4BZWA

Complete crystal structure of the carboxylesterase cest-2923 (lp_2923) from lactobacillus plantarum wcfs1
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
275
structure length
275
Chain Sequence
MQVEQRTLNTAAHPFQITAYWLDQISDFETAVDYPIMIICPGGGFTYHSGREEAPIATRMMAAGMHTVVLNYQLIVGDQSVYPWALQQLGATIDWITTQASAHHVDCQRIILAGFSAGGHVVATYNGVATQPELRTRYHLDHYQGQHAAIILGYPVIDLTAGFPTTSAARNQITTDARLWAAQRLVTPASKPAFVWQTATDESVPPINSLKYVQAMLQHQVATAYHLFGSGIHGLALANHVTQKPGKDKYLNDQAAIWPQLALRWLQEQGLLAGN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure, Biochemical Characterization and Analysis of the Pleomorphism of Carboxylesterase Cest-2923 from Lactobacillus Plantarum Wcfs1
pubmed doi rcsb
source organism Lactobacillus plantarum
molecule tags Hydrolase
molecule keywords LIPASE/ESTERASE
total genus 88
structure length 275
sequence length 275
chains with identical sequence B
ec nomenclature ec 3.1.1.1: Carboxylesterase.
pdb deposition date 2013-07-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07859 Abhydrolase_3 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4bzwA00
4BBZA 4BCDA 3WK9A 1O6GA 2YXPX 1ZGBA 2WJ6A 3H04A 3ZWQA 1IUPA 3QMWA 3KD2A 3H1BA 5F4ZA 2HA5A 2OCGA 1CUJA 5HCUA 1S8OA 1XZHA 2CKMA 2HA6A 3BF7A 1EX9A 1XZKA 4KAFA 3L1HA 1QO7A 4KJXA 5AI8A 4ZI5A 1EK2A 5DYYA 1W52X 3HJUA 5EHZA 2GYWA 3T4UA 2CEKA 3BJMA 1OXMA 4HRXA 1SFRA 3C5VA 4LHEA 4J0IA 1CUEA 1SCKA 5EFZA 1RWQA 3D7RA 2CZQA 3ICWA 3V9AA 2C5GA 5KREA 5CT8A 5A7FA 2WIKA 3PICA 2XUDA 3IB3A 1UKAA 4LYEA 4QDXA 2Y1KA 2HHAA 1XKTA 4BP8A 3WWEA 1NX9A 4B9AA 2C0QA 2YASA 4ZRDA 1CR6A 4KE8A 3G7NA 3STYA 3A2NA 3O4GA 1QIEA 3TRDA 5A7HA 4JYPA 5EHNA 4B83A 1CV2A 1GGVA 4F5ZA 5BOVA 3WKAA 3FLBA 2JGEA 2WHPB 3PUIA 2NW6A 1RP1A 1EDBA 1CUBA 2WM2A 5K3DA 2VATA 4A5SA 2FUKA 3V1MA 4Q3OA 1HBJA 5DNWA 1QOZA 4RPCA 5CT9A 3FNBA 4B82A 1BU8A 2BUCA 2C58A 4LXIA 1XROA 4CG3A 3A2LA 3EBLA 1R1DA 3HEAA 2DSNA 1TAHA 3D3NA 1SCQA 1DQYA 3VVLA 4HS9A 3DLTA 3N2ZB 3FVTA 5DTIA 4AO7A 1K63A 3ZLVA 1ORWA 4UBNA 3ANSA 3C8DA 1LGYA 4K6KA 1BEEA 1AKNA 1UOPA 1GKLA 5BV7A 4G4JA 3ESBA 2PSJA 4M0EA 4ITVA 5LZ9A 2OAGA 4HZGA 3FYTA 4CCYA 1IUOA 5DNVA 2HU8A 2VA9A 4L9AA 4TPKA 3G0IA 3QMVA 4C88A 3SK0A 1H23A 4QLOA 2HRQA 1FFCA 2XMRA 2C5FA 3TJMA 3G0GA 1TQHA 3AIMA 4KYVA 2OQVA 1W1IA 5JAHA 1JJBA 3IUNA 4Q1VA 3HSSA 1Y37A 2HU7A 3C8HA 4P92A 1JFRA 1BN7A 2OQIA 5FPPA 2XMDA 4PO3X 1AQLA 5J3JA 3JW8A 5CW2A 5AI6A 4H7DA 4X3CA 3GA7A 1ZJ4A 5AKGA 4O08A 3MVEA 6YASA 3PFBA 4IQ4A 4FFWA 2QJRA 1RYYA 2X5XA 5CRIA 1Q84A 1DWQA 1H2XA 4DNPA 4UHDA 3HI4A 2WJ4A 5CH8A 4C87A 1E89A 1YS2X 4KE6A 3WYDA 1Q0RA 4L3WA 4GHWA 2QZPA 5HF5A 4U2GA 3LP5A 3DD5A 3DKRA 3G9TA 2G63A 4UFOA 1K4YA 3GELA 5IVHA 3O95A 3NOXA 1LPSA 4UBJA 1JMKC 4W9RA 2PU7A 5ALKA 5DYTA 4XJVA 1E66A 3D0KA 1NU6A 3IUQA 3CCBA 1N1MA 3H0CA 1JU3A 1Y7HA 3WA6A 2XMQA 5ALRA 3WK4A 4EY4A 3U1TA 3QVMA 1MPXA 2WFMA 4C89A 3G9UA 3KWJA 4C01A 1CQWA 4Y7DA 2XMCA 3BXPA 1K5PA 1XRLA 2JGJA 5EIEA 4CI9A 2G5TA 3F96A 3H17A 5SYMA 2ROQA 1GQRA 1TCCA 2QJWA 4WFJA 5D6OA 3WKDA 1PJAA 3AZQA 3V1NA 5T4BA 1XLVA 1MX9A 1PV1A 1SCIA 4N8SA 3STXA 3ZI7A 1TCAA 4G1FA 1MTZA 2C0PA 4XVCA 3FYUB 5EI5A 1CFJA 4GEGA 5ALPA 1TRHA 4H7HA 2WUFA 5JYCA 4WFKA 4GBGA 4P08A 3PFCA 3IUMA 4NZZA 3WQHA 4FLEA 1QIHA 1LNSA 2C4HA 3W06A 5LKRA 5K3EA 1UK7A 5ALYA 4KRXA 5JALA 2VT6A 4XIIA 5CH3A 4BYMA 5HQ3A 4RNCA 2V98A 2X76A 4WY5A 4H18A 5E2IA 4BVLA 3WJ1A 3OC0A 1WB4A 2JGMA 1MO2A 3BWXA 4PNZA 1N5MA 2OXEA 1QIDA 4AX4A 1TIBA 3WI7A 2ZSHA 2RGUA 2UZ0A 2WIGA 3P2MA 3WZMA 3VVMA 1CUUA 1EH5A 1WM1A 2VT7A 5AKZA 2E3JA 1XQXA 1WHSA 2ORYA 4INZA 4BRZA 1UK8A 2O7RA 4DMCA 1EDDA 1HDEA 5JATA 1X70A 4UHBA 2OGZA 2W6CX 1IZ8A 4Y2JA 4U2FA 5HKBA 3Q8WA 3B12A 4BTLA 3ESAA 5IKXA 5D7BA 1R9MA 2V9ZA 4UHEA 1QFMA 4OU5A 5KWIA 1UK6A 1XFDA 3PF8A 3HACA 4L0CA 2XUJA 1EI9A 5DLPA 4X97A 3GFFA 5AK5A 4IH9A 1XZBA 5AM5A 2JGKA 3RARA 5C8ZA 2GBGA 5ALIA 3O4IA 4PF1A 1XZMA 3S2ZA 3V1KA 4BCCA 4FHZA 1MT3A 3FYUA 2DHDA 4UFPA 2I3ZA 1FFAA 1XZCA 4B0PA 1YB7A 5HZGA 3FWHA 3ZLUA 1VA5A 1E3QA 1DINA 4KAAA 4QZVA 3H18A 5K5EA 2EDAA 4GWLA 5JANA 4MYSA 4G5XA 5JADA 1XRQA 3H19A 3ESDA 1EA5A 2ECFA 1QIMA 3QYJA 1H2YA 4OU4A 5CTAA 3I2IA 4EY5A 1XLWA 1W75A 2ZJ7A 1H22A 5ALNA 1EB9A 5FPQA 4J7AA 5IH7A 3WL8A 4WCVA 2XLBA 3I6MA 2B9VA 3R3UA 4BTVA 3CXUA 2OCKA 3JWEA 3LIPA 5E4TA 4OD0A 3WL5A 1U65A 4GLBA 4K6HA 1W4LA 1LPOA 3O4JA 1G4HA 5AJHA 2VJBA 4S0XA 3A70A 2JIDA 1QZ3A 5AM0A 2VJAA 1MAAA 4M0FA 1LBTA 1R3DA 2WU4A 4QWWA 1HKHA 1CUWA 2WFZA 4UBMA 4X6XA 3WYNA 2VTVA 3I1YA 2AXEA 1C4XA 1UT6A 4Y2QA 3RM3A 5EIAA 5ALLA 4HVTA 3WKEA 4UHCA 3I6ZA 3KWFA 4FMPA 1LBSA 2HIHA 1USWA 3F97A 1W76A 3MGAA 2P8SA 4H77A 2J3QA 3LS2A 3TGLA 4DIUA 2QS9A 1XZLA 4DMHA 4NVRA 2I3DA 3C43A 4KRYA 1QIIA 4A16A 4EBBA 2J4CA 2HM7A 4QDTA 1VZ2A 5T4EA 4E11A 2QOEA 1ZI6A 5AK3A 4BB0A 1MU0A 4PSCA 3Q0TA 5HFAA 3DQZA 1L7QA 3WWOA 3DOIA 4B0OA 3SC2A 5ALGA 2QXUA 2QVBA 2Y6VA 2ZYRA 3FLEA 3G0BA 4DLNA 5LZ5A 4PW0A 4ZXFA 3F8SA 5HF6A 3EIOA 2VQ6A 4BZWA 4J0CA 1CUZA 4QDUA 3WWDA 1CUGA 2PUJA 3FOBA 1A7UA 1ZIYA 2PSFA 4C4YA 3X3HA 1WB5A 1C7JA 3W04A 4EY6A 1EK1A 1ZOIA 3QH4A 4H7IA 5T4FA 4DMFA 1U8EA 4HAIA 4V2IA 1DQZA 1GXSA 3DJYA 5H3HA 5LLSA 4X94A 4WDQA 2I78A 1IZ7A 7YASA 3FVRA 2FJ0A 4DM7A 2ZVDA 