4BZWA

Complete crystal structure of the carboxylesterase cest-2923 (lp_2923) from lactobacillus plantarum wcfs1
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
275
structure length
275
Chain Sequence
MQVEQRTLNTAAHPFQITAYWLDQISDFETAVDYPIMIICPGGGFTYHSGREEAPIATRMMAAGMHTVVLNYQLIVGDQSVYPWALQQLGATIDWITTQASAHHVDCQRIILAGFSAGGHVVATYNGVATQPELRTRYHLDHYQGQHAAIILGYPVIDLTAGFPTTSAARNQITTDARLWAAQRLVTPASKPAFVWQTATDESVPPINSLKYVQAMLQHQVATAYHLFGSGIHGLALANHVTQKPGKDKYLNDQAAIWPQLALRWLQEQGLLAGN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords LIPASE/ESTERASE
publication title Structure, Biochemical Characterization and Analysis of the Pleomorphism of Carboxylesterase Cest-2923 from Lactobacillus Plantarum Wcfs1
pubmed doi rcsb
source organism Lactobacillus plantarum
total genus 88
structure length 275
sequence length 275
chains with identical sequence B
ec nomenclature ec 3.1.1.1: Carboxylesterase.
pdb deposition date 2013-07-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07859 Abhydrolase_3 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4bzwA00
1QFSA 2B61A 3D0KA 5SYMA 2FUKA 1TK3A 1HLGA 4S0XA 5DLPA 1H2YA 4MEAA 2XE4A 4NMWA 1ZIYA 1GPKA 5ALOA 2BGRA 1XZAA 2Y6VA 4BE9A 3CN9A 5ALHA 1DWQA 4GHWA 1CUEA 4MWTA 4MWSA 5K3FA 4EY8A 3C5WP 1FFCA 1USWA 4PSUA 2WUFA 3C8HA 3D5EA 3HZOA 5HF9A 2C5GA 4FMPA 2WUGA 3G7NA 3IUMA 4H77A 4LXHA 3VXKA 1LBTA 3G0DA 1J1IA 5AI9A 3AUKA 1D07A 4TVKA 4Q3KA 3DDUA 1LZLA 3QPAA 4ZV9A 2H7YA 5K3DA 3BDVA 2HA2A 3R3YA 4MYDA 2O2IA 2G5PA 3AIMA 5HZGA 2HM7A 1MT3A 5HQ3B 4U2EA 2JGKA 4L0CA 1Q84A 2RHWA 1ZI8A 4MXDA 3R41A 5CT5A 2XMQA 3R3XA 1E5TA 4Q3LA 3I28A 4FLMA 4WFJA 2PM8A 1IUNA 1CUIA 2C58A 3DOIA 4U2DA 4IO0A 2XDWA 4I19A 2GBGA 1EVQA 2EDAA 2WFMA 1ZIXA 4B9EA 3I2HA 1VOTA 1DU4A 1YCDA 4DSZA 2JGIA 1H2WA 4UBOA 3NGMA 4B85A 1CUBA 3WI7A 3GROA 1SOMA 1T4MA 4AZ0A 2OCLA 3KWJA 4X95A 1KEZA 4U2BA 1H23A 5LKRA 4OD0A 1TCBA 2VTVA 1CUJA 1UT6A 2BJHA 4Y2QA 3C45A 2WG0A 3VVLA 1QLWA 4B84A 3AFIA 5KWIA 3G9ZA 5DNVA 2DQYA 4HAIA 1EHYA 4F21A 1ZI6A 5IKXA 3I6ZA 3FBWA 4K5QA 4PQEA 3PICA 3WL7A 5D3KA 4FFWA 2BUCA 2VATA 3F97A 4BAZA 1UKCA 4UPDA 2I03A 3BWXA 2EDCA 3O9MA 2PX6A 4U2CA 3OG9A 4ARBA 2C4HA 4YASA 4H35A 5DTIA 1XZMA 1MNQA 4YK7A 1QTIA 5FOQA 1TCAA 1CPYA 3WA7A 4B81A 3I2GA 1THGA 2QTBA 1GT6A 1R4ZA 2XMRA 4C88A 4CCWA 1CUFA 3D59A 3G0IA 1BCRA 4AO8A 5AICA 3B12A 5EIEA 1R50A 4YX9A 5LZ8A 4FLFA 3H2GA 5ALUA 4X93A 3EQ7A 4BCCA 2AJCA 2E3JA 2ZVDA 4RE6A 3VDXA 3IVMA 4BE4A 5K5EA 4WY8A 1E8MA 1OILA 5CW2A 2GYUA 5JASA 5JAPA 4G8DA 2J3DA 3CN7A 3H1AA 4QNNA 2QOEA 5ALFA 4FWBA 4ZXFA 1Y7IA 1CRLA 1ZD5A 4Y2TA 3IURA 5CH3A 3FLAA 5KBYA 2QZPA 3D4LA 4XVCA 5AHXA 1H2XA 5ALQA 3H2IA 4FNMA 2PU7A 2OLEA 1DQYA 3PFCA 1QTRA 3WKCA 1UWCA 5AKLA 1Q0ZA 3IULA 4UUQA 3IUQA 4GW3A 2QVBA 4DYHA 1W4LA 2OXEA 1HKHA 1A88A 5CMLA 1DINA 2H9YA 3EF3A 5EHXA 4A5SA 3O4HA 1KU6A 1ZD4A 3WYDA 3VKFA 4DLNA 3HYSA 1XZDA 1Y37A 3STYA 4MQMA 3DLTA 5FUMA 1VXRA 4X97A 4J0HA 1QJ4A 4B83A 4PW0A 3KD2A 1W75A 1LBSA 2HA5A 2O2GA 4J7AA 3STTA 4LHEA 1W6RA 5IVIA 1FFDA 3AIKA 5BWCA 4AO7A 4OPMA 2PVSA 3LS2A 5CH5A 1XZLA 4CCYA 1EX9A 5LP1A 1WB4A 3GZJA 2QM0A 2XQGA 2I3DA 3DYIA 1XRQA 4BBZA 2R8BA 2XMDA 3RLIA 5ALTA 3PDCA 4Q3OA 3AZQA 2XUPA 2UZ0A 2WUEA 4HXEB 1G5FA 5C81A 3DJYA 2WILA 4GEGA 3NOXA 1W76A 5FPQA 1XQVA 4UFNA 3KWFA 4NS4A 1UOPA 4H0CA 2OQVA 4ZWNA 1JJIA 4QDOA 1QIMA 3ZV7A 3DL7A 3LIIA 3GA7A 3WWPA 5FDFA 5E2IA 5ALSA 4QDXA 4W1QA 4J03A 2ROQA 2VJDA 5ISMA 5ALZA 1K6EA 4HVTA 4Y2SA 4UBIA 5DWDA 5EIAA 2NW6A 3A70A 2DHDA 4OB7A 1ZJ4A 5HCUA 1SC9A 4FBLA 4B0PA 4V2IA 3KDAA 4IH9A 5CH8A 3FCYA 1CUXA 2BKLA 4MEBA 3ED1A 4X94A 2C5FA 2XUHA 1K8QA 2OQIA 2HA4A 1J06A 1XLVA 1LPPA 4AO6A 2X76A 1OCEA 3IIIA 1CUSA 3G9TA 1QIFA 4UHCA 4Y2VA 1ZGCA 2WJ6A 5AKIA 1F8UA 1QZ3A 3AZOA 2VAVA 5KWJA 4DNOA 3JWEA 4P9NA 3L1HA 1G66A 3PF9A 4C89A 3QMWA 4QWWA 2V9ZA 2WU3A 5HF5A 4DNPA 1E3QA 1XQXA 4KR0A 1LLFA 1N1MA 1QIJA 1CVLA 2ONCA 1EDDA 3C6XA 1NX9A 3I6MA 1AC5A 2WHPB 1DX6A 1SCIA 2B4KA 3M83A 4IH4A 4AMYA 3V1MA 1ACJA 2XMSA 2Z3WA 1JT2A 1YB6A 3O9VA 3U0VA 4DIUA 4J0GA 2I78A 5DYTA 2WJ4A 4OYLA 1CV2A 3F98A 2CBGA 3DKRA 4GWLA 4BCBA 1X2EA 3B5EA 3ESDA 1F0PA 2DHEA 4AB1A 2RIPA 1AUOA 3OC0A 3H04A 5AIAA 4KACA 1HBJA 1CUWA 1QE3A 2XUIA 4H7IA 1BEEA 5EHNA 1CQWA 4EY5A 1WHTA 5I9IA 4KE7A 2BUAA 2Z5GA 5HK8A 1R1DA 1RYYA 1Y7HA 2VJCA 1R9NA 2CB9A 4CG1A 5CXXA 4E15A 1SCQA 3F96A 3UUEA 1GXSA 3G9XA 1K63A 5SYNA 5AKEA 1MX9A 3O4IA 1XZKA 1UKBA 5C8XA 3IBTA 5AKYA 1EVEA 2HFKA 1BRTA 1P0IA 4DTCA 1L7AA 3ICVA 4X71A 4HTAA 5AO9A 2Y6UA 2XQKA 5ALNA 5AI5A 4G9GA 3D7RA 2WJ3A 5JD6A 5IVHA 5AM3A 5YASA 2OCKA 1YAJA 2WHQA 5JAOA 2G4LA 4X91A 5K3FB 1JU3A 2WUDA 2XUDA 5ALGA 3F8SA 1AZWA 4LXGA 5AM0A 2J4CA 3BDIA 5HF6A 1IUOA 3BIWA 5CBKA 3D2BA 1LPBB 4DNQA 1BEZA 2QKYA 4UFPA 1TKRA 1HDEA 4G9EA 5A2GA 5AJHA 5I7UA 2WM2A 3S2ZA 3O4JA 3HRHA 3BXPA 5K3EA 1RP1A 3RARA 3WJ1A 3HABA 2DCMA 1E66A 4ZRDA 1FSSA 1GGVA 3FYTA 3H2KA 2G5TA 3F9CA 1WPXA 3HI4A 1R9MA 5ALKA 4E46A 4F0JA 3PUIA 2XUOA 2O7VA 4FOLA 5AKZA 2YXPX 1A8SA 3QMMA 3WKBA 4C4YA 5IVKA 4UHFA 4Q05A 1BN6A 3K2IA 2OGZA 5T4FA 1EB9A 2IIVA 3BF7A 2XUFA 4DMFA 5IH7A 3ESBA 4BYMA 3OOSA 4PV7A 2JGEA 3SX4A 1Q0RA 1DTEA 4B0OA 1EB8A 2QUAA 1MJ5A 5CT9A 1XZIA 