4A 3MRMB 2ARWA 1KUMA 3QUML 3VXTA 3P40A 1J5HA 1TQCB 2BJMH 4FNQA 4ZW3A 2HPTA 1AGDA 1ESOA 1FUNA 5FO8B 2IPUG 2C1OB 3IFLH 2V3FA 1O5PA 4ZRGA 5FFGA 4AM0A 1JZ4A 4DHLA 2QSCH 4HPOH 5DMKA 3IJ7A 4U1SB 2WQXA 4NLAA 4QKXB 5IBUB 4X6CB 2HG5A 1RKRA 4JFVA 3W81A 2ZG1A 5JA9A 1GOGA 3PFUA 2N0KA 5I2IB 2CO7A 3NJMA 5F9JB 3CFEA 5EWIL 4GJTB 4N8VB 1HCZA 1C12A 4NZTL 4C4BA 2PP8A 3FN9A 4WFFD 3U48A 2G9HB 1NOFA 1ZT4A 2IH1A 4K9EL 3QEUB 2W07B 4G9FA 4KGJA 3KXFA 3FFCA 3SBWC 3RP1A 2CRYA 3QXAA 4MTMA 3BCFA 1A7RL 4ZFZB 2KT6A 4XB3A 3SPJA 1Y1UA 4BSJA 5EOQH 4X42A 2WXRA 3K3QA 1H6FA 1AHMA 3DIFB 2PWDA 1LE5B 3IFPA 4UM9D 4EI5D 1T03H 2H5UA 1V3KA 1BZ8A 4BKTC 3QJXA 2JH2A 4AYSA 2N4IA 3U30B 4P57A 4UTAL 3GHEL 4ODWB 2R1WA 1INQA 3V0IA 4PJIB 4U1HB 1G5GA 3O9WD 4P3CH 1MHCB 4S0HA 1MW2A 2ATKB 2PTTA 2ZSWA 3C60C 2CGZA 2NUTB 3DDGA 4XO9A 3VCLB 1Y0LA 1YEGH 2X1QA 3BC9A 4HFUL 4FTVD 2OX5B 3DGGB 1VFOA 3V4UL 1D5RA 3ME0A 1MF2H 3NA9L 2AJXL 3NCBB 4KK9D 3V52H 3IPEA 2BINA 1I82A 5ICYA 3GGWB 2A3TA 3V4VL 2HLAB 3D9AH 5DEZA 3UBHA 1JZ6A 2QQNL 1J10A 2WLIA 2F74A 3FL7A 3CMOH 4R2GB 1CO1A 1I1RA 1LE9A 3MV01 3SE6A 2XIBA 4NENB 5BS0D 4NEHB 2CBOA 1PFCA 1WT5C 2GBTA 4NWTH 4YDMA 5E4OA 5DYFA 3P4NA 3W39B 4E9SA 1N6VA 4ZMTA 2W0PA 3AWEA 3MC0A 3RWEB 2HB0A 3K4DA 3QPQC 4KZEH 3OVUB 4JRWA 2EADA 2BHUA 1AKJB 1BFVH 4WO4C 2QHRH 2CKNA 4L1HA 1KBPA 3NSCA 1P69B 2JLLA 5SWSD 5C07E 1IGIL 3K0YA 5DYOA 3OX8B 5A2CA 4GBXD 3EFOB 3CG8A 1GCFA 2VDPH 3VXRA 2B9BA 3A6OA 3GXTA 3HG5A 3I74A 4MZ2A 1BBDH 2VH5H 1DO6A 4P2RA 1BF8A 3I3EA 2FRGP 3IJ8A 2E7BA 1AIFB 3SD2A 4A1RA 1XQ4A 4EZJA 4WQOA 4WFHE 4HPYL 5DFTA 1NEZA 4JFEA 1CFQB 1HZHH 4QD2E 5GZOC 1J87A 2X1WL 3AXLA 5ACZA 2Y6SD 4AIXA 1IU1A 1OAZL 3CVHH 2FWUA 1R3IH 3H9SB 4HXAH 4HIJB 3VH8G 4OGYH 2JJVA 4HUVA 3DHPA 1MRDH 5IROC 4R0LC 5CKGA 4UT9L 2IANB 1A6VL 3HIZA 1I8UA 1RXLA 1KPVA 3AY2A 4OVVA 5D5MF 3P1VA 1W72B 4J3VA 2ZOLB 5ANMA 1I1YB 3EH3B 3WAKA 3G9AB 5L8KB 3NEEA 5HHOE 1M1XA 3T0VA 1TVBA 1JZ8A 1UEMA 1BD2A 4E9WA 2GABA 1NIEA 3FF7A 1JZ2A 3A4DA 4FFZH 3ASNB 3GM0A 5DURD 2FDBP 5ESQB 3TZVA 1JNHA 4KKQA 1JPST 5I6PA 4MS6A 3RY6C 3VFUA 4D8OA 3MV8E 4Q6IC 5HDRA 2NPLX 3VWKA 5DRWB 4MD4A 3F01A 1RJCA 2BERA 3FB8A 4M93C 1WWAX 4E36A 2EVIA 3F2LA 4R8WH 5CUSL 3HBPA 4KPHH 4LRNH 5I73B 4ORGB 4Q6KA 1A22B 4FHKA 4MJIA 3WTWA 1FH5H 3E6FA 2I24N 2CRMA 4PN6A 2XBDA 3DX9A 4MNGE 2W0FA 1JL8A 4HU2A 4LPWA 3MBED 4NN5B 5GGVY 3HHSB 4WEBL 3UMNA 3MLWH 2BVOA 35C8L 4U6VH 4XXCC 2D7TH 5L0QB 3ZE1E 3ULUF 1CFSB 4Q9RL 1JGVH 3QZMA 5B7FA 1B4LA 5F7HA 3BVWA 3TN0D 4BK5A 4MZ3A 2WBJB 2J5LB 1IAOA 1YNTF 3UX9B 4PJ5E 3PJSA 4NX0A 2NY3D 2PW2A 5C08A 4F8LA 4D8PA 4J1UA 2OMZA 4R7NA 3U0TA 4XH2B 2KHAA 4CSPA 3K2MC 4LE8A 3MRNA 4C54A 1LILA 3DROA 4IU2A 1OP9A 3LH9A 4XP1L 3MX0A 2BFVL 3K80A 3FAWA 1Z0MA 2FQEA 4NZTH 3BVTA 3AS2A 1U8HB 2WOYA 3LXAA 4K9EH 2ZXQA 1OWWA 3MJWA 1FG2A 3Q2NA 4AMXA 2E75C 2HVJA 1LDSA 5E51A 2ZCZA 4N87A 3FCBA 2YA1A 1KLFA 4NZUL 5EN2A 2GB2A 5A2BA 2DMKA 1RSYA 3KDPB 4LLVB 5D72L 3DV4A 4AGMA 5F72S 1SN5A 1IJNA 2WP3T 5DD3L 5ALBH 3C9NA 2D03H 1JV5B 4LHUG 3ZGIA 1ZDSA 1J05A 3T1WA 3NJNA 1JGEA 3MRCB 2WY3B 1TIUA 4BCYA 5IHUL 4QCIB 1GGBL 2EDWA 4Y5VB 3SBQA 5ISZA 1CU4H 3QORC 3CHSA 3FU9A 4PP1C 4ZSOA 4UTAH 1LHZA 2NY0B 1GYAA 1R75A 1ZTXL 3EO9L 5C0AD 5T1LB 1JJUA 1AC6A 2ZSVB 3D39A 2HFGL 2WO2B 4KV5E 4HFUH 1W15A 4BFNA 4Z6AT 5HYSA 1EUTA 2Z31B 3FTGA 3O45B 3NA9H 5DCCA 1MKFA 3EF4A 3HRPA 1G4RA 2HJKA 2K78A 5B3JE 4WI6A 5ECGA 2XPYA 3V4VH 4F33A 4U4BA 1MW0A 2AJZB 1KYDA 2L3BA 3FO1B 3ML9A 3MCG1 1IT9H 4HCFA 5I5IA 2QQNH 1E8WA 4JVWA 3PU7A 4LT7A 2R7EB 4PRPE 2AK4E 4ALAH 4OFQA 4TL5A 3V0VA 3PHQB 4TM9A 4Y7OC 1G7LA 2D9CA 5D1QB 4DZBB 3IGUA 1H6EA 1BJ8A 4F80A 1QEWA 2EC8A 4K7PY 4IRZA 1EAOA 2XZCH 3HMXL 1DSFL 1N8ZA 1Z2KA 1OPGL 1BOGA 4IK6A 4NLHA 1F90L 4N9GB 5EBLB 5TQ2L 3BH8B 2AJVL 5C09B 2DD8H 3B7YA 1WFTA 5F96L 4YN3A 3WD5H 4TLKA 4LP4A 4C4UA 4IGBC 4AE1A 1VESA 1T3FB 4FOMA 1UUSA 4PMEA 2DWEA 4P5RA 3Q13A 4LVHB 3H6AA 1EHXA 1XH3A 1VZGA 4OJAA 5MI0C 1IEAB 5DF0A 1NJ9B 4G9DA 5IR1B 4PJXB 3RWDB 3SQOL 3HG0A 1PGRB 1SHSA 2Y7OA 2YAOA 3WXVL 2X40A 5IB3B 5MENB 3CCHA 3WLBB 5E95B 1S7RB 5BUAA 5C0ND 4UZUA 3MKGA 5IOKA 1WWCA 1IC0A 1W72L 4HPYH 1KTKE 1T6VN 5K59F 4QO1B 3QEHB 5I17B 3UTTE 5L6YL 4M5SA 2G2NA 2I60H 1SHWA 2RFXB 3CFBB 3QQ3B 3GSQB 3R0MA 4NFBA 3TV3H 5CAYB 5MEPA 4WDIA 1AAJA 1M6UA 4AE0A 4XBGA 2X4NB 4UT9H 5CZXC 4I3SL 3P4MB 2R29A 3UCQA 5TH2A 4DVBB 3LKNA 4LAQL 5DWUL 1DVSA 4N1HB 3W0WE 4FQCL 4U1MB 3QDJB 3T3PF 5L4MA 4HSQA 2DW5A 5DR5H 3X14A 4AGOA 4CVWA 4WEEA 1U3HB 1IC4L 3RGBA 3MJ8A 4N1EA 5K39A 2CU9A 