4BZ7A

Crystal structure of schistosoma mansoni hdac8 complexed with m344
Total Genus 152
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
152
sequence length
434
structure length
399
Chain Sequence
b'SVGIVYGDQYRQLCCSSPKFGDRYALVMDLINAYKLIPELSRVPPLQWDSPSRMYEAVTAFHSTEYVDALKKLQMLHCEEKELTADDELLMDSFSLNYDCPGFPSVFDYSLAAVQGSLAAASALICRHCEVVINWGGGWHHAKRSEASGFCYLNDIVLAIHRLVSSTPQTRVLYVDLDLHHGDGVEEAFWYSPRVVTFSVHHASPGFFPGTGTWNIFLNGAGRGRFSAFNLPLEEGINDLDWSNAIGPILDSLNIVIQPSYVVVQCGADCLATDPHRIFRLTNFYPSLSGYLYAIKKILSWKVPTLILGGGGYNFPDTARLWTRVTALTIEEVKGKKMTISPEIPEHSYFSRYGPDFELDIDYFPDSIQKHHRRILEQLRNYADLNKLIYDYDQVYQLY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HISTONE DEACETYLASE 8
publication title Structural Basis for the Inhibition of Histone Deacetylase 8 (Hdac8), a Key Epigenetic Player in the Blood Fluke Schistosoma Mansoni.
pubmed doi rcsb
source organism Schistosoma mansoni
molecule tags Hydrolase
total genus 152
structure length 399
sequence length 434
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-07-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00850 Hist_deacetyl Histone deacetylase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.800.20 Alpha Beta 3-Layer(aba) Sandwich Arginase; Chain A Histone deacetylase domain 4bz7A00
4ZUPA 5EEKA 5DC6A 5G10A 4CBTA 3Q9BA 5EEFA 5FUEA 4A69A 5EFKB 5THTA 5DC7A 4CBYA 1T69A 3MZ7A 4BKXB 5JI5A 4RN2A 1C3RA 3Q9CA 3MENA 5G0IA 2VQQA 3MAXA 4LY1A 4QA6A 4QA0A 1T67A 5EFNA 5DC8A 4ZUQA 4BZ8A 1C3SA 3EZPA 2V5XA 3MZ6A 5EFGA 5G1CA 5EF7A 2VQMA 5D1DA 5EEIA 4ZUOA 1VKGA 4RN1A 5EFHA 2VQJA 2VQVA 5G17A 2VQOA 5IWGA 4BZ7A 1W22A 4BZ5A 3Q9EA 5EFBD 2VCGA 4QA1A 2VQWG 5IX0A 5ICNB 5G1AA 1C3PA 5G3WA 3EW8A 3EWFA 3ZNSA 5BWZA 5G1BA 3C10A 5LI3A 3C0ZA 5EEMA 1ZZ0A 3MZ3A 3C0YA 5G0JA 5FCWA 5D1CA 3F0RA 5EFJD 5G11A 3ZNRA 5G0XA 1T64A 5G13A 4QA4A 3EZTA 4ZUMA 3RQDA 3F07A 5THSA 5DC5A 5G12A 5G0HA 4LXZA 5THVA 4QA3A 4ZURA 4QA7A 4QA2A 5THUA 3Q9FA 4RN0A 4CQFA 3SFFA 2V5WA 5EENA 4QA5A 3SFHA 5D1BA 4BZ9A 2GH6A 3F06A 5G0YA 4BZ6A 1ZZ1A 5A2SA 3MZ4A 5G0GA 4ZUNA 5EF8A 1ZZ3A
chains in the Genus database with same CATH superfamily