3V48A 4CG2A 1JU4A 4X90A 1AKNA 5AOAA 4WDRA 4EY6A 3MGAA 1QIGA 1ORWA 2JBWA 5AM1A 2QUBA 1UOQA 4J0CA 3FWHA 2ZJ6A 1YS2X 3JW8A 4ZREA 3WK6A 4X7BA 2YYSA 3TJMA 4JYMA 1GQSA 4H7HA 5ALYA 4WY5A 2HADA 2XMGA 2HU5A 1LPMA 2QRUA 1EDBA 1QIKA 4J0JA 1BE0A 2XMCA 1C7IA 2GBCA 4C4XA 1N5RA 3KOOA 4M0FA 3TGLA 1N5MA 3H18A 2G63A 4B82A 4UHBA 1EXWA 1XZCA 2WG2A 3IUJA 5FXMA 4EUSA 2PSFA 3H19A 4DMHA 2V96A 4N8SA 3IB3A 1ZOIA 3HEAA 1XLUA 1J07A 3FCXA 4W1PA 2WIKA 3BL8A 3ILSA 5FKJA 5C8ZA 4JH0A 3BIXA 1GKLA 3WK5A 3P2MA 3WQHA 2QMQA 4ZV7A 5D3ZA 4TPKA 4JEIA 1H22A 1PFQA 2HA0A 4X00A 3ZPXA 5A7FA 1G42A 3K9BA 4X6UA 1CFJA 4QDZA 3GELA 2QT9A 3ANSA 2HU8A 2IX9A 5DJ5A 1YR2A 3WJ2A 5C8VA 2ECFA 4ITVA 4QWMA 2XMBA 2PUHA 1VXOA 4G1FA 5HFNA 5K3CA 4CG3A 2IITA 3I2IA 4AMZA 3WK4A 1M33A 2Y2VA 1NU6A 3N2ZB 4QLOA 3C6YA 1ISPA 4DNFA 3AIOA 3V1LA 2C0PA 2XUKA 4GDMA 1O6FA 2RHTA 1DWPA 3EBLA 1ZD3A 4OSEA 5CURA 1B41A 3D2AA 3WZMA 1QOZA 5E4JA 1MU0A 4ZI5A 2GZRA 1EI9A 1VE7A 2P8SA 3S8YA 5DNUA 2WTNA 4D9JA 4EZIA 5JIBA 3DNMA 1MAHA 3C6ZA 2Z8ZA 4QEKA 3W04A 1XZGA 5JZBA 5JARA 3HC7A 2JGMA 1XROA 5AIBA 1XQWA 5DTJA 3KXPA 5ALIA 4L72A 5ALMA 3MUNA 1FFEA 1CUVA 4DMCA 5ALVA 1ZI9A 5LZ2A 3SWWA 1CUZA 1ODCA 4BZZA 4BC0A 4KJXA 4CCYB 2WLSA 4LYDA 1TIBA 5ALJA 1JI3A 1IMJA 4I3FA 1CUCA 4BP8A 4C01A 4WCVA 1R88A 3DD5A 3SK0A 3T4UA 1VZ2A 4OYYA 1FFBA 3LIPA 4JUIA 1HL7A 3WWDA 1CUAA 2WIFA 2H7CA 4Q34A 4OCZA 2PU5A 4G4GA 1ORVA 1AMNA 3BJMA 2RGUA 3C5VA 4BDTA 4WFKA 5AKKA 1UK8A 2V98A 4C87A 1HPLA 1JFRA 4HS9A 4X6YA 4GI1A 3OPMA 2OG1A 5AM2A 2XQIA 1XFDA 4RNCA 5FV4A 3ESCA 4LXIA 3I1IA 4AN0A 1MNAA 5JYCA 3WKAA 1R3DA 1E8DA 2HA3A 1GPNA 2XQJA 5EHZA 1LPAB 4U2FA 2Z3ZA 2W6CX 4BVLA 2WFLA 5K3BA 3WWOA 4G8CA 5HK9A 3VJLA 3EIOA 4L9AA 4OU4A 1AQLA 3STUA 1IZ7A 4UBKA 3C43A 2ZYSA 2WHRA 4RGYA 1X2BA 1ZD2P 1N8SA 5ALPA 4KRYA 3N0TA 5AM5A 4BCDA 3FNBA 4F5ZA 1Q83A 3FLEA 3FLBA 5HFAA 4AZ3A 1B6GA 4AX4A 1XRNA 4FNGA 1UFOA 4PSCA 4BATA 2QJRA 3A2MA 1ACLA 4BDSA 3WK8A 2QXUA 5JALA 5JD5A 1MAAA 5AOCA 4Q1VA 4HXFB 3W2TA 3QMVA 4AN1A 1H2ZA 3A6ZA 5AI6A 1JKMA 3H1BA 3LCRA 3QVMA 4J0KA 1LPOA 4FBMA 1WOMA 1W52X 3WL6A 4OUKX 3YASA 5AK3A 4M0EA 4EBBA 1E8NA 3V9AA 5EGNA 1YAHA 2O7RA 4BTLA 3PF8A 3WWCA 4EY4A 2ZSIA 1ZJ5A 3GUUA 3FVTA 1K5PA 3IUNA 4H7DA 3WLAA 4BRSA 2FJ0A 5AK4A 5D6OA 4BC1A 1ODSA 5FLKA 2PSDA 1VE6A 3AILA 1XQYA 1YS1X 2GBIA 3MVEA 3C8DA 1CUHA 2HA6A 2JGJA 4ROTA 1MN6A 4HZGA 2XI4A 3L1JA 3FYUA 2PBLA 1QIHA 5JANA 2DHCA 4BRZA 5HF8A 1K4YA 2WFZA 2AJBA 1XKTA 3WA6A 2ZJ7A 4DSAA 2WTMA 4KRXA 5JAHA 3G0CA 5K3AA 5DYYA 2J3QA 3FYUC 1GPLA 3I6YA 4G5XA 4AXBA 3C70A 2JF0A 4Y7DA 2DSNA 2JGFA 5A71A 5BV7A 2D5LA 4Y2JA 3H2HA 4Y2UA 4EA6A 2HFJA 4PNZA 2OCGA 1RWQA 3G8YA 5ALLA 4LKOA 3AZPA 2RONA 1PV1A 1MO2A 1MX5A 4QLAA 1UK7A 4PSDA 4BP9A 2PUJA 4GBGA 1QO7A 1WHSA 4RE5A 3U1TA 4P92A 5AP9A 1JJFA 4G4JA 1SCKA 3RM3A 2V97A 4KE9A 2OPHA 4B6GA 3K6KA 1CUGA 4A16A 2ORYA 1P0PA 3QYJA 4HRYA 1XRLA 4FLEA 2CUTA 3F67A 5LZ4A 4IHAA 5CT6A 1CLEA 3HSSA 1MTZA 3WYNA 3AINA 4Y2RA 3IA2A 1BROA 3W06A 5A62A 1AGYA 1BU8A 1YSCA 3QM1A 4NVRA 2ZYRA 4KAFA 5JZ9A 5DYWA 4GLBA 2OAEA 2VEOA 5LLSA 4JYPA 1ODTC 2HIHA 1KU0A 1J2EA 3A2NA 3WIOA 4UBNA 5T4BA 2DQZA 5ALWA 3QPDA 2X8BA 2DR0A 2EEPA 1YB7A 3FOBA 3G0BA 7YASA 1UOOA 4H18A 3KSRA 2B9VA 2OGSA 1DX4A 5LKAA 3HLKA 3D2CA 4Y2XA 3R3WA 2XUAA 5AK5A 3QPCA 1CEXA 5CT4A 4H7FA 1FFAA 6YASA 3GFFA 3OM8A 1SFRA 2B20A 1THTA 1MPXA 1WPRA 2AXEA 5JADA 5HKBA 3FSGA 5AI0A 4W1RA 5AK6A 4N5HX 1VZ3A 1TCCA 1Z68A 4KE6A 3LP5A 1WM1A 2PKYX 1IVYA 1EA5A 3C6BA 1F6WA 4XWGA 2BCEA 1CUUA 1UKAA 4IQ4A 2WU4A 2PL5A 4PF1A 2PSHA 1QIDA 3MUOA 1VA5A 3DYVA 3ICWA 5EI5A 1P0MA 2VJAA 2ZYIA 1C4XA 2J4FA 1GQRA 2AJLI 2AJ8A 3QH4A 4X92A 5F4ZA 1QGED 4MQLA 4P08A 1YA8A 5ALRA 4PO3X 1OXMA 1ETHA 2ES4A 1L7QA 4Z49A 4N5IX 3LLCA 5HQ3A 2BUBA 2OAGA 4WJLA 5LZ5A 1TRHA 1UK6A 1XLWA 5AI8A 4B80A 2QXTA 4K6GA 4KE8A 3R3UA 3X3HA 1BN7A 4OB8A 1S8OA 4KAJA 4EB0A 4XX1A 3E0XA 4L3WA 2H7XA 3QITA 3WK7A 5KREA 5AH0A 4FDMA 3W05A 5AM4A 3H17A 3V1KA 2XUJA 3QZUA 3DEAA 3NUZA 2W22A 2FX5A 5A7HA 3AJAA 4A23A 2WIJA 4TGLA 1QFMA 1YA4A 5EFZA 2WG1A 1LNSA 3HXKA 1IZ8A 3IDAA 1BS9A 2AJDA 5DNWA 4Y2YA 4RPCA 2XB6A 3TRDA 2RAUA 4WDQA 5AKJA 1NU8A 2WIGA 3RK4A 1EK2A 4LYEA 3WIBA 4ARAA 4F60A 2HRQA 1O6GA 5FPPA 3ANTA 1JMYA 3WMRA 3OURA 2PSEA 1ZGBA 4HRXA 1U4NA 4C4ZA 1DT3A 2ZSHA 1CQZA 1XZJA 2JGLA 3WK9A 3WZLA 3D3NA 2CMFA 5H3HA 3HACA 2Z8XA 4K6HA 3HJUA 2YH2A 3O0DA 4BTVA 4XIIA 3WKEA 1AX9A 2HDWA 4N8EA 3DOHA 4OB6A 3PFBA 1CR6A 2VF2A 1L7RA 1XKLA 1LZKA 2GBFA 4EHBA 4B7ZA 4IH1A 1LGYA 4NZZA 3B3QA 4BAUA 4K2AA 3UUFA 3UMJA 5A7GA 3I2FA 4YPVA 1T2NA 5LZ7A 1LPSA 3I1YA 2QJWA 5LZ9A 4X3CA 1GKKA 2HL6A 4KYVA 2XLBA 5FRDA 2QS9A 1QONA 4H7KA 2JEZA 4ZGBA 2I3ZA 1AURA 2CEKA 3BJRA 1DQZA 3DKKA 1XZHA 4INZA 4QA9A 2WQZA 3STXA 2GZSA 2GYWA 1EDEA 4BB0A 4BZWA 3T52A 3FVRA 5EHQA 4KAAA 1UK9A 5ALDA 2VT6A 3DL4A 3Q8WA 4CFSA 1TAHA 3NWOA 2VJBA 5T4HA 5ALEA 4E11A 3WKDA 2WIDA 4UBMA 4X85A 4DGQA 5JATA 1BCSA 5BOVA 2JEYA 4W9RA 3BE8A 3O95A 2K2QB 5I8PA 4DM7A 3QBJA 1WB6A 1WCYA 4G8BA 5A6VA 4UBLA 4U2GA 5JD4A 1GZ7A 4LIPD 2WKWA 2WFLB 1W1IA 4BVJA 5HKAA 1A8QA 1WB5A 2VSQA 5E4YA 3ZLVA 3H0CA 4CI9A 1IUPA 1EK1A 3L1IA 5LYYA 2HRRA 2Y1KA 1VKHA 5AKXA 2BGNA 3VVMA 2CZQA 1QIEA 3R3VA 3G02A 3ZWQA 1HQDA 4UHDA 4KEAA 1DT5A 