1ZICA 2YYSA 5SYNA 5LYYA 5FDFA 4L72A 5I7UA 1EDEA 3OOSA 2BUBA 4XX1A 3ZLTA 2GBCA 2HA3A 3RLIA 1GQSA 2WG2A 3FLAA 4BC1A 1Q0ZA 1B6GA 2RONA 2XUKA 3T52A 3U0VA 5DWDA 3QM1A 4BVJA 1A88A 2H7CA 1KEZA 4W63A 2JGFA 4W1PA 1Y7IA 1JI3A 4H7JA 1X2EA 3HABA 2QUAA 1XZAA 1H2WA 1VE7A 3PI6A 1TCBA 4DGQA 1AURA 3OTQA 2OPHA 4AQDA 5D3ZA 4YK7A 5JAUA 2C7BA 4C4ZA 3KDAA 4Q3LA 4X90A 4NS4A 5AIBA 2AJLI 1QIFA 4QDOA 4AN1A 3R0VA 5A62A 3ZPXA 4W1QA 4CCWA 1JT2A 3R3WA 2BFNA 1BCRA 3I2FA 3ICVA 5CURA 2RIPA 3GUUA 2BJHA 4WFIA 3IDAA 1YS1X 5AI4A 1THTA 1E8NA 2ZJ6A 5AKLA 1XZJA 2H7YA 2CBGA 1E8MA 4Y2TA 5DYWA 1DWPA 3BIXA 1I6WA 2JGIA 5AKKA 1MX1A 3C70A 3VKFA 4OB7A 1LPPA 1VXRA 2WG1A 5IVDA 3AILA 4YPVA 5T4HA 3E1GA 4N5HX 1J1IA 3DOHA 3LCRA 3VJLA 3WIBA 2PUHA 3C6XA 3O0DA 3H1AA 4B80A 4B9EA 1F6WA 4EA6A 4FOLA 1AGYA 1L7RA 1P0QA 3NGMA 4BDSA 1VLQA 3HZOA 2J4FA 3PUHA 3FSGA 2XQIA 4JH0A 1QIKA 5IVKA 3QPAA 3VISA 3NUZA 1ACJA 5AKHA 2HFJA 1ZIXA 4G8BA 1ORVA 2D0DA 2EDCA 2W22A 5BWBA 4CFSA 1BS9A 2OCIA 1XZFA 5AKXA 3I2HA 5HF9A 3RK4A 4I19A 4TGLA 4GECA 1LPAB 2WUEA 3R3ZA 1ODCA 4K2AA 2WILA 1J06A 5ALMA 4BZZA 1LZLA 1QTIA 2GBFA 2O2GA 4RE5A 3HLKA 1E8DA 4Q82A 1R88A 4MYDA 4ZV7A 4J0GA 1FJ2A 2V96A 1IMJA 5ALHA 3WK6A 1UOOA 1ZD2P 3I2GA 4RGYA 4G4IA 5K3FA 1E5TA 2VAVA 1SOMA 1J2EA 3WWCA 5FOQA 4UHHA 1UKCA 1CUFA 2ZYHA 4J0KA 2AJBA 3C87A 1CIJA 1U4NA 3K2IA 3G8YA 3PE6A 5FXMA 1DT5A 2CB9A 3BL8A 3SWWA 3D2AA 2XQJA 3QBJA 3HRHA 1QLWA 4OPMA 1N8SA 1R50A 3DL7A 3AIKA 2PVSA 1DWOA 2HA4A 1KU0A 5D3KA 1ISPA 5C81A 1UK9A 5JZBA 3DS8A 3ZV7A 1YA8A 3G02A 4JNCA 4BAZA 1CVLA 1TKRA 5DJ5A 4GXNA 4AB1A 5CH5A 4ARAA 1XRMA 5AKYA 2FJPA 1UWCA 2XT0A 2Y6UA 4H0CA 2D5LA 2RHWA 1MX5A 5AOAA 2HU5A 5KWJA 1XRPA 1VZ3A 1L7AA 1ZD5A 2PSDA 2Z3ZA 3FCYA 3WKBA 3FAKA 4EB0A 1JMYA 4QA9A 2XUHA 4Y2UA 1UZAA 4FLMA 1BEZA 1UKBA 2BUAA 5ALSA 1VKHA 1HL7A 4P93A 1CUYA 5ALUA 5AI0A 2OAEA 4HXEB 1DX6A 4LYDA 2WFLA 2HA2A 1XZGA 3G9ZA 1UFOA 3AFIA 5EHXA 4JUIA 2G4LA 4GW3A 1WOMA 4J0DA 4F21A 1U2EA 3HC7A 4G9GA 5LKAA 2PKYX 1LLFA 4CIBA 4H7EA 3H2HA 4AO8A 3I1IA 1HQDA 2BKLA 2WHPA 3R41A 1T2NA 1DT3A 2R11A 1MNAA 3JYHA 1OCEA 4U2DA 1THGA 4OYLA 5JZ9A 3M3DA 4GDMA 4UUQA 1FFEA 3WWPA 1EVEA 3STVA 4FTWA 1LPBB 4HXFB 1FSSA 3FCXA 1CUSA 4MJ3A 2AJCA 3GBSA 5CT4A 1VOTA 5AP9A 2WIDA 1IVYA 1VE6A 1YA4A 3K9BA 2CMFA 3KSRA 3I2KA 2IX9A 4F60A 3HYSA 1XQYA 1QIJA 1WHTA 5AH0A 1QIGA 2VAXA 4BVKA 4KE9A 2H7XA 1N5RA 3IBTA 4DNOA 3M81A 4CG2A 4K6GA 1EHYA 1NU8A 4X93A 5I8PA 2XMBA 1VJ5A 5ESRA 1C7IA 3V48A 5ALJA 4MWTA 4C6HA 2WIJA 1CPYA 3WL7A 3AUKA 2Z5GA 2GBIA 3DYIA 1CUVA 2Y2VA 4PSDA 2BGNA 3B5EA 1G66A 3WL6A 5AOCA 1R9NA 1EINA 4FBMA 4B85A 4K5QA 2IIVA 5ALTA 2B61A 2EEPA 2WTNA 1YSCA 4WY8A 4KR0A 5AM2A 4YX9A 2HRRA 2X8BA 1Q83A 1CRLA 4EZIA 3ANTA 2B4KA 1J07A 5FKJA 5K3AA 1A8UA 4YASA 1BN6A 3IA2A 5FP0A 1MN6A 4IO0A 4A23A 1XRRA 4G8CA 5HKAA 5AOBA 4B7ZA 3WK5A 2PM8A 3D5EA 3WZLA 1PFQA 2OG1A 5AM3A 3F67A 1AZWA 4GI1A 3SX4A 1QGED 2CUTA 3EQ9A 3DDUA 3DCNA 1LPNA 2XE4A 4D9JA 5DNUA 3VDXA 4MQLA 3CN7A 3C5WP 1OILA 3V1LA 2HADA 1YR2A 4LXGA 1AC5A 4G4GA 2AJ8A 4N5IX 3D4LA 1FFBA 1H2ZA 5AM4A 3YASA 2G5PA 1CLEA 3E3AA 1F0NA 4AMZA 2WJ3A 4QNNA 5A7GA 5ALQA 1UXOA 3R3VA 3STUA 5IVIA 4Y2SA 4FLFA 3UMJA 2IITA 1WB6A 4RE6A 4QWMA 1XRNA 4UBOA 2QM0A 4HXGA 1LZKA 2YH2A 4OCZA 2ACKA 5AKIA 4U2CA 4FWBA 1YAJA 4X6YA 5AK4A 4BE9A 2OGSA 3I2JA 3D2CA 3IURA 4ARBA 4MEBA 2XUFA 2DFPA 3OURA 2R8BA 2VEOA 5A2GA 1DTEA 3STWA 2HFKA 2RHTA 4HTAA 3K6KA 1CQZA 1ETHA 3FBWA 1D07A 5C7YA 4HRYA 4MQMA 3O4HA 1MNQA 2WUDA 1MJ5A 3BE8A 2Q0XA 3H2JA 2BCEA 2ZYIA 4B81A 5JD4A 1IUNA 2AJDA 4E46A 1A8QA 1HLGA 1BCSA 2JBWA 1XLUA 3H2IA 1GT6A 4AO6A 5BWCA 3QPDA 2JF0A 1XZDA 2PL5A 3LIIA 3W9UA 3IVMA 3KOOA 1BE0A 5CBKA 5K3FB 2WHRA 3WMRA 2K2QB 4DSAA 2DCMA 4KEAA 4X7BA 4ZGBA 4IHAA 4I3FA 4BE4A 5LZ8A 5ALDA 3O9VA 2J3DA 4LIPD 2QT9A 2PBLA 3EQ7A 3R3YA 4KAJA 4Q05A 3QITA 3ED1A 5ALWA 3WIOA 2HA0A 3N0TA 4UPDA 2JEZA 1X2BA 2GZRA 3CCCA 5ALOA 1XQVA 4J3JA 5EGNA 3L1IA 1AMNA 2PU5A 4OSEA 2OLEA 1CEXA 1XQWA 3VXKA 3QMMA 3G0DA 3EQ8A 2O2IA 4H7FA 4FBLA 2O7VA 5AKEA 3H2KA 5CXUA 5FLKA 1CUHA 2O2HA 4UBKA 5HFNA 5LIPA 3MUOA 1XKLA 4BC0A 2WG0A 3GROA 3WK8A 1QTRA 3AINA 3ILSA 2XUIA 3S8YA 4CCYB 4B84A 4H35A 2OGTA 4WJLA 3DNMA 5AO9A 4DYHA 4BAGA 3C6BA 3BF8A 2XQFA 1CUDA 3M83A 4Y9SA 1B41A 5LZ7A 1ZI8A 1JU4A 5LZ2A 1QJ4A 4G8DA 4EHBA 3TEJA 5AHXA 4BAUA 3DL4A 2XDWA 3WKCA 2DQYA 3H2GA 1QFSA 1GPLA 2I03A 2QKYA 4QE3A 2DQZA 4QDZA 4Q34A 2HA7A 2BAGA 3I6YA 5CT6A 3W05A 4Y2XA 2QMQA 4EY7A 4J0JA 2QR5A 2GYUA 3IIIA 1QE3A 5AI5A 1F0PA 4N8EA 4U2BA 5JD6A 4DMKA 5FUMA 1G42A 4FDMA 2ZSIA 2WUGA 3IULA 1HPLA 4P9NA 5ALFA 2JEYA 5YASA 1QONA 4PSUA 4Q3KA 3L1JA 3A2MA 2XUAA 5AIAA 3NWOA 3F98A 5DTJA 5C8XA 4J03A 4KE7A 4OB8A 4X00A 1G5FA 2WSLA 4NMWA 4B6GA 3R3XA 4AZ0A 5EHQA 4PV7A 4UBIA 4X92A 2WKWA 5ALEA 1YASA 3D2BA 1WPXA 4Z49A 1M33A 3STTA 1MAHA 5CT5A 4X91A 4Y2VA 4DTCA 2V97A 4MXDA 4W1SA 5JAPA 3BDVA 2VF2A 1T4MA 3BIWA 3W2TA 4DNFA 2ZYSA 3VJMA 2XMGA 2GYVA 1CUXA 3DYVA 3O9MA 4UBLA 1ODSA 4C4XA 1JJIA 1WPRA 5EIHA 4UHFA 2DR0A 1QO9A 2PX6A 2B20A 5LZ4A 5K3CA 2LIPA 2DHEA 1LPMA 5JD5A 2WIFA 3W9BA 3E4DA 5HK9A 2XUPA 1EXWA 2Z3WA 3CN9A 1A8SA 3OPMA 2OCLA 3UUFA 3WJ2A 4I4CA 2RI6A 4ETWA 2ACEA 4IH1A 4BATA 2QUBA 1FFDA 2Z8ZA 3F9CA 3E0XA 3G0CA 4Y2RA 2PPLA 3QZUA 