3SJTA 4ZUPA 4HZEA 1CEVA 5DC6A 5EEKA 5G10A 4CEVA 3E9BA 4CBTA 3Q9BA 5EEFA 4I06A 2EF5A 4RHQA 1HQGA 4MYFA 5FUEA 4Q40A 4A69A 1T4SA 5EFKB 4MYKA 3E8QA 5THTA 4Q42A 5DC7A 3LP4A 3NIPA 4IXVA 4CBYA 1T69A 3MZ7A 4BKXB 3MFVA 4RHLA 3SKKA 5JI5A 4MXRA 4RN2A 1PQ3A 3M1RA 4Q3RC 1T5GA 1C3RA 1WOGA 2A0MA 3Q9CA 3MENA 4Q3TA 3THHA 3MMRA 5G0IA 1R1OA 1T5FA 2RLAA 2VQQA 3MAXA 4LY1A 3MJLA 4QA6A 4QA0A 1T67A 4MYNA 1TA1A 2CEVA 5DC8A 5EFNA 4ZUQA 1ZPEA 5RLAA 2PHAA 4BZ8A 1C3SA 1WOIA 4IE3A 3EZPA 2V5XA 3MZ6A 3GN0A 4RLAA 4IU1A 1WOHA 5EFGA 5G1CA 5EF7A 2VQMA 5D1DA 5EEIA 1ZPGA 4ZUOA 1HQHA 1VKGA 2PHOA 3E6VA 3LP7A 3LHLA 4RN1A 5EFHA 4Q3QA 3TH7A 1P8PA 2VQJA 1RLAA 2EF4A 2VQVA 4RHKA 5G17A 4Q3SA 3THJA 2PLLA 2VQOA 5IWGA 4BZ7A 1W22A 4Q3PA 4IU4A 4Q41A 4Q3VA 4BZ5A 3Q9EA 2VCGA 5EFBD 4QA1A 2VQWG 5IX0A 1TBJA 5G1AA 5ICNB 1C3PA 4GSVA 1TBLA 5G3WA 4HWWA 3E6KA 3EW8A 3EWFA 3ZNSA 5BWZA 4RHMA 5G1BA 4GSMA 1T4TA 3NIQA 1WVAA 3PZLA 3C10A 5LI3A 3C0ZA 1P8NA 1P8OA 3NIOA 1ZZ0A 3MZ3A 5EEMA 3C0YA 5G0JA 1HQ5A 1XFKA 5FCWA 3TF3A 5D1CA 3F0RA 5CEVA 4ITYA 4RHIA 5EFJD 2EIVA 1P8SA 4FCIA 5G11A 3KV2A 3ZNRA 4HXQA 1T64A 5G0XA 4QA4A 5G13A 3EZTA 1D3VA 4ZUMA 3RQDA 1GQ7A 3DJ8A 3F07A 5THSA 2AEBA 5DC5A 5G12A 4G3HA 1TBHA 3MFWA 5G0HA 4LXZA 5THVA 3E8ZA 1WVBA 4QA3A 4GWDA 4ZURA 1GQ6A 4IXUA 4QA7A 4QA2A 5THUA 4GWCA 5HJ9A 3Q9FA 4MYLA 4Q3RA 4DZ4A 2ZAVA 4RN0A 4RHJA 3RLAA 4FCKA 1P8QA 4CQFA 3SFFA 2V5WA 5EENA 1T4RA 4QA5A 1HQFA 4Q3UA 5D1BA 1P8MA 2GH6A 3SFHA 4BZ9A 3F06A 1P8RA 5G0YA 4BZ6A 4IE1A 5HJAA 1ZZ1A 3GMZA 4GSZA 3THEA 3SL1A 5A2SA 1HQXA 3MZ4A 4IE2A 4IU5A 5G0GA 3SL0A 3F80A 3CEVA 4ZUNA 4IU0A 5EF8A 1ZZ3A 1T4PA
chains in the Genus database with same CATH topology
4ZUPA 5EEKA 5DC6A 5G10A 4CBTA 3Q9BA 5EEFA 5FUEA 4A69A 5EFKB 5THTA 5DC7A 4CBYA 1T69A 3MZ7A 4BKXB 5JI5A 4RN2A 1C3RA 3Q9CA 3MENA 5G0IA 2VQQA 3MAXA 4LY1A 4QA6A 4QA0A 1T67A 5EFNA 5DC8A 4ZUQA 4BZ8A 1C3SA 3EZPA 2V5XA 3MZ6A 5EFGA 5G1CA 5EF7A 2VQMA 5D1DA 5EEIA 4ZUOA 1VKGA 4RN1A 5EFHA 2VQJA 2VQVA 5G17A 2VQOA 5IWGA 4BZ7A 1W22A 4BZ5A 3Q9EA 5EFBD 2VCGA 4QA1A 2VQWG 5IX0A 5ICNB 5G1AA 1C3PA 5G3WA 3EW8A 3EWFA 3ZNSA 5BWZA 5G1BA 3C10A 5LI3A 3C0ZA 5EEMA 1ZZ0A 3MZ3A 3C0YA 5G0JA 5FCWA 5D1CA 3F0RA 5EFJD 5G11A 3ZNRA 5G0XA 1T64A 5G13A 4QA4A 3EZTA 4ZUMA 3RQDA 3F07A 5THSA 5DC5A 5G12A 5G0HA 4LXZA 5THVA 4QA3A 4ZURA 4QA7A 4QA2A 5THUA 3Q9FA 4RN0A 4CQFA 3SFFA 2V5WA 5EENA 4QA5A 3SFHA 5D1BA 4BZ9A 2GH6A 3F06A 5G0YA 4BZ6A 1ZZ1A 5A2SA 3MZ4A 5G0GA 4ZUNA 5EF8A 1ZZ3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZUP A;  5EEK A;  5DC6 A;  5G10 A;  4CBT A;  3Q9B A;  5EEF A;  5FUE A;  4A69 A;  5EFK B;  5THT A;  5DC7 A;  4CBY A;  1T69 