3STVA 3GBSA 4GECA 1MX1A 3E1GA 2H1IA 1C7JA 3G0GA 4FFVA 1TQHA 4QDTA 2HA7A 3STWA 5BWBA 4B9AA 1F0NA 4MYSA 2BFNA 5CRIA 2CKMA 4UHEA 3W9BA 4H7JA 4UFOA 4XJVA 3VISA 2Y2UA 4FKBA 5J3JA 3I2KA 4HXGA 3PI6A 1EINA 1U8EA 3C87A 5ALXA 4JNCA 3I2JA 2HU7A 3A2LA 1VJ5A 2XQFA 5FP0A 3ZLUA 4J0DA 3VJKA 5AKHA 5ESRA 1A7UA 4I4CA 2ACKA 4W1SA 4Y2PA 5AI4A 4W63A 4CIAA 3ZLTA 3V1NA 1CUDA 1DWOA 4UHHA 3SC2A 3ZI7A 1P0QA 5LIPA 3RKSA 5C7YA 3FYUB 3VJMA 1VA4A 3O4GA 4WFIA 4EY7A 3R3ZA 2C0QA 2VAXA 2DFPA 4Y9SA 3ESAA 4M0MA 2R11A 2XLCA 1QO9A 3WL8A 4FTWA 2CJPA 5AKGA 1JJBA 5CXUA 3Q0TA 5D7BA 2O2HA 2ACEA 5T4EA 2VA9A 2XMZA 3M3DA 2Q0XA 4QE3A 4MJ3A 4BAGA 2PSJA 4FHZA 1XZFA 4DMKA 2X5XA 3R40A 4QDUA 3DCNA 2BAGA 5CTAA 3R0VA 5IVDA 3W9UA 4CIBA 4G4IA 3WWEA 3EQ8A 5JZSA 1EH5A 3JYHA 3CCBA 2C7BA 1LPNA 3H2JA 4N8DA 1XRPA 1CUYA 4E14A 4QZVA 4K6KA 1VLQA 1UXOA 2QR5A 4X6XA 3E3AA 3PE6A 2FJPA 2VQ6A 1PJAA 5E4TA 1UZAA 1A8UA 1X70A 3CXUA 1JMKC 2XUGA 1QIIA 1XRRA 5JAUA 3E4DA 1XRMA 3OTQA 2D0DA 2WHPA 4OU5A 2VT7A 3DQZA 2RI6A 2ZYHA 4AQDA 4ETWA 2OGTA 4J3JA 1XZBA 2XUQA 2GYVA 3PUHA 1U2EA 3BF8A 5CT8A 2XT0A 2OCIA 4Q82A 1CIJA 2YASA 1E89A 3M81A 4O08A 5AOBA 2ZJFA 3FAKA 3EQ9A 4J0IA 1FJ2A 3M82A 1ZICA 4H7EA 3DS8A 4BVKA 1G4HA 4P93A 1I6WA 4UBJA 3CCCA 4GXNA 3FSGD 2JIDA 1XZEA 5EIHA 3TEJA 1U65A 2LIPA 4C6HA 2HHAA 3G9UA 2PPLA 3WL5A 1YASA 2WSLA
chains in the Genus database with same CATH superfamily
3NYWA 4MB6A 5SYAA 3WTCA 1Z26A 4WPGA 1W4AA 3VX4A 4LC9A 1GQQA 5AJWA 1AUXA 3BQMB 4DG9A 5AVZA 2WUWE 5DLPA 1H2YA 2CDBA 2V5AA 3KV3O 2O8DA 1KMCA 3O92A 5ALOA 2BGRA 4D74A 3P5BA 4HVAA 1ANKA 2BONA 4AMUA 4N82A 1XDDA 1N75A 3R75A 1K7EB 5C1PA 1QK5A 3FYDA 4MGYR 4Q3AA 1XVVA 3KHTA 1WMDA 2EATA 3DMRA 1VRVA 3ZN2A 4BE9A 4M7PA 4FS8A 1DWQA 2ZATA 4EJ0A 5KJFA 1VJTA 1FP2A 4L5CA 2BMVA 2Y66A 3BB1A 2YMMA 1JHRA 3COYA 3E4CA 3EYWA 3F6PA 1SCUB 3Q1KA 4YRRA 3PC2A 1NJ5A 3QEMA 4X54A 3E5RA 3GDWA 3ZKWB 2F1JA 5EJ7A 3HHPA 1RXVA 3N6XA 3DZGA 4NOKA 1PSWA 4TKVB 1FFCA 1SXIA 4RHUA 3N2GB 1USWA 5HF9A 1V41E 3T5AA 3T3OA 2VEDA 4TL6A 4TVBA 5FI1B 2ZRIA 3R74A 3ZJ4A 4XYBA 1BGXT 2QMUA 1DHTA 2WUGA 4OX9Y 1PLLA 5FBHA 4PLFA 5BMVF 3G7NA 3IUMA 3QW4B 3X2FA 2AZTA 5EG5A 4DQKA 2OZLB 3CKMA 1L1RA 1U9JA 2PA3A 4PX2A 3U81A 3GGCA 3VXKA 2F8MA 2CV2A 2YQZA 1DEXA 2DPGA 4RACA 3CG4A 3VR5H 2I4MA 221PA 4V0OA 2PX3A 2R48A 5AI9A 5ESXA 3WJ7A 1T29A 1IN7A 1MEEA 1DDOA 3AUKA 4EGCB 3A3OA 3M5WA 1EX7A 5IULC 4XIYA 4HNQA 4RA6B 1Z7YA 2JKZA 3M9XA 2BH2A 2P9TA 1D07A 3V8BA 4ZTBA 4D92A 2ON6A 2ZPTX 3C3BA 1H3EA 4CF3A 1P7CA 2HWYA 4HAOA 4CGZA 4D43A 1PGQA 3NC0C 1BE1A 3FPSA 4JEHA 1ISJA 4E12A 2JIZA 5CFOA 5AW0A 1P8AA 1PGOA 2R79A 3MGGA 3I9OA 1GRRA 2XECA 1I7NA 4LC1A 2A9VA 3A4MA 3WRXC 4L9RA 2HA2A 3R3YA 2P75A 4MYDA 3OTGA 4RGVA 4X20A 1JEEA 1VRWA 2G5PA 4R2WA 5BN1A 3J80A 4IVNA 2VHTA 2QW1A 2HM7A 2VRNA 2C9BA 3I6IA 5HZGA 1MT3A 5HQ3B 1Q7TA 4B7CA 4U2EA 3D7MA 2AI2A 3RJ5A 4FCWA 4NAVA 4BY9E 4I4TA 5DT9A 5TC4A 4ZCSA 1W1UA 4P2BA 3VV3A 4M7OA 4RNDB 2QX9A 4BX8A 4V03A 4MXDA 4D9HA 2IU0A 1N5JA 4ND1A 3ZBUA 4QXRA 4RIFA 3ZHSA 3BHJA 4Q3LA 2ZBUA 4H6WA 2C3MA 1R0YA 2OR3A 3LPCA 3MHTA 4DCOA 3I28A 1E4EB 4PPQA 3MM4A 2XNDA 5CA1F 1YGPA 3N76A 1JR2A 3RODA 2AG8A 2W58A 5H5JA 4LJ9A 3ETCA 5DNEA 1NMSA 4HDRB 4IO0A 2NUAA 2XDWA 3NYQA 4MIEA 3UAXA 3O8RA 4MVJF 4Z4FA 2WFMA 1Z29A 2QTZA 4C7BA 2QLLA 2F4VB 1NIJA 2XB4A 4IINA 4DJTA 3OY2A 1BJRE 5KC9A 3I2HA 1VOTA 3U6BA 1VKOA 1ZC4A 4MGZR 1KJYA 4B85A 2R3SA 3AEYA 1VMEA 3Q7PA 3ZHZA 1CUBA 2B9EA 3DOCA 4C0KA 2IYZA 1XDBA 1QGUA 4YRNA 5K7SA 3EE6A 4KWCA 4XVUA 3K09A 1W59A 2I7DA 3MRTA 1T4MA 1J99A 3OT4A 3HNPA 4S1PA 2OCLA 4AZ0A 1ICEA 2GBPA 1E3WA 4HCJA 3GQBA 3RO7A 1WVGA 2IYQA 3RVLA 4BQRA 4HEJA 4XSGA 1H23A 4M9RA 3AJ8A 2A9FA 3BC1A 4JBIA 2CL0X 2Q9CA 3VH1A 1S2IA 4OLBA 4I99A 4E5KA 3M1IA 1TTQB 2CF6A 2FVYA 3UK0A 5IXJA 1TCBA 2HNBA 1CUJA 4J29A 3QIAA 4NEHB 2GPTA 4DIBA 2RG1A 3AR7A 4FOTA 1GDHA 4HB2A 4HR7A 2YDYA 4FD2A 2I4OA 2JHAA 4Q93A 3DMFA 4QD3A 4X8OA 1IY9A 2GO1A 3C48A 4LC0A 5TPZD 4MRRA 3UC9A 3WFJA 1FDIA 2ZAOA 3SP1A 4EUFA 3GLFB 3I0MA 4I8IA 1DQPA 2Q0QA 1QLWA 1U3TA 1DKQA 4LWOA 1BS1A 2ANBA 1P2VA 2PO7A 2XA2A 2ZIXA 3CLUD 3R3HA 5F73A 1H9BA 1L1FA 2P8JA 2G5GX 3EAFA 1DIAA 3BULA 1USKA 2AXPA 4X1KB 4R68A 4XOUA 2DQYA 1ZH2A 5DNVA 1OKKA 2XE8A 4UDXX 3SM9A 3BT7A 1R10A 2PGLA 1EHYA 3AI7A 3IEKA 2JLRA 1OPRA 1Z5GA 4GOMD 3PI7A 1BH2A 4KQKA 3G89A 5D84A 1CZLA 4E5SA 3LFTA 3NHUA 4XWYA 3WIVA 3KOUA 2J5KA 2W6MA 3EXEA 1ESMA 3ETDA 4P1ZA 3LWDA 3EFHA 4WBNB 1QRUA 5HIKA 2HHLA 3O3NB 4RCVA 3UMBA 2ZDGA 5K6TA 1Z2NX 2BUCA 2YNMA 2OY0A 3FGZA 3WICA 1Y0BA 4BAZA 4NG5A 5DXFA 1RI1A 4MAFA 4UNQA 5L45A 1U80A 1UKCA 3GH3A 2Q2NA 1DAMA 1E0AA 4YMLA 4QECA 2H08A 3CYFA 3O9MA 1DFHA 4RS3A 3PRHA 2IU4A 1V2HE 1JXAA 3OQMA 4DCGA 1R8QA 1GCUA 2W71A 3GPBA 4YDHB 2QGZA 5D3MA 2G36A 2HZ7A 3OZCA 2FRXA 2NO9A 4ARBA 1I1OA 3K35A 3T4XA 1LA2A 1XZMA 2C8VA 3DT6A 1GUZA 2D5CA 2XWQA 4IO1A 4YK7A 2BTQA 4ES6A 1QG6A 3O1IC 4KFRA 4OI0A 4LRTB 1TCAA 1POWA 1M0SA 1OFHA 1FNCA 1GAWA 1WKCA 2OXCA 2ZRKA 3E9NA 3WA7A 1KETA 3ECCA 1W73A 1X7YA 3ND5A 3SE0A 4WK2B 4EO4A 3G79A 4FMDB 2Q6TA 3I2GA 1KAEA 4XD2A 2JFYA 4YAOA 1T0UA 2ZPAA 3IUBA 4WBSA 3K4HA 2FZ4A 3UK7A 1J20A 3AV3A 4C6TB 4NYJR 4HLQB 1FNBA 3Q3JB 2CZGA 4ISBA 1J56A 2AKEA 3AR9A 4TTJA 3U48A 4LRYA 3GOHA 