3R40A 5HQ3B 2QRUA 4AMYA 4AXBA 3WA7A 3I28A 2QXTA 2HDWA 3AZPA 5AICA 1UOQA 2GZSA 5K3BA 2VSQA 2PSHA 4U2EA 1AUOA 1ZD3A 5ALXA 2ZJFA 1GZ7A 2XB6A 1DX4A 2JGLA 1ZJ5A 3AJAA 1WCYA 2XMSA 4E15A 2WQZA 1KU6A 1ZGCA 4H7KA 5AM1A 5ISMA 1P0PA 4MEAA 5AKJA 3OG9A 4DNQA 1CUIA 2FX5A 1K8QA 5KBYA 5FV4A 3B3QA 1XZIA 1EB8A 1GPNA 5ALZA 1TK3A 5CMLA 5JZSA 1XZEA 3LLCA 4EY8A 4OYYA 2VJCA 4ZWNA 4MWSA 5C8VA 4E14A 4JEIA 1P0IA 5E4JA 5LP1A 1GPKA 4G9EA 3C45A 4CG1A 4DSZA 4AN0A 2WLSA 1O6FA 1W6RA 3PDCA 4XWGA 4FFVA 2H1IA 4TVKA 2VJDA 4J0HA 1BRTA 3A6ZA 2ONCA 1DU4A 2XUGA 4N8DA 3OM8A 1YB6A 4M0MA 3HXKA 4AZ3A 3AZOA 3EF3A 4OUKX 5E4YA 5FRDA 1F8UA 4FNGA 3WK7A 1JKMA 4ROTA 1ACLA 3QPCA 2XLCA 4W1RA 4X95A 2HL6A 5AI9A 3IUJA 3ESCA 3MUNA 1CUCA 4QLAA 1ZD4A 5A6VA 1Z68A 1GKKA 2XQKA 3DEAA 4BRSA 3DKKA 1K6EA 3C6ZA 4OB6A 5I9IA 4JYMA 4Y2PA 3VJKA 2XUQA 3GZJA 1YAHA 4ZV9A 2WHQA 2BGRA 1VA4A 4FKBA 1SC9A 3BJRA 3G9XA 5A71A 4X71A 3PF9A 3AIOA 1JJFA 4Y2YA 4X6UA 2DHCA 2XQGA 4X85A 4QEKA 1R4ZA 4ZREA 5JARA 3D59A 4BP9A 5JAOA 1CUAA 2WU3A 1ZI9A 2CJPA 4CIAA 4BDTA 3WLAA 2Z8XA 3BDIA 5CXXA 1ODTC 4KACA 1YCDA 4LXHA 3RKSA 5ALVA 1BROA 5JIBA 4BCBA 2WFLB 4LKOA 3FYUC 3KXPA 5AK6A 2XI4A 3UUEA 2PSEA 4F0JA 4WDRA 4PQEA 5JASA 1AX9A 2RAUA 2QTBA 4EUSA 2WTMA 4UFNA 2ES4A 4IH4A 5HK8A 1P0MA 1VXOA 2Y2UA 3C6YA 3M82A 3FSGD 4FNMA 5HF8A 1EVQA 2XMZA 2XUOA 2H9YA
chains in the Genus database with same CATH superfamily
3WK9A 1YO6A 5LQKA 1D7OA 1SO8A 4R8LA 2W2NA 1OWMA 4CUZA 1RVV1 3CA8A 3R7WA 1D2GA 1N3LA 4Z54A 1IUPA 1HEUA 1NW3A 1RZRD 3QMWA 2OOKA 4FEGA 3TOCA 1RHKA 2O7NA 3HB5X 4U5XA 3T3OA 4ND3A 3U7IA 1IBCA 2Z4SA 4G24A 2D7DA 3E6AA 1NE2A 1C80A 1IE3A 1Y8RB 3GK3A 3KPYA 3MJFA 4LOLA 4JKOA 2HA5A 1PNOA 1PNVA 2OCGA 4NV0A 3W7BA 5K3OA 4MS1B 3DLHA 3COSA 2HSEA 1IH8A 2NTYC 4P7KA 3DOCA 4X3OA 1W5TA 2GT1A 3H11A 3AUXA 4BEJA 5JLJA 1FX0B 1AVTA 1F38A 3BF7A 3KWLA 3LWZA 1QS0A 1EX9A 4OJMX 1XJCA 1XZKA 4B6QA 4LOKA 4IIGA 4TZTA 5EZYB 2A9RA 2BHLA 3L1HA 4Z9AA 1NRXA 3PS9A 3WWYA 4KJXA 4HOYA 1XJQA 3CY6A 2E89A 4HMOA 1V43A 5AI8A 1EK2A 2PNJA 1B23P 2P3LA 3KEQA 4FGJA 1W59A 3TZEA 1LBQA 1N0VC 2MCFA 2H54A 2AR9A 4KMSA 5HKKA 3DDHA 4GLJA 3IAEA 5G1PA 3P0RA 3ZCVA 1Z4LA 1SFRA 1N5KA 4HRXA 4B75A 4N3AA 1PBTA 2J9FA 3DVSX 1O03A 2P5UA 1Z88A 3ADCA 4TXMA 1I7QB 4WAUA 2P90A 2CZQA 2AF3C 3RS2A 3S2EA 3TNFA 1B0UA 1F5SA 2OL4A 2IEBA 3SLKA 1ND5A 4TLEA 3EVNA 2FU5C 3D4IA 3U26A 5JQGB 5KREA 3NBMA 3G13A 5CT8A 1OUMA 1Y33E 3F7MA 1F2TB 1K0FA 2XUDA 1TJNA 1UKAA 2XWQA 1UFVA 4UUAA 3KSAC 3Q3CA 3A1NA 2HHAA 4OXQA 2BE7A 3DZJA 3LM8A 1HYBA 1XKTA 4EMBA 2WLTA 5IBPA 5K0SA 3NKLA 3T9BA 5TS2A 3BKWA 3RIHA 1U4OA 2C0QA 3GLHB 4L4SA 4ZRDA 1T36B 4F4FA 1JDTA 3BXEA 3RUAA 1NQAO 2C77A 2WK1A 3IOCA 2DH6A 3VDQA 3LDHA 4G1EB 3FM9A 2I6SA 1KNXA 1NT2A 3HTXA 3LL4A 1KEWA 2OCDA 4FQ8A 3HZRA 3DEZA 1O97D 4S1TA 3NHKA 1QORA 4KYIB 4JYPA 4WNAA 1M1XB 1CV2A 1SJ9A 3ZJ4A 5KOJA 3EDQA 3KG2A 2CXOA 1ZMTA 1CRQA 3SDBA 4EKYA 3SQXA 4LXYA 2VTKA 4PVDA 1EUQA 1I4EB 3UWDA 3GEGA 2WHPB 5FYDA 1SUCA 3ACCA 3EA5A 3INRA 3BIFA 5AHRA 3CQ9A 1RP1A 5JMTA 3C3PA 1IBRA 5I4KA 2XYGA 1QAOA 1KMHA 2OE2A 2JJMA 1G3RA 2ZI9A 5FPTA 4ZRMA 4CZ2A 3A9UA 4HWGA 1YQGA 1SQ0A 4TM8A 1D9ZA 4CQLB 2VATA 3G1TA 4QGFA 1YTUA 2FUKA 1ZUIA 3V1MA 3L4BC 4YCJA 1FSZA 4Y6RA 3E3MA 4EDHA 3IOYA 5EJAA 1U0TA 2QZ9A 1X1AA 3PQ5A 5DNAA 5IDWA 3RK0A 3JQPA 2F6RA 2EJCA 4RLSA 3WHLA 1CTQA 1JSXA 1FVOA 3TKYA 5JOQA 4Z4IA 2OILA 1XN1A 3EUFA 2BFMA 2PGOA 3FNBA 3K6RA 3AESB 4ND6A 5CT9A 3RUIA 2ZAYA 5CFQA 4Z0TA 4PAGA 1U81A 1TM7E 3AKDA 4F2GA 1M75A 3QU4A 1PO7A 1E6CA 3QKWA 4UMEA 4Z9XA 5IKPA 1DDIA 1N1GA 2E4UA 3FETA 4IXTA 3M6WA 2XNJA 1ZXLA 2DSNA 4JEMA 1G20A 4A10A 3ZTWA 2HQSA 3BH6A 2PRKA 4Z2AA 4DLLA 3D3NA 1O8CA 1SR8A 3UG7A 5HX7A 5D3MB 4NBLA 1SCQA 2CWDA 4I5DA 1Q6ZA 1H3EA 1QQ6A 1BFUA 1V6SA 3BULA 3KZMA 3QVGA 1WDKA 3DMYA 5K0ZA 4O2BF 4FW8A 3N2ZB 1ECGA 2GPYA 2PPVA 1Z37A 3I01A 2EJVA 5DTIA 1TFRA 3NEPX 4RVCA 3FB4A 3OEYA 4RK4A 1OGJA 4LMAA 4LRYA 2C92A 2PH7A 1K63A 3IYLW 4IHKA 4NWIA 4RM2A 3ZLVA 4DAOA 4V1CA 3WMWA 4G4SO 2GM5A 4ZT4A 2VPWA 3A9RA 1CS4C 4CQMD 4IO1A 4B87A 1ZMBA 5IP5A 3ZV5A 1YRHA 5JRZA 3D54D 4TV9B 4K6KA 4R1PA 2R8ZA 5TRTA 1UOPA 2ZYWX 4UKDA 5BV7A 4LHXA 4CE6A 1ONPA 4U8HA 4CMEC 1WF3A 3NHBA 5KUTA 2VPZA 3ESBA 4HDKB 4BN5A 2FQWA 4ZAZA 2O8NA 3AF5A 1KMNA 3EZ6A 4UQPA 3OAAD 2AMVA 3KKQA 2P4SA 3ROMA 1YJXA 4F96A 1VMIA 3GPDG 1Z29A 1ZRHA 1N3BA 1E98A 2WWXA 1ABEA 2J6CA 1Y9EA 2BEUB 2Y0DA 1ZJYA 1M6YA 2VA9A 1GXSB 4TPKA 2XCIA 4KK3A 4UUMA 3ZDQA 2WWWA 2ZAIA 1IHUA 5E7MA 1XCOA 1HE8B 3HLTA 3SK0A 3KVYA 4GXQA 2HRQA 2XMRA 1E1CA 1MIOB 2CUNA 4LTMA 3VOTA 5C5CA 3KQWA 3G0GA 1TQHA 1PZNA 2HRCA 2J8ZA 1CQPA 3B8EA 3EIWA 3NBYC 3ZH2A 1O57A 4H1HA 1R6XA 1K6XA 3FHOA 4XTRA 3UZUA 1JJBA 1GG5A 5JAHA 3IDZA 4BNDB 1ZINA 2FP4B 4HNQA 1JKJB 5KYYA 1V1RA 3RYCB 1JFRA 4R1UA 4XCVA 1K7EB 5IAOA 2JVJA 1WTAA 4S35A 1CNMA 3IIEA 3RROA 3IE2A 3GNTA 3AF6A 3PNQA 4EW6A 1C7ZA 4UUPA 1CY0A 4JYAB 2R5WA 2X40A 4GPEA 4YPFA 5HJ5A 1GU7A 5DSTA 1V11A 2ZSAA 1JFSA 2MR5A 2ZLBA 1TIKA 1M0EA 1M6WA 5GMOA 3TQRA 4XSGA 3S55A 5J3JA 1R18A 2DBQA 2H63A 3R5TA 5DWVA 5JTUA 2O05A 4X3CA 3GA7A 5TVKA 4TRRA 5CX4A 1ZJ4A 2G5GX 2JLWA 4BNNA 4WXRA 1VRCA 2CHFA 4XQ0A 4UAVA 4BX3A 1E92A 1UMCB 4CETA 5SICE 2R7NA 4IQ4A 4FFWA 4IDEA 2AYXA 1H8EA 