A;  3MZ7 A;  4BKX B;  5JI5 A;  4RN2 A;  1C3R A;  3Q9C A;  3MEN A;  5G0I A;  2VQQ A;  3MAX A;  4LY1 A;  4QA6 A;  4QA0 A;  1T67 A;  5EFN A;  5DC8 A;  4ZUQ A;  4BZ8 A;  1C3S A;  3EZP A;  2V5X A;  3MZ6 A;  5EFG A;  5G1C A;  5EF7 A;  2VQM A;  5D1D A;  5EEI A;  4ZUO A;  1VKG A;  4RN1 A;  5EFH A;  2VQJ A;  2VQV A;  5G17 A;  2VQO A;  5IWG A;  4BZ7 A;  1W22 A;  4BZ5 A;  3Q9E A;  5EFB D;  2VCG A;  4QA1 A;  2VQW G;  5IX0 A;  5ICN B;  5G1A A;  1C3P A;  5G3W A;  3EW8 A;  3EWF A;  3ZNS A;  5BWZ A;  5G1B A;  3C10 A;  5LI3 A;  3C0Z A;  5EEM A;  1ZZ0 A;  3MZ3 A;  3C0Y A;  5G0J A;  5FCW A;  5D1C A;  3F0R A;  5EFJ D;  5G11 A;  3ZNR A;  5G0X A;  1T64 A;  5G13 A;  4QA4 A;  3EZT A;  4ZUM A;  3RQD A;  3F07 A;  5THS A;  5DC5 A;  5G12 A;  5G0H A;  4LXZ A;  5THV A;  4QA3 A;  4ZUR A;  4QA7 A;  4QA2 A;  5THU A;  3Q9F A;  4RN0 A;  4CQF A;  3SFF A;  2V5W A;  5EEN A;  4QA5 A;  3SFH A;  5D1B A;  4BZ9 A;  2GH6 A;  3F06 A;  5G0Y A;  4BZ6 A;  1ZZ1 A;  5A2S A;  3MZ4 A;  5G0G A;  4ZUN A;  5EF8 A;  1ZZ3 A; 
#chains in the Genus database with same CATH topology
 3SJT A;  4ZUP A;  4HZE A;  1CEV A;  5DC6 A;  5EEK A;  5G10 A;  4CEV A;  3E9B A;  4CBT A;  3Q9B A;  5EEF A;  4I06 A;  2EF5 A;  4RHQ A;  1HQG A;  4MYF A;  5FUE A;  4Q40 A;  4A69 A;  1T4S A;  5EFK B;  4MYK A;  3E8Q A;  5THT A;  4Q42 A;  5DC7 A;  3LP4 A;  3NIP A;  4IXV A;  4CBY A;  1T69 A;  3MZ7 A;  4BKX B;  3MFV A;  4RHL A;  3SKK A;  5JI5 A;  4MXR A;  4RN2 A;  1PQ3 A;  3M1R A;  4Q3R C;  1T5G A;  1C3R A;  1WOG A;  2A0M A;  3Q9C A;  3MEN A;  4Q3T A;  3THH A;  3MMR A;  5G0I A;  1R1O A;  1T5F A;  2RLA A;  2VQQ A;  3MAX A;  4LY1 A;  3MJL A;  4QA6 A;  4QA0 A;  1T67 A;  4MYN A;  1TA1 A;  2CEV A;  5DC8 A;  5EFN A;  4ZUQ A;  1ZPE A;  5RLA A;  2PHA A;  4BZ8 A;  1C3S A;  1WOI A;  4IE3 A;  3EZP A;  2V5X A;  3MZ6 A;  3GN0 A;  4RLA A;  4IU1 A;  1WOH A;  5EFG A;  5G1C A;  5EF7 A;  2VQM A;  5D1D A;  5EEI A;  1ZPG A;  4ZUO A;  1HQH A;  1VKG A;  2PHO A;  3E6V A;  3LP7 A;  3LHL A;  4RN1 A;  5EFH A;  4Q3Q A;  3TH7 A;  1P8P A;  2VQJ A;  1RLA A;  2EF4 A;  2VQV A;  4RHK A;  5G17 A;  4Q3S A;  3THJ A;  2PLL A;  2VQO A;  5IWG A;  4BZ7 A;  1W22 A;  4Q3P A;  4IU4 A;  4Q41 A;  4Q3V A;  4BZ5 A;  3Q9E A;  2VCG A;  5EFB D;  4QA1 A;  2VQW G;  5IX0 A;  1TBJ A;  5G1A A;  5ICN B;  1C3P A;  4GSV A;  1TBL A;  5G3W A;  4HWW A;  3E6K A;  3EW8 A;  3EWF A;  