4BZ1A

Structure of dengue virus ediii in complex with fab 3e31
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
96
structure length
96
Chain Sequence
MCSGKFSIDKEMAETQHGTTVVKVKYEGAGAPCKVPIEIRDVNKEKVVGRIISSTPFAEYTNSVTNIELEPPFGDSYIVIGVGDSALTLHWFRKHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ENVELOPE PROTEIN
publication title Structure of Dengue Virus Ediii in Complex with Fab 3E31
rcsb
source organism Dengue virus 4
molecule tags Immune system/viral protein
total genus 14
structure length 96
sequence length 96
ec nomenclature
pdb deposition date 2013-07-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.350 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4bz1A00
4ALAC 2P5PA 5AAMC 3J2PA 4UT6A 4UTBA 3J27A 5GZNA 5JHMA 4X42A 1SVBA 2V33A 3C5XA 3MUUA 5KVGE 3N41F 1Z3RA 4GT0A 2GG1A 2R69A 2H0PA 4UTAA 3N44F 4BZ1A 4FG0A 3UZVA 1RERA 4UTCA 2R29A 5H37A 3N40F 1S6NA 4AM0Q 3UYPB 3P54A 5JHLA 5AAWC 5LBSA 3IRCA 5KVEE 3UZQB 1UZGA 4AL8C 4L5FE 2ALAA 1OANA 2JSFA 1Z66A 4GSXA 3N43F 3VTTA 3WE1A 1TG8A 5LCVA 1PJWA 1ZTXE 2HG0A 4FFZA 3N42F 5B1CA 5KVFE 4FFYA 2JQMA 3C6EA 5IREA 4BZ2A 1OK8A 2I69A 1URZA 4UT9A 5IZ7A 5GZOA 2JV6A 1OKEA 3UZEC 3UAJA 3G7TA 5KVDE 5LBVA
chains in the Genus database with same CATH superfamily
4LSQH 4V1DA 5A2BA 4ZQTA 4ZXBB 4D0BA 2YXWA 2PXYD 4JO2H 4HP5A 4JR9L 4NUGL 1DVQA 3MLXH 3V0JA 1SXBA 5JXAL 1I8MA 4F8NA 5FF6B 2IALA 5TF1H 1QPKA 5A16A 2X2UA 1NGPL 4FCHA 1AFVH 1KDJA 2BVQA 4I8DA 5JHMA 1AE6L 4B9JA 3QRLA 1M1SA 4X7DC 2JF1A 3O4LD 3QNFA 3GZPA 2BIQA 4KI1A 5KVGE 2ZSVA 2E9WA 1BGXH 3BMWA 4APQB 4I1NB 2J55A 4R4NC 2XVLA 1JGVH 2HT3D 3EUDA 1G0XA 1KC5H 4Y4HA 3TEUA 3UYRH 4TKWA 2G2RB 4MBOA 1AIFB 1G9ML 4HK0A 3CFDB 3HS0A 1BM3H 1A8ZA 1K2DA 1USZA 2N7SA 2RACA 3D2UA 2KDYA 3DV6B 3QO1A 3OMAB 4JMNA 5DS2A 5MI0B 3UBFA 3F58H 4BQCA 1D5MB 4GLRI 4PJAE 1WUZA 2EDBA 3GLDA 4FS0A 2Y5QA 4M5ZH 4J6RL 3L95B 1JF1B 3MGTB 5DURB 5J5EA 3RU8L 4OCNC 4UU9B 4CKVX 1A1NB 4MXVF 3FDWA 1NGQH 2GBAA 4PUBL 4L8BA 3GMLB 3NPZB 3EJCA 1CXKA 1OZUA 5IWLC 4KO6A 3V95A 1LMIA 4JY6B 3VCLB 5C2BL 1A6VL 3DJRA 3SKNB 2FX8L 3TBYA 2DQUH 1UACL 2MSPA 2NY5L 1NDGA 3U2SA 2R59A 2H1PH 5KAQF 5H2BB 2IGTA 2Z4TA 3FU8A 4QI3A 4MJIA 1R3IL 4IOFD 3OSVA 4AM0B 5AWNL 5I0ZA 5I1KH 5FHAH 1QUPA 4DAGL 4E9VA 1M42A 2B5IB 1LEKB 1C5DB 4IKIA 5E5MA 3QFGA 4R2GD 5FKAA 2QHRH 1FNHA 4BFOA 4LIQH 5JA9A 3JWOH 4Z7WA 4UQBA 2DWEA 1XMEB 1ZV5A 3VWKA 5ALCH 4IU2A 5IB3A 2AQRA 1FDLH 1P4IH 2J8UE 3IDYC 2FBJL 4N68A 1B0RB 3O4OC 3SGJA 4WGKA 2YJLA 4J5VA 2ZG3A 5EU3B 4ZD3H 4D0DA 4XNXH 3CWGA 3UCQA 5JIQA 4PRDB 1GJUA 1KCWA 3SY0B 1CFNA 2AK4E 3C8DA 4M8UA 1UB6A 1CF8H 5F2FA 4ABQA 3DDGA 3PABA 2IPTL 3ZE2B 4ETQB 4U6HA 4WFED 3HB3D 1SLWA 1L5GB 1CFTB 1IAKB 4L0YA 1VERA 2PCPA 3L54A 1BZOA 2O5XL 1QUNA 4FABH 1XEUA 1OPOA 4KKCD 4WJ5A 1XB6A 4MSWB 2ISDA 3DTUB 1B0GA 2P7TA 1UH2A 2DM4A 4MFHA 4L3EE 2K0RA 3PUCA 4IBQA 3O8XA 2DJSA 2UZXA 4KJPC 5D6CA 3WFBL 1DVSA 3ZQWA 3TVMC 1CLVA 2XHNA 4NKQB 1E6OL 4NQSB 4OCXH 3FH7A 3MNWB 4O5LL 4LCIL 3ABGA 4APXB 1CI5A 3RP1A 1FLRL 1PZ5B 4Y1AE 5JIMA 1L9MA 1DFBH 4PPTA 3AU0A 4PGZA 3TH4T 2WSDA 4NC2B 4A7TA 3KPRD 5EOCH 2HLEB 3ZMRA 1HKLH 4RWYH 3O6ML 1WS8A 3NIGF 2NTSP 4U0RC 3EJZD 1XVSA 3M8OH 4GS7C 2Y6SD 4WDIA 4M03A 4YL9A 2AEQL 1BLNA 1QBAA 1TENA 1UENA 3BUIA 4ICXA 1JZIA 2F53E 1IBGL 3QUKA 3AAZA 3ORJA 1KTKE 5D70H 1IQWL 1DLFH 4HDIB 1WK0A 3MACH 3TNNA 3QUMH 4IMLA 3IVKB 5HGAB 4HMDA 2DJMA 4PAZA 3WSQL 3MMEB 1FCCA 2NR6C 2WLZA 2R39A 4GW4B 4J3OG 2FEEI 4R0LA 3E6FB 2ZG2A 1HCFX 1NIBA 3BOVA 3NZSA 3GXIA 4KBPA 2DKUA 3J07A 5EOQH 1XIWA 5F7DA 5B8CC 1YAIA 5BXFB 5KVEE 2AXGA 3UTSA 3VXRA 4HCFA 4P07A 4WUKH 4M3JA 3F12B 3T6XA 5BS0D 1NEZG 3RIFK 4UTAL 5JW3L 3G6JF 1HL9A 3ZMEA 3HFML 4HAFA 5EPMB 5FYJL 1T6WA 2XWJA 2VXUL 3N0AA 4AJ0A 1KT2A 4HT1H 4X6EB 2ZQKA 3WN5B 1GJIA 3BPLB 2NY4D 4U4IA 1XL6A 1NBZA 4EAEA 1BF5A 2MIZA 2X4QA 4K3EL 3QI9D 3KWXA 3LPOA 4U1SB 3IFOB 2G9HB 1AYRA 3OAZH 4UT6H 2WLJA 1KXQE 2EC8A 2E86A 5HVWA 4AGOA 4HD5A 3N42B 3VXTA 1N6QH 4L5FL 3FT3B 4OFYA 5J3HD 3ARFC 4LHQB 1ZGLA 5CZKA 3B8YA 4MKMA 4L23A 3V4UH 1EX0A 1YMMD 3CH1A 2NPLX 4JO3L 3ARBC 5HVHB 4TOYH 2VLJD 3UZEC 2J1ZA 5AVXB 1TQVA 1Q72H 2H4EA 2XWXA 4DGVL 4ODTL 3UPAA 4P57A 5C0GA 2FYYB 3VSUA 2XDHA 4NP4H 1AD9B 4PJHE 3TIDA 1FL3B 3HG1B 4MB1A 4LCWD 3FU9A 2YXFA 4YBLC 2JCCE 4FF9A 4X4ME 2LT9A 1JNJA 1HNGA 1AIZA 2R51A 3KXFD 4XAKD 2IWKA 3NDZE 2WQXA 2QVMA 3M46A 2AV7B 4PTTB 2BXYA 4YN3A 3VA6A 1HQ4A 2E9IA 3ZOAA 1NC4B 1EAJA 1DN0B 3VE0B 4KTEH 2F18A 1T7ZA 5KBPA 5BJTB 5KVFH 3VNZA 4QT5B 3BXNA 3ZIYA 3VD0A 2ADYA 3MXWH 4JG1H 1P6WA 2BDNL 3SKOB 3ZDYF 2BNQA 5GS1B 3CFEB 1PS3A 4EN3B 3ZHDA 3RIFF 3QC6X 3TO4D 3VWJA 5IFJA 4OI7A 1CUOA 2G0KA 1WISA 4G1EB 4O2CA 1I31A 3CZSA 4PGBB 1M7IB 1IGYA 4LVNC 1GGTA 4PJ7A 3WUZA 4CN4A 2PYEE 4MAYD 1ZS8B 3LIZH 3RY6A 4Z7AA 5EBMB 4MMZA 3ML9A 4AM0Q 1LYQA 4LLWB 1AJ7H 1HQRB 4Y88A 2YD3A 4RGOH 4KZEH 1S5HA 3OQRA 4UV7L 5IR1B 1J87A 1REIA 2JIXB 2P80A 1NFDF 4QHKI 4AJYV 4YC2C 3JUYA 2BIOA 1XDTT 2CIKB 3WFEH 4J3OF 2DOCA 4JANA 3MROB 3FMGH 5HGBB 1AHMA 2X4RA 1NDTA 5EORL 2AQ1A 1IJNA 4NT6B 1FF5A 1Q9OA 4R7XA 4DW2H 4ORGB 4Q0XH 2R0KL 2ZX9A 4GI8A 5E1QA 2W07A 3FRPA 3GS7A 3EJRA 5C09B 5G2NA 4LLAA 4ZPTA 3VGFA 