4LXUA 1WXHA 1QRAA 3CLTC 3R3HA 4ZQGA 4Z7JA 5U9CA 1OWPA 5CRIA 1J20A 1H65A 1WXIA 1Y7TA 1NLMA 3MUFA 2O59A 5I3ZA 1HLPA 3QEOA 4ZEXA 2WFAA 3K9NA 4OHWA 4RJIA 4KGDA 1AK9A 2XTNA 3PL5A 4W7IA 3U3JA 2BR4A 1AT1A 3EDCA 3KS9A 2RJNA 3HI4A 4E7OA 2DXIA 4JJ7A 4MDYA 3UUWA 3FNEA 3FJYA 4NCNA 4INOA 2XCOA 2AMYA 2QG4A 4PLHA 4R9NA 4AKIA 2HK9A 3CRMA 4CV1A 4PTLA 5I45A 2FPRA 1VL5A 5IHXA 1YS2X 3OJOA 3LRTA 4PWYA 4E2ZA 2Z2ZA 1LV7A 5CYOA 4DVJA 1Q0RA 1QC5B 2ZVQX 3RAEC 1VI2A 1GGNA 2ABWA 4L08A 3DFZA 4GR4A 4UCFA 2D13A 4GMXA 3BXXA 3KKEA 1SU8A 1YR9A 3K9FC 3AFMA 2Y9PB 5ICEA 2PA0A 3SY8A 1VIVA 4O0MA 4D8VA 2DOKA 3X2SA 1ZRMA 1Z16A 2X3UA 2DBRA 2ZUSA 3JX9A 3K9QO 4HNVA 1E6MA 4QBGB 1GL7A 3V4ZA 1U5CA 5U1PA 2YNMD 1L7BA 3ACDA 1CWUA 1NV8A 2G1JA 3JAWB 3NOXA 3LW7A 1F48A 4UBJA 2DPMA 4Y0NA 3UF0A 4W9RA 2Q6KA 4GVLA 3LQ4A 4AYTA 1A72A 3HA2A 1VI6A 1NGSA 4XJVA 5HMMA 3JRXA 2PQ2A 3D0KA 5FOTA 5AVSA 3SVLA 1R16A 4JLAA 1L5QA 1KOLA 1N1MA 2FLKA 1IJKA 1Y7HA 3EDYA 4FGLA 4YY3B 4JDPA 1OD6A 2XMQA 2RI1A 3HGQA 3R3JA 1VLJA 3B6KA 2YZ7A 4Y98A 5FBKA 1ISHA 5LP6A 2FW6A 1JSRA 4PLWA 1EHIA 2JAPA 5FBVB 2H2HA 5K8JB 3E3OA 2VBGA 1TM5E 4L8WB 1DKMA 3Q3HA 4YECA 1QR6A 4C01A 5EKSA 3N8IA 3U4MA 2VXOA 2CLKB 4ISBA 5ERXA 1RXVA 1PV4A 2XB4A 1YGYA 3H9CA 1K5PA 3ZKWA 5CB4F 2BGGA 5H0IA 5FO1A 5EIEA 1HWYA 2AG1A 2OMKA 3IXLA 3U4DA 5LLDA 1ULAA 3F96A 4M21A 1FNCA 1NMXA 2ZDGA 2BEKA 1H69A 2NXNA 1LFDB 4WLUA 2VJMB 2HLNA 2OYRA 2O1EA 2ROQA 1DO0A 4D8WA 1LC0A 2KLBA 2QRZA 1TCCA 3FFBA 2IDJA 1V3QE 3EYWA 5EPUA 4LF9B 4WFJA 2A9QA 2CUKA 3A1DA 2VOJA 1G5PA 2YWHA 3FGNA 4XD2A 1PQPA 2KX7A 2WM3A 4XW2A 4RF3A 2DPHA 1TU0A 3KQVA 5CHEA 3U6BA 1GITA 1PSZA 4IZHA 3GA0A 4CR8A 2FEWB 4QQNA 1V3TA 3K92A 2C7OA 1Y6ZA 2TECE 3G2IA 5EE3A 1JQDA 1GQQA 4TSKA 4RTSA 4GSLA 2HR1A 2GLXA 1U9CA 3C4QA 4WT7A 1VTKA 4OP3A 4RHYA 1TCAA 4E13A 1L4EA 3KEFA 1AZSC 5FWDA 1P1JA 4RKRA 1Z5ZA 2C0PA 2ZE6A 4XVCA 4LBYA 3FYUB 4K3VA 2ET6A 5E0OA 2C1XA 4YS6A 2Z6UA 1QQ5A 1KL7A 2OO5A 2QE6A 3VFDA 3ZE7A 1ORIA 2E2WA 5AW9A 2ADOA 2CNWA 1LSSA 3GGDA 3SQOA 4HFMA 3VRHA 5K8VA 3PDHA 1P3JA 2DFVA 2VEDA 5I7AA 1O6ZA 1NW8A 3AI3A 4HKTA 4Z99A 1CZRA 1J23A 2PX4A 4OBBA 1RJWA 3HKEB 1O9HA 2D54A 2XKJE 4UE6A 1GQOA 3D3JA 4XM2A 1CHDA 1V9CA 1WG8A 2PYDA 4NZZA 4FLEA 3OTWA 5C32A 3GLUA 1GNRA 1LNSA 2QR3A 1TT5B 4DA6A 5K3EA 2C57A 5I5GA 3S5UA 3PHIA 1LX7A 3LP6A 4CKBB 1H66A 1J6UA 3FCCA 3ST7A 1KDOA 1WUYA 5EJMA 4XIIA 3T6KA 3SU8A 3AR3A 3PNLA 3WY9A 2KWIA 4YAKA 3D0RA 3OQOA 3M9XA 1OH8A 1RE1A 2UYCA 4UUBA 4RNCA 2HC9A 1P1FA 4IXDA 1NY6A 1NP7A 1H4TA 2X76A 4H18A 4K9NA 4A6PA 4E30A 5F23A 1Q0LA 2R8YA 3CKKA 3TLXA 3L6UA 4AZTA 4BVLA 4WPGA 3RRXA 1M6VB 2R6HA 3N3BC 1NI5A 3OC0A 4NBRA 3FGPA 5F4BA 3G5LA 1NOIA 1QG4A 5AXDA 3K8OE 3KBBA 5FL7A 1SBCA 1WB4A 2JGMA 4H08A 3UQZA 1NXPA 4AS2A 2QW8A 2YXNA 1B15A 3ZDAA 2C07A 1T13A 1L5RA 3DZ8A 3PNPA 3SLRA 1BMDA 2OXEA 1GCAA 2QRHA 3PGXA 2EL7A 1F9AA 2IYNA 5JSZB 4IDPA 3NBFA 3UK6A 4JXZA 2JAWA 1T0PA 3BHJA 4YMHA 2ZSHA 5K0TA 1E1NA 4FMDF 3Q6MA 5DBFA 1NBAA 2O9JA 1SIBE 2D0IA 3RUPA 1GL6A 1FJHA 2GPBA 5A5DA 2GD6A 3U5ZB 2JFZA 3AVOA 2J3LA 1K7FB 4N82A 3FOEC 2UZ1A 4FJ0A 5AKZA 4ZOQI 1EFCA 3C48A 4AP6A 1XXHE 1MH1A 4BQOA 3UJDA 1XV5A 3GLVA 5AVWA 2ORWA 4R71A 1RKXA 2GAAA 1YE8A 5HNKA 1W5SA 1DKOA 1QK3A 2HQOA 3QPVA 4JLKA 4P3XA 3EZLA 4DMCA 1EDDA 4LFAB 2JCXA 3KAQA 4EJSC 5CVEA 1XP8A 3M4XA 2R4UA 2RHMA 4X60A 1L8QA 1XK7A 2HK8A 3DGEC 4UHBA 1DIRA 3OPYB 3PKIA 4YT5A 4LZLA 4G5QA 4GS5A 2GPWA 2W6CX 3C4JA 3LX5A 2RGCA 2VJMA 1JB9A 3NM4A 2HTFA 2C5BA 1C9DB 1GCGA 2OVBA 1BJRE 4IDDA 5HIMA 3P5BA 1LQ2A 1PHPA 3B12A 1DUSA 3ITKA 3VOSA 2WU0A 3ESAA 3OBIA 4X1KB 5IUNC 2V9ZA 4UHEA 3OTOB 5ITZA 2EJUA 1J7JA 1Y1PA 1M7BA 2FSUA 2P9JA 2Q3CA 2WZQA 1SB9A 2QZSA 3JD0A 3A7EA 3L6OO 3L7KA 1W0KD 4NJOA 5ES4B 4RJ2A 5KWIA 3RAGA 4CNBA 1WXGA 1ECPA 2FZLA 1JDNA 2DETA 4XFDA 3FHTA 1CDDA 1G7TA 2OR3A 4FU0A 4N3NA 2XUJA 3IIKA 4PR3A 5CW1A 3SJAA 4E0BA 4F06A 4LF7B 3T7KA 4E70A 5DISB 2FMTA 5ECWA 3T7IA 4ZVVA 1GZUA 3FAZA 4IH9A 5LBUA 3RRJA 3D2LA 1EGHA 2H4ZA 3RTGA 1BH2A 4X44A 2ZTVA 4DDUA 5C8ZA 3WLKX 3O8BA 2EYQA 1G9XA 3EVTA 4XXHA 1N2HA 1LNZA 4OQEA 3QU9A 2B3TA 4DG8A 4H3SA 1CZLA 4PF1A 4QIHA 5E1DA 1HZZA 1RJ9B 1UANA 1WKBA 3S2ZA 3V1KA 5KNBA 1DCKA 1L5VA 2APJA 2A5FA 4CTOA 1P44A 1MT3A 4A2CA 3FKSD 4HH3C 1IYZA 4IV8A 4TT8A 3FYUA 3EMKA 3OCVA 2WE7A 1AD2A 1M76A 2NO6A 2I3ZA 3TRKA 4WK2B 3BX1A 1A7AA 5MF6A 1CJCA 3UMGA 4PN7A 3MBOA 1YB7A 1ES9A 2VTBB 5HZGA 2XCUA 3TQTA 4HADA 1DQSA 1KOJA 1U8YA 4MQBA 4BLSA 2ZFUA 3R77A 2QRPA 4M7RA 1NDQA 3PXBA 3U19A 5DRYA 5AW3A 1NOJA 4C6RA 1VA5A 2DT8A 2IF0A 3IL2A 2O20A 1EBUA 1SIOA 2WJGA 4O4HB 5A9SA 3QEMA 3AR8A 4QZVA 1I24A 2JG3A 2EDAA 3NYQA 2RSLA 3HM2A 4WJZA 4RDIA 1FQKA 2B3DA 1U2SA 1WP4A 2WAYA 1PT7A 1KTVA 1X9IA 3ED5A 4MYSA 3JWJA 1XRQA 3H19A 4BEWA 3ESDA 1T6NA 1RJFA 2JW5A 4FEEA 4UZFA 2QX6A 4B7AA 3H9BA 1ESEA 2AUTA 5BUSA 1WEKA 3RVSA 1EGVB 4BO1A 2B25A 2P0AA 1XLWA 5DB4A 2ZSFA 3VTAA 1H2BA 3NZEA 1M1YA 1HNXB 2YNMC 4TTJA 3A4TA 3IT2A 2AOUA 3KTOA 4NE9A 2M6LA 4BECA 1OLUB 4ZOAA 1N75A 5EJ4A 1DUIA 4F85A 4YMSA 3WL8A 1Q5PA 3VR4A 3BS4A 2C5HA 4EW2A 3CBQA 3E22A 3RU3A 4KPEC 1R5BA 2VNIA 5TQJA 4BTVA 1SVNA 2J9XB 3D6MA 3N2GA 1OTHA 4HMPA 3IEMA 4FWIB 3RYCA 5K8IA 3HY6A 4A0HA 2H2DA 3ETLA 1L5OA 13PKA 1U65A 2ONYA 3PC8C 5ERYA 