3O4OC 4TUOA 2FHBA 1ET7A 1E3ZA 5IVXE 3V5DA 4N2AA 4GQ9H 3SDAB 3LZNA 2VXUH 1U8JA 5AKSA 1AMYA 4EN3D 5L8LB 1DFXA 4FZ8L 1IAIL 4LEOA 3MLRL 4QHKJ 2W95A 4G42B 2V5TA 3FO0L 2NYYD 3Q01A 2CHNA 3R1GL 4TF4A 4ODXA 2OMYA 5ID1A 5CUSH 4PJDE 1EAPA 2VR9A 4H5SA 2XZAH 3QQ9C 1NGWB 4LLQB 4ZK8A 3CFNA 3U2JA 5ADOL 5IHZB 1K85A 2R0WL 4KO5A 1KXQA 5IQ7L 3NIGE 2ZQKA 1FIEA 4RFOH 3HZMB 4K3HA 1QFWI 4AQ1C 5J5EA 3OG6B 1C08B 5BRZA 1IIIA 1QW8A 1IGCH 1Q4NX 5CFHA 2B3RA 35C8H 1JCKA 2OMXB 4Q9RH 1NBQA 4AVHA 3F58H 4DUWA 2HP4A 4PJ8D 2X5PA 2DI9A 5EUKA 2H45A 3NN8B 2BVPB 1E40A 1IM9D 1XB6A 4QOKA 3GBLA 3GFUA 3I2CL 5D6DA 4G6FB 1DSWA 5B4MD 1IGTA 2EXYC 3R8BB 4LASL 4XP1H 1FZKB 2PWHA 2BXYA 2VN6A 4RA0C 4XWGL 3FFDA 3PWNA 1QBML 4QKTA 2JQMA 2A6DB 3D25B 5JIQA 2C4FU 2DQCH 3NQKA 2DLFL 3WY4A 3UBXG 3UDWC 4LSSL 4X8CA 2MPVA 4GO8A 4WWOA 5I6MA 1QSEB 2P80D 5DD6B 2P3YA 5B38B 5DHVB 4HIXL 4YDIH 3C6SB 3ARBA 3FT1A 3KL3A 4MA3A 1A4KA 1INEH 3KR3L 1KIUA 2D9QB 1LO2H 1L4IA 4RA3A 4JFFD 3W1ZA 5F89B 1H3PL 1V8HA 1RVFH 3MNZB 3PYCA 5F9DC 1Q0YL 1OGAD 1Q9KA 1RUPL 4KRLB 1YDPB 4FFWD 1R3LA 4KUCD 3IU4H 3S6CA 1SQ2N 2LVEA 2WXGA 1GGBH 4B9FA 2DM3A 1HJCA 4HC1A 1A4AA 1A6TA 3D1MC 5D1XC 1JOIA 2B1OA 5DJ2A 1ZLWH 4JO1H 1ZAGA 4AEHH 2YA2A 3EO9H 2IQ9H 4KXAA 4J3WA 4YDJB 3ZMRA 5JZ7D 2P8PA 4JKPL 3BSZA 1FGVL 1UB6A 3MROB 1S9YA 1ZHNA 1ZVNA 3RWGB 4L2YA 1MY5A 5FHAL 4XVJH 3KZ8A 5T3XL 3GIZL 3NDZE 2Z7ZA 2A9DA 2EIMB 4GAGH 4WV1C 4Y5YB 5EA0H 5C7XL 1LD9B 4JCWA 3I50H 1UA7A 5GSRA 4N2OA 4IYKA 4P0DA 3H3PH 3HS0B 1C5CH 3FQ1A 3W11D 2KMWA 1E9QA 1MEXL 2GC7C 4FQHA 4XPTL 1FCGA 2ED7A 3HMXH 3PV6A 4M02A 1DSFH 3O41B 1OPGH 2ZP0T 3IU3B 4A55A 2DLHA 4OGQC 4Z7WA 5TQ2H 4MD5A 2AJVH 5GGUB 5HHVL 3QZLA 3CZEA 4L8DB 3UZQA 1BX2B 2JWYA 3BGFB 3HI1A 3BQUB 2QVTA 4KMLB 1QFPA 2R0LH 2UZXB 3KPPB 2R2BB 1TJMA 1QLRA 4AZ8A 5EZJB 3HVNA 4WNJA 4JY5H 3MV9E 2G4GA 3GSUA 1BJ1H 2OI9C 1U42A 3N42B 4YHNB 3SQOH 4KXDA 1KCWA 5FLVA 4YSOA 1IV8A 5KVFL 3QH3B 3WXVH 1G4MA 1UACL 3CSPA 4P3DB 5CWSB 3ZVVA 2VMDA 3B6SB 1YN6A 1JWSB 4BSVA 4GI9A 4FRWA 5CCKH 3NSYA 3QCVH 5AAWA 4R7LA 3SSGA 3N9GL 2IAMC 2EH8H 2W9DL 4R3SA 5LCVL 3KNBA 1W72H 3ZE0F 1F4HA 4JPQA 4DUVA 1RHFA 3DYOA 4M43L 2P4AB 5L6YH 2WXLA 5I6XB 2R0KL 1JGIA 2X4SB 4K71C 4RIRB 3TBVB 1ZJBA 4LU5L 5KYUA 1E6OL 4GAYA 5E6ZA 3E7JA 4I3SH 1N59B 3KYAA 4P9HL 4AYID 4LAQH 1DQLL 1P6FA 3LH2H 3L3HA 5I18H 1QUNA 3QJSB 1T66D 5FM8A 5EIVA 1CK0L 5CMAA 4PCKA 1IC4H 5IG7B 1DVFB 3TVMA 2ZCHL 1DE4A 4F57L 1CIUA 4G9FD 4FMFA 4I0PC 3KXFD 3FFCD 4P4KD 2E4TA 5DHDA 5C1MB 4JFXB 1CXHA 3QFDB 3QIUB 4TTDD 4G3YH 4PBDA 3MFFB 4FZ8H 2F8VA 3MLRH 4RX4A 3DKHA 1DBBL 3FO0H 2X7LA 3OKOA 3R4RA 4OZFB 4Y1AB 3UTZB 5CLXA 3IFOA 3P0YL 3QUXC 1HAWA 5ADOH 3DVNA 2R0WH 4Q52A 4W6WB 5IQ7H 5JHDA 4JFPA 3ZZQA 3RBSA 5JO5B 3SN6N 2FLRT 4YHMH 1BXUA 3GEFA 1KDIA 2IEPA 1EZLA 4G6JL 1RIHL 3F7YB 4N8UA 3ZW3A 2P44B 4ELME 1DR9A 4PJCA 2OLDA 1D3CA 1YO4A 4FNPA 1D2PA 4EKXA 4L4JA 3M1BA 3VXOB 1NGQL 1X5AA 3ZXAC 5IQ9B 1OTSD 3WFEL 2Q76A 4XNUL 2PYEE 2QELA 4ZFGH 1ZTXE 2OXGB 4F2MA 2AS5M 3NCXA 2B5IB 4X9HA 3UP6A 4N2EA 1KTDA 1P4IH 1NWPA 4X4ME 3UGXA 1ACCA 1J9CT 4NBZB 1HE7A 1IM3B 4XPHL 3MOQA 4LGRB 3AABA 1DANU 4K15A 4FNUA 4PJAA 4I2XB 4ZNEA 3T0WA 2DLEA 4RBPK 1O7SA 1QBMH 3FCTB 1TR7A 1UVQA 2XYCA 5TJWK 2XC8A 3Q5TA 1FFRA 3CBJB 3CHOA 1JF1B 1TKWA 4P2OA 1F13A 2MKLC 4LSSH 4JM2A 4EIBA 3CDCA 1NMCC 1WZAA 3K72A 4JJHA 1T1WB 2F54A 4DEWA 4BH7B 3KR3H 4JN2B 5HHPB 1PY0A 2GSIA 2GPZA 4JFUA 1WCQA 4YFLF 2YEVB 1HL4A 1VGKB 1B2WL 3L1FA 2YD7A 3QZNA 5HDQH 2B1AL 1IGJA 3VE0A 12E8L 4UQ2A 1BZ9A 3U0WL 5AOKA 1I7RA 4XVUD 3WLWD 2WQSA 2QZ5A 4QRQB 3WIFA 2P43B 4HAFA 2YARA 4MMYB 3QDMB 3CLFH 4P2RD 4K07A 1XXDC 4X7EC 4GRLC 4J6RH 2DL2A 1J0HA 3P77A 5EO0B 5TF1L 4HOMA 5KAQG 5MERB 5HGDA 4OFYA 5L88L 4OB5L 4JFED 4JKPH 4EI0A 1FGVH 1N10A 4JRFA 5LAXB 4NQDA 4FNTA 3A47A 5SX5K 5I5JA 1PX4A 4JHAH 4P4RB 5EUOB 4NN6C 1MPAH 3PL6C 5T3XH 3RTQB 4NFCA 3W56A 1KENL 3N40F 5AFAA 2HJFA 1EIBA 1PAZA 1EH9A 3MOAL 4N0FA 4JFWA 1XF2B 2WWOA 4IBUA 1NBYB 3PIQB 1OK8A 2DWYA 2NY6B 2NX5A 5E9DA 1BD2D 3NUKA 4ZUUA 1PSKL 2BNQB 2GCYA 3IJEB 2GSGA 3ZMNA 4KRPD 2VKWA 3TZVD 4I3RL 2GW5A 5I82A 3M7OA 1MFMA 5HHVH 5D7JB 1IZJA 2A74A 3A67L 4IK7A 3M86A 4NO2B 5FYJH 1NL0L 4FG2A 2AKRA 5DFAA 2R8SL 4Z3FA 3Q9QA 3V7AG 1ZVHA 4UT6A 1EQWA 4HDIB 2I26N 3BP7B 3L13A 2OTWA 3CUPA 4NI6A 4MJ2A 3EYVA 5LGHH 3VMPA 2B1HH 4LEEA 4MJID 1I7ZB 1X7QA 1OY3B 4PJFB 5KVFH 4ZFFA 2J71A 3CPLB 1WA2X 5DXWA 1U8OB 2BSCA 5BZWB 1JXFA 3MYJB 3N9GH 5CINL 5JOPE 3HAEG 4UQEA 4JDEB 1I1AA 1G6RB 2D0GA 4YAQA 4M43H 4ES8A 2PO6B 2FJGA 2F53E 