4KY1H 5I66A 4HHAA 1H8OA 3O3EA 4APQD 5E1GA 5MERB 1AP2B 1E43A 3BPCA 2FX7H 3LRGA 2HVBA 3VMOA 1CLOL 1A47A 3BVNB 3ETSA 5IM7B 1V5JA 1MHHB 2NSMA 3MBEA 4RNRB 1Z9MA 35C8H 4U4BA 5IMKA 4HF5L 5BV7B 1WD9A 2VDQL 5I1DB 5HDQH 4K5OA 4PHXA 4LNVA 2Y72A 3R0MA 4Y4FC 1QR1A 3WKNA 4BDVB 43C9B 3L7FB 1N4XH 5IMOB 1UA6L 4JQVA 4X9GA 5FYKH 4JFEB 1E6JL 3W3BA 1VFOA 3PP3H 3MRFA 4MYWB 1IC5H 5DEFB 3NFNA 2PUQT 3HG2A 1MQKH 3P3UA 1HILA 1NC2A 2G60H 2K6ZA 5HYSG 2YAFA 1ZAGA 3GKZA 3WNLA 1GH7A 3J8F7 3GSUB 1HINH 3ILQC 3KHOA 1D6EA 3PP4L 2AZAA 3KYAA 3B9KB 3K1KC 1N59B 4B9FA 3N55A 5DQDH 2A9DA 2YLKA 5BO1H 2O5YL 1KF9B 2IH1A 4ZTPL 2ATKA 4F2MB 4OSUH 1PG7X 2FSEB 4XPFH 4KH2A 4WO0A 4OZIB 2TRYA 3IFLH 1R3KA 5E1AB 3ZT7A 4YHYB 4MA8L 4NERA 1WBYB 4WNQA 4P3DB 3PU7A 2OX5A 4LCUA 2LAGB 5B21A 2J21A 1TF4A 2VMCA 2YPVH 1F58L 4XMUA 5SWZE 1NCDL 4QO1B 3HZVB 3RJOA 3HMXH 4QY8A 4FZ8L 2IV9A 2EDNA 4NHCH 4ODWB 1JNLL 1KV3A 4YDKL 4OZHA 2QPDB 3JTBA 1OLLA 2WNGA 2V3FA 2KLSA 2NY3C 3MCKB 3NOIA 3FFCE 1E5YA 1S3KH 1F90L 5MEOB 5C8JB 3CZUB 3WIHA 1GS8A 3S8FB 3R06A 1OTSD 4OZGE 1SOQA 5IQMA 4LNRB 1S7QA 3CXFA 2DPKA 2AAVA 3IXAA 4XN5A 3MCYA 3OSKA 4LKXA 5FA3A 3BZEB 3VX0A 2PW1A 1BWMA 3ETBF 4B97A 1X9LA 2K9FB 3D8MA 1DBML 2MEJB 1JZFA 1ADQL 1SM3H 2W88A 3HVNA 3CHQA 3NSDA 2Y1ZA 5JPMA 4S0HA 1JRHH 3SQBA 2TAAA 4NN7B 2J20A 4LSSL 3DURB 4LBEB 2Y3NA 4F92B 2P8PB 3OAUL 3P11H 5F1NA 2NUTB 3WS3A 5KN5A 5LCVA 1C7TA 3K91A 3QT2A 3RDTA 2GFBA 1KCSH 5L4IA 4Z3GA 4NQEA 2XFGB 4XOAA 2ZOOA 2C3HA 3LMJL 3PLYA 5MEQB 4ZDHB 4R26H 4KGLA 5JO5B 3HG3A 2XZCH 5HVGB 1BQLH 2WQAA 1YMHB 3DDFA 4P8QA 1EDQA 1KBKA 2UYLA 3DX9B 4CW1B 1KCBA 2K8QA 5DR5L 2M83A 4LSPH 5GHWH 1M4KA 1TTFA 2OQJB 2KPWA 3IJSA 1WBZA 3KWUA 2YFNA 4DWHA 4H40A 4Y4KC 2ZKWA 5GJTH 2Z7WA 2J6EL 3D4GA 2J1KA 4LQFH 1VESA 3RVXC 1FO0H 1FFNA 1J12A 4JGNA 4QAWA 2WXLA 1SXCA 5FKPB 4OU3A 1QRNB 3O2VH 5IHUH 5CFAA 5ETUA 1D5RA 1R5VA 1P5UB 4UV4L 4AL8L 3EADA 5J6GA 4FA6A 1W0VB 3JWNC 4WW2A 1KULA 3T4YA 1I8IB 5E9AA 1NUNB 1IEBB 3RYMA 1MHPH 3RNQB 1MFNA 2BIHA 4ZFZA 1LO2H 3PPEA 1IE4A 3H6JA 2YSSB 3AGVA 1A7NH 1MCNA 1WA1X 1YJDC 3AC0A 4KHTL 5DD0L 4AZ8A 1O6TA 5FC9A 4OFIA 2KH2B 2X4OA 5B38A 2OMWA 4TUOB 4LOUD 1WT5A 5FWRA 5EIIB 5F97E 3S35H 4Q97A 1GZPB 5FO8B 2VJXA 1FH5H 2C8NA 4UB0H 3GMNB 1EZSA 4H13C 4BKSC 4HWEH 3FUJA 5FYLD 1BOYA 1T20A 4JN2B 1AGBA 4JFHD 3UIYA 2RQEA 3HG1D 3WIIH 1SUHA 2YAMA 4TUJB 3CQFA 4HLZH 1I8KA 1Q9KB 3B6SA 3HPJB 3P1VA 4QRFA 5D1QB 3Q5TA 5EBGA 5ADPH 2PR4L 1TJIL 2MPVA 3NCJL 3TV3H 4JFFE 3HE6C 1UZ8A 3CVIH 4RBPK 3FTVA 3L9RB 3O3AA 1ONQA 3MV9D 4NX0A 1SN5A 1OOWA 3BDBA 3FB7A 4HUVA 1DQMH 1T1WA 5E7BA 2FT8A 5IW1A 4FXKA 4JMXA 3ECWA 5HHPA 1J1PL 2GUOB 1KENL 1E3FA 2AW2A 1FZKB 1HI6A 3CSPA 4M4RB 2MNJB 2MQ3A 3IDUA 4EN3D 1G4MA 1ZTXE 3LKRB 3L4UA 3KPQA 2BY0A 1C5CH 3IFNH 1MVUA 3VRJB 4IBZA 4GMSH 3UO8B 3GIVB 1GS7A 3S3CB 2XIBA 4F9LA 3P2TA 2NDGA 4Q74A 1H3PL 3W82A 5DUMH 3OAWA 3MV8E 1ZVHA 1KOAA 1W72H 2FNBA 1XB3A 1MG2C 1YEFL 2IADA 4QRUA 5J13C 2A77L 4UT9A 3SGKA 1B9KA 4NAQA 1GGCL 1F11A 1RJZA 4HAKA 1DVFC 1SHWA 1AOZA 3FB5B 4UF7C 5AYUL 4KZCA 5IOKA 1LVEA 2JIXD 4YGVB 3QUYC 4JFQB 3S88H 1B2WH 1HXYB 3VW3H 2HX7A 4H0GA 2ZCLH 4JRYE 3EO0A 3QXAB 4HWBA 4IU3A 1UVQA 2VM9A 1DDTA 4M48L 4V1DE 3LY6A 2X4UA 3MRPB 2AJ3A 1LP9F 2KYIA 3PJSA 1OT2A 1CL7H 1Q9WA 2HKFL 3C2SA 3DRQB 1ESOA 3NJXA 4JRXA 5C09D 1MN4A 3OKKB 3RWJB 3ZDXB 3PGDB 3TYGL 3VI3B 1XF1A 4HZLB 2BRQA 1MLCA 3ELAT 4LKCA 2IANA 1PY9A 4ORZC 5DI8A 4GPVA 1J8HE 1LGVA 2HKAA 4QEGA 2HWZH 3DO7B 1Z0MA 1PX8A 3RZCD 1LO4H 4EUPH 5TGBA 3L3IB 5I30H 3VMPA 3VD3A 1QEXA 3W37A 4GG6B 5L0QC 5GJSL 4IGBC 3VFWB 4FMVA 4MJ6B 1GY2A 2YD6A 2OYPA 3GK8H 1H15B 2V8MA 4PVLA 4FG0A 5C3TA 3UO1H 4C57C 3HC0B 1BIHA 4JFED 2BJML 3NFPB 5C07E 1EEZB 4L8SB 1HHHB 4UZUA 3IGKA 1TYJA 3FH5A 2K4AA 3FQ1A 2CBTA 4K23H 3TL5A 2RFXA 4N6RB 1KJMB 2F08A 3G6AA 1BCIA 1EVUA 1BAGA 3NSCA 3RX9A 5EF2A 3US1A 3BP6B 5IVXE 3PQYA 3U4BH 3B9KD 4EI5D 1VFMA 4ERSL 3D48R 1JDDA 1SMAA 2FH6A 4KU1A 5DO8A 3F7YB 3H56A 3PDOA 2WWKO 1LEGA 4OZFH 4RX4D 3FB6A 4XP4H 5ECJE 1Z9PA 2XUWA 3NJMA 3K2UH 1MCFA 1KPRB 2DQTH 4XC3L 5LXVA 1INEH 1XSIA 1X5MA 1AI1H 1DQIA 2VDKL 3AB0B 3VTTA 2OSLA 2FT7A 2R69H 5FYJD 1AYOA 1NAML 5HHNA 5IMMA 5HDBE 3TZVA 2GT9A 4MQXD 4L4TA 5EBWB 4DVRH 1D5BA 1FL5A 4I0PC 2FIKA 1IGCL 2BVTA 2UXGA 1JGLL 2VN3A 1F18A 4KNSA 2WK2A 3H3BC 1NUDA 1WCQA 4QXVA 1IT9L 4R83A 1QLFB 3G5YB 5DK2B 3GM0A 3LZQA 4F33A 5JR1H 1CBJA 2YAQA 4JFZH 1V10A 3HNTL 4KDTA 5F7WC 3TN0C 3QEHB 3JYCA 3JWNH 4FTVB 4XGZA 5IB4A 3GM8A 3T0ED 2A6IA 4WK4B 2XWRA 1QA9B 2YMTA 3ASNB 1IFRA 3CQQA 3MRDA 2NNCA 3BJ91 3P3TA 5IMLA 3QR0A 3VTAA 2ENYA 1UTDA 5CKGA 3Q6FA 2KBGA 5DRZA 2BHFA 3O41B 3X11A 3GSVA 1UWEH 3H4FA 2ZXGA 1NMBH 3QO0B 4XNUL 4BSVA 1HU8A 1BJMA 1NCIA 2FO4B 2G3XA 3QUXB 1WPCA 5H4YA 4RZCA 4RGMC 3MO1B 1BV8A 2B1HH 3K46A 3PAVA 5IBLD 1GAFL 3L7EA 1OWWA 1RK0A 3BWUF 3V9EA 5IOPB 3VG9C 1SVBA 3I3DA 2P5WE 5CR8A 3DO4A 2GI7A 1OSZA 1SY6A 4TVPH 1UD2A 3PJNA 1FSKB 1BD2A 4JM2A 1G6RA 3BSGA 5KBKA 2YPKB 4Y4HC 3VGAB 4PR5B 1QI3A 2I32A 4JFDE 4BGLA 1NKOA 2APBA 2FECI 3IPEA 4S1DC 5ANMB 2APTA 1I1FA 4AK1A 1LO5A 4PY8J 1A6ZA 4UOZA 4I3RH 2CKBH 3FCSA 4I3SH 3V4PL 4YSTA 4J2XA 1BLIA 5HPMB 4XN1A 1PZDA 2CU9A 4AH2B 4HS3B 2B77A 3N04A 4WTQA 4F24A 