3U40A 1EUCA 1IY1A 1GPDG 4K6HA 1W4LA 2X5OA 4KMMA 2J9GA 3TNDA 4BO5A 1L8XA 1O94A 3V4RA 4Y30A 1LNQA 2E5LB 2XZOA 3O94A 4JI0B 4WK6A 5DRTA 2BVNA 3O90A 1A5AB 1POWA 4KTTE 3HVHA 5AJHA 2CW5A 1A27A 4NPCA 3HJCA 2BGIA 5K51A 1QZ3A 2HEIA 2QMOA 2QP9X 1NJSA 1E18A 1KHTA 3E9EA 3H8WA 3FNIA 2LCIA 3QXXA 5THXA 2ZM6B 3SIRA 2JAHA 4BMOB 1XB2A 1R3DA 3T1VA 2H17A 1LI4A 3GRKA 3E9MA 1RP7A 1SHZA 1MG0A 2IUEA 2YWCA 3NHJA 3QFFA 5DX8A 3TKAA 4NENA 3I5UA 4D9CA 1M34A 4X6XA 3WYNA 5C8YF 4D0SA 4CJXA 4MHOA 2QM7A 3DEFA 3ZBPA 4YHHB 1C4XA 1XJ5A 3OWXA 2GAFA 1NXTA 4O4JF 3CNBA 5BW4A 1O4WA 2F4VB 1WZUA 1PK9A 1F8YA 3UT5A 4D42A 3SVTA 1DJLA 2XA2A 3I37X 4IXMA 2F4NA 2QR2A 3P2KA 4FMPA 4OFBA 2FVYA 3SS9X 1JVNA 1USWA 2JFPA 2VCHA 4PTZA 4M1TA 1DAEA 1NUAA 1RKUA 2HGZA 3ISVA 4FINA 3SN6A 3ZW8A 3B6JA 3EY4A 4MA5A 3PHBE 4YWJA 1HE3A 2RGEA 1P91A 2GGSA 4MGIR 5KOHA 4IG4A 5I7SA 3KO8A 3NVKI 4A1OA 2JDIA 4IIJB 5G0VA 4TMVA 3K15A 5C9ZA 2D62A 4MVJH 4BOYA 1E4YA 2H2AA 4JR2A 2F43A 1Y1KE 4MMZB 1XZLA 4DIUA 5B1YA 3CO0S 1YHYA 4MNTA 1QNFA 3TR5A 2J5XA 4EK9A 2XCQA 5ECDA 4A16A 4QOJA 2J4CA 3MS2A 4RWEA 4CHTA 1ORRA 1VZ2A 4DJFC 4E11A 2FKNA 4LOIA 4QXPA 2MMCA 4QUGA 2ZZNA 2DVMA 5DW3A 4D6PA 1ZI6A 5ARCA 3CPJB 2EKQA 3E7XA 1MU0A 1VPEA 5FA5A 4BB0A 1HRKA 4CM8A 1XLTC 5HFAA 5E6SA 4BX9A 4MV8A 1PFWA 3GJXC 1NJ6A 1X1CA 3CKYA 3DDOA 3HCNA 4IMRA 3TFWA 4CMHA 5HJEA 5JS7A 4CKEA 4HFNA 2H3EA 3DVAB 3WR5A 5IN4A 1XKQA 5TLSA 1FFXA 3WDLA 4EM6A 3MJHA 5TSDA 5I9MA 3PCXA 3D0QA 4B0OA 3HB4X 1Z4OA 1Z6PA 2H18A 2JGNA 2VJLA 3L93A 3M2PA 4YI5A 5EMMA 5KAPA 1C3LA 4YXWA 3U80A 1OOEA 2HBRA 3CUYA 3LK6A 1V8BA 5K2MA 1WQ4A 1TCVA 2QXUA 4M8IA 4N4AA 3TI9A 2Y6VA 2ZYRA 1OYWA 4KYTA 1W25A 2ZUUA 4A8HA 4YCDA 3T7TA 2WB4A 2QN6A 4Q9DA 2XAUA 3AUFA 4UAGA 3LPNA 1Q1GA 4BKRA 5F76A 2IV2X 2Z6QA 2XBLA 3SXUA 4PXYA 1R0KA 4EZEA 4JCOA 4JBNA 2F00A 4EYEA 3EIOA 3TQSA 2ST1A 4BZWA 4WN9A 4ID3A 2REOA 4FQ5A 4FIZA 3SP1A 5IHPA 4XGNA 5COAA 6REQB 4EA9A 1YCHA 2I54A 1USKA 3BFPA 5B55A 3FDZB 1SB8A 2PUJA 1HYQA 3DE6X 3A1UA 3X3HA 5DGCA 3TG2A 3W04A 4GG1A 5TS3A 4IIJF 3AFHA 4FR5A 1KH1A 2WOOA 1VPWA 1ZOIA 1QO0A 4G63A 3A6GA 4R69A 3E4CA 1QOQB 4I08A 2YQ4A 4P22A 3HXPA 4WVFA 3B51X 1GADO 4X94A 1GCIA 4WDQA 4DRYA 2GEVA 4MTCA 1IZ7A 1YMUA 3RWBA 1VSVA 2J7PA 3CWZA 3ENKA 3ZWMA 4EA7A 5TX7A 3U44B 1DKLA 4TVOA 4XWAA 4ZTUB 1E9BA 2DWQA 5TMPA 4B3XA 2PD3A 1VB3A 5L95A 3OE1A 3GEEA 2QRNA 3LA6A 1NYRA 1NWHA 1RWXA 2HLHA 4MQUA 1E1YA 3BTSA 3G2QA 3RBZA 5LQUA 4ZCLA 3F6RA 1Y8QB 2WJVA 2XH8A 3GO4A 4PHHA 4BFUA 3HN2A 1QHEA 3V7WA 2FUCA 3WSVA 1Y3FE 2OC4A 3FFXA 2WV9A 4MRAA 4B6JA 3ZK9A 2VCEA 4F3CA 3TPZA 2PVCA 5ICFA 2ZDHA 3BMQA 1KAGA 4F4CA 4DCOA 1JIKA 1BMFA 3JATB 5I7UA 4G9BA 2ODNA 2ZWVA 4KR2A 1EKXA 3USCS 1US8A 3DTVA 1DKNA 9LDBA 3HEBA 3WB1A 1EAMA 3IVGA 1LLDA 1JJ7A 2XW6A 3KQSA 4M83A 1FP2A 2QRVA 2WMOB 3B53X 4D0RA 4CPDA 5D86A 5KOHB 3H7AA 2QL9A 4M1EA 5EVJA 1G8GA 1UBLS 1KQPA 2M2IA 3I9KA 4KKVA 4NZ9A 5E7QA 4M8KA 5IMBA 2CLHB 3DBLA 2OVFA 4XOIA 1DO2A 4J7CA 1I33A 1RMQA 1X8XA 4TS1A 3ZWDA 4AZ0B 4BC1A 2Q62A 5T3YA 3DQPA 4I9HA 2D0OB 4JB8A 2PKWA 5IJXA 1Q50A 2QTLA 3ESZA 3I73A 3PDWA 2Q8QA 5K9ZA 5LOVA 3ZQ4A 1B8VA 1P4SA 2JH8A 2N47A 3P32A 4M9CA 4MYHA 4R9UC 1BXZA 4W63A 3AERB 2G6BA 1GSOA 4MULA 1PJ2A 2Y0PA 3G7UA 1II0A 1V39A 4X8HA 3UHPA 4B46A 3UMYA 1NG9A 4H7JA 1X2EA 3Q40A 3TE6A 3ANYB 1XZAA 2ZRHA 2FSVA 2ZYUX 4IQGA 2VVTA 3D4BA 2JH9A 2V8BA 1IHOA 4GE0A 1X19A 4HGOA 5B3JA 1HMYA 2ZJOA 2WWGA 4KXMA 4YAFA 4LC1A 4E5YA 4CKYA 3ZGZA 2CGEA 5KX5B 5AK0A 4DJ5X 1ZCFA 3KQOA 1Z17A 3EMVA 4ND2A 2K4MA 1ZC3A 1R0SA 4NS4A 2Z1NA 4BS9A 3RT7A 1Y8CA 3FCOA 1W35A 2IKSA 4MVYA 1YMVA 2J33A 4Q01A 4ZQFA 1J09A 5FUXA 4AN1A 4CU2A 3S2FA 4OHBA 3THYB 4I1VA 2W6ZA 1E59A 5LMUB 3AMVA 1NVGA 3TMKA 2VQ3A 4W1QA 3LT4A 3KKKA 1DEKA 3ZPXA 2BGTA 1BCRA 4KQJA 1XTRA 1E4VA 1QZUA 2IHVA 3H3JA 3M8KA 3ICVA 3AUUA 2WHYA 1TRKA 2ZBUA 1F7UA 1EUZA 1CYDA 2II6A 3QMPA 4WFIA 5TEVA 5GJBA 5AI4A 3F9RA 3QEJA 4HT3B 5K2OA 1TU3A 2AOUB 1GSIA 4ZCMA 1D8AA 4G2NA 4A15A 5AKLA 4WESA 1BE6A 1XZJA 3EXFA 3LE8A 4DQDA 1USGA 3E15A 1C8VB 1DWPA 3AY7A 4HDRA 1KVSA 4KVGA 2JGIA 2R85A 1H42A 1EDZA 1NVFA 4HLQB 3EH2A 5AJZA 3VKFA 1VJ0A 4NH4A 2GEFA 4IJVA 4WNAB 5IVDA 1B8PA 1EJ6A 2IDKA 1Y1LA 2OBLA 2V5AA 2P79A 3DV2A 2QX7A 3L7OA 4NBVA 1XCLA 5A3RA 3B85A 1J1IA 5BQ3A 3Q9NA 1E7MA 3DOHA 3I6BA 1P29A 2HH9A 3BWYA 4J1QA 4KLRA 4A1FA 1E9FA 3S68A 1V6CA 3A0UA 2ZW9A 3VTKA 5DN9A 3HP1A 4FCVA 3O0DA 3FX2A 4JENA 4PO1A 3GP5A 3RIYA 1W93A 3T5GA 1L0BA 3CX4A 4HDSB 5FBQB 4MVJA 1OXBB 4EA6A 2EAUA 1GR0A 1NVVR 3H8SA 1AGYA 1DDOA 4DDMA 1WD5A 1W0JD 1VYVA 4B33A 1EFRD 4ZJYA 2JD2A 2OO7A 2GXAA 2IIBA 3RLFA 1N34B 3BMQB 1J5EB 4KLAA 4TZKA 8LDHA 1HTWA 4JH0A 2GJ9A 2ILTA 4IIBA 4L7VA 1FQJA 1U63A 3CIFA 1S5PA 5FTNA 3T3GA 4F93B 3NUZA 5KYXA 2ATIA 2OB1A 4XB1A 2IYEA 1XN4A 2YL2A 2I6TA 3UGKA 3SIWA 3RAFC 1V7CA 4G8BA 2DUWA 3E1KA 1ORVA 2Z56A 4ZI7A 2J0UB 4I55A 1E1QA 3RVNA 2BFFB 1MRNA 2WIAA 2EDCA 1KDYA 1W4ZA 2FSGA 3CZQA 5F9HA 4D02A 1W8DA 3L05A 4E31A 1N8TA 3CRZA 3RIXA 4US0R 3UKOA 4Z7OB 3M5WA 4RETA 3V4FA 3U7EB 1HZJA 2OCIA 5AWFC 4CI0B 1DC4A 3I9JA 4GL2A 4EYSA 5SV2A 5TMEA 4Q3BA 3GBVA 1U6IA 3TSWA 3IA7A 4MLDA 1DIOB 1EA7A 3FRJA 2CC2A 4LPSA 1ZWKA 2AI2A 2AUNA 1IOVA 3NNSA 1XF9A 1ODIA 5EWLB 3RVRA 2ZZKA 3OJLA 4FOPA 4RYLA 5TC4A 