3FF4A 4CCWA 3ADBA 3QFHA 4QRDA 2XZPA 2Y0PA 1RACA 2O8CA 5DGTA 1BCRA 5IF9A 2VTDA 1TJ5A 2EERA 1WXWA 2KW5A 3I9KA 1U8AA 1V9LA 2BGGA 3N0RA 2YYZA 2B4RO 1ZS9A 2LW7A 4EJ2A 1A4UA 5EWLA 1PP4A 1PNOA 3CNEA 3EGIA 4JT9A 5DGHA 3SSNA 5BMVB 4ALMA 4G0WA 2O3SA 3PUJA 3TOVA 2C20A 2HPVA 4ZVSA 1JRLA 5F7XA 4CF7A 4NTZA 5MHTA 5GJVC 3DONA 2JLXA 3GJ7A 4FX2A 1W2WB 3G7UA 4ML3A 4UZEA 3A9VA 3TN7A 4EB8A 4BNGA 5MDHA 3W5CA 4RIHA 2ZVDA 3ZKAA 2WPDD 5JRZA 5HJ2A 4OYRA 3L41A 3SJZA 3VDXA 3FKSD 4L9WA 5BYBA 1AHPA 4JUCA 1U8TA 4HLDA 2ZTVA 1E2BA 1L9KA 3LP8A 4R1UA 5F12A 3HBMA 3VH4A 2ZRGA 4TMZA 3EIHA 5EP2A 2IPOA 1F4LA 3QU2A 5JSFA 2B2NA 5JASA 1BNCA 4JD5A 4P4NA 3EXG1 3GVIA 1WCIA 4NWIA 4J07A 3KQKA 4YP0A 4ZODA 1VCMA 4CRWB 1S2NA 13PKA 4LE1A 4X24A 4WY2A 3H1AA 3TW8A 1WCWA 3KEMA 3OKPA 1I2ZA 2OVBA 2O8DB 2YBDA 1ZLYA 2CK3D 1SUEA 2OOKA 1WU7A 3TPZA 5JNVA 5G0WA 4KXXA 4ZXFA 4K6MA 1Y7IA 2EIHA 2XNKA 5CGZA 3Q8MA 2GN0A 1ZD5A 2WSYB 1EKXA 3LWNA 3IURA 3C3WA 3TPCA 5IASA 2RGDA 1F0KA 3VA7A 5CH3A 4BB9A 1ZW1A 3FLAA 4UEJA 2BCJQ 4KR3A 3O82A 5ARCA 1A4RA 2CJWA 2CF5A 1GG2A 2ZUTA 3M3PA 4XSHA 5AHXA 1Q7BA 1AKRA 1ZM4A 1EVZA 5D00A 2ZJBA 4KWTA 4DA6A 2VQEB 4LI0A 3L07A 1QDLB 2IXTA 4O6VA 4I0WB 3Q6IA 3THRA 4AG5A 5ALQA 1U3FA 4QTTB 3TEFA 1K66A 4GZ5A 4GOOD 3INNA 5CNMA 3CH4B 4FFDA 5AQ1A 2H5IA 1E6LA 1UOEA 1JKJB 2O23A 2PH3A 3GG2A 2Y93A 3KPJA 1YULA 4HNVA 2OCPA 3IBYA 3BG5A 3H9GA 3A04A 4EYSA 3WKCA 1NXTA 1UWCA 1KH3A 1M2NA 3OZBA 4RXTA 4JSTA 1JQAA 4CCYB 5T3UA 4UUQA 2PL9A 4R8KA 2EQAA 4GW3A 4DYHA 2YVLA 1YB1A 3C0KA 3GMTA 4PVCA 5FWXA 1A88A 1L5LA 1Y5MA 1DINA 1IZYA 1RKXA 3OY7A 4MV8A 5KYNA 2IS1A 1IBMB 1NQWA 4M6WB 4XQEA 4DQ0A 1UANA 4DTIA 1UMBA 3PGKA 1UFQA 3OE7D 5CITA 3H5WA 4U5XA 3UTDA 1IY0A 1E79D 4G1VA 4K28A 5T6MA 4MA4A 1ZD4A 4IAOA 3ZG6A 3WYDA 4H6PA 3EW9A 2ZBPA 4D6XA 3ROFA 1G5RA 5A1TA 1TPZA 2MDTA 1NQUA 3P52A 4BXOA 2AA3A 1I3OA 1UC8A 1HRKA 3MJTA 3TG2A 5EMMA 2C4VA 5A03A 1U1EA 4PBSA 4WESA 3RWOA 4DPLA 1SNYA 1XD8A 2A1UB 1ITZA 2CHVA 3REGA 1GTJ1 2WMYA 3FRIA 3FUCA 3HFJA 3NQ41 4HEHA 4J0HA 3SJAA 1QPZA 3B1WA 1E0JA 3AP2A 3DHVA 5AVTA 3RNOA 3W77A 4RHTA 5F78A 1LSUA 3K8QA 4B35A 4AURA 1UH5A 2I6FA 3BE5A 3OQJA 4UNNA 2MMGA 2C92A 2WWGA 1Z2OX 2AG0A 3OIUA 4OSPA 3OQ1A 4IJ5A 5DT2A 1JHMA 3FA2A 2G7ZA 4JT8A 1F2TA 2PMBA 4P0TA 1LDGA 3TI7A 4MYTA 2N1MA 1QH8A 2H52A 2QUKA 4ND6A 3FPAA 5JBQA 1EX9A 3A1SA 3HI6A 3LDGA 3UY4A 2CLKB 2FSVA 1X1BA 2I6XA 1XRQA 1IG3A 5I7VA 2E4XA 3HXLA 1SRRA 2XTJA 5ECGC 4BV3A 2BKUA 4QBIA 3M6IA 1U8FO 1TQDA 2BRUA 3EOBI 1GRNA 5C1DA 3RLIA 4DIKA 5IEBA 1EVKA 3KQLA 5FPSA 3PDCA 3AZQA 2QVGA 3FWPA 3I5MA 4L74A 1JPNA 1QX4A 1SA0B 2H54A 6AT1A 3TCXB 4N7JA 4D6PA 2PZJA 4GKKB 1U2DA 4LQCA 5KYVA 3DJYA 1JWBB 1TYZA 5D01A 1ZM3A 2CY0A 4UE3S 3UENA 2WILA 3WC4A 1H69A 4QM7A 3ZQ4A 3SQDA 2FMFA 3KJIA 3PQ2A 3VPAA 1K75A 4DJ5X 2ZR0A 3HO6A 2ISSD 1N2XA 4CTNA 4UFNA 2ATVA 1QG2A 1U8YA 2H1CA 3TOXA 4JENA 2DKFA 2DY0A 3A32A 3LDFA 2ZWIA 5D2CA 1WMFA 4ZWNA 5JLAA 4WRRA 4OREX 2BEKA 4GX1A 4W5JA 3GA5A 3G8CA 1JJIA 1MB4A 4QDOA 4KUHA 5IARA 4DR6B 3CRVA 2OP1A 1U0FA 2FZWA 4MUNA 4PR3A 2CUNA 2HF8A 2YZ2A 2O0KA 4YQYA 4YRPA 3SYNA 3ZDRA 4C78A 5E7IA 3A37A 3V3TA 1X86B 1JUDA 1T6NA 5FDFA 3GAMA 2GLXA 3U3RA 1B8VA 2J46A 4A03A 4G07A 5FOSA 1A9XB 2PS0A 2HPHA 1T3ZA 3LYAA 1UBJS 2BEWB 1U1FA 4NCXA 3Q5DA 3UOGA 1ZJ6A 1EUZA 3BWEA 4LZZA 5CX1A 4KXUA 1NF3A 1ST2A 4KBYA 1W5BA 3G59A 4P53A 4O2AF 2ODPA 3TVDA 3FCSB 3IUEA 3HG7A 3LLMA 4AQ7A 2BZ1A 3GJ6A 1ISRA 1PJCA 4TRRA 5EIAA 3PC6A 3PFGA 2NZUG 3KTAB 1RQGA 2BKAA 3B2NA 4HT3B 5TIIA 3PDJA 3QE2A 2YJ5A 1ZBQA 1SBIA 1KJWA 1ZJ4A 2SECE 1Q7CA 2HHCA 3K9NA 1KK3A 3Q3IA 1XDUA 2I22A 5BQOA 5KX5A 2BEUB 3KDAA 1C9NA 2C7VA 4RETA 4OFWA 5D87A 4LNAA 4PM4A 3EVGA 1CY8A 2C07A 3ROGA 4R9SA 1M6NA 2W6ID 3AY6A 1CUXA 2FAXA 3IELA 2XTNA 3A1FA 5EHIA 4D8XA 3M4YA 2VQDA 3JTMA 3K1AA 4IV0A 4O0LA 4EB6A 4BNTA 3RYIA 3RUCA 3CVWA 3L7NA 1K8QA 4HEA6 1XTRA 4DLTA 4WBXC 3UT5B 4JLMA 3PXGA 5C8YF 1IAQA 1LPPA 2BM8A 3IAFA 3OD5A 3OE5A 3OTWA 2YWEA 1V48A 4BQQA 1YIAA 4CCAA 4IW3B 5TS2A 4AUEA 5LQCA 4R1PA 1KYIA 3ENVA 1OF1A 1VHQA 1QIFA 3JQ8A 1RQNA 2RE8A 5K05A 3ZCUA 2YV1A 4IMIB 1CY6A 4J0QA 4UHCA 3WO1A 5M2QA 3PJGA 1P2GA 4RXUA 2NOAA 5AKIA 3LYUA 2ZUUA 4IICA 2O8BB 1ZKDA 2CNBA 4RTOA 4CMBA 2R1VA 1E2PA 3ES9A 2G88A 1BHQ1 4HFMA 1JYFA 4EX7A 1KOGA 4RY0A 1I14A 1ZNWA 2UUOA 5HS6A 3W8RA 2AR0A 4RADA 1N25A 4N0QA 3I72A 5F76A 1HETA 3ZHTA 3UPUA 5JO9A 2LV8A 3HH8A 4RMIA 2E6UX 2BEJA 3FKQA 4PTZA 3RK1A 2XVZA 3KQVA 3JWEA 1P4RA 2DOKA 3L1HA 3PTZA 1KO4A 4IIFA 4P9NA 4YI3A 3PF9A 5FIUA 3UANA 4C89A 3N2KA 4K9RA 4KQJA 3DG9A 1I24A 2D2XA 1RAIA 2WU3A 4LHYA 5E9WA 5HX7A 1DAHA 1MXFA 3ZW9A 4B8ZA 3WX0A 4N39A 4KR0A 1N1MA 1QIJA 2ZT6A 3NRCA 4YC7A 3VRHA 1QTNA 3GUCA 3VC7A 4B3SB 5CB4B 3R6WA 3T3PB 3Q72A 2EGGA 4Y9DA 1FSFA 4IZ6A 5CBPA 1DX6A 3BHNA 3RJ9A 3OZ7A 4GKVA 1WNTA 3FWKA 3KB8A 4N5DA 1ZRMA 4F1JA 1ACJA 1W85B 2XMSA 1HSZA 3ABSB 4LHVA 2Z3WA 1HI9A 3O9VA 4XM2A 3ZHRA 4V1CB 2Y76A 4K0RA 2P9ZA 1JR3D 3FMFA 4J0GA 4YECA 2V7QA 3K16A 3A27A 1P80A 2FRDC 4LNUB 4EA9A 5F52A 4PPGA 1CV2A 1Y8RA 5COAA 3LCJA 2CBGA 2C59A 5E2BA 3DMDA 4MA5A 2D1YA 3U16A 4GPAA 4TS9A 3PGJA 4RW0A 3SC6A 1TOAA 2EEZA 3ESDA 1F0PA 4K87A 1Q44A 2QL6A 3P94A 1G5QA 2R7KA 1WEHA 1M1UA 1ECFA 3EGEA 3I42A 5ED0A 5H3CA 3RV3A 