3BVDB 2OP4L 1S9YA 2X9ZA 1OGTB 5DEZA 5AYQA 4U1KA 3WEAA 1KIUA 5D7IB 3UMNA 3TBSB 1KFGA 4TNWK 4MNGB 1RK1A 4XBEL 1JD7A 3MLSH 5CCKH 3UCRA 4G2AA 2NNFA 3UJJL 4RQQA 2CDGB 3GKWH 2Y4SA 5DJXB 5EUOA 2APFA 4HSCX 5DEGB 5TE7L 3VXSB 4QRQA 2NZ9C 5I2IA 1YYMH 1NDMA 3DHMA 4XMTA 3UTSE 1EHXA 1DBKH 1QRND 5HY9B 4HIXL 5T1LA 3T3PB 3EYSL 4XN7A 1IGJA 2DTML 4FLRA 4LVOC 5I1EH 1MI5B 2OMNA 1GPOH 1X4ZA 1GMEA 4AT6A 1I8LA 3KPNB 1MPAL 2BFVL 4N0UB 3NN8B 1QW9A 4WEUD 2C4FT 4D94A 2F54A 5C92A 4G6KH 3SGJC 1K8IB 1NH6A 3Q9PA 4OKVB 1MRCH 2Y0SA 5SV4A 3P3RA 3VU2A 5IFAH 2AMUA 1ZDQA 1NZRA 4DZ8B 2Y06L 4XN4A 3HJEA 5E8NB 2HMIC 1CDHA 2VL4A 5IREA 1QSEB 5T1KD 3KM1A 2YD1A 3LZRA 3KJ4C 4XVTH 3MDJA 5D72H 4K9EL 3V4VH 3FTUA 3OGCA 4JZJA 3BIKA 3U4EB 5EF3A 3EAKA 4AQEB 1NL0H 3F2LA 1W0WB 1J8KA 1EUUA 1CLYH 2I9LB 3V5HB 2JJVA 5DS8A 1J88A 1IB5A 4HWZB 1M7DB 5D1QD 1FPTH 1O6VA 3O8XC 2Y7SA 4OLWL 5E6UB 2NUPA 4WWID 4XCNB 1T1YA 2EDXA 2CRYA 3X13B 3SDXB 2X53A 4M43H 2EIMB 5T33H 5FUZH 5DK0B 3VH8B 2OMZA 2QTVA 3OKNB 3BWSA 3LPGA 4TNWF 2NXYC 2E7LC 4G6AD 3ARDB 2CNYA 1MVYA 1KSRA 4ZUWB 1WFJA 2DF3A 3RNKB 1U4FA 2ARJA 3OX8A 3GSQA 2AK1L 5C0FA 1OP5H 5JHDB 1F41A 1I7UA 2CRIA 3NG5A 4WFGE 3BCDA 2PPFA 2BNQE 2VDRL 2VR5A 4HOXA 4PJHF 3JVFC 4OLXH 4MNQB 4PJBB 2VW6A 2VOTA 4PI0A 3V6ZA 4PJ8B 3H3PH 4ATWA 5C9KA 1GGBL 2UY6A 1E5UI 4ZS7L 2WYHA 3MR9B 4AEHH 2FR4B 4HKXA 4ODXB 3L08A 3WUWA 2W0FA 3ATFA 2IBZX 3N3EA 4GRWH 4R0LC 4DUWA 4MS8C 5IIEB 3WKMH 1U8QB 4X7EC 1VPOL 1XIWC 3MRMA 4CMMA 2AQ3A 4R7NB 2VMFA 5KVMC 4LPYA 1KB5H 5J06A 5GRVK 1MCPH 1KLUB 2D03L 2H45A 2D8KA 1N12A 2VXVH 2HRPH 2VDML 3NABH 4LESA 4YSEA 1VADB 4U1IA 2ZKMX 2CHZA 4ALAL 2KUTA 1QBLL 4OLEA 4EI0A 5BVJA 1RK7A 1MIMH 4H0HB 2DQIL 2Z35A 3F3HA 2CIIB 1QZ1A 1NCUA 5G5DA 5K9JL 1MWAA 3DX4A 1TG8A 5AW7B 5JW4Q 4HKBB 4CVZA 3KCPB 4Z78B 5D7SH 3EFFB 4C4BA 2V2TA 3CE1A 5L9DL 4H8WC 4Y5XB 4DESA 5EOCJ 1O9ZA 1KJVA 1PEZA 2XV2A 3WS6A 4WU5A 2MCG1 5JPNB 1BZ9A 1RZ8A 1UUSA 1YCSA 4LP4A 1A02N 1X6NA 2MFNA 2X3CA 4TVUA 4NNXA 5JMOC 4WJG3 2DBLL 2YUVA 2FBOJ 1O75A 3IDMA 5I8OH 1T4KA 3MGOA 1G7MA 4YXKH 1TZIA 2W9DL 4M7LH 4Q6YA 4MJ5A 3UBXB 4NQDE 2WLLB 3IU3B 3QIUB 3G5XB 5A2AA 2YD8A 1CXLA 2J1YA 4PVBA 3QHFL 2ADJB 1OGAA 2K7PA 5ICZA 1VGKA 3SJVB 1N3NA 1QTYT 2WLIA 3HZ3A 2HZHA 4YXHH 4HZ1A 4FI7A 3QJZA 4XT1C 1MLBB 3QCTL 5IQ7L 5SWSE 4ENZA 1BZEA 2H0EA 3TT1L 1RZJL 4FQ1L 5I8KH 3KPSB 1RFDL 3EDDA 1OSPH 1CURA 1OW0A 3DRTB 4J3WA 1A4JB 3BSZH 4BFNA 1EHKB 3MRBA 3IWUA 3PGFH 1MEXL 2EYRA 1DANT 3FXIC 4X5PA 5DFAA 5E8PB 2O6CA 4WUUA 2FZ3B 3HJ0A 1MCCA 3EDJA 1S4IA 3F6IA 1JUFB 3DECA 3MNZA 2P9RA 4I1PA 1NKRA 5HGGS 4Z0BL 1NCCL 4LMQE 4NWUH 3VWJC 2GJ6B 5L88L 2WUBH 5AD0A 2OMYB 1JZ6A 1OLZA 3L9EA 1MFDL 4MA3A 2JELH 2FB4L 4Q8BA 2ESVB 2BO0A 2DYSB 1R4XA 4FTVD 4KAQH 4F7PB 2GSIB 5I15L 2R29A 1PF3A 4QLWA 3FOMA 3SO3C 1A6TA 5CWSB 4MMZC 5GGUB 4X0KB 4J4PC 1UQSB 2CPCA 2WLHA 3O2WH 2XZQH 5AOJA 4I18B 1ZWIA 5I71B 1QYGL 1OD7A 2KDGA 4KKBD 2R1XA 5I82A 4UYQA 1RZFH 3QUXD 4XH2B 1WGVA 1G7PB 4XN9A 3TH3T 1KYOK 1D7DA 5AKSA 3B7UX 4IBYA 5DSCA 5EU4A 2VMEA 3S35X 2DLHA 1UGNA 5DJAA 4G80A 5HYFA 1JZ4A 3U6XS 2QMKA 3A5VA 4JGUA 1A4AA 2Q3XA 4PWIA 5EZOH 1OAZL 2GPZA 2NX5B 5IV2A 4F8LA 4PRIE 1XF3B 2YRLA 4PB9L 3SCMA 2G5BA 3OPUA 3W39B 5E2UH 3TCLA 2XN2A 2CJSA 2IGFL 1KLFB 4V2CB 5I1HH 4TYUA 4OZGF 3WTWA 3GMRA 3B2XA 4LSUL 1BYNA 3OTTA 3UYPA 4JDTL 3D1MC 4FJ6A 5MEPB 2NCMA 2D4FA 3T3MB 4JQVC 5A43C 2WBKA 3PPSA 4XO9A 1XGUB 5AVTB 4YH6A 3ULVC 2BIPA 1P9MA 4XOBA 5I16B 1LLAA 2QKIB 1E9PA 5IROC 4IS6A 4Z7OB 4H1LH 4KK6D 1F13A 2R9HD 1U8OA 3UAJA 1CFQA 1ETZA 2X70A 3N1PC 1FORH 5EC2A 3MZGB 2ED8A 1VRSA 4ZOEA 4U1JA 3ZE0B 3RUGB 3LQZA 5EF1A 3U6XA 2CZNA 5HHOE 3I9GH 3KGUA 4FFVC 4XOEA 3ZVVA 3LKOB 5J6SA 3DETD 1L6PA 1UKTA 4YHNB 4O00A 2VLRA 3CFCL 3I50L 3KPMA 4POZD 4WTZG 3L1GA 3QAZC 4XAWH 4DZBA 4DN4L 3QJXA 3QDAA 1EZLA 2PPAA 4NFCA 4LPCA 4LE8A 3AREC 3GMPA 4WKZA 3FCGA 4MCYB 1BW8A 4KITB 2OXGA 5FDYA 4X7SL 4PRBB 2BVOB 3O3DB 3UROR 1IGMH 3C08L 2VXTL 4GMTH 4QRPB 1IAMA 3FFDA 1OTUC 1J0ZA 1WFUA 2XA8L 1J0JA 4NCC2 2VQ4A 2C9XA 5TDPB 4KKLD 2QADB 4PRHD 5JXED 5DHYB 3IDYB 2R56H 1NMAH 2X38A 5I17A 3HI6L 2YQBA 4H8WH 5C3IA 1L3WA 2VRAA 1HN1A 2HG5B 3BEVB 2CJ3A 4WEBL 1S46A 1YEGL 1IL1B 2X42A 1XV8A 4Z7VB 3P9MA 2NYKA 3PL6B 2UUDK 2WJ5A 2XFXB 2ZONA 4LEXL 4P4KA 3QISA 2IDQA 3X12B 1X5KA 5C0JB 1XF4B 3SZKC 4JQIA 5HJDA 3ARDD 2XZAH 3NSFA 3H9HA 3U83A 5B1AB 1ZHNA 1K8DA 2PXYA 2MNUA 4H44C 3W0WA 4KJYB 1VHPA 3RDTC 4QUOA 4P04A 2VZ1A 3MRRB 3S4SB 3AROA 4FNRA 4JL2A 4UUJB 5JHDD 5KSAA 3I3BA 1AQHA 2LQRA 2RALA 4J1UA 3LH2H 3QEQE 4QHUB 3O4LA 4XNBA 3RL1B 4PJXA 3WFHB 4F1ZA 5C70A 3P4NA 4UT7L 1V7NL 3QQ4A 4PJ8D 3GB7A 3W56A 1KBGH 3D25A 3P40A 4UIMB 1KYAA 1JTTA 4UQ9A 4KQ0A 2EVHA 1DO6A 5F93C 5E6RB 3VGBA 1UWGL 4HBQA 4M5TA 4N1EA 1FBIH 1YSOA 5K9QI 4NLHA 1FN4A 3BZ4A 3B7SA 3S8GB 4GS7B 3FTGA 2AI0H 3KW8A 3HOGA 4PJAB 1A4KA 4KUCF 3D51A 3ZL4H 3DK0A 4IW4C 5GGRB 2M8XA 2HLAB 1OARL 1DQDH 4L8CB 4AYFB 2IO5A 1XGYH 4XP5L 3IJYB 4S1QH 3VD2A 2X0WA 2A5UA 4RRPA 1YEJH 4P23D 2H2PD 5DRNA 5FR3A 1S5IH 3VFRA 1TTBA 4OUUB 4B0MB 4WI4A 1I1CA 2C9PA 3GJFA 3LKQA 5HYJE 2F8OA 1K6QL 4GIOA 4XPGL 2CMRH 1EH9A 2ZUVA 2WKGA 4FZEH 4I48A 5DZAA 1XF5A 3DIFB 2O6PA 3BDYH 1TZ8A 1RIHH 5HHMD 3DX2A 