2WXMA 4KROB 1EO8H 3G04B 3OSVA 2WTOA 1TENA 4JKKA 4LCUA 3CHPA 4LU5H 5DT1H 3BKJH 1E4XL 2QVIA 2WKOA 5C08D 3L5IA 1FVCA 3LHPL 2SEBA 5DK0B 1BPVA 1YYML 3SGJA 1DQLH 2V5YA 5HI4C 1M7XA 2CO4A 3L3DA 4OUUA 1INDL 2ZP8A 3APDA 3F62A 4ZDHA 1RUQL 2Y07H 4FTDA 1DDHB 1DQQA 1T6BX 4KX9A 5DZPA 1Q9OB 4F57H 1S7QB 4YBQC 43C9A 1KJMA 3IDIB 2BNRB 1HEZA 5D1XE 3PCYA 5ES4B 5DJDB 1JNJA 5IWLA 5E2UH 1F02I 4QDGA 3NZ8B 1LYQA 3MKKA 1Q0XH 1J11A 5C7ZA 2YPLA 3RZCC 4IDLA 1J86A 4WGVB 1PFOA 1XSIA 2YSSB 1M53A 4U6HA 1MCEA 4YZWA 4Z7NE 1JPSL 4U7MA 3GIVB 4AOFA 5ISZD 3CFKA 2A9CA 5FYKH 1RZ8B 3Q8BA 3NK3A 2X09A 1VA9A 4I3GA 4EUPA 2ZUSA 1SJEA 1BECA 2EDMA 3RWJB 3FDWA 1U8QA 3D39D 4Y4HD 3DVIA 2ADFH 9PCYA 1PPIA 1H3TA 4IJ3C 2ZAGA 2DH2A 4GW5B 4FABH 2NY4D 4TVSa 3FQNB 4B27A 1HHGB 1MNUL 2AABH 2CGYA 2EVFA 1WZ1L 3VXPB 4ETQB 2FAUA 4PWHA 1A9VA 5FKPA 3GMNB 4OZGE 2CLVA 1T0NA 3DMMB 3P9MB 3K6DA 3MMEA 1IAIM 1PLBA 3UZVB 4XPHH 2A83B 2D7MA 1AFVH 2K4WA 5DHVH 5T1MB 3SKOA 1YEFH 2JB5L 4ADIA 2COQA 1OE1A 2NW2A 4I48B 4YE0A 4QI3A 1ZT7B 2AEQH 4MJ4A 1N6QL 5F3BA 1JZEA 5CHNA 2WUCH 4L05A 4U2ZA 4U6XB 2PCPB 2P24A 2PETA 3C5ZD 1BMZA 3OKEA 1H9VA 4HHAB 1YNLH 2EH7L 5GRJL 1AR1B 2E46A 1NLBL 2VM4A 5FGCB 3ARGB 3KYOA 4M9OA 4XGZB 4PJ9D 5EC2B 5BJTB 2AQ2A 4G8IA 5E23A 12E8H 4FG0A 2LAAA 3QXUA 4OGAD 3JV5A 1KBWA 1S7WB 3RIKA 3D87B 5BVPH 3TOPA 4MMZB 5E8PB 1TSRA 2BWQA 5TF1H 3GJFB 4ISVA 5DK2B 5L88H 5IMMA 4EI5C 5CD5D 2V2XB 2UVFA 2VOTA 3E2HB 3EADA 2F19L 2CO6A 2QKSA 2X4RB 3OKLA 1HINL 4RRPA 4EZKA 1J0KA 1ANUA 1PCSA 4G7RB 4RGNB 3IE4A 4NSKB 3FK3A 2E56A 5JPNB 1FE8L 3IGKA 3MOAH 3T0EA 4QAMB 1ZRUA 3EDEA 3VTTA 4JPVH 4BELD 3O9WC 1CCZA 4FJ6A 4IM8A 2DIJA 1KXVC 1E7UA 2YXFA 3CN2A 4Z78B 2WNGA 3LN4B 2X70A 2NUPA 3UPCA 3VFWA 4BEIA 5HHOB 1SNRA 3DURB 2N7AA 3O3AA 4OQ1A 4X2UA 3WJJC 3D0LB 4YSQA 4AYBA 3LKRA 1UB5A 1J9QA 1G7MA 3B7SA 4I3RH 4KK9C 4KK5D 4Y9GA 1AGBB 4X9FA 1LO5B 2NY5C 2APSA 4N0UE 1N0LA 4LCCA 3AM8C 2VITB 4MKTA 1PZ5A 3SY6A 3T3ME 3UADA 2WQWA 4IBZA 4L3EA 3HR5A 2AXFA 3MREA 5BOZG 4KUZH 2PWEA 4YSDA 1KC5H 4GUPB 3PAUA 2GEQA 1Q9WA 3PREA 3AT0A 4IRSD 5A16A 4Y16B 2V3EA 4QHKI 4NKIL 2A9NH 1I53A 3FB5B 3RY4A 1OW0C 3WNJA 5BRZD 3SKJH 3CZFB 1UASA 1XGYL 4JANB 4MNGB 3I9IA 3M17A 3NG5A 1T7ZA 4AIZB 2PXYA 5CINH 3T5WA 5HHMD 3STBA 3FOMB 4UQBA 4GBXC 1DFBL 3VFGL 3BYTA 1YEJL 3MUGB 1HXMA 2X4UB 1ET5A 3DNKA 2FEJA 4MXVF 1VPOL 4Y4FA 3VXMA 3LHPH 1RJYA 2L7EA 2LU3A 3P30H 5JW5A 4LQ1A 1T5WA 4C56E 4LOFA 4YHLL 2VDKB 2LQRA 4K7FA 4MCYB 4GS7B 1JN6B 1RUQH 1THAA 2K7QA 2OCJA 3QG6B 4LCVA 4OZFH 2E47A 1DBKL 2PF6A 2NZ1A 2Y6SC 1SVZA 1E5YA 2WD0A 5L2KE 4GQZA 2FUQA 2FJFA 5CLTA 1F97A 4ZPVB 3WUZA 3MO1A 5C0RL 3ULVE 1X5GA 2Z4QA 3ARBD 4JQIA 2WXJA 1J0ZA 1ZHKB 3GMMA 5FPIA 3BUBA 3NCFB 3VFVB 3KMDA 1G7QB 3MU3A 3QFJE 1MJJA 5FA3A 5I76B 3B8SA 3SQBA 2PPFA 1U8IB 1WBYB 2YRPA 2FJHA 2K6WA 1JPSH 4K5MA 3CQPA 4PJBB 4UINL 2VKXA 32C2B 4W9FC 2HUHA 3L9RB 1QX1A 4PWGA 1FL5B 2CRIA 1VADA 2Q86B 1T6WA 2RHEA 4PG2A 4Z3HA 3DI3B 5D2LB 4ZQKA 3ARXA 5D6CB 3IXAA 3BDXA 1DJYA 5HTSA 2EZ0D 3CVIH 4YDLC 2EC9U 3AG4B 4G6KL 4U3CA 5AKTA 1WZ1H 3U1QA 3SCMA 4YHOL 4JDTH 3SJVB 3X12A 2YUVA 1U3YA 3DWTA 5DRNB 3BEWA 3STLB 4CNIB 4YXHH 4UBDD 3M1CA 1E67A 1TJIL 4YBHA 5LGJA 3RWHA 3U36B 2X05A 3RWCB 1R24B 4KZ0A 1A1NB 1XWVA 1KIRB 1ORQB 2X2JA 5DD0H 5EBWB 2GBAA 1W6WA 3TN0C 1NICA 4AKOA 2E8ZA 4PWEA 4QRRE 4XAKE 5CLYA 3MNMA 4DFIA 1OALA 1CR9L 2P5WE 2E27L 1N6QH 1QSFA 3AB0C 3DO7B 2NY3C 4BZ1A 1Z5HA 2XV3A 1A7BA 1BJMA 2BIHA 1MNNA 1KB9K 3E1F1 4ZO9A 4UMGA 5LN8A 3G6JB 3QZWB 5G4MA 3ZTNH 3ATBA 1NLBH 3VYPA 2OJEB 3EOTL 5H37A 4HK0A 5KVMC 4HT1L 4A7SA 1ODAA 3B2VL 5JOFA 2DBLH 4J8RA 4WAFA 5FO9A 4KOBA 5LO7A 3BXNA 1MAML 5TF0A 1GPOL 4NKMB 1P7QA 3GD1C 4KK8D 1A3RL 2ENSA 1VZHA 1ZSDB 3DUUB 3EFFB 5BXFA 3BWAB 5GS3A 5I30L 1GGTA 3LXUX 4MZRA 1UA6L 4LZKA 5T1DH 1GTNA 2TSAA 3VNYA 4HGWB 3IFNL 4ANVA 2F68X 1HQRA 2P7TB 1E4KC 3OR6B 1HINH 1M2VA 1P7KB 4QMEA 3BZ5A 3LQZA 4NZDA 2ZUXA 3HHMA 4HUXA 3RIAF 5E8EB 3EXLA 1CXFA 3MCKA 3UEZA 3RPBA 3BWZA 3TPUB 2WK2A 4X6FA 1SYSA 5MEQB 1G7HA 4DGVL 4I1PA 3U4EA 2WANA 5L2JB 4X50A 1KXTA 2VE6A 4YWGL 2CIKB 2XWBB 3VXUE 1T2QH 3MNVB 4GSUA 4DKFH 4M1DL 4XBEL 3TVMD 4HGMA 5LKNA 1P9MC 4EQ3A 4O58H 1CF1A 2J7LA 2YQ3A 3DIVA 1AZBA 1G1KA 1SXAA 3MJ6A 3Q06A 1NKRA 4UQ3A 3GI8L 4DPAX 1GJUA 4WI0A 3FPXA 3OSKA 4RX4D 5BPPA 4RBPH 5T3ZD 4Z7WF 1D9KA 3I6LD 5K1JA 5LJYH 2ZKWA 3VFRB 1QD0A 5DHMC 1U58A 5JHDD 1G6RH 4KNUA 1XGQB 4DP1X 1PS3A 1M7DA 2RBLA 4NKIH 4UIKL 4AUUA 1UM4H 1CYWA 1E9PB 1RUAH 4LLWA 5AAMA 2A4CA 1CGUA 2CHDA 4DQAA 5SWQB 4HULB 1S9KC 2NZ9D 3MTRA 