3CX7A 1L4GA 3W2HA 2DKOA 4DR4B 4BLVA 2F8LA 3IKJA 2V1UA 4FNAA 4HH3C 2ODBA 3UMMA 3PE3A 4ZJPA 4HSEA 1EQ2A 3AWIA 4AS2A 2F8SA 4YRKA 1X7XB 4PHTA 4EY5A 3HR8A 3OIVA 2XX3A 3E27A 1IVSA 1TM3E 2JKYA 3HCNA 1KERA 4A9AA 3R7LA 2AZMA 4X64B 2Z5GA 3OMWA 4BKOA 3L43A 2I66A 3JQAD 3R9WA 1QVWA 4E1VA 4R41A 3DP7A 3H3XA 4JYBA 3FPKA 4KK4A 2AEMA 1RYYA 1Y7HA 2R97A 3H4MA 4YFVA 4ZZIA 2CB9A 4EG5A 2QMZA 2FMTA 3WTBA 5CXXA 3BMQA 1V95A 3IT3A 4PWYA 1PG0A 1LC0A 3CLVA 1RI4A 3KSDO 2GZ2A 3F1KA 1ADCA 4A15A 4C2UA 1YDEA 5K0ZA 3G9XA 1PE0A 5KNBH 1GRCA 2NU6A 4LJAA 4FVTA 5SYNA 4YLYA 1DBIA 2QRMA 4DBLE 1XZKA 3HU5A 1KZYC 4YJDA 4B5LA 1ACMA 1A5AB 1U28A 1X1AA 2E6KA 5IJAA 2HJGA 2HFKA 3EIWA 3D6VA 3NIFB 4FDAA 4ENUA 5TVKA 1C7FA 1BRTA 3B82A 3GAAA 2I62A 3NBMA 5CM8B 1FYDA 2O0JA 4FFMA 3LH5A 1W36C 1QZTA 1R6VA 2XAUA 2C78A 2ZTUA 3LGXA 4IKEA 4M1KA 3WLIA 2VUHB 3GX1A 1W0KD 3CZ5A 4QTZA 1BVUA 1K5GA 2CW5A 1LBQA 2H6EA 4RY2A 5AI5A 4C4ZA 4GX0A 1ZD8A 3QOWA 4FYIA 5ADVA 5B6PA 2GEDA 3ZHUA 3O8NA 3X1YA 1VBMA 1Z5OA 1AOXA 3EWAA 2OCKA 3HDHA 1BZYA 3NO4A 2ATCA 3PHLA 4OQEA 5I9TA 1NY6A 2X4IA 1YAJA 4X91A 5C51B 1C3JA 1V16B 4KN8A 1I33A 4V0KA 1OQAA 5DSTA 3L4BC 4NCKA 4G5FA 1G63A 1J6UA 1PJBA 3NWEA 4NULA 1KI8A 2WUDA 2JVJA 3ZNNA 3U56A 2XUDA 5KWVA 3P9CA 3FNHA 4PPNA 3MMXA 4GQBA 3ASZA 2QAGC 4JL6A 1FQJA 5FHQA 2RK6A 2W2LD 4YJ2F 3F8SA 3ZQ6A 1ABEA 2H0RA 3A6KA 3HBJA 2ISQA 4CFZA 1V9SA 3CRNA 4LXGA 4Q4LA 3QQPA 3Q3CA 1QCYA 1IUOA 4YJ3A 3M33A 4KXWA 3PHIA 2X2PA 3N58A 3L4EA 2X1HA 5HIMA 2AB0A 5KAMA 5IN5A 1P3DA 3TL3A 4MMZB 1IDOA 5A0FA 3NTOA 2QKYA 4UFPA 1JTEA 1TKRA 3RUIA 3O8OB 4A3SA 4HDOB 2FSSA 1Y7TA 1LRLA 1Z6ZA 5G1OA 1A77A 2WM2A 2K5UA 5IP5A 3AHDA 4NAHA 3VHLB 3E2IA 1QHEA 4DQUA 3WWZA 2A5JA 1EK0A 3BXPA 4QXAA 1GR0A 4EYKA 2QBYA 4JI8B 3ZWCA 5EKSA 1D6JA 1BXRA 2AG1A 3HABA 1KE1A 4E2WA 2C97A 4B74A 4JP3A 3H3JA 2IHUA 3DH0A 4U63A 3NOVA 2JFHA 3P96A 2XEXA 4ZRDA 4B3MB 3GARA 1FSSA 3DBLB 3DO5A 1SKQA 3K15A 4YRIA 4ZC1A 1FVXA 2CV0A 1P7PA 1RKBA 1VJDA 4YN3A 4P4SB 3I2YX 2G5TA 3T9BA 2WBLC 4YRAA 2VJMB 1N2BA 1V8FA 1R27A 1MOZA 1N0UA 1G291 3LC1O 1SCNE 3FXAA 1J2UA 3AW8A 3WGIA 1GA4A 2IOQA 1I1NA 2ZKIA 4S1TA 4BO5A 4N3NA 1S2GA 2JFUA 3HNRA 2I6TA 3MYRA 1NHWA 4LYJA 3WV4A 2W90A 2O7VA 5AKZA 9ABPA 1Z4KA 2YRWA 3MOSA 2WABA 5H1YA 1C29B 5B7GA 3JRXA 1OXKB 1DC3A 1GOTA 2Q6IA 1AF7A 1C9DB 1E9FA 3HB4X 3HCAA 2W5UA 1F48A 3H1FA 4QU9A 5FTJA 1BN6A 2W48A 4PGFA 5A3JA 4LFAB 4EH1A 1HE3A 2OGZA 2PUEA 4MVJH 1TZCA 3BEOA 1NVKA 2AMFA 2NN3C 3DLIA 5I7OA 1BQ4A 3JARA 3DEIA 2VYNA 3DEZA 3OQBA 2XUFA 3EGDB 4JEMA 3JS5A 4IDBA 5DFAA 4DMFA 5JS6A 5KPJA 4IF4A 3U4AA 3RIEA 4BYMA 3VKHA 1MJGM 5L4NA 4ZKDA 5ENZA 4H08A 3H7IA 3H5OA 5EA2A 3DAFA 1CE8B 5TMBA 2HLDA 1RQPA 2BM1A 1T3SA 3GF4A 3AFOA 1SU6A 4KMSA 4PY2A 5TMEA 1N6PA 4C05A 4ZYUA 1A95A 1CK4A 1JIJA 3AG6A 3PRJA 4G84A 1F51E 1W4BA 4NPHA 1NYLA 4XPIB 5T8KC 3RYFB 4EYEA 4RDCA 5IWAB 1ECBA 4TWRA 1FX1A 4TSFA 3A9SA 1AKNA 3CB4A 3M34A 4WDRA 1NVMB 1Y6ZA 2I80A 2CVZA 2XZDA 3KFVA 3PENA 3MGAA 3FBGA 4XYLA 4YUWA 5KINB 3H11B 3R8XA 3RAPR 2EV9A 1RHUA 1G1MA 4RGQA 4DWWA 1YE5A 1I5RA 2CD9A 2D4HA 2GD6A 2H1WA 2JCBA 4I4IA 5ANRB 1KBOA 2BJVA 1IUKA 3OI7A 2JBWA 4RTNA 4AY3A 1EBBA 1GU1A 1CZRA 1MC1A 3I32A 4RPLA 3B3AA 1DOHA 3I9NA 5FBZA 1KI7A 4PGMA 4DR1B 2HJWA 1ONBA 1MA3A 4ZZ1A 2MSCB 3FWHA 3MWFA 4O29A 4Z9FA 5CFQA 3BB3A 4CM5A 2EVWX 1L6RA 1VDMA 3CR3C 3H86A 4QUHA 5IHPA 3ZD7A 1Z18A 3PC8A 1VE5A 2BI8A 4OHOA 5A9SA 1OH8A 5C80A 3DW1X 1SKYE 4UM8B 3GGOA 4ZO7A 4CQMB 1WY7A 5HKKA 1OU4A 5HRUA 1OB5A 2X86A 1VP3A 3BTVA 1RRVA 2O0LA 3DV0A 4IIBA 3WGQA 1E62A 3AONB 3GPLA 1RI2A 2B1IA 1PW5A 3VPSA 1DJQA 2ECQA 4JYMA 4WZBA 4YJFB 5BSGA 3RS5A 1ZUWA 4H7HA 2WWRA 2CE2X 1A8HA 3E9QA 4ZXPA 1DHRA 2YZGA 4NESA 2X0JA 4DMRA 2HU5A 2QRUA 1PS9A 3Q8XB 4C76A 1Q1AA 2UVQA 4OFXA 3N05A 5ICFA 1NF2A 5LDDC 5EUMA 1OLSB 2ZG6A 4RF2A 3U5TA 3RTCA 4AJ9A 5KZMB 1HDGO 2JHPA 5BRAA 4M9ZA 4NXNB 2HBRA 3FSJX 3QGMA 1N5RA 2Z95A 4S24A 5LPNA 4RJTA 3RU2A 5JVDA 1T3TA 4NENA 4DV1B 1QZZA 2HB6A 4M0FA 1YFJA 3TGLA 5F1OA 1U0EA 4OK3A 3KPWA 2CSUA 4L7QA 5EVCA 3ZJ5A 1D6NA 3NDRA 3TYXA 3ANYB 2PKEA 3SZGA 4QVIA 8ADHA 4IGFA 3RIXA 3VR6H 4Q1AA 1EXWA 4U6QA 1PKEA 2OFXA 2XYRA 1XRJA 2HRZA 5F2OA 1L7MA 4CKEB 4UCXA 3R7FA 1G38A 4RIEA 4CKBA 1P0FA 1QQ6A 1NXOA 4EUSA 1Q92A 2PSFA 1L7OA 4KI7A 3H19A 2J9FB 4WTOA 3SVLA 4IDPA 4RDHA 3B52X 3RM3A 3RIMA 1C1DB 2XY4A 4IIJB 4C3OB 1NBEA 4EQ6A 3A4TA 4LZNA 4FYHA 1Z6AA 1Z8HA 3I12A 3IB3A 4MP8A 3ORFA 4UU1A 2AC2A 5MN5A 1YK0A 2B3DA 3A1VA 4XASA 3FCXA 4LYAA 1L5GB 5ICSA 4K88A 5G4KB 2RAFA 4BO0A 2OUIA 2WIKA 1G98A 1UZMA 4DHEA 1RE0A 1GUYA 9LDBA 1ZHFA 1CY4A 1RWVA 2CGEA 2D2IA 2G4VA 2OGUA 2HXGA 3AHFA 3DL0A 4PZ9A 2IEYA 5TRTA 2BWJA 3UWSA 4IGAA 1J8DA 4KBFA 3P2MA 4BJHB 4Z2AA 1JFVA 1MIOA 3A1NA 4GZ6A 5CYFA 5CB6A 4OY3A 3WQQA 3TPFA 3DBRB 1QC5A 3UAGA 1JA1A 3QPVA 2IOYA 3D6UA 3TZCA 1KDZA 2HA0A 4G26A 3NT5A 4F4UA 3A8TA 2NZ2A 4X00A 4TRNA 4D4GA 5A7FA 3KUCA 1DEOA 4L5AA 3R9KA 4UMDA 1H85A 2VWHA 3H8JA 3LUAA 1CFJA 4O4IF 1PV4A 4YV1A 3DVAB 3U4MA 5IT5A 1UIMA 4CNQA 1QF9A 1AD2A 3L5KA 3MB8A 3ZX4A 4E4RA 2FFHA 3FOZA 2RGYA 2PV7A 3O38A 1T36A 2GEFA 3ANSA 3MOGA 3TQRA 3ZLJA 3CNQS 5BN3A 1IOVA 1HWYA 4UNPA 3RWMB 1JEYB 4KX3A 5LUBA 2IX9A 3UJBA 2ZULA 4EF4A 1YR2A 3R5TA 4J6FA 3KPYA 4Y6OA 4C21A 