3W5MA 2ED9A 2B8OT 3W11C 4AVKA 3OKEB 4PV1C 3FCUB 4L2LA 2VW7A 2JJTA 3LPWA 3DUUB 1AQKL 1UA7A 1IIIA 3MLUL 2BP8A 5BVPL 2XQBL 4JDZA 4PJEA 3L5HA 1BHGA 2EEXA 4IRSA 3VGDA 3PWUA 1TTRA 2EDHA 4FFTA 3G08A 1LTXA 4FQQB 3FQWA 3SJVD 3NJJA 1Y6MR 5EG6C 4CN6A 1ZLWH 4LGPB 3FSAA 4A2GA 4JO1L 4LCCC 5DF0A 3KWWB 4NKIL 1F4YH 5JUEH 1TEGA 4GAYA 4Q52A 3DC0A 4X6DE 1XCQB 1QKZH 4YBQC 1SBSH 1YPZA 1WAAE 1HYSD 1SJEB 4GSXA 3CCHB 4J8QA 1DDHA 2JI3A 4I5BB 1Z1WA 4YBLB 1U58A 4YVUA 4XZUA 1U8NA 5AW9B 3OZ9L 3QS3A 2EDWA 2WC7A 4L4TE 1TMCB 2PCFA 2Q86A 4F9LC 3BWAB 4CDHA 1J0YA 3U4KA 4Y8AA 2F5AL 1Y6KR 4ELMA 3CGTA 5IVXF 1T5WB 1OB1A 1TU2B 1N2RA 3KPRA 1YC7A 1I3GL 3NCYP 4CVUA 5J11C 5B7EA 1PKQA 4ZTEA 1JTOA 5D9SB 4GLRH 5L7XL 4N0FB 2Z31C 4KVNH 4EIZC 1ZIAA 1NGWA 5GRVL 4PJFA 3BFOA 3QWOA 2CJUL 3L3KA 1OAUH 5IJBC 3GMMB 4LHUG 4QOKD 5ITFA 2Y7OA 1M7XA 1C12A 1FO0B 1NJ9A 1UCBH 3OB0K 3QJSB 2OL3B 3V0HA 4GY4A 5HDBF 2A4EA 3AWGA 2AABH 4WQOA 3U46A 2J8HA 2VN5A 3MLWL 2WXOA 5E8DH 3MFFA 4MA7H 3WIHH 5CEZD 3LOWA 3NACL 4FFYL 3ZDZB 3CN3A 4XCFL 3US0A 2NX5D 1KYDA 3HUJE 1CE1H 3NZHL 2BM3A 4PS4L 2QGBA 5IW6B 1QTSA 1F3DH 3HNSL 4UDUB 5BS0A 2ZUTA 1V3JA 2D9CA 1U8IB 1T83A 4ZO6A 2WBJD 1BD2E 3NRFA 4XCYA 3I85A 4QJ3B 1DQLL 3L2MA 2BH0A 4A2EA 3C6LB 5KJRL 4AC2A 4GSDL 1ROCA 1CYXA 1Y0LA 1HH6B 2J5LC 4JHUA 3ZTJG 2EO7A 5DRWA 3CNKA 2ROXA 1J5IA 1G0DA 1XSJA 1XO8A 4M1DH 5ERWB 4D9LH 1IC7H 3QI9A 1TVBA 4HUUB 4HXBL 4R97B 2DS4A 3IJEA 4ZMAT 2X1WL 1IC4H 5DQJB 3HKZA 1EZVX 1K4CA 1RLBA 5E56A 4D8PA 1SPDA 3QUHA 4XVUD 4U6XA 3HS8A 4R3SA 5DT1H 5EA0H 4OI9A 5F7HA 1C5BH 4UOW1 5D7LA 1H0DA 3WXWL 5IKCB 1DBJH 1YMMA 3I2CH 1B4LA 4PJDA 3IXTA 2VLJA 3GPEA 4L4VE 3VXUB 1JYNA 3S2AA 1B0WA 4P2QD 4FG6C 3SPCA 1BREA 3OLEA 1ZK5A 3Q2CA 2B4CH 4WFFE 2JCCB 5CD3A 4YUEL 4CSZA 4LCWA 2UWEF 2IOIA 3UACA 1YZZA 2IDCA 4A55A 4XP1L 3KXFA 1BQHB 1GYUA 5BV7L 3FONA 1HTYA 1OCWL 2OFQA 2W94A 4B5EA 1ZHLA 2D3LA 1E28A 1G4RA 3ATEA 5FWQA 4ONGH 4FNUA 4C8XA 4OIIH 1DQTA 5I1LB 4KDTC 3MRHB 3O9WA 3QDJD 5CP3H 3MNVB 3A4AA 5F9OL 2QADD 4JPIA 2VZVA 3TLRA 1Y18B 2OTPA 2WJ7A 1R5IB 3B83A 2DQEL 5IB1B 3RB5A 3MOBH 2JV6A 3BP7B 4UOJA 1MQ8A 1U93A 2VDNL 3AT8A 3TO4A 3T4AA 3KYOB 3T71A 2XKNA 5AKVA 4OM0H 3BUYA 3CUPB 2XT1B 1P4BH 4FHKA 2N01B 4MAYA 3DV4A 3LRHA 1WP6A 3T6WA 5B7MA 1WCBA 3BLBA 3U0PB 3T8MA 1EJFA 3PL6D 5IEHB 5DJ2A 4XXWA 3QWRD 1WGOA 3EGDB 2EABA 4U2YA 3BLKA 3ES6B 2PP7A 2ITDB 4G6JL 5CZXD 3VDAA 1WZKA 4JRLA 4JFTA 1NBQA 1A1MB 1BAFL 4JM2C 5FF6A 5I1CL 4K7FB 3BO8A 2ZF8A 1EEQA 3ILDA 4NN5B 4OGYH 1WICA 3P4LA 5CLYA 4DCQA 1WFIA 3BAIA 2H32H 1EZUA 2FWSA 4APQA 3C9NA 3K71B 2EH8L 4DFHA 2CGRL 1WO2A 1J5HA 4NKDB 1A6UL 3LDBC 4N1CA 2G2RA 2JNZA 4KWUA 4X8CA 3V4LA 3MV7B 4OJCA 1RSYA 5ANHA 4KKAC 3MRGA 2VQ1A 1XXFC 2NY7H 1MAMH 3KWVA 2B2XH 3SE9H 2EDRA 3EGSA 5DUBA 1J86A 1RVFH 8FABB 3L95A 3MGTA 4HJGA 2XVBA 3BZDA 4Z3HA 4NNPH 2AFNA 3UJTH 2D9QB 5C0RL 4B95C 1JHLH 3KCWA 1W9XA 4HJIA 1CT8B 1JMXA 3LVEA 3OD3A 4ODVL 3T2LA 4OZFB 5FB8A 2YAPA 5KYXA 3JVGA 1I1YB 4UT9H 3SOBH 2P8MB 5I5JA 2J4WL 1BA9A 1YNTB 4JY6A 4HKJB 2VLLA 4LL4A 5E4EC 3L48A 4IEFB 1I8LC 4O58L 4S1RH 3QJFB 4A68A 4XVSL 3SPGA 3Q8CA 5H2BA 4MTMA 4AM0A 1S9XA 4QHLA 4N2NA 2EYSA 3WNOA 2YKKA 5DJYB 2OR8A 1EANA 2A99A 2HVKB 1XGTA 4JKWA 5I1IH 1ZTXL 1J48A 4D7PA 4HETA 2WN2A 3RTQC 4RFEB 3GSNA 1VFBA 3O0RL 1KELH 4IHBA 1NLDH 1JVLA 4W4OC 3OM3B 3MXVL 4JZJC 4E41E 2YD9A 5CLXA 5TH2B 2IFGA 3ZQXA 3WEOA 4NCC1 1I75A 2AK4D 1U4EA 2V17L 1OAJA 2A7BA 2E9JA 3X1NA 25C8L 4PRPE 2RCSL 3FYIB 4PS7A 1NGXB 2EIZA 5KW9L 3QVAA 2BY1A 1JFQH 5I74B 3ZKMC 3FO2A 2A9NH 3VFPB 4M9PA 4HS6A 5DLML 4Z0XA 4PJIE 1P2CA 3EO9L 3RVUD 1OGAE 1KIQA 2DIAA 1R0AL 3X14A 1ZK9A 3R4DA 2H0JA 4LSRH 5J57B 1DJXA 3HHMA 5JHLL 4YWGL 3Q2WA 1MRDL 5C08E 1LO3H 2Z92A 4LF3B 3BAEH 3WYRA 4L3ED 1HDMA 3J2PA 2P8LB 1G1KA 1CIDA 3KPOA 3EOBA 1E30A 5KSVA 1UOVA 2A6KA 2R0WL 2V33A 3S3BB 2W60B 4Z8FH 1Q0XL 3MNWA 1NINA 1INDL 1MFBL 1SDDB 4Y1AD 4B6ZA 3FZUC 4APXA 1HIMH 4FMKA 5CD5D 5E70A 5TJWK 3UABA 4M7JH 2CKBB 3U0WH 2CRMA 2H41A 3UTZA 5ES4B 2YGPA 2YD4A 1FFQA 3JBG7 2DQDH 3MA9H 1PAMA 3Q0HA 3KLDA 5FW6A 2D0HA 1XZ0A 3LXUX 5FO9B 1BXXA 3RBGA 4AIZB 1UJ3B 5CLTA 1XGRA 4EI6A 1IEHA 4HEPA 3G9AB 1YY9D 2F53D 4Z7UE 5H37A 1PDKB 4RMRA 3BEWB 2JXMB 1D5IH 2WZ5A 4G8EB 3RGVD 2IC2A 4RMVA 4WW1A 4YDIL 1CPUA 2Z1KA 4D0CA 3PXJA 3NSXA 1I9RL 2WO3B 2AEPL 5TTRA 5BRPA 2AGJL 4KMQA 4IBTA 3MMEA 1KXHA 2BCKA 4GW4A 3RX7A 1DVFB 3E6FA 2A9CA 3S5LG 4WO4A 2EUXA 3QH3B 3NFSL 2FEDD 3WBDA 4HUKB 3HBQA 1DBBH 5IQ9A 5EU6E 5DJ6B 3F12A 3N43F 3QXDB 3V2AR 3GWJA 2I7OA 2OMUB 2VWEC 1AR2A 2WQ8A 4OQTA 3N85L 2GTZB 4MXQD 2AV1B 3H9SB 2WUCL 5L4FA 5EPMA 2XQYG 3IU4H 5TDOB 3K72A 1QNZH 3C6LD 5C0EA 1I82A 4FDWA 2ZKHH 3V5KB 1THCA 3B5GA 2WZPA 5BQ7A 2MHAB 3JZYA 2WCGA 1U8PA 3C6EA 2Y9RT 2HX8A 4G6ML 1KTDB 3V4VB 4PGJA 1SY6H 4PLKD 1IZKA 1CICC 4U1SA 3RVTD 3IFOA 1X44A 2V37A 1WS7A 3QJQB 2G9HA 4R84A 1G6RH 2K78A 3CZGA 2OMTA 3BZFB 4LLVA 5E5LA 4OT1L 4Q9BA 2H8PB 5L0QB 4I0KA 4WWNA 1TJXA 1UXSB 5EWIH 2ZUWA 4F37K 3KEHA 4IBSA 5D1ZB 4I77H 4JLRB 4U3SB 4NFBA 1UXLA 4HPYL 4IYKA 5EZLB 4JKMA 4IKLA 1WG3A 3ARUA 5CLWA 1MFEL 2QBWA 3ABMB 2YEZB 1CGTA 4LOFA 4NJ9L 4PJ9B 1OW0C 3NAAL 5BRZB 2XQYK 2CO6B 3W81A 4B3EA 4MZRA 3HG1A 2IAMA 3OHXB 2ZJSH 5ACZA 