3O3EA 3TYGL 2RB8A 3B9VA 5IK3B 1OAKL 1T83C 1A47A 3IDUA 1DFBH 1JXDA 2BIIA 3HZYA 5F1OB 3RNQA 2K1MA 2YRZA 1P53A 1N67A 2PN5A 2ADYA 3BUPA 3KEDA 2OPCA 1MWAB 1SFDA 1VPOH 3B4NA 1C7TA 1JYNA 2NQCA 2X3BA 5CIPB 1LP9B 2WLNA 3PABB 4WO4B 4X8JA 5E5MA 4YHLH 4DFHA 5F9WC 5C0NC 5SX5H 2HH0H 2F7IA 2Y3NA 3D4ZA 4M61A 4XRCB 4OFKA 1DBKH 3OPZL 4WFFE 4CGUB 1P7BA 2MOVA 3CXHJ 1FAKT 1RZ7L 4OI7A 5JHBA 4JM2D 2N0MA 4JO4H 3MRBA 1GGCL 5C0RH 1Q0EA 2EYRA 2F54D 2YC1B 3VFMB 3QDHA 1I8IB 5D1ZB 3SPGA 1KCVL 1Y6NR 2G2PA 3UAEA 4FS0A 2PCFB 4GEIA 1H3WM 1BEXA 5I8KL 1QG3A 2DMGA 2W65A 3HBGA 4JRYB 2DQUL 4NAJA 3HRZA 5K69A 2X4PB 2KPWA 2Q8BL 3ENEA 1PDKA 1COBA 1J18A 2LHAA 1S8DB 1TVHA 1U8KB 1TEYA 3ZSTA 4B7LA 3KPQA 5DJXA 3SPCA 3CPUA 4EN3C 1TJGH 4Q2ZA 4OFYD 2WN2A 2NYYC 4W9CC 1N5AB 3VB8A 1U21A 2GJ6B 4NQDD 3FKUS 4FTVE 2OYPA 4U05A 4FFYA 4PJCF 1H15A 4UUJB 4KNQA 1X5IA 2DYPB 3JUZA 3MLXL 1FV1B 2RTTA 4YHOH 2H3NA 2TSBA 3QZBA 3AGWA 4DF9A 2OMVB 4M6OH 4ZUTB 2YHGA 4X5LA 1QHPA 1TJIH 4Q6IB 3AMLA 2X0WA 5I24A 2CHXA 2EO7A 3GSXA 2NX5D 4HWNA 4HLZG 5E9DD 4PJ8C 1YYCA 1ZEAL 1HI6B 5BS0E 5GGSA 1MRFL 4NP4L 3S3JA 1NC4A 4HHWA 2WXHA 5IV2B 2ZP9A 4DKEL 2UX7A 4PJAF 2W9LA 5K9JL 4E5XB 1GMEA 4JPKH 2H32A 3KLKA 1NSNL 4YBLB 2C7UA 4QEGA 2GTQA 2EDDA 2WZPA 2J88H 3FQRB 5B4MC 3I6KA 4MJ5A 2NSQA 1AXTH 2WXKA 3C87A 4NRYB 4PGEB 5SWSE 1TFHA 1F6AB 3NPSB 2HLEB 1HCYA 3GJFH 4JQVC 2X9WA 3QO1A 4HT1H 3RA7H 1ORSA 3B2VH 1LJMA 5ESAA 3VGHA 5E8OA 3CH8A 1B9KA 2EDBA 3TTYA 4ZO6A 4JZNA 1DVZA 1GPOH 2E59A 2ZX8A 1SN2A 5I8EB 4XNQB 3S8FB 1OE2A 4PGDB 5KW9L 4L4VE 3M7FB 1S9XB 4AL8L 1BXXA 2JB6B 5GS2D 3RZWA 1CL7L 3SPVA 5I30H 1I1AD 2FX7L 2R83A 4LSRH 1QFWH 1CD1A 1NMAL 3IFNH 4U6YB 3VACA 5F0PB 4FFWC 2XKNA 1WG3A 5TK4A 1JZJA 1OGSA 1W16A 3QA3A 1KN4L 4CVXA 3DV6A 1I4FB 4MDJA 4ODSL 4RMRA 5F71A 2P1YA 2QVFB 3MLUL 2LU4A 3L7FB 2APWA 2B59B 3QI9A 2H8PB 4RSVA 1BZ7A 2VAAA 3ARRA 4DGVH 2IWKA 1AG0A 4OJDH 4RVBA 4XCEA 1V3LA 3LEYL 5JZ7C 1HH6B 1YC8A 1YEEH 1GYWA 1TLKA 4HJ1A 1KJ2A 1CBVL 1HYRC 4M6NL 4XBEH 1PKQE 3UXFA 4WFGD 4BFJA 2AZAA 2M1KA 3L95B 4OZHA 3E38A 3QORB 3CFUA 3QIBA 4MNQA 1U3NA 2VLJA 5E99H 4P5MB 2OTPA 3IJ9A 2XN9A 2UYLB 4IIQB 2OR7A 1MHEA 2OM5A 4G83A 5SWZA 5B7MA 1U92B 2YPLD 3ARZA 3W11C 1VCAA 5F21B 2ZXDA 4XOEA 2WGNB 1J7VR 3VDCA 3RX9A 1JXJA 4ZX5A 4HIHB 4YDVA 3IJYA 3GT6A 5B39B 2GTZA 1PLGH 4OLVH 1HHJB 2EEXA 1S5HB 4X4XA 1NCHA 1DJSA 3NRPA 4JVUA 3WEAA 4C55A 3ESUF 3GINA 4KXCA 3TYGH 1KCLA 5LLIC 2K4AA 1J5CA 1M42A 1TVDA 2IFGA 2PPCA 3LNHA 5JPMC 4YSEA 2VDKH 3OKKB 1OAKH 3BPLC 3TBBA 4LBEB 1KBGL 2R56H 2XY1A 5C0CB 1CYXA 2F7OA 2Z92B 3L48A 1I8LC 4QRUB 4PTUB 2EE0A 2W8CA 3P3UA 1WK0A 4A6YA 2HCZX 2F5AL 1BVKA 2YD0A 2WKOF 2XJKA 1T1ZB 2ALAA 1AQHA 1NAML 4EIGB 1T80A 5GS0L 1D5MA 2J56A 3PGDA 4XCNB 2IGFL 2AJYL 1A6PA 1F8TL 3OPZH 2E7CA 5MI0B 1BIIB 1PD0A 2XACC 5E2TL 5KYXB 4IBQA 1EBAA 3N1PC 5D4HA 1RZ7H 4PI2A 4I77H 1Z9SA 1NDMB 3GZKA 1JGUH 3BEVB 4IOIB 7TAAA 3GK8L 4ORZC 3GKWL 3GMOA 1OZUA 3FT4A 1S7UA 1D5ZB 2DQDL 4H8WH 2HRGA 1KCVH 1SXSA 1CI3M 3FUEA 2VDLB 1T66C 4R5XA 2KI6A 3C5SA 5I8KH 5DI8A 5GJTL 3IDGB 1Z1WA 3UTQB 3HC3L 3KYNB 4K2UH 4WI8A 2DQUH 3U6RA 1YCSA 2YAMA 4O2CB 4P4KC 4XO5A 2DQFB 4BDVA 4I8DA 1M3JA 1U3ZA 4BV1A 4TTDC 1GC1L 1M9WA 5KSBE 2YQBA 1F18A 1HSAA 4C83A 2R69A 2KL6A 3TWCH 1YA5A 4QAWA 2QGBA 3RX8A 1Z0NA 1M1SA 2DYSB 4Z77A 1UZGA 1JK9A 2FATH 3ZT7A 1CFBA 1MCCA 3B9KA 4GAJL 5D70H 5DA4A 5L4JA 4TUJA 1VKXA 1NCWL 5C3TA 1FBIL 4X5PA 2V5SA 3T0ED 1XIWB 2ZJSL 4M56A 1CFNB 1YQVL 3RHWK 5FWQA 5GGRB 5CBAB 3QXVA 1G9HA 1OTSC 1ZIAA 1MFVA 1MRFH 4NP4H 4FQXA 3U46B 4P2QB 4DKEH 3GBMH 3VH8B 1J0IA 2VLMD 4L1BA 4GSQA 2ZX6A 1T5XA 2A5UA 5AUMA 3NABH 4JFDA 1BGXL 3EBAA 2RALA 1ILUA 2JKIS 4L3ED 1P4BH 3L1OH 4P23B 4OV5B 3O6LL 1AC0A 2ITDA 2XZZA 1JI1A 1G9ML 1P6AB 4G5ZL 4NYLB 3D34A 2DEWX 1WICA 3AY4A 3DXAA 3ROOB 4DVRH 3KPSA 1F1DA 4UB0L 5HDBB 2GHWB 4URKA 3L5XL 3ZDXE 4KNTA 2PXYD 4XCCL 2FQDA 3WFBL 3BP6A 4F5CA 3GSWB 4PBXA 1T4KA 5DQ9B 5FB8A 5EF0A 2OXHB 5F9OL 4ANXA 5BV7L 1DYZA 2YD4A 5FO7A 3DSNB 3G9VA 3CFTA 3CVBA 3SYPA 3WLWC 3H3KA 4XVUC 3CDYA 1E27B 1T1XA 3MLUH 1O6SB 4WI4A 5TDOA 5F6IB 3V7MA 5CR1A 1HHHA 3NFNA 2EE6A 3LKPA 3CSBA 4H8QA 1JS4A 3FTSA 1F58H 1JTOA 1XCQB 4D0DB 3DO4A 4PRNA 1U91B 3K8KA 5IHBA 3MBXL 3R06B 3PJLA 1TFPA 4E2OA 2ITCB 3GSNB 4HISA 3I6GA 1HSBA 2VABB 3F7VA 4HUKB 3QCTL 4U3SB 3V0WL 3KCPA 4M1GL 2JKTM 2COVD 4F8QA 3RIAK 1FWXA 4HUMB 4BQ9A 2PPDA 3JWDL 4M8RA 5BV7C 5IVNA 3H85A 1ZK5A 4UTBA 4N5UA 3MLTB 4CL7A 3TEZA 5E5RB 3DTXB 3GRGA 5L9DL 2LLNA 3Q1EA 3QG7L 4KRPC 3TZVC 1PEZA 1ITCA 1BZDA 2I07B 