3KEQA 1J9ZA 4ITVA 4BPBA 3SGLA 5G4KA 2JJ1A 2G08A 2YWJA 3BMCB 3LECA 4PQFA 1UT8A 1T13A 3R7BA 4AUNA 1VXOA 4G1FA 1H0HA 2HCJB 3LHIA 4M0KA 5JAQA 2FXIA 2O06A 3VM6A 3I2IA 3WK4A 5F3DA 3QFRA 3L6CA 2ZB3A 3N2ZB 5HOQA 2FW7A 3LL4A 5EMHA 4MR9B 1MQSA 4D3XA 1BD4A 4QLOA 1KYZA 2JLQA 3TQIA 4DNPA 5DO9A 3EGVA 1ULUA 3WGJA 1XBTA 3V1LA 4GUDA 3G9QA 4DCPA 2C0PA 1PV2A 2KBEA 4JJAA 5HP4A 2XUKA 3HBAA 1PVOA 2BW0A 1YGYA 2VQ3A 5E1OA 4GZ3A 4KTVE 2GLUA 3U4DA 4YT4A 3P7MA 1ABBA 1OI3A 1IPHA 3OQNA 2FDRA 4IM7A 4MDHA 1KI6B 4HP8A 3LPDA 3OUUA 1B41A 1W96A 1UXGA 3HE3A 1PZEA 3NDPA 1LSOA 1IOLA 4TN1A 4LXYA 1WP9A 1D1PA 1NNSA 2P9BA 2NUPB 3K5IA 2FZCA 1QB7A 1S96A 2W6JA 2OENG 1PL8A 3ZZUA 3T1OA 4J1TC 2HWUA 2BOVA 2P8SA 1JHDA 4V0MA 1PNTA 4XRRA 5DNUA 3WNCA 4D9JA 4L5YA 4EZIA 1IJEA 2F1RA 2QTLA 3NEPX 3DNMA 3G5AA 2BFBA 3QHQA 4KQCA 3ZZNA 1W44A 2BFCB 5EVJA 4B8WA 4BRWA 4WWHA 3HC7A 5JARA 4CM9A 4NE2A 4ZDKA 2XTAA 5CYGA 4ZEXA 3ZWAA 3PR3A 3KJFA 4BEWA 1NWCA 2R6AA 4G0YA 1XU4A 3INRA 2QM8A 5AUQA 2Q7OE 3PHGA 1W88A 3GUZA 1T8WA 2YHIB 2OWEA 3Q6NA 4PYLA 1QGAA 4L72A 2CXRA 2XHEA 3ZGOA 4F4FA 4MR8A 1M1XB 1P1JA 3QXHA 1LLQA 4R2LA 3BD6A 3HK2A 2I2XB 1TEZA 5LZ2A 2WF6A 1A5SB 3EVNA 4JSRA 5BUCA 3SWWA 3OM0A 4BNKA 5IKEA 3F6YA 3ZWNA 1X1EA 2B99A 3OP4A 4RPKA 4XM1A 4ZAWA 4CKZA 4CEHA 3EMDA 3MIZA 3ISVA 5B4TA 3KOMA 1M2FA 1OAKA 1TKCA 1B74A 1C0PA 1UINA 2O2YA 1QU3A 4BIMA 1TIBA 4EATA 1IMJA 2GRUA 2IYLD 1SU7A 2BISA 1T5OA 2FFBA 2BFFB 2P4QA 3EUFA 3M4JA 3NM6B 4H6XA 4I3FA 4LPKA 1M3SA 5K0JA 3QEOA 1G17A 4LI3X 2UYGA 1CUCA 3A1WA 4MP3A 1NP6A 4NBNA 4KLAA 2ECPA 4L9SA 1HDZA 3W2IA 2Z30A 3MUEA 3RJTA 5C5EA 1ZXBA 2HMVA 1KAOA 4KIJA 4Y9UA 4QKQA 3GEMA 1SCBA 3OMXA 3JQGB 1RKVA 3R0ZA 4XGRA 2IEDA 3LBAA 3SK0A 2C2MA 4CN8A 3O1JC 5DXJA 4A8HA 1KMNA 3KSBC 3NHRA 3TWOA 4S2EA 4ZDIA 4IVRA 2Q0HA 1NTRA 2IE0A 5KYUB 2H5EA 2BLLA 1L5OA 2IYNA 3AHGA 3QENA 3R5KA 5EMLA 3DL2A 2NU9A 3L0PA 1K89A 4R2XA 2AHRA 4KHPB 2CHFA 4YACA 4RFSB 4MRMA 2BFPA 3S6JA 4IXDA 4IVPA 2P5TB 1FDRA 4OCZA 3ROPA 2QROA 1T3HA 1T0HB 4WECA 5K4GA 1SHKA 1P44A 4NMXB 2PGIA 3FMPB 4MUFA 5JG7A 1T8PA 5L7TA 1PEAA 1Y1LA 4LZLA 1BG6A 5HTOA 4CEIB 3PHJA 4JITA 3NETA 3CR7A 5B2EA 2HUNA 4OM8A 5IDWA 2DFNA 2IUFA 1HFEL 3N86A 2JVKA 2BE7A 1EAYA 2HLHA 3IEIA 4KYIB 1OMOA 1RFGE 3L4JA 2AOTA 3SF8B 3S28A 4HYEA 1JFRA 4HS9A 4X6YA 4QOHA 3U0BA 1X9IA 1XTVA 1Z0FA 2VO1A 5EJFA 4P83A 1W35A 2OG1A 2KLHA 4RU1A 5HGJA 3ZZ1A 1UBGA 3ZEAA 4C3VA 3CUEF 1JBKA 1BQ3A 2CNWD 3FLMA 2GKOA 4YRDA 1G21E 2GAOA 4KYUA 3VBCA 1XPOA 1KS9A 3FGOA 3FPJA 3IBSA 3I1IA 1YOVB 3A4LA 3C15C 4LS3A 2XODA 4YHHB 1DZ3A 2KSQA 4DC1A 3ZV5A 2R6HA 1HTTA 1NVWQ 1TU4A 1DIBA 2QJOA 3FIJA 3OCYA 5DWQA 2GF2A 4BKRA 1R5NA 2IBMA 5IZCC 5I51A 5L3VA 4AT1A 3LG2A 4D44A 4EJSC 2UAGA 2JLSA 2XQJA 1T9BA 4B75A 4DLWA 1CP3A 4E5YA 2ZSBA 1OGIA 2DFDA 2GBLA 3OIFA 3JVEA 1RWKA 5DWVA 5E6UB 3RBVA 4BX2A 2WFLA 3WWOA 3LYLA 2CLOB 1DWUA 2ZETA 2Q5HA 4EDFA 4EYOA 1W2HA 1U7WA 3SZ3A 1WZEA 1CF9A 1S2DA 3ZOZA 3IBGA 1JU9A 2F43B 3K5WA 4RMGA 2BM0A 3SBXA 3P97A 4UATA 3MC1A 3U62A 3ZNPA 2COUA 1HT3A 1RE1A 3NEJA 2OCDA 3DXFA 4W5WA 3WRYC 8AT1A 4EEZA 3LC0A 3IVXA 2C1ZA 3E1KA 4YJHB 4DLPA 1DKMA 3Q98A 4ZZ2A 1F2VA 2N0SA 4IYRA 1D7AA 1KJNA 4PEVA 4CLOA 5I4KA 2IEZA 2C04A 3IVRA 1X2BA 1ZD2P 2IVZA 2VXCA 3ISTA 4HN2A 5TT0A 2JCGA 1XQ9A 2I7VA 1SQ6A 4MHTA 2X9VA 4WBNF 2NZYA 3ABZA 3ZD9A 2QUHA 4EF6A 2F64A 2MOKA 1VGVA 2CJFA 4FEGA 5CIQA 2EX0A 3KNZA 3TGWA 2C31A 3BIOA 4QGSA 3EXFB 2VSFA 2R7AA 1WOYA 5EIBD 5LOVB 1FXWF 2KHZA 1Q0HA 4TM7A 5CGQB 1SBQA 2FSIA 1RWPA 3U4QB 4YRZA 1KBQA 1UC5B 1XRNA 2HTFA 2REBA 3MAJA 4UTPA 3FD8A 4PSCA 5LYJA 5EMKA 2ARKA 2YHUA 3NG1A 4KPUA 1I13A 1Y1KE 4PYKA 3A2MA 3EZ6A 4O5AA 4I81A 5DI3B 4BDSA 2QXUA 1MAAA 2JFNA 1LU9A 4Q1VA 5JCPA 4DCCA 4E3WA 3TMYA 1H2ZA 4C03A 1N2OA 5FO1A 1JIXA 3NPAA 4FMDF 4DLVA 1K98A 1ZO8A 4MW1A 3LCRA 3U40A 1KJJA 1D1TA 1ZHOA 3PUXA 5JJLA 2XDQB 1JVSA 4QUIA 4JI1B 4PG8A 2PVPA 1N0VC 3IERA 1WOMA 3MT7A 4RKEA 1RM4A 3PPIA 3WL6A 1YVRA 4HQ6A 2BY4A 3C8MA 4YBZA 1R9GA 4Z7NB 3HP7A 4PONA 4CM8B 2E48A 4RK5A 1P1CA 2DUNA 3NHFA 3SNHA 3ZBTA 3GLGE 2B21A 2AZXA 3LCCA 4EBBA 3PL5A 3DBIA 1EK5A 3B3JA 2G1PA 1EXNA 5K3OA 3WWCA 1BXGB 4EY4A 2H3HA 2RKOA 2ZI9A 3GUUA 1ZN8A 3RPEA 4A6XA 3PXEA 1K5PA 5LWHA 4ZRMA 2WNIA 3QLJA 1RRCA 4BFCA 1VL2A 4MW9A 5K09A 2MR6A 5M5BA 2FJ0A 3ESRA 3VNAA 5AK4A 1YRAA 1HG0A 1PWEA 1AV7A 3WB9A 2PE5A 1OHHD 1ORTA 1A9RA 1XJWA 5F3RA 3VNUA 2VTEA 3H5LA 3CPSA 4ZIRA 4L2IA 3QVWA 4TLCA 4XEHA 4D8YA 3VPBA 5EE9A 3GY0A 3CLTD 1QB8A 4MW0A 2H4HA 3HJRA 5DF1A 4BO4A 4H2DA 2YC2C 3AILA 3D8UA 3K0AA 1C9KA 3DM5A 4LF6B 1AG9A 1VL6A 5EKDA 1KK1A 3HUDA 1YS1X 1NRXA 1O95D 1P45A 1AS0A 4GBED 4MUKA 2YFKA 3GHHA 9LDTA 5K20A 2MYTA 2JGJA 4NZMA 4W82A 3UMGA 1VHWA 2Y1GA 4ZVRA 2JD0A 5TF4A 1CYEA 3ESQA 5IJWA 3L1JA 5SZKB 3BJZA 4XFKA 3FYUA 3IALA 5DBFA 2IZ0A 4DLUA 3OF3A 1H8ED 1W94A 3SLGA 1FZQA 2DHCA 3BJIC 2ZJOA 3PGXA 1X42A 4DCNA 3BMNB 4HVCA 2PJUA 1I94B 1NKSA 1QRSA 3WGOA 4YPOA 2A9QA 1YR9A 1XKTA 3WA6A 4N12A 4DSAA 4I5DA 1SIWA 5JAMA 4JA2A 2NYVA 1IN4A 3L7JA 5K3AA 2P91A 2FWRA 4GC5A 3KVNA 2ZTHA 2XXAA 1TFRA 1NRJB 1TMOA 1QYXA 2ASVA 3E2PA 3SZMA 4RZHA 5AHRA 1R00A 1GPLA 1RQ7A 3A6DA 3C7DB 3O4VA 4JKIA 3MWJA 4ZD6A 2V45A 1H3NA 1VG9B 5JS8A 1VJGA 2W37A 5K0TA 3ADOA 2D0OB 1OI4A 2L42A 3C70A 