1F20A 4PYMA 3EVFA 3GT7A 4RS3A 2PZMA 1JFVA 2OK8A 3EEQA 3WK7A 4E1VA 1XMSA 5LMCA 1EZ4A 5K05A 3UWMA 4F3TA 1NQXA 3N59A 3EIFA 5EAIA 3VR3A 2GZMA 5H9WA 4K2AA 3OQVA 2WILA 4H1UA 3QLUA 5KYWB 2DC1A 4NATA 2Z83A 5ALMA 5KNCA 2BFEB 1N0HA 2WMYA 4RADA 3VU1A 3OIWA 3CUVA 1YE3A 3VPCA 1EIZA 3O38A 4ENPA 1U1DA 2G1UA 3BHMA 1QTIA 2IODA 2GBFA 4YP9A 3RYHB 3DUFB 4GEKA 4JXJA 1R8SA 3WLTA 1DQNA 3CE9A 1OC4A 1NVEA 2OZLB 2HMYB 3NBKA 4DBZA 2BI8A 1P4RA 1XWIA 2LXNA 1CVIA 2PR7A 1UJNA 2VXCA 3C6MA 2V96A 3EW7A 3FVQA 3WGZA 1XR3A 4KXQA 2J6IA 1UOOA 4LHSA 4XH9B 4A6DA 4FYHA 4OBEA 5DGTA 4LSMA 4ESEA 2X4DA 3HYCA 2Q2OA 3EVEA 3N8DA 1T4DA 4H6VA 3TDKA 3A1EA 4AJEA 4BMCA 4CL0A 1GA4A 2FY8A 5DNDA 5IJ0A 2DRIA 2P9CA 1F3OA 2O1XA 1I7LA 1D0SA 3WWCA 2FMUA 1G0NA 2Q5CA 3EIUA 1ONOA 5LWHA 4EGSA 2WM9B 4M9ZA 1A9OA 1GAQA 1FMJA 1UKCA 4M76B 1AQIA 1IJBA 2R1TB 1CUFA 2C8JA 5DM60 3ELWA 3L7IA 4QC2A 1I94B 2Q1WA 4DEVA 4A8PA 4MB2A 5KNBD 1M2VA 3AVYA 1YXMA 1I80A 4HC4A 1Q91A 1K8YB 1ULBA 2ZETA 4BPBA 1CIJA 4ARIA 3RC2A 5CP8A 3SEZA 2GPTA 2B2CA 3FOCA 3LF2A 3B6MA 3SQWA 5DHAA 4AP9A 1UIRA 4JUFA 4AMVA 1PWZA 3PT9A 1R6BX 5AJVB 3DHWC 1ILEA 2WZCA 2XAAA 2HX1A 1QLWA 2QJOA 1YZ3A 5EJ7A 3E05A 2CJWA 2IY9A 3I9OA 3EF0A 3SQDA 2XHEA 3BSYA 3DL7A 2ZYTX 1L1RA 3CH4B 3ETCA 3M6FA 4HVCA 4PRYA 2QX4A 5J59A 3AU9A 1DWOA 2EGGA 1KU0A 5SZIA 1ISPA 1RJDA 4MDFA 3OTHA 2HPHA 5JZBA 3HBLA 1T8PA 3UJAA 2ZSUA 5K8TA 1AN9A 2YVKA 5FUBA 2G08A 4X61A 3HVJA 2EGUA 4BAZA 2O8EA 4LDPA 1IL0A 2J3KA 2O7SA 3A36A 1SWWA 2QTVA 4BNIA 4R1NA 4W9NA 3TJRA 1IIBA 5CH5A 1C2TA 4ARAA 3IJPA 1PE0A 1WBJB 2ONZA 1RWBA 3IFSA 3KOMA 3ANXA 4Q7MB 5DBGA 1M2EA 4HDSA 1XRMA 3MBIA 4M9RA 3RPEA 4QG3A 1G21B 1RQGA 1RLUA 4OM8A 1DKUA 4KX5A 4E2WA 2RGXA 3EC2A 1S9DA 4KFSA 4GYWA 3MPUA 1R0BA 4RZXA 3DT6A 1TADA 1CHNA 1YDMA 4IR7A 1CF9A 3ZTYA 3AVUA 2YJZA 4KR3A 3K73O 4H0CA 1KO4A 2HT6A 3RS0A 3K70B 1JYFA 3SKYA 1Z0ZA 3D4OA 4G1UC 3JWIA 1HEIA 4M1KA 2HZBA 5C52B 4RM3A 1OLSA 3GLSA 5EWMB 2NSDA 1BEUB 16PKA 5KWJA 1RAGA 2R66A 1PEKE 1UFQA 2FPOA 1J56A 2HF7A 2I3BA 1MZVA 3BXZA 5J5CA 3WLOA 1GZ5A 1TVMA 1I7SB 1JA9A 4CMIB 3LA8A 5E9JA 2PSDA 3FCYA 3P9CA 3FMFA 3F9IA 1VKNA 2QLMA 3LQYA 1JMYA 4PC1A 3AV3A 4L5JA 1LRJA 1R8XA 1F9EA 3MNFA 1Z2NX 2ZROA 2FW0A 3TD9A 1PP4A 4QXOA 3X1JA 4CW7A 4HV4A 2B4RO 5IJAA 2H57A 1Y34E 3R7BA 5IDXA 3CWCA 2GZ1A 2C4KA 1BDJA 4G5RA 1BEZA 4UVDA 3DEYX 3B5JA 1UKBA 2BUAA 1YJ5A 2IYRA 2AX3A 2R7AA 3DLPX 3NHYA 3CPSA 1H1LB 3N74A 2DPLA 7REQB 4W82A 4J4HA 2PMBA 3EZ9A 3HJHA 4NPHA 4TYQA 5CDYA 1DX6A 4HB4A 3ZY3A 1H5NA 1XX6A 5L45A 5MDHA 1SBNE 1YE5A 1ZSYA 3OO0A 1HR0B 1AKUA 4DKJA 3GYBA 1XZGA 4FK8A 1RCUA 4LCBA 3ZYCA 4UD2A 4EAAA 3EZNA 1PZMA 2XECA 4NRDA 3UKJA 1PTJC 3AFIA 1NI4B 4C3OB 1P1KA 1T25A 4DV3B 4C2UA 1BA3A 2QTFA 4DM3A 1AKVA 5G41A 2G4LA 2Q1SA 3MN1A 3HDTA 3PPXA 2VDWB 3Q11A 1CDOA 3EXG1 4GW3A 4MVJP 5FAKA 3FDXA 1YL6A 3PHJA 4R81A 4F21A 1CY8A 1SK8A 1SUAA 4OHCA 3R7SA 2FCRA 4LF4B 3DBRB 3DAPA 4AJKA 2OPBA 5FOXA 4AULA 3AWIA 1L5ZA 3TZ6A 4A8JC 5GONF 2GESA 1YKSA 1X6VA 1MHPA 4Y6SA 2AH5A 1X9GA 4MJLA 4ZHQB 1H8HD 4W7SA 3ER6A 3E7DA 1XHFA 5L8VA 2KS6A 2WP0A 3NANA 2ALJA 3PDUA 3DNFA 3I1IA 4JWKA 3TOSA 4URYR 1G64A 1N5LA 4MUMA 2WHPA 3EOAI 3IAHA 2ZS7A 2ADFA 2VH5R 1I6KA 2IS4A 3J81A 2VS1A 4RV5A 4BFZA 2IS2A 3E1SA 4U6QA 3FKJA 5CPBA 3T7DA 4BVBA 2R11A 3K32A 4GVPA 4ZMBA 1SCUB 3N2KB 3IPRA 5EMHA 1NNUA 4DYVA 1MNAA 2VWPA 3PENA 1Q2UA 4GO1A 2R7LA 4ENVA 1NHGA 1DAOA 3I9LA 5C37A 1CJSA 1L4FA 3IEPA 4KSYA 4XR9A 4M9SA 4QXQA 1AM4D 2IUYA 5JZ9A 2VSFA 3M3DA 4GDMA 4UUQA 3CX8A 2JIBA 1YBHA 3LF1A 3OF3A 4DE5A 3HZHA 1EVEA 2A14A 3TZQA 4FFOA 5CM8B 4AY6A 2VRBA 2Q7XA 2ZRFA 3P9YA 1J7KA 4B3RB 2VTEA 2EP5A 2JLAA 3EGXB 1NE7A 5BP7A 2BDEA 3VA7A 3ELYA 3HJGA 1PD0A 3GBSA 2Q5EA 1MF7A 3TLCA 4FS8A 1BCSB 3IJRA 3NBUA 1AA9A 1CLUA 3MTDA 5AP9A 2QZZA 2GLUA 3GEIA 3SC3A 3ZOZA 1BGVA 3C98A 4HQNA 1O94C 3ZZMA 3GJSA 4U7FA 4CGYA 1DJOA 1UQUA 2IPMA 1F2UB 1NBOA 3OX1A 3ABOB 3KSRA 5CEJA 4QUJA 3HYSA 4ZZ1A 2NZJA 4XQGA 1NI3A 1JP7A 4PG8A 2E0IA 3LSYA 1QIJA 3RB8A 1WHTA 1N5DA 4DEXA 1W96A 1W88B 4B74A 3HGMA 3B1JA 1ZESA 2VHZA 3AR2A 4IJKA 1XMIA 1Z2EA 5E6UA 4TYNA 5H80A 3D6FA 2SCUA 3L7LA 5K03A 2BD0A 3WLEA 5JS1A 4YC7A 3EVDA 2H7XA 2XB8A 3QXHA 3P9RA 3E81A 1K08A 4GNKA 3AEUB 1L4KA 3O2QB 4QXRA 1YQ9A 1S89A 5FO0A 4EB3A 2BZGA 3O9ZA 3FFTA 4OGWA 5BV0A 4CDNA 4K6GA 4EGAA 1AF7A 1GPAA 1EHYA 1AN0A 1B0ZA 1EJBA 1NU8A 1L7OA 2QPLA 1Q12A 1RWNA 2XMBA 2CNWD 2BEUA 3RV3A 1X74A 5ESRA 3R5HA 4WJKB 4ZKEA 1N6NA 1UKVY 2CE7A 2YQZA 3FYHA 4NEHB 4F5YA 1V95A 1KP3A 3V48A 2E5WA 3VV3A 2EWVA 8ABPA 3EXHA 3S5JA 3UWSA 5JY6A 2YZ2A 3QP9A 4QOGA 1QQ7A 2IEGA 3WVNA 2JI8A 2JPDA 3HCWA 4IBOA 3ZXYA 9LDTA 1V7PC 5A4KA 3UCFA 1PGPA 2QMHA 4KOAA 4RPJA 3VZPA 2TMYA 2H1CA 4MROA 6CHYA 1TT5A 5I4BA 1YL5A 5KYNA 2HYDA 1XQ1A 3CBGA 2VRCD 4GM1A 4TV9A 2MMGA 5HMLA 4GZ3A 1GUDA 3B36A 4S2UA 4WBNB 2PGIA 5J1SB 1OFVA 1XO1A 2ZIWB 4GIBA 3ZBQA 2GBIA 2ZJZA 1DIHA 3FPAA 4TQUS 4TWJA 4ZRNA 1N7GA 1R9JA 2B99A 2WVGA 1G66A 2GVDC 1Q44A 3IOMA 3COWA 4KWHA 3WL6A 2GX6A 2Z8YA 3THXB 3PXAA 5AOCA 1JIUA 2F3QA 4MHSA 5AXCA 4EGFA 3P0HA 4QYMA 1DKRA 1R9NA 2DZDA 5DGXA 3THRA 3UJNA 4FBMA 1VGRA 1MGOA 3SR4A 2D3TA 2GBLC 4K5QA 2IIVA 4H17A 4KXLA 1Q11A 3F5MA 3UJHA 2V7TA 5EQJB 5D5QA 2VDRB 1FYXA 2AC7A 1QUEA 1Y6RA 2JCYA 