3EZ8A 2B4CL 4WV1B 4P2CG 5EN3A 5D4IA 1MWAH 1NBZA 1A6UL 4WI2A 3B3IB 3WFDL 4GSRA 2GIXA 1KG0A 1MLBA 1E5UI 4FC3E 5CIPH 4LHUB 1GHFH 1J48A 1VGEH 6FABH 4NQVB 5ERWB 1EVUA 1MJ7L 1JPFB 1LO3L 2YAQA 1NOAA 3DX2A 3JT2A 4A7VA 4BFEA 5KG9A 4X6DA 4YPJA 1NGYB 2BVQB 3QNZA 4NO3B 5FV2A 2EE3A 4AC2A 1D5BB 1AHWA 5H94A 3LRLA 3ESOA 3CGTA 2F5AH 3IB4A 4F8TA 4O2EB 1BW8A 1FAIL 1RU9H 4MB4A 2WKLA 3ZKXC 5AB0A 4EDWH 5GS0H 2UWEB 5J12C 4S1DD 2Y23A 2HZHA 4ENED 4DKTA 4BK5C 3P0GB 5E2TH 4PREA 1DVTA 3BP5B 1QSFD 1EO7A 3MRRA 2J12B 3KYKL 2N59A 1J88A 5IY5B 3GK8H 2XV6B 3GKWH 5FM4A 2MNUA 3BUIA 5HDOA 5H4YA 3ESMA 1UWGH 4JFFE 3JV4B 4O02A 1CDYA 5FAAA 5GJTH 4ESKA 4I88A 1GJWA 1OGAE 3IT8D 4HWBA 4Q6YA 4H20H 4ZW6A 1OM9A 4G8EA 4CC0A 4JO8A 2ENPA 5EV7A 2WYZA 3UMTA 3B9AA 3K4AA 4APXB 2CKBA 2PCYA 3KEHA 5DC0A 4A7UA 1P7QD 4BKLB 4Z7OF 3ZE0E 3HLAB 2FR4B 3RFZB 3NTCL 4YGVA 4TOYH 4TMPA 2VR5A 4NPYA 3MRHA 1EAQA 1WBZA 2BO0A 1YAZA 3KPLA 4XMKL 4F2EA 5ITFA 3GTNA 4MLSA 1B0GB 2V33A 3F64A 1YN7B 3LVTA 4K0OA 5I1AA 5EU4B 3K5RA 3CSFA 4H88L 4GAJH 1L9OA 3TC9A 1QLFA 1FBIH 3PV7A 4FQLL 1VJSA 5D93B 4Z3GA 3CC5B 5FUCC 5AOMA 1LMIA 3LMJL 2DQTH 4M8VA 4Y4HC 4XBPB 1UGKA 3TIDB 1FVDA 3P02A 1JPGB 5TQ0L 3X1GA 5D71L 1GOFA 5J1AA 1IGYA 4R97C 3KVDD 3N06B 2NY4C 3MV7D 4U1JA 5IM7B 1XSOA 4HS3A 1CQYA 4FERA 3DJ9A 1CZ8H 3OMAB 4AJYV 5KS9A 4GG6E 5BVJA 4HEPG 4Q0XL 5EZLB 4N0UB 4HP5A 3BO8A 1Z9MA 4F91B 5J06A 3IGAB 2ITFA 3JTSB 1D9KD 3G5ZA 3QCUL 4X4KA 4OVUA 4Y19B 3UIYA 4G6AD 1U93A 3BSGA 4TULL 2J8UB 3FU0A 4F1ZA 2DMBA 5E4EB 1Q90A 4Z7UB 1G9MH 1CICA 2MCAA 1LO0H 4PJEB 4ZZFA 4PJGE 1DQDH 3VGFA 4UB0H 3L5XH 3C5ZC 1EEQA 4QTIL 2G0LA 4XCCH 1UXWA 2BS71 2OR9L 5I1IL 1C5DB 4Z9KB 2P47B 4X98A 1TZGL 5TE4L 2D0HA 5F9OH 3K46A 4PJ9C 3QXWA 4KVNH 1L0PA 3VMNA 3L3OB 4PJ7B 3VQMA 1KV3A 1SY6L 1J8RA 4OGAC 4I13B 3BN9D 3O6FB 1MW3A 4XNZB 3VQ2C 2XSKA 4PIRF 1FO0A 4UYQA 1NMCB 3KG5A 1DCLA 1J8HE 1A9EA 1AQ8A 2GAZB 1LO4L 1JNLH 4UQDA 4KRMB 4OZIA 1MCQA 4ES9A 3B43A 5CD5C 4WWKB 2GUYA 3P0VL 5B8CA 3PFQA 1EO5A 3MBXH 3P2DA 4OBSA 3JZYA 4G9FE 4XMVA 3OAUL 3DJZA 3FFCE 2YD8A 1B0RA 4U1IA 3WKPA 4AYDC 3H8NA 3QCTH 4M1GH 5E00A 3FQYA 5DQJA 1KPUB 4XVOA 3OLEA 3QHZL 1GIGL 1DBJL 3JWDH 4GSXA 2LE9A 2JI1A 3C2SA 4B60A 2VLLB 5CR8A 5C0IA 4RNRA 1U8LB 2LOEA 3QRGH 2ICEA 3ZIYA 1OSZA 2DI7A 2L8AA 3B9DA 4NKDA 2DQJH 3SDDA 3QG7H 3MV8A 4MS8D 3MLZL 4KK5C 3UBXB 2B4CH 3BUTA 4G43A 1FQ9C 4F58L 1L6ZA 2V7HB 1RJZA 4TKWA 4ABQA 3II2A 1A6UH 1YLBB 2J21A 2O5YH 4DZ8B 3WFDH 5C0GB 3BZFA 5JW4N 1QTSA 2ZICA 2CDEB 3HS9A 3BLKA 5AW1B 1XV8A 3KWUA 1BVNP 2Z91A 4DGIL 4OIAA 4DQOH 4PS3A 2YD3A 1MJ7H 1LO3H 2MOQA 4HD5A 4YHPA 4KH2A 4IRSC 3O4LB 3ZHFA 3UG3A 2XJLA 4M5YH 4W1TA 3TEXA 2XG4A 4PLKD 3D2TA 2XQYG 5E56A 4NCC2 2BW4A 3QNYA 4NKOB 4PW4A 1ETJA 3KLAB 1TF4A 1FAIH 2ZT9C 3MV11 3MGOB 3T4YB 3H9HA 4DERA 4ZYKA 1ZA6B 2VDLH 3F12B 3SO3B 4JHWH 3ZOAA 1MHHA 4PJ5A 2V5RA 1JMZA 3DX0A 3O2DL 1NC4D 4QTHB 4QWWD 4A38A 4QRRB 2FVNA 3T0AA 2VMEA 2FIKA 2P5WB 3KYKH 4NT6A 1GCYA 5T5FH 2X6MA 5D6DC 2WZPD 2HVKB 1TCRA 1EHLL 3FRUB 1SZNA 3CK0L 5CKAA 1RLBA 4S1QL 2ODIA 2AEOA 2RR3A 3WHXA 3JV6B 3I75B 1IE4A 3P4OB 3HNVL 4WY7H 4OM0H 2AJSL 3EOAA 1R46A 1KELH 4X5WB 1AS6A 1CIDA 5D7IA 5TGBB 4KZDH 4M8UA 4YGAB 3BW9A 3N85L 1HU8A 1DDTA 3LZPA 3NTCH 4P2RE 4W9LC 1R5WB 4Y5XA 3ARBC 2FBJH 2YPKA 3SO5A 5CCJA 1H3VA 1EEZB 2QPFA 2Y36L 4JFEE 2QHLA 2G3MA 4K94L 1PYWA 3IXTA 1F11A 4NIKB 5E9AA 3KPRD 4ODUA 4H26A 8FABA 3PG2A 2CBMA 2QKIB 4GP5B 4H88H 1JWUA 3UPAA 5K5YA 1W0VB 3KDMA 4FQLH 3QI9D 4XPAH 5ANME 1I3RA 5B22A 4ELKB 4XODA 5KBLA 4TVPL 2JCWA 3RZCB 1RMFH 5TQ0H 1BD2E 5D71H 3S97C 3SYOA 2EZ0C 5GGVH 3VXUB 3DX3A 3GRWA 3MJ7B 1FJ1A 3L3IA 4OZ4A 5ABDE 3VG0L 5D9SB 1ZDQA 4KFMA 3HMWL 4XX1E 4MBRA 5E6IA 3QIBD 1XZ0A 2H41A 2UZYB 2VLJD 4X7DC 1CWVA 3CVHA 4K94C 1QP1A 1RZJC 2XN9D 4Q0XH 4TQ8A 4UBDC 4OY9A 5SWZD 4QHUA 5F7EL 1V54B 1M7IB 2O6CA 5HPMB 3N43F 1PG7X 4MJIE 2LVCA 4B5EA 5DUPH 2ICWA 3B2MA 1YPZB 3BHBA 4YVUA 3TT3H 3ULVC 2WTRB 1T7VA 1WEJL 5EZPA 4BZ2L 2G5BA 3NSXA 1JFQL 2R1XB 2OQJB 4DW2H 1AGFB 2OR9H 4U7KA 5I1IH 1QO3A 2ESVA 2UUDK 2VIRB 3C5JB 4P8QA 1MW1A 5BQDA 4LHQB 4TQEL 3ZL4H 2GG1A 4GKNA 3GEWB 1MI5A 1OCOB 1OO2A 1FZJA 5C08E 3PUCA 3GSNH 1SOQA 1ICTA 4KK8C 4Y9EA 3DSFH 5AAWC 5MEOA 2ATPA 3KBEA 2AJ3B 1XF5A 3TYFA 3N91A 2A9AA 3P0VH 2GJZB 1AXSB 1Y1DA 2CLRA 4HU8A 2BSDA 2OSWA 4NZRL 2DMHA 4RETB 3HB3D 4LMQE 1KJVB 3V8OA 3LN5A 1SJHB 4EXPX 3GLDA 2RD0A 1DEEB 1YEHL 1UXSA 1HHKA 3QHZH 5DZOA 1GIGH 2ZXGA 1DBJH 2JCCA 3L7EB 3MRFB 1R17A 3CX2A 3WKMH 4A2FA 4UV7L 4CN4A 1ND0B 2CH8A 3UCRA 1FZOA 5HI3D 4PY8J 