3GN1A 3I73A 2ZB2A 3RIYA 2D74A 2GCOB 4BTEA 3B1ZA 1INLA 2OV1A 4I1OA 2FB9A 1QTQA 3CZQA 4H0FA 2XGJA 1KMQA 1LJUA 3AY0A 3WL3A 1KPGA 2IPLA 2ZSDA 1GARA 4PNZA 2REQB 1IZZA 2ZQ5A 2ZRLA 3NTRA 4ZVKA 2DB3A 4ZQIA 4CUZA 3GFBA 4JUFA 3OEYA 3W3AA 2ZI6A 4LKOA 4Z0HO 1BJKA 2GZ3A 3AZPA 4EI2A 1U2PA 4US1R 3ITDA 2RHOA 2C5SA 3LL7A 3EVBA 1ZVMA 5I3CA 5BYAA 2VYVA 4FPXA 4FZVA 2YWFA 4MYCA 5JY6A 1A9TA 2VP9A 4R54A 1IEXA 1PEKE 3P9QA 4QOJA 5E6SA 5A4FS 2NNLD 4PZEA 4CL3A 1UK7A 3RS9A 3GZNB 3U7GA 2LCQA 1RZRD 2HNAA 4LYFA 3FH0A 1SC3A 2X0IA 3G85A 1O5TA 1KQFA 4YIHA 5AP9A 1PG2A 4HO1X 5DYIA 3JD1A 4OGLA 1SCKA 3KVVA 1JF8A 1RRMA 3IJ5A 4M1YA 3ZXYA 3SBOA 4QDKA 2OPHA 5IF3A 4QHYA 1K2VN 4RD6A 4TTRA 4GNKA 2EFHB 4HS4A 4A0QA 5TX7A 4KRGA 1XLTA 2WF7A 3K1JA 1CUGA 4O3FA 4OMFG 4XWKA 2ORYA 1D3AA 3U44B 2GK3A 2H1RA 4ZDWA 4UHKA 4TROA 3EWNA 5E1MA 3RDPA 3BUSA 2FN7A 2XF2A 4NZ9A 5BNTA 2JZOA 3K0CA 2HZBA 1XRLA 2FEKA 2M9MA 3GWGA 2CUTA 1E2FA 4TMYA 2GN6A 2DPXA 4LOIA 4RLQA 4XQ9A 4DL9A 3FTFA 1XCPA 2GK6A 4OP1A 5CT6A 2G77B 2V7UA 1CLEA 4XVHA 1XJQA 5K6AC 3HSSA 4FZ5A 4AN4A 3AINA 4Q4CA 4Y2RA 3QE0A 2X7XA 4CT5A 1TTTA 3NHBA 3ZLUA 3W06A 2EGUA 4MINA 1ULSA 4DWOA 5A62A 3RFVA 2ZWPA 1QGOA 4M76B 4M87A 3PQFA 3DAPA 4DRXB 4EG3A 2OZKA 4KAFA 3DEHA 5GONA 5JZ9A 5HJ5A 1T26A 1RYMA 1ZMBA 2H31A 3ACDA 4NOLA 1E63A 1KJIA 2OAEA 4KXYA 1RJFA 2J9GA 1DC6A 1P2TA 3H84A 1Z06A 2I1VB 4MS3B 1IN5A 1VYTA 3ENWA 3TINA 4DARA 3M4XA 3MT8A 2EARA 4B48A 3TZKA 6LDHA 5DULA 4UBNA 1S1CA 1QF7A 4JJ4A 4NS1A 4Q9NA 2OFWA 3BK1A 3MRSA 1QQAA 4MEJA 3DDWA 1Q91A 3FOBA 4ZHQA 4Z54A 3W2GA 1K8ZB 2Q62A 2Q6LA 7YASA 4E5UA 5KS2A 1QYVA 3AYZB 3SR4A 2ZDQA 2GHIA 2DWCA 2YMQA 2O8NA 3HZHA 3LVBA 5DW3A 3NFRA 5F2KA 1USIA 4DZZA 1I6MA 5LKAA 3FHJA 3ZXUB 4HX2A 3DP9A 2DFVA 2ZE7A 2ZRJA 4UVEA 2R8RA 2KBFA 2AFIB 3CLSC 1I51A 1TCVA 3CQ9A 3WIDA 1SU8A 3KT0A 2O59A 2NVUA 2JEOA 3PNPA 2MT9A 3OJFA 4HG2A 1F2DA 2QSYA 1M7GA 4OQYA 4BNNA 4Z1OA 2M6LA 1CEXA 4FFOA 4MB2A 1TUGA 4KQ6A 4JX9A 1J49A 1KYXA 5CT4A 1SM4A 2GD2A 6YASA 5JU6A 2KPOA 4L5BA 1M8JA 4OA5A 1TW2A 2I1LA 3LKZA 3WLHA 1XU7A 5A5FA 3D8NA 3K71B 4ZT2A 3AR4A 4F1KA 1Q1EA 1NQVA 2WHEA 1Q7EA 1WZUA 1L7VC 2ZU0C 4D2IA 4M9SA 4DSNA 3ZDAA 4BNWA 1F6DA 2IYEA 1GADO 3KHSA 4JQCA 4NRDA 2HQSA 2QQGA 4A8TA 2LCFA 1Q16A 1BVRA 3BWVA 3BZUA 1NVDA 4AICA 2WJWA 4LY3A 3NAZA 3KK0A 4JB3A 3ZY2A 2UYHA 1TCCA 2DYKA 3LT0A 5EWJB 2C3UA 3OA2A 4URUR 3USZA 1E2IA 3LP5A 2GPBA 2WMNB 4RD2A 5AJTA 2VYCA 1PJ2A 3CMMA 4WA8A 3ZHVA 1WUJS 4GMGA 2E0IA 2JFBA 3SDBA 3Q8KA 4AZWA 1T15A 2XBLA 4X9XA 3UWOA 2IX3A 5K6AA 1N0WA 4E4YA 5HIIA 2DFKB 4DWVA 4RJJA 2XXJA 1QH1B 1SOAA 1UKAA 2BCEA 4MKRA 1N4AA 3S4YA 2Z8YA 2B4TO 4NZYA 1G6Q1 1EJ6A 4RESA 1M5UA 5C5DA 1MFPA 3P19A 3DYVA 4PRKA 1U0GA 1TZKA 3PUZA 2Z9DA 3HVRA 1P0MA 2GYYA 4IMJB 5EWMA 3D3JA 2B5VA 1B6SA 3HBNA 5E0KB 5BR8B 1N36B 2C8LA 2VJAA 2PWAA 5TR9A 1JFFA 2OWDA 3OJOA 1PLKA 4J7CA 1AKYA 2QWXA 3HB1A 4H17A 1GQRA 4FGUA 4YUZA 1IEVA 1AM4D 2HQOA 3OCWA 4ZTZB 2GGSA 1YC2A 3U3ZA 2QTRA 4EITA 1XAHA 4X1OA 1XHLA 3MAAC 5LP6A 2K4MA 1ZMXA 3LO8A 5J63A 3RUDA 5KOJB 1T9GR 3KZMA 4MQLA 4P08A 4XDZA 2IU6A 1KEUA 4OA8A 2Q45A 1BMQA 1C2TA 3DOUA 4BQPA 4TV8B 2I1WA 1O6ZA 2B1QA 2C42A 1FC0A 2GEKA 2X77A 4L3VA 1AKEA 2X0DA 4BQEA 1R0RE 3GLHA 3OWXA 4J49A 2GJSA 2AQHA 3VU9A 4Q4JB 2FZ5A 1VIMA 1CIPA 1GRVA 1QKJA 1WW2A 2V0CA 3EDCA 3H8SA 4O4JA 1HNNA 3PNKA 1JHYA 4L8VA 4Z49A 3HB7A 2VRCA 3R8FA 1FYFA 4Q5IA 4N5IX 3O8BA 3ITEA 3LLCA 1RZVA 4QVKA 2J6HA 2V7PA 3TQSA 1K6JA 2C7RA 2R8OA 1P4GA 1UK6A 2OTCA 4O2BB 5AI8A 4YP1A 3VR3D 4K6GA 1AZSC 5SICE 4H6VA 5JMWA 2NSYA 3P0JA 4G24A 3W2EA 4XFDA 1ORHA 5DM70 4OB8A 3L92A 1S8OA 4W7SA 5JS2A 2W43A 1JPJA 3AV0B 4WKOA 1U3DA 4MJ7A 1J21A 4EAAA 2X0KA 3PCRB 4EMTA 5IJ9B 5IPFA 1WBDA 2B34A 3E0XA 3FCEA 3NKFA 4UDOA 4MS4A 1XWWA 5PGMA 3QITA 2ERXA 3JZDA 4RKFA 5TQ2A 4YAIA 5KREA 1N32B 1KI2A 1VE1A 3TL2A 2Q1UA 1TD1A 2CXNA 1Y4UA 1BXZA 2A7QA 4GSKA 1WXQA 2JFXA 3GT7A 3QSGA 2YIMA 4KLNA 5DBOA 1OZAA 1DGQA 2H1HA 5C1IA 3SNKA 1C8KA 1CR0A 4WK6A 3PUVA 2NV6A 1PZMA 3UIEA 1WS6A 3TW6A 3E7XA 4JX8A 2ZT8A 3TFQA 1E77A 3QZUA 3V6LA 4POOA 3NUZA 1QS0A 1AKMA 1THZA 4XTRA 3RHSA 3SM3A 4PYOA 4TTAA 2FWIA 2Q3LA 3H1PA 4LY6A 4B3GA 2VJYA 2FZKA 3HBFA 5L53A 1I30A 3G2MA 5DM60 3LW8A 5FTWA 4F5DA 2PT9A 3R77A 2FSHA 4BJ1A 4A23A 1X80B 4OJKA 2AQIA 4HPWA 5F51A 1R0XA 3ZUGA 1XVAA 1T24A 3OX3A 1FYWA 1JFLA 1KVRA 5CDHA 2ZJ5A 4FB4A 5E7JA 4FK8A 4U3JB 1DOZA 2SCUB 1RNLA 4GWGA 5D51S 1KR2A 3SXUA 4QJ4A 3DFFA 1TT5B 3T3IA 5B3JC 3CF0A 1K4KA 5AW5A 1NQTA 2EAUA 5JCOA 3N87A 3AESA 5AVUA 1MAUA 2XA1A 2C95A 2PT5A 2AJDA 5COQA 1W25A 2YR0A 1Q3HA 4LZJA 4RPCA 4UU8A 5DNWA 3RF6A 3HJNA 1DKUA 4FSDA 3U7EB 5KYYB 1NU8A 3RK4A 5C1BA 2Z4TA 4DA4A 2ORIA 3A14A 2ZSEA 4Z7JA 1PBNA 2Q8PA 1CJMA 1MCZA 1HDRA 2DT5A 5JQWA 2PIAA 1G8SA 1KGSA 3OZWA 1RMQA 4XYMA 4F7DA 5LXTA 1Q1BA 1ZFNA 4F60A 4HAWA 1U2GA 1SN7A 1PFYA 4CCSA 4CL0A 1AB5A 3AEZA 4XWOA 3D31A 3WG9A 1JMYA 3OIYA 2AMLA 4FHCA 2B82A 3IB6A 1XTPA 2WE7A 1DT3A 1ETUA 2ZFUA 1CQZA 2PR7A 1EVIA 2ZSHA 3BRSA 3DVQX 3QTTA 4HDMA 4BLRA 2D2FA 5U4XA 3D3NA 2FN3A 3MGCA 4EKYA 1JHXA 1T6XA 2P6NA 3BWCA 1SPBS 4JJ7A 2GDZA 3HACA 4MULA 1UJNA 2IYXA 3SDSA 1DQSA 1L4EA 3VPHA 4BNLA 4YXFA 2F59A 4K6HA 1JTFA 5F7OA 5KTYA 5P8WA 2F3QA 4M7WA 1IBLB 5AHOA 3V80A 1OIWA 