4AI6A 4QUEA 3T7JA 4WY8A 2PFSA 2UKDA 3CFYA 4R83A 3TUJC 3LX8A 2GM4A 4XGKA 1P2DA 3AKEA 2QROA 4KQ1A 4LVCA 3RO7A 1NVKA 3S2YA 4N01A 3ZDBA 3R0QA 4TKLA 5F7ZA 1IB6A 5B1IA 4DIFA 1IG0A 2XDAA 2V6IA 1OFGA 4PO9A 1J00A 4K46A 3OOJA 4CCSA 3BMXA 2YJ6A 3OQBA 3V4SA 4B6SA 4DIEA 1OVMA 2HSZA 3COVA 3GF4A 4GKVA 5JD3A 3R8XA 4EZIA 4X1OA 2PGNA 5K3AA 4KR9A 4N6NA 1BN6A 2I2BA 4O6VA 1HF3A 1E2PA 1MN6A 3UAYA 2WTAA 4XPIB 3VR5D 2I76A 3GDGA 4L0MA 4MI3A 2F1IA 3G2JA 5EERA 5EIWA 2BM9A 4DXHA 4UMVA 2QTMA 4YJ2B 3WK5A 3VNVA 2WJPA 1I7DA 1BD3A 1PFQA 3LY8A 1XDSA 4G0NA 3VJRA 4LQLA 4YONB 3A2KA 2D5AA 3WHPA 2I8LA 4GI1A 3SX4A 2QW1A 2WMDA 4DEYA 4AK9A 3BDAA 1V5EA 4JN6B 2AN3A 2JCVA 4KOEC 1OQAA 1CEEA 3FUXA 1E58A 3LCMA 3OCUA 3B52X 4RELA 3R9IA 3JQRA 3NR2A 2WYVA 4H0NA 4E5SA 4C7BA 1AMUA 1H9AA 4V0SA 1LPNA 3ZCPA 3NAGA 2M6KA 4GVXA 3VU8A 4C05A 3DAOA 3N2GB 2ZXEA 2EFYA 2WBLC 3KD3A 4KXNA 4A0SA 2NXCA 4KAXA 3VDXA 4YP1A 3FPSA 2AS0A 3C5WP 4JVNA 1U9JA 1WNTA 2R8RA 1L6RA 3OAAA 2HADA 3NTOA 1PF7E 1HG0A 3MRXA 3TH5A 4RZQA 2UYHA 4N5IX 3D4LA 1GGFA 5NLLA 1RKBA 3CT6A 4AKGA 3YASA 2G5PA 1VFNA 1CLEA 3E3AA 1QX4A 2RC5A 3LKVA 4ZZ0A 4O0LA 1KOGA 5DCYA 3L0SA 4HAZA 2ANCA 2NXJA 1GUAA 1FLVA 3NLLA 1F0NA 1YZVA 4G0OA 3AI2A 1VKZA 4BO6A 2ZR8A 4DDHA 2WJ3A 1R15A 1V8ZA 2H1RA 1G7CA 4EQ6A 5KEIA 5A7GA 2W2KA 5EZYF 1TFUA 3GJTA 4E94A 5K6AC 2IBMA 3C4VA 2Z8YM 3F6PA 4LZNA 3R3VA 3K9CA 3STUA 3ETEA 3CRQA 3ISTA 1HLDA 3G5AA 3QWAA 4LY3A 1ID8A 2VH1A 2BI4A 1C1HA 1RWVA 2UZ1B 1WF6A 3I53A 3KKOA 3OZTA 4H6PA 4Y2HA 4RE6A 2HCRA 5A4FS 3KZXA 4X0EA 1TVEA 2ON6A 3WGGA 4JLVA 1U3GA 5JQGA 1GNLA 2V8OA 3H6HA 4DDKA 5A3JA 1CQIB 3KVRA 1P7YA 2BL4A 4HXGA 4BRUA 3EOBI 3TTYA 2EFGA 1LK0A 2OBBA 5D87A 5AFSA 1E1QD 3T9FA 1KETA 3N8NA 4H1VA 1RQPA 2LRHA 4DXAA 4HLNA 5E9QA 1I36A 3DC7A 3KJIA 4I9UA 1BKYA 4QARA 1Y80A 5JSZA 5BW5A 3AUSA 4GDFA 4BNLA 1YRWA 3SZMA 5C34B 2IBSA 2I7TA 4J8PA 5IZ4A 1YRBA 2ZJ1A 4ER7A 4ARBA 1W5EA 3OSUA 3PFWO 1JALA 2XUFA 1NYTA 3CEAA 2RKBA 4M7PA 3CLSD 4WK4B 1RBYA 3GP8A 4U7WA 4S3MA 1A9TA 1MOSA 1U1IA 1U04A 4I8XA 1KFJB 4IGKA 4RVUA 3T9AA 5A2GA 1FC0A 5ANRB 4HB2A 4NBNA 2FLWA 4YJGB 1E2MA 1NKVA 1K6MA 4N18A 1TA9A 4E5PA 1PKXA 1FZQA 4B73A 1VHJA 2Z6AA 4KR7A 5G2OA 4D9BA 1TO2E 4FD2A 3ZKWB 1P1HA 1LX6A 4QYIB 4B47A 2QPAA 1ZK2A 2BP7A 3K6KA 1DG9A 5K45A 4G84A 3A6DA 3S2SA 3W8EA 4C06A 4EDFA 2GPNA 1UBOS 2BEJA 5C7YA 1B4DA 1Q7EA 3B9BA 2A94A 3OO1A 3V80A 3MAJA 3UQYS 3VC2A 4UTNA 1G6KA 3ZDFA 5HKKD 1KKLA 2MYTA 5C51B 3GUHA 4UU7A 4YO8A 1QP8A 1Q3TA 2C94A 4BE7B 4LOJA 3H2JA 1I1HA 1B3RA 1E79D 4YMUA 1KDPA 1UAAA 4YQFA 4RHUA 4R6WA 2BJWA 5JCOC 3TZCA 3EZYA 2MINA 1LD3A 3UW1A 3DE1X 1YVDA 5KSPA 2QDXA 2JBWA 3E9CA 1XLUA 1XEXA 3H2IA 4ZO7A 5EIBC 4HVLA 1YR7A 3TGPA 4ZV4A 1FIUA 3RI3A 3QPDA 1Z6QA 3PR2B 4KYUA 3UMVA 4D0LB 4OHYA 4YMLA 1KI3A 5KWVA 3HYTA 4MV7A 4BFWA 1XZDA 4CM9D 2K7ZA 4IV5A 4MCJA 1JT9A 2PL5A 3TTTA 1LSUA 2W6OA 1P2SA 3IIJA 1YS4A 2O0KA 4NICA 3WICA 4EX7A 1OX4B 3WQBA 4BMZA 4FSXA 3WYCA 5F3DA 1N2IA 4A8JA 1RXSA 1XEAA 3T7CA 1N9KA 1DFIA 3FVWA 3QSYA 1CQIA 3F5DA 4MYTA 5KC8A 2PVPA 5FPHA 4MA0A 5EG5A 1MEEA 5EJ6A 1U8AA 2P5YA 4MAFA 3WC4A 3T1YB 2LCQA 4CIDA 3AJRA 1H2AS 3H1GA 2FHSA 2RAFA 3OE7D 1W9HA 5EKUA 3EA4A 4EHNA 5KYTA 1L4BA 1XT6A 6Q21A 4MV1A 1UBGA 1G3UA 4XJTA 1I9GA 2EG5A 4O1IA 3RAPR 1RHRA 4LZJA 4JLDA 4TWIA 3IUYA 1HETA 2QT9A 3K8ZA 3BREA 5JAMA 4JYZA 1US8B 3OH8A 3Q9UA 5FR2A 1W46A 1KP9A 1E99A 1TF5A 2X42A 4KAJA 2I6GA 4Q05A 3H5TA 3GB9A 2XF2A 4ROSA 5BMVF 5JNWA 1BWSA 1GZ3A 3LQ2A 3WIOA 4C4RA 2JRLA 3K0CC 3N0TA 4WZAA 4N7JA 4UPDA 5JAZA 4Q3NA 3ZYZA 4FP9A 1K4MA 5C7OO 3FA2A 5ALOA 4DPLA 5CBPA 4Z9YA 4WD3A 1EUDA 3L1IA 3UMFA 2CXPA 1D2CA 2CNBA 2GEKA 1E20A 3L7BA 3ZTTA 2F1RA 3N2EA 4BLQA 4DM4A 5LDHA 1YU6A 3O5AA 6NULA 4NL4H 4PINA 1QVWA 3TQIA 4ACBA 3P71T 4H3VA 1E7SA 5DYNA 3GLTA 1T9GS 3GEPA 4EGCB 3EQ8A 1GV1A 5KCZA 1TYDE 2ODEA 2W2VA 4ZYXA 1ZHFA 5AKEA 2NAFA 2A8YA 1LRKA 2WHEA 3RC3A 3HXOA 4KVFA 4W8HA 4PX5A 3SFZA 3UJ7A 1J9ZA 4Y9TA 1MGPA 5FL7D 3M2TA 4BNDA 4BQFA 5LIPA 1UPFA 2QPTA 3DO6A 2BFCB 1KJIA 4GYJA 3S81A 1O87A 5U4QA 1QTRA 1X38A 3I34X 5FOUA 2OD2A 1OH6A 4YRKA 2XUIA 1ISRA 2FQYA 3IESA 1WABA 1FYDA 3LSTA 3PZRA 4V0NA 1L7MA 4CCYB 4F4HA 1G4UR 1FX1A 3OBBA 3H2BA 2P8JA 3B1YA 3SSMA 3ZHZA 3AJ9A 2OGTA 5M7EA 1B7GO 1I0LA 3PHHA 4UNNA 1QYXA 3DNMA 4UZSA 5T6BA 4WJLA 1GZ6A 4JX9A 4OMFG 1Y3DE 3GQVA 4UOZA 2XT9A 1UC8A 4I1RA 1PR4A 1VSUA 4AX8A 3WMFA 3U7JA 5LCXA 3UK1A 2JBHA 2XQFA 2PO7A 3LBAA 1V35A 2PS9A 4KLZA 4HSEA 2XD9A 1B41A 1OYOA 4CMJA 2CYCA 4OL0A 1NRJB 4UEQA 1HYGA 1JU4A 2N42A 3KOXA 3MIIA 2JZOA 3VDRA 1PDOA 3K0FB 3P9QA 4E21A 1QQTA 1OV4A 2UAGA 3GOHA 1N2XA 4O25A 4UDNA 2R6JA 2NO4A 1J0DA 3HKCB 4HWKA 4NZPA 2IS6A 2ZVJA 3BK7A 4AFNA 3X1DA 1WTCA 1GPLA 4KX3A 1ZH0A 3M0EA 3RSCA 1UBHS 2Q5IA 3ESXA 4QE3A 4HATA 3EDOA 4HXYA 1JQBA 3QYAA 3IHKA 4QDZA 4QUIA 1RRMA 2ODWA 3FSRA 1QCDA 4JT2A 1UT8A 3CZ5A 2V9CA 4Q34A 4Y8VA 3LHFA 1A8HA 1JDZA 2CL6X 3I6YA 4FHCA 1P5JA 1E6WA 4TXNA 2F62A 1KJWA 5CT6A 1ZH4A 1H6DA 3W05A 3AYXB 2GQ0A 3EULA 3P26A 2QMQA 4QRIA 3EZFA 4Y2XA 5JY1A 4MQFB 5EJEA 1TQ8A 4BNZA 3PLAE 3IHTA 5TNXA 1DRKA 1E9VA 2YY5A 1SVWA 5FBRB 2CXQA 4IRXA 3GH1A 4ZC1A 4MW6A 3RSFA 2WYHA 4D4LA 4M0CA 3TQOA 1PNRA 1QKJA 1PUIA 4CT5A 1P18A 5EKTA 4ZYZA 4LV5B 2A0WA 3D3EA 4FDMA 4WERA 