3WDJA 3TVMC 1K3IA 3HA0A 1W0WA 3MRQA 4J6IA 4MQ7A 5DD1L 5J9PA 5TE6H 3T9WA 4AT6A 3MLZH 5ISZE 3U7WL 2ATAA 5DTFA 3K6SA 5KOMC 5MHSD 2EAEA 3QAQA 3NJKA 2V37A 3FHEA 3BWSA 4P5SA 4R6UA 2EACA 1BXVA 1OGTA 4HA1A 3AQYA 4KXZI 3SZKC 1NFIA 5FUCE 3CN3A 4DP2X 3NPZB 1QASA 3D39E 2X4OA 2ZPKL 1ADWA 4A04A 1T20A 4FNSA 4M7LT 3WJMA 2A9MH 3PP3H 1UD5A 5GSVA 2Y0SA 4W9KC 5F3HA 1MH5B 1QUPA 3K6IA 4YFLI 3V10A 1SEBB 3GB7A 5D5MB 1OT4A 2ZUVA 3B9KD 2M26A 4RFNB 3TBSB 2F5BH 5I28A 3MFGB 3MRLA 3BAEL 1A6WH 4MASA 3S3CB 2XRAL 2NZ9C 2JTYA 4QRTA 4UTAA 1WT5A 2AQRA 4E9YA 2B0SL 1T2XA 1WBXB 5AL0A 3U9UA 4Y2DB 2F1EA 5ABAA 2DQGL 2UZIL 1SJVA 4FQXD 2C3VB 4JDZA 1CGSL 4XP5H 5BUPA 1VFBA 2FL5B 2D4FA 4UOW1 5IFJA 3EOYG 4KOCA 4HPHA 4IHOA 4JFDD 3K2UL 4RWHA 2E4FA 1E9OB 1EHLH 1K8DB 3V4VA 2B20A 3CK0H 4XCYA 4CU7A 1U4FA 2Q7AA 4TL4A 1FL6A 3UO8B 5I0WA 4KMQA 1TJHL 4CW1A 3CH1B 4JFHD 2CIIA 4RRPG 2DQMA 4EJ1C 3KS0J 5LQBL 3GUTB 4BIKA 4JM2C 2HJLA 3HC4L 2P5EA 2GHZA 5KYYA 4Y2OA 1RV6X 1Z5LB 3VGBA 3US1A 3GHBL 4FFVD 5IMLA 1IEBB 1O9VA 1FN4B 4EVNA 3P11H 4MXVE 1AQKH 4CAGA 1YNTB 3NGBB 3T8XB 3TL5A 4JG5A 3APFA 3ILPA 1DLFH 3MRGB 4R0LA 4AM0Q 1EZSA 2A6JB 3TA3B 2C5DC 4PRHA 3FMGL 3P4LA 5FDYA 3JTTA 1ZANL 2C7FA 1A5FL 2R2EA 5CM1A 1G7JB 3NJVA 4MRBA 2DZEA 1BHGA 2NNAA 1GYCA 1F3JB 3HC2A 3HAEB 1U6AH 4TVPH 4MDIA 2XWEA 3L3KA 4WFED 2EECA 4B9GA 4F9LC 4DP7X 1UFUA 4Z0XA 4Y1TA 3IK2A 2WVUA 1JZGA 2GEEA 2AGJH 2CCWA 3ZKMD 2FJUB 1O9WA 2R23A 5GHWL 2MCPL 3RFRA 4JCMA 4JEGB 3VXSB 1FORL 4HYTB 4L5FE 4PB0L 3F7PC 3IDMA 1CLCA 3IS0X 3IETA 4LSQH 3R8QA 3S4SA 4KRNA 4HKXA 1LK2A 2CLZA 4UT9A 5IFAL 3SKNB 2LTQC 3WBDA 2BPBA 5ICXA 2ODHA 5E1GA 4M9PA 5IIEA 3H1ZA 3L3JB 1D7FA 1KXQE 4JY4A 2NTFA 1P5VA 4MQSB 1WRFA 5K9KA 3VFNA 2BOBA 2A74C 1TOXA 4JCLA 2DV6A 2Y06H 4E41A 1WEJH 5BRZE 2X2YA 1ZLSL 4HW6A 4JKWA 1NUFA 2R1YB 1E7VA 5DZVA 5FYLD 5HHME 4XC3L 4ABWA 3MOBL 4GXVH 1VAHA 1AS7A 3LZFL 1R3JA 1X9RA 2EQDA 2FECI 3GMQB 4PRIB 1LEGA 2VLKD 5AVYB 2EEFA 5EEZA 3MRMA 4F8PA 3DBXB 3VX0A 1UYWL 1A8JH 4ICWA 1KYOK 3AB0B 3MJGX 3M1OA 4X7TB 3VFTB 1ZKAA 5FO8A 4BUHA 4P2YA 5FF6B 1I1AC 3E9TA 25C8H 3ULVH 1NKOA 1KT2B 4B9YA 4CVZB 3AJ7A 1N4XL 3AADB 4Q89A 1OF2B 1XGPB 4BUQA 4TRPL 4X6CA 4NZRH 3IVKB 5I2IA 3VYNA 5AALA 3FCSB 1YEHH 4KK6D 3S96B 3STZA 1BSIA 4N8VA 3SGJC 5CSZA 1GYUA 4JKNA 5DS8B 1YEIL 2G9HA 3GXUB 3QEUA 4S0TD 3EJZD 3QFGA 1XGUB 1Y6MR 4OSUH 3O81A 5I5RA 1MIML 4ZFZA 1S7TA 4DN4L 1EJOL 1UATA 2WZ5A 4DPCX 5I8OH 3FH5A 3DIFA 3UO1L 3FJTA 4EDXA 5IWLC 5I8CB 3N50A 2VO5A 4J3XA 1KULA 3RYMA 4RZKA 5KSBB 1QA9A 5C0AB 5I71B 2ZPKH 3QWOA 2BLFA 4JFZL 3CN1A 4ODWA 1PZ2A 3B3BA 4LMQI 3VG9C 5CNHA 4PJIA 3DJTA 4U7SA 4B9IA 1RFDL 3FO9A 1MHCA 1ZLEA 2GK0B 3C2AL 3OZ9L 4XHJD 5HGBA 2Q8AL 3T3PB 4NXKA 3X1FA 1QI5A 3S5LG 1EGJL 4BQ6A 4X6DF 2OX5A 4KHTL 2XRAH 1I1FB 3KBPA 1FHNA 1N8OE 5CJOL 2B0SH 3GGWA 5H37G 4MCZB 2YFOA 3X11B 2HLAA 2V9TA 3DVGA 1OAYL 1ZS8B 4AMKL 2DQGH 4P99A 5EOCL 1PBYA 2UZIH 2N7SA 4DAGL 4IGBA 1CGSH 4Z7WE 5LBGA 4AENA 2RH0A 5HJGA 3VI4B 4CDGC 3FU5A 4QJ5B 2CDGB 2CO1A 3ULUL 4PV8B 5I1LB 3W39A 5E8DL 4DEPC 3ISYA 2WVTA 4FYSA 1RIUL 2XWJB 3V55A 1L5GB 1RUKL 4C4KO 4PS4L 3SYAA 3WNKA 2D2OA 1EJ8A 5HYEA 3FUFA 4F92B 1T22A 2YXMA 4J3OH 4ZBJA 3R7QA 1AKJA 1CICD 4MNHB 1MJUH 3KBFA 1JHTB 3KHQA 4HS6B 4BH8B 1Z66A 2AV1A 3UTSB 4K3JL 3BSHA 4ZS6D 2FGWH 5GRVK 1JHKL 5HHXL 2CO3A 3HMXA 3Q1SL 5LBSL 1G6VK 4K23L 3BKCL 2VQUA 5I23A 1UWXH 3PE9A 3GM8A 4AUYA 3W37A 1IBYA 3S2CA 1TITA 5F9WB 3D06A 4CBPA 4TQIA 1AYOA 4JK0D 3BFOA 4FQ1H 4HG4K 1AIFA 2GBVA 4L23A 1IKFL 1JZ3A 3OJVC 1ZANH 4J23A 2W81C 1A5FH 3D0VB 4XZUB 5GS1C 1AO7E 1T1YB 1TYRA 4XN5A 3V9CA 4AVJA 5JHMA 3WI9A 1K6QL 4HIJA 1SBBA 1TMCB 3RQ3A 3GSOB 1X9UA 4U1KB 1AGCB 3T1FA 1A3LL 4YSAA 2IANA 2X3CA 3L9YA 3CE1A 1P1ZB 2C1PB 4AV4A 5GRUL 3H42L 1W72A 1FGNL 1YY8B 2FO1A 5GHWH 4FEMA 4PB0H 1GGUA 4EBQL 3T0EC 4L0ZA 3ZYIA 4GAAA 5DK3A 1DANT 5EULV 4FLHA 5T3ZE 3I6LE 1DL7H 2IWFA 1SJXA 5ESQA 3OAZK 3O8XB 5IFAH 3ABLB 4PU2A 5GQBA 5DHYA 5IEKB 2VDQL 3OZKA 5JHDE 3SDDD 5H35B 3WE6B 3N40P 4C58B 1CLVA 3DX1A 5JXAH 2CJTA 5DRWA 4FQQA 1GGYA 1ONQA 3V0EA 4KI5D 4F7MB 4LCCC 5IB2B 3V0DA 1E30A 3PQYB 1ZLSH 4H13C 3MRDB 3QDGD 4XC3H 3EIFA 3H0TB 3MOBH 2MKWA 2H3KA 4W4NA 1P4LB 2HT3C 1HC1A 3LXBA 1BF2A 1RZKC 5FUZL 4WKXA 3QHFH 2VJ0A 1CFSA 1C9SA 1MCIA 1NCNA 1YECH 4MA7L 5D2NB 3AUVA 2PXYC 5IF0B 4PJAE 4IDJH 1BM3L 3GBEA 3QK0A 4X8XA 3ZZ1A 4NBYB 4TSAH 1XD1A 3EYFA 1U8PB 2EXWD 3EYSL 3FQTB 3GBNL 3F85A 4XH2A 3WTXA 4OZIF 1GOHA 3S36L 1KGXA 2MQGA 2NYKA 2BZCA 2ZUUA 3LD8C 4MXQD 1BIHA 1S9WA 3OKNB 1MHPH 2F54E 4GQRA 