5TPZA 1PK9A 2A0UA 3C39A 3KYCB 4LJSA 2V65A 4XIIA 5CUQA 3OQHA 1AX9A 3PYLA 1FMJA 4Q0MA 4AAYA 3FRJA 3WSWA 1SU4A 1T2FA 3L6EA 1NPYA 1UAGA 3C5EA 5KYYA 3TUZC 4U00A 3QX8A 1Z7BA 3HKBB 4OB6A 1XF1A 3PX7A 5IBPA 3TRFA 5D85A 1FEZA 2VF2A 3MBOA 4EHNA 1G19A 3QE9Y 1XKLA 2H29A 1DS6A 4MWOA 1H2HA 3FFAA 4BB6A 4CM4A 5HZMA 3UK6A 2CEAA 1ZOSA 3BCHA 4XLLA 2ONKA 3W8NA 3D5QA 4HKTA 2G0TA 4UOEA 4AKIA 3Q85A 1UKVY 1LGYA 2J45A 1YU9A 1AGXA 2DHRA 3B3QA 1Z4JA 3PSAA 4NZZA 3AKEA 3TZQA 5JCXA 5LA6B 3HADA 4DV2B 2FG7C 2GETA 4OQLA 2DAPA 1WIWA 3K5HA 1N2ZA 3L04A 1J90A 2AH5A 2ZXFA 4OAQA 3TOSA 2BP7B 4YPVA 1UXKA 4BMDA 1FJGB 4ETIA 1FVFA 3GO4A 1JE1A 3F78A 4MI6A 3LQFA 1GT91 4ZZ0A 4OQXA 1M6VA 3QUSA 4OBBA 4RMJA 3OEED 4NDNE 4EDHA 1JJ7A 3SZOA 5LMUB 3MNFA 2CD7A 1QYIA 3BK7A 1L5MA 3E2MA 4Y6PA 2XLBA 4UE6A 2B78A 1STOA 4LY0A 1GPUA 5FOWA 2VLIA 1QONA 4CJXA 3I5YA 4TWIA 3NI2A 4ZGBA 1JKFA 1AURA 3L0OA 3BJRA 4IL5A 2WZBA 3DKKA 5K0FA 4NU5A 1NJGA 4BMPB 4QXPA 5KOHB 2QI9F 4UQPA 4BGIA 5CLLA 4O25A 1KP3A 4KR6A 3AR5A 4PIPA 4G1BA 8MHTA 4GLOA 4ZAGA 5HE8A 4GLFA 1OT3A 4A5OA 4JVSB 2I2DA 1S0UA 3OPQA 4E5PA 5F5LA 4KAAA 1UK9A 3ZWWA 1H2FA 3R9XA 3DL4A 3W4KA 3D9QX 4BMYA 4JLVA 4UMFA 1A7KA 4OQQA 1SEPA 2PX8A 3GN2A 5T67A 3T99A 5TGDA 4DJJA 2H65A 4B4UA 3NWOA 2A6PA 1NQXA 1IHPA 1KKLA 3L01A 4GU5A 5T4HA 1K92A 2YKGA 2V3WA 1TECE 1GNRA 1V5IA 5ALEA 3THYA 1J0EA 4R3NA 4GP7A 1GTL1 3ZGLA 4X85A 4V2UA 4DIDA 5IYZB 3JQEA 1SOVA 1CR2A 2JEYA 4R1MA 2X0EA 1ADYA 3WOHA 3HEMA 3T7KA 2FWAA 2H5JA 4KN9S 5JJBA 4ZCIA 2FE1A 3OQIA 1EE1A 4RQUA 2H2DA 3KB1A 2HJSA 3SR0A 5AW1A 1T4DA 1XUOA 3H9JA 3Q0EA 3VO8A 3GFOA 2B92A 5EN4A 3N75A 4DM7A 4ENQA 4A1FA 4EI9A 4MHSA 1WB6A 1S3GA 1EFKA 2QTNA 2WPDA 3ONFA 4DDTA 4R2IA 5DX1A 3FKSA 1T4CB 4OHBA 1EGVB 1X13A 3IAM6 5I4BA 5JD4A 3GHYA 3I52A 1GZ7A 3E84A 5DYGA 5JSYA 4EFMA 2FMXA 4MV6A 3KJQA 3S2FA 4EA8A 4Z7QB 1E2JA 1XP5A 2CUZA 3GQVA 1E2DA 3UM9A 1IC6A 2W2VA 3G2HA 3O91A 5MN6A 1E9BA 1Y8AA 1A8QA 2LE0A 1U0NA 4I5FA 3VZPA 4B3IA 4CMCA 2FPGB 2RHGB 3C6MA 5IDVA 3I83A 1AKTA 5DSXA 3H0EA 1OC2A 1GZ6A 4PGAA 1L8LA 4R5HA 2YYAA 4HJXA 5E3JA 3T95A 5CB0A 3H0KA 1C7QA 5K1ZA 3H0CA 2PTGA 3Q3EA 1JVBA 2P68A 3DKVA 3MJHA 1KYQA 3JZAA 3VUFA 5A4MS 2QP9X 1E4OA 1EK1A 2GM5A 3PZBA 3IQZA 1LRJA 1RHJA 1DIHA 1T1EA 2GZMA 3CS3A 3L1IA 5LYYA 4YR9A 4ZEMA 3ZHOA 3UMSA 2C1EA 3QLUC 4PLZA 2KJQA 2VNIA 2I91A 4HAVA 3L8MA 2DC1A 1Y1QA 2VT3A 4OHPA 2V03A 2AOXA 5JPIA 1IY8A 4TTSA 3TFWA 1KY5A 1VKHA 2UUPA 4YMSA 3MUFA 3BGDA 2G7MC 4YT2A 2YZMA 4OHVA 2PUGA 3CLRC 5KQMA 1QIEA 1T25A 1GNQA 3LBYA 4Q3CA 1I36A 4JLKA 5EP1A 3RF7A 5H9VA 2HCBA 2W8ZA 1Q12A 1SUWA 3UEOA 4NATA 1KYTA 4YUVA 4ZVOA 1JFSA 1OXSC 2EWMA 4UHDA 1E92A 3VSCA 1HR0B 1ULTA 3MK31 5AFSA 2AD5A 2H5LA 1DT5A 2BZ0A 5FO0A 1UZNA 3JYLA 3SQLA 1O54A 3QBEA 4M9CA 4HADA 1C7JA 1NI4A 1Y33E 1YS9A 4FFVA 5EUCA 3T3DA 5HOEA 5CYPA 4JASB 1V7ZA 4QDTA 1OFIA 5KI6A 2RGBA 4HPJB 2HA7A 4IFBA 5NULA 3U39A 1FPMA 2DJ5A 1Z33A 4IJUA 4YRCA 1N9GA 2VJLA 3KUUA 2O19A 1JR3E 3G2LA 1WA5A 4LOKA 1YQDA 3AF2A 1C80A 3OE7A 4R9NA 1CZNA 1UADA 4U9HS 1LV8A 1E79A 1XN4A 2Z2XA 3D3KA 1N2IA 3I92A 2F62A 4LISA 4NARA 2HYDA 3RT9A 1C8VB 4IIJF 3IXMA 4H7JA 1V4VA 3BDAA 4XJVA 4CIVA 1OBFO 1QHHA 4HAUA 4MWZA 2JJQA 1E59A 2ZREA 4XUEA 4WKGA 3PE4A 2EW2A 3P45A 1TEHA 2R96A 1ZCJA 1XQ1A 4JC5A 1UPXA 2ZSJA 3D6NB 3UTCA 4GO1A 4YXWD 2NO5A 3PI6A 2Z5FA 1EINA 1S5PA 1U8EA 3C87A 2JFZA 5ALXA 3EGXB 4ZA2A 5ICEA 5I9SA 1SB8A 1R6BX 1JX6A 2VFAA 2QZ4A 3R5FA 1FQKA 5SZIA 1VJ5A 3LQKA 2NU8B 3SMQA 4H59A 3WB1A 4CDRA 5FJIA 3ICOA 5KNCD 4FNOA 3LHSA 2G40A 3N2NA 2YUIA 4L73A 4XCQA 2WD7A 5F2EA 4FILA 3EPKA 4NAUA 3KR2A 5AKHA 2DZDA 3ROXA 3WQSB 5KYWA 1VPTA 3FVQA 3KKKA 4P36A 4A27A 4RSRA 3IP6A 4QU0A 4DA7A 3L6DA 3HP4A 2QGFA 1KSFX 3K0KA 4EMUA 1BQEA 4G0XA 5GV7A 4ZOBA 2EOAA 1H66A 2BDTA 2W4IA 5AI4A 5J47A 3OTIA 4CBVA 1T2DA 4QPJC 3PJEA 4HGRA 4TKUA 3V1NA 3TRKA 9GPBA 3LVFO 5HPYB 2BMAA 4OK6A 4ARZA 1MOSA 3RKSA 2IUTA 1EWRA 2OHHA 3K1TA 5C7YA 2O7NA 1V71A 1FFXA 1Y3IA 3NZEA 1ZP6A 3B7PA 3EISA 4WFIA 2XE6A 3QY9A 5HZHA 2AQKA 3DDSA 2BFDB 4AYXA 4BVEA 1Q0QA 5E7MA 2LVBA 4B31A 4M4SA 4O4HA 1D4OA 3FGNA 1QLHA 4J3NA 1M67A 4Y9SA 2VCHA 4NBKA 4P33A 4AI6A 2Y4OA 5AJVB 4M0MA 1NYRA 2XLCA 3AYXB 4WLFA 2NU8A 1TK9A 2DE0X 1V5FA 4E6PA 3IQEA 1DMRA 2CJPA 4D02A 3W79A 4ERXA 3KFLA 1JJBA 1I4DD 3OCZA 3ZD8A 1L6IA 5FUYA 1LSJA 3MAGA 4XB6B 2O2HA 4PFKA 1OAAA 1Q15A 3M3DA 4CIWA 1IH8A 2XJ4A 2JI4A 3SIWA 1XZFA 2JI7A 3IEPA 2LDXA 2X5XA 3C1OA 3R40A 4EL0A 4IILA 5DBEX 2O5EA 5M3BA 4OHWA 1GTSA 1CLUA 4IJWA 2C2KA 4UM9B 1ZRSA 1DAFA 2XVXA 1OTHA 2DGDA 1JSRA 1YZHA 3W9UA 1EFVA 4CIBA 4M54A 5CLGA 3EQ8A 3W7AA 3QVVA 4KMMA 4MQEA 4Z4GA 1EH5A 1PJ8A 3CCBA 3PHCA 3U7RA 4K1LA 1NJSA 3ORQA 1XA4A 2LUOA 1C4OA 1J0CA 4KVGA 1XRPA 3TLCA 1O94D 2GZHA 3VR5A 1CUYA 5GIPE 3CZCA 3OQOA 3RVRA 4U4AA 4Z99A 1PSZA 3VDRA 5IKMA 2WSBA 2FZEA 3AL3A 4PRLA 3PC7A 4ESHA 2ZB7A 2OVFA 1X0VA 3I76A 2XZTA 4Q9DA 4X6XA 3E3AA 1E58A 2FJPA 1WHSB 3AB8A 3HKDB 3I1JA 4G0ZA 3BSWA 1J5XA 3QOXA 4N0PA 4N9QA 2C1XA 3LRPA 5CM2Z 1KRXA 3VHXA 1Y6GA 5TQVA 2LKCA 1H05A 3PQ6A 3V7NA 5CFNA 1V47A 1NPDA 3L8YA 4ZAVA 5JWHA 2YXBA 3RJZA 4E30A 2HPAA 5AW8A 1S9HA 2QN3A 4IRXA 4DEXA 4V3CA 1YC5A 4UW9A 1LK0A 1A9PA 1QIIA 1C3OB 1X7ZA 3U1VA 4DYVA 3DZFA 3VTFA 4MI1A 1V25A 1V6AA 1RI5A