3ZNS A;  5BWZ A;  4RHM A;  5G1B A;  4GSM A;  1T4T A;  3NIQ A;  1WVA A;  3PZL A;  3C10 A;  5LI3 A;  3C0Z A;  1P8N A;  1P8O A;  3NIO A;  1ZZ0 A;  3MZ3 A;  5EEM A;  3C0Y A;  5G0J A;  1HQ5 A;  1XFK A;  5FCW A;  3TF3 A;  5D1C A;  3F0R A;  5CEV A;  4ITY A;  4RHI A;  5EFJ D;  2EIV A;  1P8S A;  4FCI A;  5G11 A;  3KV2 A;  3ZNR A;  4HXQ A;  1T64 A;  5G0X A;  4QA4 A;  5G13 A;  3EZT A;  1D3V A;  4ZUM A;  3RQD A;  1GQ7 A;  3DJ8 A;  3F07 A;  5THS A;  2AEB A;  5DC5 A;  5G12 A;  4G3H A;  1TBH A;  3MFW A;  5G0H A;  4LXZ A;  5THV A;  3E8Z A;  1WVB A;  4QA3 A;  4GWD A;  4ZUR A;  1GQ6 A;  4IXU A;  4QA7 A;  4QA2 A;  5THU A;  4GWC A;  5HJ9 A;  3Q9F A;  4MYL A;  4Q3R A;  4DZ4 A;  2ZAV A;  4RN0 A;  4RHJ A;  3RLA A;  4FCK A;  1P8Q A;  4CQF A;  3SFF A;  2V5W A;  5EEN A;  1T4R A;  4QA5 A;  1HQF A;  4Q3U A;  5D1B A;  1P8M A;  2GH6 A;  3SFH A;  4BZ9 A;  3F06 A;  1P8R A;  5G0Y A;  4BZ6 A;  4IE1 A;  5HJA A;  1ZZ1 A;  3GMZ A;  4GSZ A;  3THE A;  3SL1 A;  5A2S A;  1HQX A;  3MZ4 A;  4IE2 A;  4IU5 A;  5G0G A;  3SL0 A;  3F80 A;  3CEV A;  4ZUN A;  4IU0 A;  5EF8 A;  1ZZ3 A;  1T4P A; 
#chains in the Genus database with same CATH homology
 4ZUP A;  5EEK A;  5DC6 A;  5G10 A;  4CBT A;  3Q9B A;  5EEF A;  5FUE A;  4A69 A;  5EFK B;  5THT A;  5DC7 A;  4CBY A;  1T69 A;  3MZ7 A;  4BKX B;  5JI5 A;  4RN2 A;  1C3R A;  3Q9C A;  3MEN A;  5G0I A;  2VQQ A;  3MAX A;  4LY1 A;  4QA6 A;  4QA0 A;  1T67 A;  5EFN A;  5DC8 A;  4ZUQ A;  4BZ8 A;  1C3S A;  3EZP A;  2V5X A;  3MZ6 A;  5EFG A;  5G1C A;  5EF7 A;  2VQM A;  5D1D A;  5EEI A;  4ZUO A;  1VKG A;  4RN1 A;  5EFH A;  2VQJ A;  2VQV A;  5G17 A;  2VQO A;  5IWG A;  4BZ7 A;  1W22 A;  4BZ5 A;  3Q9E A;  5EFB D;  2VCG A;  4QA1 A;  2VQW G;  5IX0 A;  5ICN B;  5G1A A;  1C3P A;  5G3W A;  3EW8 A;  3EWF A;  3ZNS A;  5BWZ A;  5G1B A;  3C10 A;  5LI3 A;  3C0Z A;  5EEM A;  1ZZ0 A;  3MZ3 A;  3C0Y A;  5G0J A;  5FCW A;  5D1C A;  3F0R A;  5EFJ D;  5G11 A;  3ZNR A;  5G0X A;  1T64 A;  5G13 A;  4QA4 A;  3EZT A;  4ZUM A;  3RQD A;  3F07 A;  5THS A;  5DC5 A;  5G12 A;  5G0H A;  4LXZ A;  5THV A;  4QA3 A;  4ZUR A;  4QA7 A;  4QA2 A;  5THU A;  3Q9F A;  4RN0 A;  4CQF A;  3SFF A;  2V5W A;  5EEN A;  4QA5 A;  3SFH A;  5D1B A;  4BZ9 A;  2GH6 A;  3F06 A;  5G0Y A;  4BZ6 A;  1ZZ1 A;  5A2S A;  3MZ4 A;  5G0G A;  4ZUN A;  5EF8 A;  1ZZ3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...