4XAWH 3RDTB 4HBCL 3TCLA 2X9XA 1BREA 2NT1A 4M62L 4JFFB 2W9EL 4PP2B 4CUCA 3NCJL 1LVEA 3KHOA 5D1XA 3WXWL 4OFVA 2VRAA 4NDMB 1EJOH 4LLVA 3MUUA 4AYGA 3RGVB 2IBBA 4XZ4A 3UO1H 3VFSA 1H5BB 2XWTB 3O6KL 3BH9B 3MRCA 4OIIL 3FH7A 1VACB 2H6OA 3FW6A 3PHOB 2QMJA 4JFQA 4Y5VA 2AAVA 3BPOC 3KPNB 4KI5F 4NQDE 5AOLA 3NSJA 1T0MB 5C86A 4NQED 2ZUTA 3IMBA 3KLHD 2EDRA 5JHLH 1B0WA 4RAUB 5HYIA 2Q8AH 4XHQA 1EGJH 2G2RA 2IADB 4LXFA 3LV3B 1KZYA 2UUDH 1CFTB 1WO2A 4V33A 3LQAL 4KHTH 1QLEB 4PG2C 4OGXL 3FU8A 3O45A 2NX5E 5E9DE 3ZE1F 1EFXB 3W5NA 1OAYH 3FO1A 4AMKH 4OZGA 3C09C 4TSCL 4XMPH 4UTCA 4XN8A 3UYPA 3CHQA 1MLCA 2UY7A 3PHQA 4ZFOB 1MIEH 5D1QA 5E6ID 3WAJA 2ERJC 5DLML 3ULUH 3KPMB 4F7EA 5E8DH 4ZMLA 4AYFB 5I6OA 2X1OA 1OB0A 3ATFA 2V4LA 4P5TD 5FW8A 3RAJH 5GGSY 4A2GA 1QOKA 3BH8A 1W9XA 4ONOA 5AOIA 4NKQB 5C09A 4QGTA 4S1DC 4NJ9L 4ENEC 5JR1L 4MB3A 4WHCA 1T3FA 2EDKA 1I7UB 5D7SL 5E4AA 3KH4A 4OCMC 3F65A 1QTPA 3LQAC 3OQ3B 4K3JH 5B1BB 3Q1SH 4K23H 4F7CB 3BKCH 3R19A 4MAYB 1NJ9A 4UU9B 3RWDA 3ZUNC 5KVGL 4NFDA 5D7IF 2ESVD 5JTWA 1N7ML 2IOMA 3P3RA 5IB3A 3HAEH 2F58L 3WLBA 2AC0A 1MI5D 3K4ZA 2C3HA 4Z1PA 1OAUL 3VD2A 2XPGB 1S7RA 3HNTL 1AP2B 1GA2A 3ZO0A 5JQIB 3FU3A 1IKFH 3V5HB 1MAJA 3FCGA 5DMKB 5C71A 2BY2A 2DLIA 3EFDH 3QEHA 5I17A 2BIQA 1LXMA 1NPJA 3CAFA 2RFXA 3CFBA 3GSQA 3SEPA 2ZOOA 1QWNA 4FXGB 4BK8A 1K6QH 4BE6A 2GIYA 4JUTA 3U1SL 2WVSA 1A3LH 4AWJC 1YJDC 4XOCA 3P4MA 4KV5F 1I3VA 1BQKA 4DVBA 4WFGE 5KSAD 1KTBA 1WZLA 2Z4TA 3FRPA 5GRUH 4U1MA 5LCVA 3QDJA 4MZIA 5IUCA 3KXFB 5C0EB 3TNMA 4EBQH 4YHIB 5EOTB 1U3HA 5JXEA 1ILSA 2XG5B 2MIZA 3C75A 5LXGL 1I9RH 2QVMA 2OW6A 2VDNL 3EJUA 2CD0A 3EDJA 3IFPB 4IOFD 4AGLA 3SDAA 3HFMH 1ES0A 1ZS2A 2K9FB 4ONFH 3ZGHA 3N44B 4XN2A 1RHHB 4RAVA 4JR9L 3C5XA 5DJCA 1CDIA 4LLQA 3T6WA 1NGWA 4PY8I 4WK4B 1TQUA 3ETSA 3NACH 4BRJA 5F7FA 1D9KC 1EWHA 3HZMA 2XYBA 3RJDA 1Q9LB 4G6AC 1HYSD 1Y0LB 4JMXA 1C08A 4CA4A 3G6DH 5GRVL 3ME0B 1R47A 4OR1A 5LXVA 3EGSA 4NQSA 1I9EA 4XN1A 1EUUA 5AAMC 2H0FA 4E42A 3Q9PA 2WLIB 2Z34A 3NN8A 3N55A 2F74B 4Q4IA 2IDQA 2BVPA 3L81A 3ZY7A 1U8MA 2ZX9A 5LGKA 1A64A 1FDLL 4MCNA 1OD9A 2YPVL 5F8QC 4JVPA 4PUBL 1MFAL 4QR7A 4XNXH 5AKVA 3EYSH 3BIBX 1MCHA 3S36H 2EINB 4I4WB 5BOJA 2L04A 3UFIA 1FZKA 4YDZA 3BN9C 4RH4A 2A6DA 3D25A 1WE5A 4RWYL 1NINA 5L2KA 3HC0A 4WI5A 3ZDZF 1TG8A 1QSEA 3WXWH 5B38A 5DHVA 1MFDH 1JNNH 3C6SA 4JG0L 1Q72L 1DQJB 1GKEA 3VXRB 4D3CL 1A4CA 5F89A 3HKZA 1QABA 2APVA 2P5ED 4YPGB 3EGXA 4QHNB 5JDJA 3M6DA 3D85B 3QFJA 4ZAKD 2E9BA 3SE8H 4LK4A 3PL6A 4L48A 4YXKH 2J55A 3V95A 5ACZB 3HRZC 4TSBL 2BSSB 1CUOA 4MS8C 3V0JA 1NCJA 2F18A 3D5OF 3LQMA 4PRHD 5INCA 1SYVB 4YDJA 4HUVB 1UOWA 5HJDA 3TO4D 2H6PA 1CTMA 3T0EE 1IVTA 4ZFOL 4DH2A 1KPVB 3GI9L 1E4WH 1JERA 1YMMB 4OGXH 3K71B 2XETA 1NUDA 4M7LL 1WWBX 1IMHC 4Y5YA 3QUZB 4BFIB 4N9OB 2ZKXA 1A9BA 3ZJAA 2G3ZA 1K4CB 4TSCH 3TBYB 1SDYA 3RWFB 1V05A 4LLMB 4MAZA 1VDGA 2OP4L 2VLME 3OJMB 1JPTL 1BPLB 4O9HL 4PLKC 1SDDA 4RMTA 1FYTB 1SDAB 2XX1A 2VR8A 4DKAA 4L3EE 3VWKB 2ZUYA 3IU3A 4E9LA 1BA9A 1T0PB 3AU1B 3QR2A 4L8DA 4Z7QE 3QRLA 1OCCB 5JR1H 3BQUA 5D7SH 4NNYB 4QWWC 4MJIB 4XMLL 1DJIA 5KJRH 1OSEA 4E41D 2W0FB 5E6UB 1IFHL 2H1PL 5KVGH 1DBML 2HSIA 3QH3A 1H8LA 5IUSA 4P3DA 5CWSA 2C9PA 3B6SA 5DEJA 3DIDA 1JWSA 4P46B 5JW4Q 4GKSB 1ZLUK 1OAUH 1ZA3B 1XF1A 1Q1PA 2ZIDA 4GI6A 1IAOB 2QQKL 2VZOA 2Z6FA 1PU0A 2WCPA 1QTYT 4K3DH 2PW2B 3CU1A 1PZCA 2OMZB 4R7NB 4HMCA 5FUOL 3ZL1A 1T04A 4G71B 5I6LA 3BWUF 1BFTA 2AEWA 3ABZA 3WFCL 4IU2B 2X4SA 1DZBA 4Q9QL 2NXZB 3ROLB 5I1KL 1O5DT 1MFEH 4IOSA 2EC9T 4XP4L 1N59A 4N1CA 3UJTL 4GSDL 4X80L 2MQCA 2RIKA 3QI9C 4NNXA 5G2NA 4FZEL 4XMTA 3DV4B 4B3EA 4IRJB 5TK2A 4Z7OE 2Q2EB 2WSDA 3JWOL 1J05B 4JFXA 3QFDA 1CE6B 5ID0A 4ONHB 3PAVA 2M83A 3QIUA 4N2DA 2A7BA 4LEBA 3MFFA 2PW1A 1Q38A 1I31A 4OZFA 1FFNA 4ZSOB 3QIBC 3DX7A 3MLYL 5FW6A 2WZ0A 1KYAA 4POUB 5LNDA 5A6LA 3MUY1 1JRHI 3MRIA 4A6YL 1XCXA 1MCPH 5F7UA 3D12B 4OTXL 4R97B 3TLRA 4YL4A 3D8MA 2NY4B 4YJZL 3KGSA 5I1CL 1M4KA 2XZQH 3HEIB 3IGLA 5T1JA 2GJRA 2HJKB 1RIVL 1EK3A 5IQ9A 3WNNA 4Y1SA 3KYMA 1OP5K 3EYOB 3D09A 1IZKA 1K9TA 1RZFL 1U95B 2OXGA 1ETZB 4I87A 5DRZB 5CFAA 1DBAL 1MFAH 2VCOA 2IPTL 4V2CB 1BOGB 4WI7A 2KKQA 1QSFE 2WAQA 2YEZA 5SV4A 2XVBA 1MJ8L 1O6TA 3BD4A 4PG9B 3T77B 4AQZA 4LPTA 3OM3B 3CFJB 2BY0A 3HE6A 1JF1A 4FP8L 1G1YA 1II4E 3N1GC 4Z23A 1EX0A 2A1WL 4FAAB 1AKJD 1EXUB 2E7MA 4G9DB 4JG0H 5H2BA 3HB3C 4BH7A 3U9WA 2R4SH 4D3CH 4ZODA 5CEYA 1P5UA 4UM9A 3JWNG 1OQOA 3CCHB 3CBKB 4LDEB 3QWRA 1NZRA 3GSRB 3WV0A 1YMHA 1QLEH 2HLFD 4JN1H 3GTTA 1WF5A 3NFSH 4QRQA 3ZPDA 