1TUBA 2R4TA 3IULA 3I2YX 4KO3S 1Z7GA 3IQDB 5JVDA 1GSAA 1HPLA 1ZBQA 4F6LA 2BFCA 4P9NA 1JG1A 1UMKA 3VVBA 2JEYA 3QI2A 1A4XA 1J1ZA 1G55A 4IZ6A 4PSUA 3ML1A 1H85A 3UMSA 2Q21A 1ZAKA 1WCWA 4GAEA 3A2MA 1ISMA 2Q6IA 3PTAA 3QVUA 5J63A 3DFIA 1AV7A 3CF6R 1KMHB 3PFGA 2PXXA 3HR8A 4O33A 1XQ9A 4ASUA 3E23A 4KE7A 1JWAB 4OB8A 3AXTA 4XVRA 3NU1A 1KI7A 2KJQA 3EH1A 4B6GA 4Q4AB 3OKPA 1T3GA 1EWTA 2Y0CA 4FDVA 1BW9A 5G0UA 2WSMA 5LYJF 1QHHB 5EHQA 4PV7A 3X43A 4DIOA 3O3CA 5I48A 1Q1EA 1JIJA 3U9SA 1VMKA 4TZ6A 1V45E 3Q1LA 3TAUA 2QY6A 1EYZA 2IOFA 1YASA 1RAFA 3BSSA 4RH3A 3L84A 5EE9A 5LXTF 1G8PA 2WF7A 5D84A 3BMOA 5I51A 2ZB4A 1GUBA 1OZAA 1LKZA 2GK3A 3JQBA 1UBRS 2JAUA 4C04A 3C3YA 3SOZA 2XWSA 2OESA 4G2TA 3AEXA 4DTCA 4KN6A 3OF5A 5JJLA 4MXDA 4HS4A 3IDFA 4LS3A 4PG7A 3TEFA 2FMIA 3EVBA 3GAMA 2FZVA 1OXSC 2GAOA 3FTDA 3G8CA 5EWMA 2F7SA 1TD9A 1T4MA 2VF2A 5TF4A 3W2TA 2FB9A 1X39A 2ZYSA 4QJIA 3THOA 1RLMA 5BVGB 3PD1A 4QAJA 4MSUA 1EZZA 4L4ZA 1EGAA 4EB6A 1F2TA 1JZTA 5BO5A 5JS8A 3ZZUA 1SXQA 2OQ2A 2QTWB 1ADJA 1QVRA 3D5QA 1N9ZA 3H65A 4UBLA 1CIVA 2M1XA 3BHIA 3KQQA 4UNPA 4HFRA 4ZK6A 2VHWA 2Q4TA 1FDTA 3DFUA 3L06A 5DNCA 1CR2A 2I80A 2OD7A 3CR3C 3DONA 1V5WA 2Q9UA 3OZRA 3QYFA 3LW8A 4ARZA 5EP3A 2DSTA 4F91B 5BR8B 4G1MB 4AJ4A 3B3GA 4BB9A 1FRFS 4URZR 4P4SB 3SJZA 1VIYA 4K88A 1VHQA 2YIVX 3F78A 3T4PA 2EKDA 1PQ4A 1RAAA 1Y3HA 1YR6A 2FXIA 3JYOA 3PGJA 4D3ZA 1D2RA 1U28C 2HU2A 1LPMA 2NSHA 1VYUA 2BHRA 1IG3A 2WIFA 4I4NA 4S12A 3RODA 3TUIC 4CUKA 1EBBA 4MVJI 3WRYC 2GCOB 4AF8A 1IB0A 1I1QB 1U3FA 3G8BA 2PZKA 2ZB8A 2Z3WA 3GXOA 3QE0A 3UATA 3WJ2A 4WZ6A 3MLAA 1IAQA 2RHJA 4PZZA 1IY9A 3LKZA 3ND6A 3ADBA 1X7XB 3C15C 3GRPA 1KI4A 3KX2A 5DPMA 1M6VA 3SZUA 3ULKA 3VPDA 3LMKA 1DBQA 5EJ5A 1H9BA 2G83A 4FDLA 4RHEA 3ZHYA 2DY0A 2Y67A 2XEXA 1EAYA 1EX1A 2CJWB 5DE3A 2QUBA 2Z8ZA 5DTEA 1JHXA 1GAEO 1SOWA 2JLRA 4Y2RA 3SFTA 5DM0A 3QZUA 4IFTA 3A4MA 4IJUA 4DLPA 2BKXA 5ENDA 4BO8A 3BZWA 2Y1XA 3GFRA 2QV7A 3II6X 4MW4A 3P9NA 3MAAC 4M0PA 2QXTA 4R1QA 5GPBA 1P1BA 4F1JA 4YRGA 4PM4A 1WY5A 4PHGA 3AZPA 4RXTA 4Z86A 5AICA 2H08A 3R09A 4LRWA 1IN6A 5JNUA 1S2DA 2Z9DA 2GZSA 4WOPA 2R1VA 3EEBA 4Q48A 5K3BA 4XRGA 4M98A 2V7PA 1JJVA 4DA7A 1OT5A 2VSQA 1R8JA 1VJCA 3N6XA 4C7OB 1ZGHA 2PZFA 1KK2A 2NU8B 3UANA 1QYRA 3LBYA 5IABA 1FTGA 5J40A 3T99A 4ZVPA 3VGPA 1JWLA 5FA6A 3B1WA 2GM3A 1DBVO 2VHQA 1QNLA 4YI3A 4AM8A 1E9AA 1P8JA 4A0QA 2PGDA 1UQRA 4ZOLF 3BVPA 2LV8A 3WDSA 2JGLA 2KLHA 4UVHA 1IULA 2NM0A 4HYQA 4OQPA 4OK3A 5GJWC 3RSGA 3R5SA 3AJAA 4QYSA 4CDRA 2X13A 1QX3A 2XMSA 4R9SA 5KU7A 1ZHHA 2QV0A 5UKDA 1KC1A 2X0EA 2JJYA 1HUQA 2WQZA 4RPIA 2ZRMA 4F6RB 5BN3B 3GRZA 3QKSA 4JUAA 3DLBA 3CINA 3PLRA 2BHSA 1FMLA 3CUWA 3KPJA 1J2TA 4QFCA 4M4SA 1SG9A 2QWXA 4MEAA 3S99A 3DBHB 3JTEA 2ECPA 4M7WA 1E5QA 4QUDA 5AKJA 2FX5A 5I8ZA 2WAOA 3SD7A 1PWEA 4I46A 2OQRA 4JKIA 4YP7A 1XZ8A 2C2XA 4JUCA 1QZZA 3L1UA 1OV6A 2XSZD 4K9OA 5JZSA 1XZEA 4EG5A 2X14A 4WRRA 3EGOA 2VJCA 5J5VA 1B3BA 5KC9A 5J1TB 4HGNA 4G4SP 4EKEA 4F9GA 2ZIXA 3E5HA 2NZXA 4XYGA 4G0UA 5KB3A 1WXWA 1YH3A 3R20A 2FPIA 1DCTA 4E14A 2XNCA 4NNOA 4JEIA 3RUFA 4EG1A 3QBDA 5JNVA 3SQLA 4RTOA 1QMPA 1USIA 5K99A 3A6JA 1USVA 4WBNA 5E4JA 2O8FB 1AXEA 2R84A 2ZBDA 3CVJA 4KODA 4CLXA 1VQ1A 4F72A 4N3BA 5B12A 2IXEA 3IB6A 4REQA 1FQWA 3A4IA 3D5TA 3LCUA 1Y0BA 2REBA 3C45A 3FBTA 3BB4A 1VB5A 4EHDA 4CG1A 4E5MA 5JZOA 1GZDA 2YDXA 1F14A 3L8DA 3ZW7A 2OFXA 2A2ZA 4ZKDA 1WW3A 2NWQA 5EQFA 4ARUA 1DKPA 3CVYA 2JJ8A 2RHCA 3VNSA 3OOYA 1U8TA 4DLVA 1UEIA 2ZQ5A 2CDCA 1BRTA 2CWWA 3PJGA 5D5PA 3DM9B 4KNWA 2QGFA 5AW8A 1UBFA 3SG0A 1GL3A 4K26A 3A6PC 3U7FB 1RQ2A 5CGQB 4HN4B 5B58C 1YJ8A 4EHFA 1C1XA 1OFUX 3B7GA 2IEIA 2WC1A 3MK31 3MT7A 3JZDA 4L50A 3DEJA 3MWDA 2VDLB 5CA0B 5KQMA 4JROA 4EPVA 5DO9A 4DR4B 1CZKA 1WUIS 3MMPA 4RIFA 3TLGA 3UHFA 4AZ3A 5TXGA 4JQZA 4WKOA 3AZOA 1Z4KA 3BAFA 3EF3A 2CHVA 2Q5QA 2B9EA 2O2SA 4MGZR 3RS3A 4JSRA 1PHRA 2J5RA 4DMMA 3CMCO 3TS1A 4F3KA 3OEED 3GLGA 1TJ4A 2FWNA 2WNIA 1JHAA 4EVSA 3UPTA 1M8PA 1ZJJA 2XOXA 4IDAA 3ZDZB 1QKIA 4B3IA 2B1GA 4PLPA 3E7PA 1OLXA 2G09A 2X15A 4LI3X 3HVRA 2E5FA 2AA3A 5DM4A 4FW9A 1CUCA 1C7EA 1T91A 2A9FA 4WUTA 1EGQA 1ZD4A 2W6JD 2CVPA 5CLIA 4L95C 2JKZA 4C08A 1Z68A 1Y81A 1WWKA 5FBZA 2C7VA 2BTQA 3HVIA 5H81A 1GKKA 3DEAA 4I99A 2JIRA 4P5EA 4GBED 4NARA 2BMJA 4FQ7A 5SYAA 3RTCA 1T6XA 3G1WA 4OB6A 3MTIA 3UVEA 3PC8A 3VR6D 5HDQA 5I9IA 4PGGA 2UUBB 1W1WA 3EIQA 1QHYA 3H1PA 4Y2PA 2QGZA 2IYAA 5JG7A 2AL7A 2WZBA 3VJKA 3S1AB 3U4GA 8ATCA 5I47A 2A0KA 5DF1A 2XUQA 3K1TA 3IQZA 4JSYA 2G82A 1F7VA 4LHYA 3EWAA 3RSLA 4Q0MA 1UJCA 4PZLA 4TMWA 1GTVA 1F4PA 3CNEA 2YWRA 2QRLA 3WLNA 2B21A 4A4DA 1ZD8A 3LHSA 1Z5GA 3HUEA 4IOJA 2GMWA 4BLTA 4C0SA 1XYGA 5F7XA 2YHBA 4EW3A 2HSGA 5EUMA 4RIGA 1NW6A 2JHGA 5FTWA 4BNVA 5HOQA 4BMVA 4R5MA 2X77A 1QF7A 1VA4A 5A9TA 2VP5A 3ZVRA 5CCEA 4JI4B 4BX0A 4LJ5A 3HFGA 1PU2A 1EFLA 4XQEA 4DADA 2D4AA 3BJRA 3UY4A 3TZKA 1H2RS 2AF4C 4X71A 5FD8A 5BT9A 3AIOA 1ZUNA 2VWQA 3AU8A 2CHQA 2FEPA 2I29A 2R00A 1UINA 3ASYA 3PNSA 1SD5A 3L5KA 2NTVA 3DCYA 1QGUB 1TYEB 2J9RA 2FDRA 4L5YA 4X85A 4AYWA 2Q3FA 4L5AA 4ER3A 2FQQA 2AW3A 5FA8A 5TQ0A 1HA3A 1R4ZA 3QXJA 3C3WA 3CC8A 2XGGA 2DG2A 4REQB 4IPTA 3EZ2A 4RWZA 4DMRA 4FUTA 3LO8A 3T7EA 1UDWA 5CA1A 1M2OA 1U4SA 2CJPA 1ZI9A 2XVXA 1XP5A 5SY4