4LPVA 3UDWA 1I3VA 5C0CE 4JFFB 1XQ4A 4OZ4B 3VXME 1XXDC 4B9KC 4NI3A 1NBYA 1HCZA 2ED7A 3FUNA 3OF6D 1S2EA 3ASWA 3MODL 2VTFA 2DIBA 3MV9A 1IZJA 4K4KA 4OV5B 4DN3L 1DN0A 2DLTA 5LAXA 4WTXA 3I02B 5HDLA 1URLA 3O6LH 1D7FA 3WEMA 5DD5L 5GS0D 3P0GB 5LXGL 4YVNA 1JPST 1BBDL 1T22B 3L3JB 5GS1A 4EN3A 2B7DT 4OGXL 3ZQ9A 2Q10A 2Y7LA 1T2QH 3FNKA 1AXTL 4GRWB 4A2DA 3QEGL 4GRMB 4XMPL 4O02L 4PGBA 2PYED 1M7IA 1VZHA 3GBMH 1DL7H 2QPSA 3L4TA 3ZE1E 5IK3B 1PZCA 4OJDH 4ENED 1KB5B 1UJTA 4U1HB 5EBMA 2VC2H 1QFUH 1DR9A 2VDPH 3IPFA 4B60A 4GAFB 3VU1A 4M5YH 1VGEL 4DP9X 1TZGL 2JIXA 2Y23A 2CDEB 4UZSA 1Z32X 2FEJA 3BH8A 4JRYB 4YZFE 3QPQD 2WVVB 4YE0A 2AF2A 3BD3A 3FN0L 4V1DB 1JZGA 4DK5A 2EILB 4G6FB 1MJ8L 3GUTB 4NT6A 3UMTA 4ELDA 3SCMC 1C7SA 4TL4A 4YPGA 5EBLA 3LZNA 1I8MB 3VRLF 1JG9A 4XO3A 3AUVA 1OCOB 3C8HA 3QWNA 1DQQA 2BVQB 3ECBA 4RGMB 4XR8C 2AC0A 2Q7YA 1AP2A 1BVNT 1E42A 2VRQA 3BKCH 4ODHL 1CBVL 1IGFL 5D4IA 2ZSVB 3UOAB 3RZCA 1MWOA 5D2NC 1ZLEA 4EBQH 2XIIA 4GAGL 3ZGIA 2VXQA 4AGPA 2ZSWA 4RNRA 3MV7D 2KZKA 2NY6B 1P5VA 3BWZA 1V27A 3FQTB 3V9CA 2EXTA 3S4SG 1O9WA 3PHOA 3RDJA 4AENA 4BDVA 3HS0B 2WXHA 1K2DB 4E9XA 1WC7A 2EZ0C 3D2UB 5C07B 3QO1B 3VI4E 5DZLA 3B7TA 4JFEA 4FYTA 1BEYH 1S9VA 5JIIA 1QR4A 2DW5A 3CJJA 3Q01A 2R8SL 2CPUA 2QVKA 2X89D 3QUZC 1YN6A 3UTQA 4L8BB 1GZQA 3BRFA 3R0NA 5C6WH 1BMGA 1JPFB 2IDFA 5FFOA 3OVUB 3MAWA 1JI2A 4FQ2L 4EI5A 3QRGH 1DVTA 3OMNB 1PU0A 1ZRUA 4DTGL 3BRGC 1BG1A 1KIRA 3TBYB 3FOLA 2PR9A 1TTUA 3U2SB 1NDGB 4RX4A 2I85A 2XPZA 3SYAA 1A7PH 2YR3A 1SJXA 4WSKA 4UTAA 5E5MB 3NCYS 5FKAB 4LVOB 2I07A 4ZX5A 1CTMA 5FGBA 1GGIL 5L2KA 4UILL 3MLZL 2B1AH 2BP3A 5BO0D 3LNIA 2J1XA 5CILL 4RMSA 5HI4C 2DEXX 2YEVB 2DWEB 4UTCA 3EJUA 5ESAA 3SKJH 3VWKB 1E8XA 4QO1A 4IU2B 2B0SL 5IB3B 3MLVL 4L9LA 4NKMB 1RPQA 4Z7NB 3U9PL 2R1WA 4D0DB 3ZL1A 1JXJA 5CJQL 4YGAB 1NMCB 5FX3A 3AQZA 1EUTA 1CFNB 2QQKL 1B2YA 2DMBA 3FFCD 1NGYA 4ZX4A 2QSQA 3HRZC 3MCKA 4PW4A 1MFAH 2MWCA 3DMMB 3F8UB 3T0EA 5KG9A 4P5MA 3D4ZA 4NQCE 3W38A 4OF5A 4D3CH 3FO1A 5H4ZA 3C5ZD 2PCPB 1T89A 2JSFA 1FQ9C 1F97A 1QBML 2G30A 2PXYC 4WJ5B 2ZYHA 2P7TB 5B3JE 2X10A 3ULUH 3RIAK 4NZTH 3RWGA 3S37H 3D50A 2FL5B 1FVEB 3H0TA 4E5XG 4ECNA 2QVTA 5HJBA 3ZN6A 3X3FL 3Q6GL 3A6CH 4FOMA 3C09C 3DUSA 2XI9A 4FFZA 2NXYB 4QRAA 2NUTA 3VFUB 4BXSV 3IYLW 3UJIH 3GMQA 3VXQA 5ENWA 2DWDB 2HT3C 4JFDB 1ED3A 3AGWA 3FCTA 3NIDB 4XO4A 4OB5L 4NZRL 3EOTL 5DZPA 1T03L 3CD4A 4LSQL 4X6DF 3TT3H 4WF7A 4WDIB 4JO2L 1BLNB 4ZSOE 1TLKA 5CIPH 3R7QA 2XXMB 1YMHA 1KEMH 4OJAA 1JNHA 2XTJE 3LYRA 4WHCA 3W5NA 3DROA 2Y7MA 3QUKB 5GGTA 3V0FA 4URKA 4CW1A 5TF1L 1SVCP 1AFVL 2BS9A 4WY7H 2MCPL 1G1CA 3TNNB 5I0VA 2OJZH 2DJ4A 4AMXA 4P2AA 2TSBA 1IBYA 4I4WA 4Z5RA 1QVOA 1BXUA 1BGXL 4HQQH 3T1FA 4R0LB 3C2AH 3SY6A 1U8CA 1GYVA 4NM8H 4OIBA 1FNGA 1CGSH 1JGVL 5F7DB 1XIWB 2AXGB 1ZY9A 3UTSB 1KC5L 1AO7A 4U2ZA 2HA1A 3UYRL 2ZKYA 5EO0A 3K6SA 4W9CC 2YBGA 1BBJA 4IOFC 1BM3L 1EA9C 2COQA 4B9CA 4LAQH 2V3DA 5DZVA 3QQDA 3F58L 4R2GC 1P5UA 5T3ZH 1W0VA 2XWJB 2CSPA 4XODA 3DBXA 2AMGA 4QJ4B 2D7QA 1KT2B 4MB5A 2JJTC 5B39G 2YGQA 1NGQL 1JI1A 4XWGH 1L9RA 3MSPA 5KSBE 4F15B 1IEBA 5GRWA 3RNQA 3D52A 2X4QB 4RWHA 5T5FL 4OVUA 5DHDA 3TBTA 4N86A 1HEHC 4DPBX 4FQXD 4RAUA 2O72A 3F85A 4TTGA 2ZOWA 5ILTH 3VXTB 3CFUA 3FO9A 2DQUL 4GO8A 5T1KA 3ULAB 1DCEA 3S34H 3HUJF 3SPVA 2N7AA 1KCVH 1A9VA 4UQIM 1GZPA 5I1KL 1A6WH 2ZOKA 3HB3C 5FHAL 4NBXB 4U1NA 2BHUA 2CBQA 6CGTA 4FXGA 2QHRL 1MCDA 4JS7A 2E74C 4LIQL 3INUH 2DEYX 4X6FA 4JN2A 1I4FA 4KKCC 3R19A 1C8QA 3JWOL 4P57B 5C0GB 2N0MA 5DMKA 1Q9KA 3HPJA 5ALCL 3MJ8A 1GY1A 3MOAH 3UBHA 4JFFD 1FDLL 3TIDB 4CVXA 4XBGB 3EYQD 4ZUUB 4Y1SA 4ZD3L 4XNXL 3R8QA 3CDGB 4WHYH 5FLVA 4AQ1A 4EVNA 2GCYA 2KKQA 3AACA 4L37A 5JQHC 1HQ4B 4KTDH 1QZNA 1FZMA 2XWDA 1UOWA 4M4RA 1L0YA 3LCYA 3BXNB 2ZWZA 5KS9E 2BNQB 2Y6SC 5CSZA 3VGHA 4FABL 3BH4A 4HJEA 1B3JA 3GIVA 3MV8D 1X5GA 3VWJB 5IFJB 3WNJA 1JS4A 1X7QB 3EJYD 5F71A 1AZRA 3AWFA 2MQ0A 1J5OH 4W68A 2GK2A 1NPNA 4PJ7B 2IV8A 5E6SB 4PIRF 3ATBA 4ZOBA 3VB9A 4OCXL 2M2DA 5HYQA 5JIDA 2VN6A 1WEJL 1T7YA 3A67L 4YGVA 1O6SA 1DFBL 1JN6B 4POYA 1YYLH 4JRYD 1CDBA 1S5HB 2X4PB 4L0ZA 2XBTA 4W4NA 4V1DD 5GZNA 1OZTG 2H7WA 3WY1A 5EOCL 4LRNH 1HKLL 5HTSA 4RWYL 3IDIA 5K9OA 2OK0H 2EICA 1IBDA 1PSKH 3IETB 2D73A 1KYUA 3MRPA 1E5CA 3L4VA 1NIDA 4YHZH 2X4RB 1Q9OB 1QACA 4EIBA 4F20A 3OKKA 3VUAA 1M57B 1SXNA 2F68X 3BI9X 1BZQK 3FAWA 5DJCA 1J8HD 1WH0A 5AVUB 3D0AA 4ANWA 1KXVA 3M07A 4ZPTB 4JQIH 1DLFL 2NY4C 3K2IA 4HHAB 5I66B 3MACL 3O3EB 3O6FB 1SJHA 1GGUA 3QUML 3DYMA 1XMWA 1QLEB 3QI9C 2F7QA 4R9HA 3BPCB 2NY6D 4YAQA 1NWPA 4EUPG 3TEXA 1E90A 3MBEB 4K15A 3STBA 1TPXB 5EOQL 4C58B 5C07D 5J3HC 2YAEA 3LS4H 4LDOB 3FT0A 3NPSB 4WUKL 3NFPA 1QR1B 4OF3A 1YECH 4DH2A 2EO1A 3ZIMA 4C4KT 4P3WA 2A0LD 4N5ED 4PJGF 5D96C 5LJYH 4P5TD 3RWCB 4NQDB 1EFXB 4M6ML 3ZTNH 2C5DC 1TQBC 1I7ZA 4HT1L 2RMNA 4WI3A 1HILB 4PP1D 1NC2B 1TIUA 1A64A 2DDQL 4KXZI 3BAYA 3L4CA 1URIA 1D6EB 4A39A 4N2AA 3FU5A 5J12C 4PMEA 5SWSB 2XX0A 3F7YA 4U1LB 4ZW3A 3G5ZA 1CDGA 4UT6L 4ZX6A 2BC4A 1N6QL 2IH1B 1KMGA 1HE8A 1ULVA 1F3DJ 1KPRA 2ATKB 2ENPA 3QARA 3CSTA 1G7HA 3KBHE 4OZFG 5F3BB 5AG8A 3D9AL 1A8JH 1E8ZA 1CD0A 1JMZA 1HL5A 1R3KB 1YYCA 3V4UL 2BCMA 5GRZA 3NRPA 4FD0A 3NCCB 3GJFH 3V6OA 