4MMYA 5JIMA 3QDMA 3TBTA 4OI8A 5EO0A 3K8MA 3O9WA 4WDIB 4YDNA 3ETBF 1G7PB 4CJ1A 5LAXA 1XR9B 1BDYA 3EYUL 5CN3A 5TH2B 3Q48A 4PD4K 3H9SD 2CUIA 5KANI 3MACH 3RTQA 3I85A 3LPPA 5GRZA 3ESNA 3N04A 3VVVA 4Z76B 2IH3A 4A2DA 2R4RL 2ADGA 1NCUA 2IAND 3D48R 1HQ4B 4IS6B 1BWMA 4R4BA 3MV7E 4HHGA 5K39B 4OCYH 4TUOB 3PGFH 2GUOB 5FWRA 4YHYB 1KBBA 2IQAB 3ZDYB 5I74B 2VXVL 3B9KC 4GY4A 5IREA 5CP7A 3PIQA 2I9LB 1JPTH 3WUWA 2QPEB 1M05B 1RZIB 4OLWH 2BP5M 4O9HH 1ZGLB 1KIPA 1MCLA 2BVEA 1F4YH 4M8QB 2AF2A 4LSUH 5BS0A 4FDWA 4ZS7L 5D7JA 3WENA 1G5AA 4IEFB 5ID1B 1EAPB 4H5SB 3F7KA 4M3JA 4N0RA 4NO2A 5CZKA 3RL2A 4FQXC 2VSKB 2WCSA 2ZWSA 4NO5B 4XMLH 3UTPD 2VXSH 4HDIA 4M4PA 3WEOA 4BWUA 1A02N 3BP7A 3EHBB 4DP5X 3A4AA 3PPEA 3DYMA 1BF5A 1RK1A 2VN7A 2G60L 5KN5A 2H1PH 1I7ZA 3ASOB 1S7VA 4PJFA 4X4YB 4ABUA 3W9DB 4LEXH 4XVTH 3CPLA 4PB9L 5BZWA 4WK2B 1PZDA 4RFEA 4Q74A 4HFWB 3MYJA 5BZDB 4IU3A 4KXZH 4L4VA 1JCVA 4RSYA 3AY4C 2VUKA 2QQKH 5T5NG 4QOKB 2ZKMX 3BESR 1JWMA 2FNWA 5K9QI 3KJ4B 2PO6A 1BAWA 4AYEC 1MWOA 5JLZB 4M5ZH 1IGTB 3NJHA 2ARJB 3G04A 2WBJD 2WSPA 4FFVC 3LRSB 4LIQE 4Q9QH 3T08A 2HKFH 4O5LH 3CHRA 5HI5D 5DK0A 4XP4H 3L16A 1L9TA 5ICUA 3S88L 1XTMA 1USQA 4BZYA 4DP0X 4WUUB 3S5ZA 5AB1A 5DGRA 3UJTH 4RMVA 3B34A 5EEUA 2PABA 4GSDH 4X80H 3NIFE 3WSQL 4W9EC 4JE4B 4FLOA 1Q94B 4W9IC 2J4WH 3ARBB 4MA3B 1Q9OA 4ELDA 4ZX6A 1S7QA 2OMTB 5ETUA 1KDJA 1PKQA 2BNRA 3IDIA 1OLZA 3JWOH 4NUPA 2B3IA 2VISB 4B50A 1U0QA 3QJRB 2QGCA 2YQGA 1VEMA 2P8MA 3NZ8A 1R3LB 4KTDL 2EDOA 2XXCB 4D7PA 3SOTA 1BV8A 3ZKMC 1IJ9A 1A6TB 3DTDA 5DJ2B 3MLYH 5IKCA 2YSSA 4W6XB 2M8XA 3K2KA 3U4AA 3GIVA 5CJ8A 3ES6B 3AVEA 3C8KB 2H9GA 2ZWKA 3ESPA 1XH2A 1RZ8A 2P8PB 3NIDB 4OUOA 3Q43A 1S9YB 3U9PL 3VJ6B 4ZMZA 3BFWA 2A4ZA 2NY0D 5BO0D 3MBEA 3CFIC 3WMQA 1G7IB 5I1CH 3Q0HA 4Q8BA 3RWJA 1CGVA 4IBTA 3CXDL 4ONGL 5G5DA 1XT5A 5FCUL 3E8UL 4GW5A 4JMNA 1IC1A 3AROA 2Z31D 4WK0B 3FQNA 4CSZA 1HHGA 3TN0A 3VXPA 2PR9A 4ETQA 1FZMA 4KKNA 1WSST 3FT2B 4AK2A 1DBAH 3GMNA 4DPRA 5AQ0A 4FQHB 4CKQA 3P9MA 2IPTH 4HLZH 1MZYA 3UZVA 4U1LB 3LHAA 1YYLL 5FA4B 3IDYB 4KKBD 4AQAA 2A83A 4MRCA 1F42A 4MD5B 3A6BH 5D1QD 5ALCL 2WXFA 1AHWC 5T3XD 3QHTC 2PR4L 1OARH 3QJFB 1VFAB 2D3NA 4QJ3B 1ZT7A 1N6UA 2ZOUA 4TS6A 4AZ8B 1GMIA 4WJ5A 5C09D 1NFKA 1RSFA 4HKZA 1B6DA 2OYMA 4NQXB 4U6XA 5F7WC 2PCPA 2A1WH 3WHE0 3QJTB 4XC1L 1DN0A 4OD3L 3CFQA 4WWID 3G5YB 4HHAA 4TQHA 2DM2A 4LDLB 3KW8A 3LKQB 4KK6C 3PDOA 1YN6B 3GXNA 4XGZA 5EC2A 4B9CA 3HVDA 3L5WB 5FR3A 5FYJD 2E6PA 3EJZC 2WUBL 3POHA 3KNBB 3VD7A 4OF6A 4YXLL 2WW8A 2XFXA 3KPRE 1S7WA 4MMZA 3O0RL 1HAUA 4PSPA 4DWHA 3GJFA 1J5IA 1EDHA 1UM5H 2V2XA 4ZTOH 4MGXA 4M7JL 4U1NB 1G9NL 5JW3L 3KWXA 3L3HB 4PCYA 2VLRB 2OCCB 3C08H 5I16B 1P9MA 2DB8A 1ZVYA 1FSKB 2R4RH 4N90D 4ZUVB 4Z8FH 2G3NA 2YD2A 3MZGB 4GRWF 4EE2A 4BFKA 2HG0A 3QDJD 3V4PB 4OZHE 4XHJC 2VXVH 3FB6B 4Z78A 3JWNC 2VLJE 1U3HD 1XH0A 5JXED 3FF8A 1UA3A 2XN9E 4OZGF 3DURA 5E2VH 3BE1H 4L0PB 3Q5OA 3QJVB 4WLCA 5SWZE 5HHNA 3B2DC 4BCZA 2DQHH 2X7LB 3OKOB 3F8UB 1MCOH 2XV2A 3SDAD 4IBSA 1LO5A 2IG2H 2VITA 5AYUL 3K8LA 4NI3A 4X5RA 1UCBL 1KFAH 3ORJA 4QPEA 5IGXL 5C6TH 5DUML 4QXGL 3B56A 3NFPA 3CSGA 2QMKA 2EUVA 1QFHA 2DWXA 4YZFF 3PDDA 4GUPA 4B9ZA 5HVWA 3T0DA 1J8KA 2G60H 3IM1A 4PJCB 4Y16A 2FO8A 2UZPA 4A2LA 3FB5A 1UGNA 3M1BB 4IJTA 4PB9H 4H25A 1S7XB 3CZFA 1OTUD 1CICC 3FQ2A 3D52A 1N68A 1CGYA 3NVQA 1BAGA 4ZS6C 4FGMA 4F2MB 5A2JH 3FOMA 1D5XA 1KTDB 1FFOA 2X44D 1WQVT 3FU6A 3AS1A 5F9AC 4HWZA 3MUGA 2X4UA 3IFLL 3DRTB 3IJSB 2NW3A 3S88H 2QSCL 1BFSA 5INDB 1T0OA 5G4OA 5GZNA 3EJJX 3AMKA 1ROCA 4HUCA 4P2OB 4MCYA 1MCDA 2AZUA 1JN6A 1TTGA 4FEIA 5B1JA 2CALA 2BK8A 3LCYA 3QG6A 1WFUA 1FNGB 2CJ3A 5F70A 4IBVA 3K72B 1SVCP 3VD0A 3IYLW 1NDGA 3LPWA 4D0CA 4N0CD 2NY2D 2GSIB 5L2KD 1QSED 2GTWA 4NQQA 3LEVH 1DQML 8PAZA 4KTDH 4JRXB 5DMIL 5DVMA 3TT1L 3VE0B 5MHSE 1I7RB 1UQSB 4LCWB 1Y6KR 1ZOXA 1I85A 3QFJD 3QISA 3UP1A 1WBYA 3NCYP 2HAZA 1HIMH 4PV9A 1CURA 3IMRA 3P77B 4PJBA 5HGDB 3QUHA 2EDTA 2ICEC 4ZPTB 3U9PH 4H8UA 1FL5A 4Y89A 3WIHL 3SDDC 1LL1A 3WTUA 1ZHLA 3BDBA 4OV6F 3S35L 3KJ6H 2F08A 5EO9A 1ZVSB 4IRZH 2YMXH 5FGBA 1VF5C 2WBWB 4X6BB 3LRHA 4ONGH 3T2PA 1XEUA 4KI5C 3HE7B 5FCUH 3RVVD 1SMAA 2AFNA 3E8UH 3G5VB 4N0FB 1YEGL 3B8YA 4J3TA 1NA8A 4XN9A 2EO9A 3EGDB 5LDSA 3POCA 3V52L 2KC0A 1KSRA 3STLA 4CNIA 2QADB 1NGZB 2P52A 2GCYB 3OHXA 3WG7B 3GLZA 1YYLH 3F6JA 1KNOB 5CP3A 2FWOB 3CIQA 3LRKA 5DJ0B 1R24A 3CMOL 3ECBB 2W60B 3RWCA 1NIBA 4ODBD 5B1AB 1A1NA 3WL9A 1KIRA 4CU6A 1ZD6A 2CNYA 4JFDE 4Z0BL 4HH8A 2BP8A 1TTRA 1LEKA 3SY0B 4NWTL 1UJTA 3AG2B 4KO7A 5JQHC