1EMTH 2QMJA 1YVLA 2WCPA 4LCUB 1Q72L 4C56E 1XTLA 2F74A 1ZOXA 4NP4L 2A9ML 3G5YA 4UBDD 5F21B 4YLQT 3T4AC 1JYWA 5A2FA 5JLZB 2X1OA 1TEFA 3DOSA 2MRYA 3U7WH 2KQMA 4MAYC 1E8WA 4OZHB 3IBEA 4FTVA 3G6JA 3DMMD 2VAAA 4HX1B 1K5NB 5I9QB 3ME0A 4XXWC 1XH0A 1TSHA 1VCAA 4M7KL 3WL9A 4HGMA 3CBJB 4FXLA 4KTEL 1R5WA 3R06B 4FLQA 4W9GC 3MXWL 3PE9A 4JG1L 3O41A 1SHMA 5CGYD 4HVBA 4LKXB 5A2KH 2WZAA 2BVYA 3EDEA 1VEMA 1UWXK 2PW1B 2XWBB 1ZEAH 3BAXA 3MO1A 3E2HC 2ZXAA 2BWQA 4N2IA 3ET9F 3FQUA 1J8SA 5GRUH 1NSNH 3IJ9A 4OD3H 4QXUH 3VYNA 1U3JA 5JPMB 3H7BA 4APQC 3SQBB 3LIZL 4UM8A 1SXZA 4PRIB 3X17A 2BY2A 3KL3A 4HJUA 1WIPA 3GSXA 4JFDD 4PJIF 5F1NB 3HIZA 5CAYB 1AJ7L 1KTBA 5BMFL 1GCFA 2XPYA 4RGOL 5ANMA 4KZEL 2GFBB 3OC5A 5C0IB 4AYBA 2KLTA 5MI0C 1HK6A 4NQEB 5TE4H 1JXDA 3F04A 1UD5A 3T08A 3FMGL 5HD8D 5SX4I 1RUPH 4JHBA 3QUGA 3ULVE 2WLKA 4DW2L 4GIAA 2OBGA 4PB0H 1OGTA 2J25A 1QHOA 3STZB 2UYLB 1O7DE 2G4EA 4O9HH 5FGSA 4YHIB 4KY1L 1WBZB 2P4AB 5PAZA 3KL0A 2HFEA 4NC1E 4W9IC 4AG4L 2BSTA 3CQPA 2FX7L 3UTSD 3VXRD 5FO7A 3QNXA 3FH8A 2IDSA 1N0LB 2PYFA 35C8L 4P2YA 1ANUA 1PMYA 4XN2A 3W9DA 4Y5VB 5HDQL 2O5ZH 1TT6A 1CVRA 4Z7UF 5G4NA 4AZUA 1VFAA 1F5WA 1F42A 4NENA 4Y19A 1N4XL 4M3KB 4LL9A 4RDQG 3GXFA 5F88A 3TNMA 5ICYA 3IAGC 5ETUB 5FYKL 4N0UA 1H3VA 2JB5H 1IC5L 4TM9A 4AYMC 2JQMA 3KH3A 1PFOA 4WW2B 1AQ8A 3L9YA 3T4YB 2CLVA 2FLMA 2JKJA 5I24A 3FT1A 2WTPA 4OKVA 1AGDA 3BVVA 1NFDA 3H55A 3BVUA 5IBUB 5IZ7A 2NXZB 3P77A 4K94C 3IJ7A 4U6TA 4QRTA 4XMXA 1OE1A 5IESL 3RIKA 4ZMXA 4AZ8B 1KYFA 5DQDL 4WWKB 3RURA 3HC4H 3V52H 3NA9L 2X4OB 2AXHA 5BO1L 1U6AL 1RUAH 4KHXL 5B38B 2OMWB 4PRHA 4OSUL 5JXEA 1W0WA 5FFLA 5F44A 2I9LA 3IFLL 3PG2A 3WMPA 3X1BA 2Z8SA 1BSIA 4MNHA 4WEEA 2ROYA 1T20B 2Y36H 2YPVL 4XCNA 4P5RA 3X13A 1I8KB 4A38A 4HIHA 1JK9A 3Q48A 2WSPA 1BYOA 3H2QA 5DK0A 2EE2A 3HMXL 4X9IA 1UZ8B 3UTPE 4ZFOL 4NHCL 3O3AB 1ONQB 3QEUA 4PVMA 1V7MH 4ACPA 4M00A 3P3YA 4U33A 3WEBA 3FB7B 5DVOA 3RNKA 1WYJA 5IW1B 4AYGA 4ADJA 2C9SA 4FXKB 5HHPB 5AW4B 2FWOA 1HI6B 4WFGD 3FT4B 2BNQD 1LE5A 4FNTA 3SQRA 2GTQA 2EDDA 4JREB 1MVUB 5C0BE 1DSWA 1QSFE 1AXSB 2EECA 2FQFA 3OGOE 2F9BT 1EXUA 1U8MB 4PJ8A 4QRRE 3UFIA 5HHXH 3IWVA 4OGAD 3TXAA 3ZGHA 3CN2A 3ZJAA 1R3LA 2IADB 4QRUB 4XVJH 1HHGA 1SM3L 1F11B 1RJZB 1JRHL 5FW7A 5IIEA 4YHKH 1U8QA 1G9EA 2P80D 3P11L 4P05A 4G1MB 4R7NA 3OKDB 4U0QB 1Z66A 3APMA 3N9GH 2NW2A 1FGNL 1KCSL 4AKPA 4IU3B 1UVQB 2JKTM 3D08A 3NCWA 1F0LA 1MREH 2X4UB 2Y5EA 4P23A 2AJ3B 1NFIA 2C3GA 1I7TA 2C4XA 4JHAH 4R26L 2I7SA 1Q9WB 5FLUA 2XZCL 1BQLL 4R8WH 5INDA 1XCWA 4HU8A 1F8TH 1XGPA 3EG9A 3BPLC 4YBHA 3MHZA 4JPKH 3W1ZA 3O6FD 1MLCB 3JUZA 2IANB 4K2UH 4LKCB 4RDQF 5DI8B 3AG2B 3SB3A 3G5WA 4LSPL 2FQDA 4YSSA 1ODUA 2YFOA 5TGBB 2VQUA 2PTUA 5GJTL 5SX5H 4ACTA 3S37X 3A3YB 4YR6A 5JPNA 4LQFL 5IEKA 4KROB 1HL8A 1ZXQA 3OMIB 4N9GA 4LOUC 3VM7A 1TJMA 2V2XB 4C47A 5HVHC 2E7CA 2ZXDA 3F5WA 1JYVA 1MXDA 3KLQA 1EFXD 4NQDD 1NPUA 2YN3A 3GBNH 3O2VL 3ZBMA 5IHUL 2O93L 2LLNA 1CWVA 5SV3A 3G5XA 3Q8FA 1NC2D 2YXMA 1AC0A 1OAYH 2ADJA 3FRUA 4P2OD 2ZCHH 4GT7A 5LWYH 4HEMA 1FNFA 1PGRB 1EJOH 3G6AB 4RMWA 5SWSD 3VB8A 1MLBA 3PQYB 1MHPL 4FQLH 1LILA 3FU3A 4YQXH 5F7UA 1BVKA 2ETWA 4M8VA 1OF0A 4AGNA 3PDOB 1LO2L 4TQEL 1LEGB 2W0LA 4PYGA 1A7NL 1A3RH 3DRTA 3FB6B 4RAVA 5IJCC 1A4JA 3TV8A 3N2JA 4PJ5A 3ESOA 4G42A 1PW3A 3SQOH 5GZOD 5GRJL 4LQ1A 3MJWA 3S35L 2Y1YA 4A37A 1BZ8A 4C59B 5HHNB 5GS1C 2HSIA 1FH5L 2VT0A 4EN3C 5IMMB 4UB0L 3TZVB 4F2EA 2GT9B 2E56A 4ONHA 1RUMH 4L4TB 4HWEL 5L2KE 2ADIA 3FSOA 1D5BB 2FIKB 5I1GH 2DQ6A 2XA3A 3FC8A 3GHBH 3WIIL 5A3IC 5HYSA 4JFSA 3ZO0A 4JJ5B 5ADPL 2YN5A 3ZHLA 4F7PA 1F1AA 4F33B 4JFPA 3TV3L 2NY0B 4P4RA 3GSNH 3CVIL 1CG9A 4Y5YB 3TJHD 1U8LA 3TTYA 4XGZB 2EKJA 1CDCA 3B9DA 4NGHH 2JI1A 1OM9A 1XH1A 4L5FE 2K1MA 4OCRH 4RIRB 1DQML 2A6IB 1HNYA 3L5IA 3VD7A 4QOKA 1Z6JT 5LGJB 3MRDB 5IMLB 3UPRA 1P6AB 3BMVA 3ESVF 3Q6FB 4K94H 5DRZB 4KC3B 3FUMA 4XP6H 1RUKH 3X11B 2XG5A 3DKHA 3BIBX 4F7EA 1UC6A 1C5CL 2NY1B 2WXKA 3IFNL 4BSVB 3R18A 4GMSL 1AKPA 4J23A 4ZOCA 3IMUA 3LV3A 4RZCB 5AZEH 1E5ZA 1J8RA 1KCUH 4CAGA 4QIRA 5DUML 1JIBA 2J72A 1W72L 1RK0B 3ZXAC 4PRID 5FA4A 3E3QC 3LD8C 1F4XL 2OULB 4CVWA 3RZCC 1BF2A 1MIEH 3W39A 1BD2B 4JM2B 5GIRA 5IBTH 1G6RB 2ZIDA 3Q06A 2EKSA 1Q1PA 2WBJA 1KLFA 2Q8AL 1BFVH 4X83A 3S88L 3ILPA 1TYEB 2BSCA 2O5NA 1B2WL 3OLDA 5I6MA 2DWSA 3DJSA 3VW3L 5MEPA 1FZJA 1A6ZB 3FCSB 3HZKB 4P9HC 5CJ5A 5KYUA 1XGUA 4I89A 5AKRA 1RXLA 3GLZA 4H88L 2R0LH 1CL7L 2QKIA 1ET8A 3PIQB 1S9YB 4CBPA 4U1KB 3MX0A 1KIUB 1QNIA 4H20H 3NP3A 4PJCE 5T3XE 2WWMD 4H1LG 2BSDA 3D3VA 5JIHA 1RK1B 5H37H 2B59B 2HWZL 3EH4B 3B9KC 4RQQB 1LO4L 1X5LA 1VZGA 2XWZA 1MCEA 4ZAKA 2YOCA 2W65B 4K7PY 5I30L 2B08A 3LKNA 3LKOA 5EUOB 5I2IB 4QRQB 1QO3B 4U6VH 1NDMB 4YHNA 1JWSA 2I9TA 3GK8L 1AO7E 1I9JH 3FQ4A 4P2QA 4A6YB 5T1LB 4YHYC 3HHSB 3UO1L 1SXSA 2ATPA 3WLWD 5SWQA 5E4EB 3LQAC 5C0NC 4AT6B 4C4UA 5FO2A 5K1JA 4MQXC 4F5CE 1PQZA 1BVNP 4K23L 5FXCH 3CN0A 1RERA 3LRMA 2BSBA 4L9LC 4G5ZH 2CXKA 2F54B 2HLFD 4F1SA 1CZ8H 1CXHA 5CGTA 2EEAA 2HT2C 2NXZD 3O3DA 4OQTH 3F7QA 4QHNA 3GJEA 4LLDA 1AH1A 3U4BL 3CZFA 2GABA 1TVHA 5DZJA 3QDJA 4WWKD 3NP4A 3GI8H 5LN4A 3GEFA 2VC2B 2EVIA 2WMPA 3MRNA 4BFJA 3MLTB 2KZWA 4IIQA 4GSUA 5DHYA 2QGCA 1C16A 3OGCB 1LK2A 2LFEA 3BIKB 3K2UL 1D7BA 2X4NA 5LDSA 4EQ2A 1IKNA 1ETJA 3BAWA 3FU6A 2R69L 4Z7WF 5L2JA 5DS8B 4GQ9H 1IL1A 3MV11 5I0DA 2EIKB 4DVRL 5HHVH 3NTCH 4V11A 4PM1A 4HG4J 2NUPB 2YIHA 1T1YB 2C26A 3AS0A 3L6FA 3X12A 5AOMA 1XF4A 5IBLC 3K3QA 4OQ1A 4NN7C 5JR1L 1KDIA 5F7YC 2OMZB 2EIJB 3QAQA 1RHFA 1LEIB 1W16A 4HV8B 5FYLH 1OP3H 3MRRA 1YUHA 1OF2A 4FXTA 2ARJB 3OX8B 2WHVA 3QEQD 1FI8C 4CJ0A 4PGEB 5C0FB 1IAOB 2H6PA 1I7UB 5E24E 3L4XA 1NEUA 1UACH 2WP3O 4UIMA 1YJDL 1NMBL 3GXDA 2DQJH 2UXTA 3EBAA 4BFEA 1LHZA 2UY6B 2KS0A 2B1HL 2C9RA 3BX7C 1AY1H 3IFPA 4B7IA 1TNNA 2VM3A 3B4NA 4PJAA 4HKXB 2X44D 1GHFH 3HPLA 4MRBA 3WUWB 2W0FB 4WAFA 1FYHB 3CFTA 4TVPL 4GXUN 1PZAA 4L8CA 2FBJH 3H53A 2QZQA 3FHAA 1W80A 3MRMB 1KB9K 2HUHA 4CMMB 4FX5A 4W6YB 4ELKB 4G7VH 1UB5B 5KS9F 3TA3A 4K3HA 3O3BA 1CD8A 4OUUA 4I3RL 2CKBL 4I3SL 4ZMVA 1P5UC 2ILLA 4HOMA 3MZTA 1O5DT 1U3HA 4F8OA 1ZV9A 4IJ3B 3PFQA 2J5WA 5ADOH 5AOIA 2Z35B 4WI9A 5G5DB 1MWAB 5HI3D 3VSQA 2C34A 2C3WA 2QPEB 4CVZB 4WVRA 3VFVA 5IT2L 4JPQA 3MV01 3MLSL 5CCKL 2V2TB 4Y2NA 1QPPA 4RGNE 4KROD 1CLZH 1KJVB 1X5AA 1ZA3B 5DWPA 7CGTA 5IY5B 2IPUK 5ISZE 2J8UA 4YIQB 2BNRE 3L13A 2ZWSA 4WU5B 3BGFB 1YYML 3FRPG 2VITB 2QKSA 3UAAA 1R34A 3RWFA 1DBKL 4NNXB 2YXVA 2C3VA 2OCCB 4H0LC 3IDMB 5IJVA 2AK4A 1U8KB 1EBAA 2VXQH 1GPOL 1G7MB 2VXSH 3MGOB 1TZIB 4A2FA 5DWUL 5EU7E 4HJJH 4MJ5B 4DK6A 5DK3A 3SD2A 4KZ0A 1PBYA 1T04A 2NLJA 2XBZA 5D1QC 1OGAB 4G6KL 5ICZB 1ET7A 2XV0A 2WLIB 4DGUA 2MPAH 2YGOA 4WI0A 4Y2LA 1G87A 1MRCL 3RFZA 3X1FA 3QE5A 1KY7A 4XE0A 4ZO8A 4TNVK 1XCQA 1N8ZA 4NUQA 4AQ1C 3TVMD 4L3EA 3F05A 4G6AC 2MH4A 4RFOH 1GYWA 1SJEA 4XVTL 5D72L 4G59C 3V4VL 3MRBB 4A2MA 5IVNA 1TDQA 3QZNA 2RHEA 4FHBD 5I1JH 2EYRB 1NL0L 2Z93A 3TZVD 4L4TD 4WUUB 2ENSA 1CLYL 1I85A 1VIWA 2QT6A 2DWTA 4LZKA 4Y1AA 3MNZB 4FP8H 4ANUA 4TQIA 1TCRB 4P2RE 1FPTL 1ZGLM 5EEYA 5F7EH 1TU2A 4MA3B 2OR9L 5AVVB 4F9PA 4UTAH 4YL4A 1A7QH 2EEFA 3HFMH 3BUDA 2P5EE 1YEEH 5FYJH 5T33L 3LQAH 5FUZL 2D0GA 2X40A 3S3PA 3FOMB 3MUGB 1A6TB 1BP3B 3FT2A 3PF2A 3RWHA 1C08B 2F53A 3RPIA 3GMMA 2IAAC 4JO4H 5KVDH 3T2NH 4W9DC 3RGVA 3FL7A 1OGSA 4UANA 1R33A 1P7BA 2OL3A 2R1YA 4LCVA 1ZWIB 3RG1C 3H42H 1IM9B 5IFHL 1YEDA 2NY1D 3S97C 2Y1AA 2GITA 5K5YA 2DMKA 1ZPUA 3GRGA 1O0VA 1KLGA 4MD5B 4OLXL 2J12B 1ACYH 2ICES 4KRMB 1HWGB 5EU4B 2B1OA 1KXVC 4FQPA 4QDGA 4MGXA 5DJAB 4G80B 3FCBA 4OUOA 1BD2D 5CUSH 4AEHL 1U8IA 4Y8DC 4BZ1A 1DANU 3SCMB 3EH5B 2G5BB 4A67A 3C6LA 4WNSA 3TCLB 3WKML 4AUYA 5JORA 2CUMA 3FTXA 2I60H 2HFTA 1WFTA 1ZLVK 3CSGA 3GMRB 4NDMA 4G83A 1M53A 3UYPB 4FFZH 4J12A 1RZKC 2VXVL 5DD6B 4D9RE 4HUUA 1KXQA 2HRPL 4LEEA 3MRQA 3NABL 4N85A 2IBZY 5J1TC 5HSFA 2FVNA 2NNRA 1E9PB 1UKQA 2XXGA 4IS6B 3KYMA 1CGYA 1MIML 1OANA 5EH1A 1U8OB 1MHEA 1CFQB 1ETZB 5CMAA 2X70B 2ICEA 2XNAA 3I9IA 5D7SL 4X4YA 1EGJA 3KS0H 2G75A 2GHZA 2V5RA 4PD4K 5EF0A 3KE0A 3LQZB 5ITBH 5K1NA 5GGTH 1BQRA 3EJQA 1WWAX 4AY0A 4FLSA 4PJHA 4AK2A 4S2SB 4M02A 2Z7UA 3ROLA 1JBJA 3HN8A 5D2LE 3AB0C 3FPXA 4OF0A 2JCCA 3AS1A 2VLRB 3OG6B 3Q8EA 3DJTA 1OAXH 2NYZA 1A7RH 3KPMB 5FOBB 1ZGLP 3F7RA 4Y19E 3ULVF 2WLMA 5I8OL 3CU1A 4A2HA 2WWKT 1LO0H 4UV7H 2VUKA 3OF6A 3GMPB 4WKZB 1OEZW 2VR8A 5I1LA 4ZX3A 1UFUA 3REVA 4BFBD 1JWMB 2E8ZA 5GGSY 4HK3N 3DHUA 1XGZA 4YXHL 2OA9A 1E50A 4JG5A 1YEHL 3FK3A 4K07A 1ZA6A 1T0OA 1A2YB 4WLCA 4DGIL 5CM1A 5I8KL 1OSPL 2ADGA 2VSMB 4L3CA 1T4WA 1YLBB 3BSZL 3ZE1B 2PYEA 5K59F 2GUYA 3A23A 4I9WE 5LG1A 5I17B 3BKJL 4G11A 4NLAA 4GRLB 3CHRA 4S0TD 5MENE 4KKBC 3IE9A 4HF5H 3WHE0 1MCSA 3QUXC 2VJ0A 2NT1A 3CPUA 4NWUL 5HP5A 3P9MB 3DXAE 4GAAA 2WUBL 2P3YA 2WVSA 1TR7A 1J9TA 2W38A 3QNZA 2QQNH 4P4KB 5CJXC 3LRLA 2JELL 5J1AA 2ITDA 4KK8D 1DSFH 4NQVB 5I23A 3LNEA 4KAQL 4N2GA 1FSKC 1OB0A 2EEDA 4XWOD 3H9HB 3S36H 1ZHNB 1K8DB 2BHYA 2AQPA 3RLSA 4X80L 4FQCL 3VGAC 2HRLA 3W0WB 3WJMA 1F56A 2NSQA 2GIXA 1QG3A 1MJJA 3EOAB 3HN5A 3SN6N 3KYNA 1GL4B 3O2WL 1TUPA 3EHBB 4N6QA 4JJHA 2XZQL 2CO2A 3QWQB 4YSDA 3LEVH 1XH2A 4BA8A 5KSAB 2AP2A 5IHLB 1ID2A 4LFHD 1ZHKA 3GZQA 5KANI 4ESKA 4J1UB 1O7VA 5D2NE 1JE6A 1OIOA 1JPTL 4M62L 3P4NB 4PGDA 4ZTPH 3CX5K 3GB7B 3D25B 3JV4A 2FLBT 1CD9B 4Y4FD 4J8RB 4JFOA 3NQIA 2GVYA 3B43A 5AAWA 3CHXA 4WWPA 1VENA 4U7MA 3D4CA 4KK6C 3M1BA 1FN4B 2R9HC 3BZ4B 5I6PA 1SEBA 3VI4B 3FTGB 8FABA 2ICWI 1A4KB 3MLPA 4K5PA 5EV7A 4K55A 1M05A 5F7LB 3T04D 1U8JA 2XN9E 4AMKH 5E2UL 1SYVA 3HE7B 3OQ3B 3CSFA 3ILQD 2X89A 1WFMA 3UTTE 5I1HL 2NZ1A 1B6DA 3DETC 1R1CA 3B56A 3NIFB 4DF9A 1P4LA 3RVWC 4RMBA 4D9QE 5DRNB 3SYOA 2FK9A 5CINH 4POZC 3SDYH 3RY5A 3VFRB 4GIPD 3WNPA 3RQ3A 3QJFA 4GBXD 5E2TH 1EDYA 3LSOA 4L48A 4MLIA 1EIBA 4FFYA 4ZO7A 1MVFA 1GZHA 1WZLA 3GDBA 3Q5YA 1MCRA 2PKDA 4I48B 3R8BB 1XF5B 4TVSa 4L29A 5DJYA 2HVKA 3PJLA 4ZRGA 1FORL 1BIIA 1GR7A 4E41D 3SBWC 1OAKH 1HSAA 4X6CE 3I9GL 5SWZA 4DERA 5D5MF 3U1SH 4KKLC 2PF6A 1N7MH 4K3DH 4PRPD 2BP8B 2WXFA 4CADB 1KIPA 1ZJBA 4UCFA 4NCDA 4M93C 1KZQA 2VCOA 4PJEB 3OAUH 4YLCA 4XAWL 5E0FA 1ZT1B 4IRSB 3PWUB 3G08B 1OGAD 2J2ZB 3FQWB 5HHQA 3FFCA 3WD5H 4HPHA 4D8OA 2Z0UA 1YG9A 1IARB 3AT0A 4NQCB 4AYEC 1TQTA 3FTYA 5C08D 5BPPA 4OZGA 4Y89A 4HSAC 2QSCH 5IUSA 5F9JB 2XJKA 4LF3A 3C5ZA 1IGML 2XN1A 4TUKH 4GMTL 5DLLA 2P8LA 1MCLA 3ARDC 4P46D 1ECYA 2Y5TA 3MRCB 3VDBA 1WHPA 4ZBJA 4BINA 3QXVA 2WTRB 3MJGX 4YSUA 1NCBH 3FU7B 3L8QA 3WY4A 4FGMA 1YPZB 1HX0A 3AZUA 3M1CA 4WFHE 3BN3B 1TQWA 1DDHB 3DO3A 3MBXH 1NMAL 1QBBA 1GOGA 1U58B 3WTSA 4XZUB 1IUZA 1GGYA 1U8NB 3E9UA 3KR3H 3U30B 4H8WL 3M86A 4FKEA 5DGRA 1MY7A 4I9XA 4XPAH 3S7GA 1YEWA 2PCFB 2CQVA 2Q86B 4PJ8C 3ZT6A 4TS6A 1S6NA 1G7QA 5JDSA 1NCHA 4ELMB 3MNDA 1OB1B 2LVCA 1N2RB 4PWHA 1UJ3A 3T8XA 1LL1A 3CC1A 1PDKA 3DPBA 3TYFA 2ZWYA 4ZSOB 2K7QA 5E1HB 2XZAL 4CRPA 1NUGA 3QXUA 4PJFB 1ES0A 3QWOB 1K5WA 3L3KB 2BK8A 2Q87A 1IM9D 1L7TH 5FFGA 3HLAA 4Z7QB 1C12B 4Y4KD 4XB8A 5EO9A 3B9AA 5DS1A 3FO0H 4FKKA 4P23C 2H2PC 4IRZL 2OZ4A 5T3ZD 1L9TA 4KHTH 3LH2L 1AR1D 3U46B 3PV6B 4CC4A 3L4ZA 4FN0A 3QH3A 5F0LB 3QFJE 5EU6D 3AXHA 1KBGL 3MFFB 1HCYA 3D39E 4HBCH 4Q4IA 3IMWA 3AQXA 3PAYA 5GGQL 3QXDA 2HT4D 2OMUA 5TD4A 1FBIL 4R7DA 4WSJA 4M7ZB 1L9NA 1NM9A 3WHE1 4Y5XC 1JZ7A 1Z9NA 2AI0L 5BS0B 1MCIA 3WLBA 5C86A 2SODB 1JK8A 1KTRL 1PX3A 2I69A 3ZL4L 4YSCA 4XCYB 1U9KA 5JPNC 3UEZA 2Y3AA 1DQDL 1KUMA 2MHAA 5ICUA 5F7KC 2E6QA 3WG7B 1AHWA 3OZLA 2CRZA 4HIIA 2H0FA 5KSBB 2FDBP 1KTDA 5T1JA 1P7QD 1XGYL 4EE2A 2IVFC 3HAEB 4S1QL 4YX2H 3CFMA 2XACC 3L3GB 3VFOB 2Q7NA 2JK5A 1TVBB 4JUSA 4FL4C 2J44A 3IMSA 3IJEB 3C12A 5C7XL 1KENH 1KJ2A 1UXSA 3K6FA 4FQXA 3UAJD 5HBBA 2CMRL 4P9MH 2UVEA 4FZEL 1K4CB 4D8PB 4JN1H 4KNTA 4PHZA 4U3SA 4U6XB 3VX1A 3D3VE 5EZLA 3IM1A 3UIZA 5D7LB 1BX2A 2D7TH 1TXKA 3KM2A 3LHAA 1YMMB 2Z4QA 2EDYA 1RIHL 2YEZA 3BDYL 4PJDB 1QQDA 4H0IA 3IXTB 4ANXA 3QYMA 2VLJB 4KRPB 5JTWA 1H6TA 1LDSA 3OHXA 3NJNA 5C0CD 5FDWA 3C60B 1WDAA 2CUHA 4DKTA 1CFBA 4JM0A 4JFFA 5CD3B 3BAKA 4Z3JA 1M6OA 1LDPH 4BE5A 4R4BA 3N44B 2D7NA 3RWDA 3FONB 5JOFB 3WHXB 1ZHLB 4PJCF 5GS2D 3VJ6A 1E28B 3I02A 2BVPB 2I25N 3LZPA 5HGHA 1DQJA 1MHCB 4AEFA 3M45A 7PAZA 3O9WB 3L3JA 1MSPA 4TLTA 3VYPA 4RISL 5JUEL 2WSKA 2WXMA 4JPIB 3ULVL 1LP9E 2QL1A 1QKZL 3BT2H 3WJLA 1EERB 3MV8A 4I18C 3TO4B 3WFCH 5I71C 1WLHA 4NC0B 4GRLD 4WTZA 3GTTA 3DYPA 2XKNB 3F6JA 4U1HA 4YDLB 4JM4H 3A22A 3FS9A 2AVGA 4MAYB 4UIKH 3DV4B 1WCBB 1X5IA 2ORBL 2G5RA 2OXHB 3T9WA 2AJZA 3T0WA 4XNZC 3CVHA 3QJVB 3PWJB 3ZHNA 4YJZL 4JRYA 4GXVH 2WVVA 3H1ZA 2EE0A 3PDGA 1DTUA 4OFVA 3GUTA 3W0WD 3AY4A 2N1KA 3E9TA 4KVNL 1G7IA 4XN8A 1J11A 7FABH 2NNXA 3EHBD 1OAUL 1QSZA 4G82A 5KSAD 2G2PA 1W6WA 4GUPA 3BO8B 3E2HB 1WQVT 4U7SA 1J8HA 3I6GB 1UCBL 4DCQB 2VABB 5TK2A 1M2VA 4WV1A 2DD8H 2ITCA 2BZ7A 1S9KC 3C9NB 2AABL 3QZOA 1OPGL 4Q6IA 4ZG1A 3WV0A 2QKIC 2B15A 3L1EA 4DO6A 3GXNA 2AHIA 3FQTA 5E8DL 4XP9L 4MA7L 3ZK0A 5LNDA 2A38A 3LNGA 3RKDD 2CH8A 3WIHL 2JCWA 4HIJA 3CLFH 5C07A 3MRGB 5AAMC 2VQ1B 2HFGH 2YLHA 3OR6B 4XVUC 1CE1L 2H26A 4XPBL 3RHWK 2WB7A 3EGSB 4LMQI 5DUBB 4NZ8A 5J8OA 4B9ZA 4HOWA 1IGCH 2GQHA 4HJGB 5J4MA 5GPRA 3CH8A 3HE7D 5EN2A 3DARA 4P5TA 3BHBB 5FB8B 3BESR 3N41F 3CXHJ 3ZU8A 3HNTH 3WENA 5KYXB 5IVXA 4Z3IA 1G1OA 1JPFA 2AJVL 3UEQA 1NAKH 3HNVH 2VLLB 2CXGA 2B9AA 4FTDA 4M1DL 5C0AE 4D9LL 2OSXA 2XLLA 1IC7L 1KGIA 2MJWA 1K72A 1CR9H 4BV1A 1FVDA 1MUJB 4S1SH 3ABLB 1J9CT 1IC4L 2JJSC 1ZXKA 3UZVA 2GIMA 1S9XB 2PN5A 4QHLB 2EYSB 1E4XI 1RP8A 3ARSA 1UT2A 1NCAH 3MTRA 5DT1L 5EA0L 5JA8B 1XGTB 1C1EH 1C5BL 4XNUH 2HUEA 2QVFB 1DBJL 3GF8A 5EUOF 3I2CL 3N40F 4KGJA 2ICWA 1JP5A 1VFBB 2QADC 2LAAA 3GSNB 4AW7A 3BC9A 1ERNA 4NKMA 4NXSA 3S6CA 3JT0A 5GISH 1T0PB 5JW4N 2VYRE 3L5JA 1IKNC 3DX7B 1R17A 1SVZA 3APDA 4BJLA 1F4WL 2ALAA 4IRSD 3SHSA 1VCBC 4M6AA 4XOCA 4F3FB 4GO9A 2ALWA 2EIZB 4HIQA 2SEBA 2AQNA 4K73A 3FO2B 3DMMA 4HXAL 1GKOA 3E80A 4NQCD 3PL6C 3TFKD 2WD0A 4HS6B 3L3OA 5F0MB 4Z0XB 1P2CB 3G9VA 4ONGL 3ZKQD 3B2MA 1TJHH 4YHMH 5GRYA 1KIQB 6PCYA 5FV1L 4OIIL 1S7UB 3X14B 4R96A 1WD8A 2H6UA 2Z92B 3GBLA 3AY2A 5CZXC 1HDMB 4HPOH 5DFVD 2OCJA 3RHWF 3KPOB 1T3FA 3EOBB 1HHKA 1HSBA 1TNMA 5KSVB 2FL5A 1FVEA 2A6KB 4E42B 3MOBL 2VLKE 5DJ0B 1OY3B 3T2PA 4FI6A 2P5WA 1XFPA 4X4KA 5TE6H 1P4BL 1EJ8A 4E9SA 3VFUA 3S48A 4HJ1A 4KKNA 4YOKA 3T77A 3UTZB 4GI6A 4QNPE 5F6IB 2AJYH 5T8IA 3LZLA 2DWDA 3RI5F 4F93B 2P43B 4JFDA 4B3VA 4GP5B 4L05A 4O4YH 3RX5A 1XZ0B 4NSKA 4LSTL 3V6FA 1UUNA 1XGRB 4EI6B 2XTJD 4NRYA 2OMVA 3SE3A 4OJFH 2APXA 3E6HA 4PLOB 4WW1B 1CDUA 5FUOH 1NIAA 3ZX1A 4D0CB 4PBXA 4XBMA 4NI6A 4MJHA 2OMXA 2AS5M 4KXZH 4TTDD 5FCUH 3C5XA 3DIVA 4JDVA 4X5XA 3T6QC 4ONFH 1OP9A 1JPEA 2BCKB 1X5YA 1JFHA 2NZ9D 5CN1A 4WO4B 3A4DA 1XZWA 3GHEH 2ITEA 4BZ2H 4FG2A 3L5WA 4B5ZA 5IQ9B 2F61A 1H6UA 2NY7L 2FGWH 1RJYA 3IGLA 2B2XL 3SE9L 4BM7A 1RVFL 3HR5B 3K72B 3GSRA 4M6OH 5C0EB 3OKMA 4NNPL 5IP4A 1QPXA 3T0BA 1JHLL 1FNSH 5CEZH 5BQ7B 3GS0A 5E4IA 5IVZA 3FSVA 1RURL 1U8PB 3PWPE 3N40P 3SOBL 3MRIB 4F8TA 3BWUC 2DIJA 2X4SA 4MDIA 3S36X 3UZQB 2OMTB 4LLVB 4S1RL 1EAQA 3ZE2E 5EEVA 4WI7A 2FUTA 2DQHH 4HK3J 2F5BL 2WVUA 1R75A 1KBWA 5D7LD 1Z3GH 3H8NA 4IMKC 4KXAA 3RGHA 3RVUC 5AB9A 3BUTA 1BFTA 5TFSH 2VDRH 3RFZC 1N5AB 3EFOA 1A4BA 4KRPD 5I1IL 2X6AA 1N6UA 1N26A 2H1XA 1GGBH 3C60D 3LH8A 1KELL 4TF4A 4Y2DA 3EYVA 3TX4A 2E27L 1JCKA 1U92B 1I3RA 2IAMB 4XBGA 5ACZB 4ZUUA 5LLIC 2X3BA 3VD9A 5B1CA 4BFGA 3CDGA 4AI7A 3GLEA 4QD2E 1YNLH 1NBYB 5H8DA 5CD5C 3LZOA 2K9UA 3D0VA 1PY4A 3MV9B 4EJ1C 1JFQL 1PZ3A 4L3AA 3V0GA 2A9NL 4KI5E 5LAXB 1DBAH 3O9WD 4F9PC 1H5BA 2AQQA 4AQ8A 2VL5A 1WFNA 4LSRL 2X3AA 2D3JA 1Q1JH 1LO3L 1M1XA 4OJYA 3BAEL 5C0BB 4N0CD 5SX4H 5CHNA 1YY9C