4BZWA

Complete crystal structure of the carboxylesterase cest-2923 (lp_2923) from lactobacillus plantarum wcfs1
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
275
structure length
275
Chain Sequence
MQVEQRTLNTAAHPFQITAYWLDQISDFETAVDYPIMIICPGGGFTYHSGREEAPIATRMMAAGMHTVVLNYQLIVGDQSVYPWALQQLGATIDWITTQASAHHVDCQRIILAGFSAGGHVVATYNGVATQPELRTRYHLDHYQGQHAAIILGYPVIDLTAGFPTTSAARNQITTDARLWAAQRLVTPASKPAFVWQTATDESVPPINSLKYVQAMLQHQVATAYHLFGSGIHGLALANHVTQKPGKDKYLNDQAAIWPQLALRWLQEQGLLAGN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LIPASE/ESTERASE
publication title Structure, Biochemical Characterization and Analysis of the Pleomorphism of Carboxylesterase Cest-2923 from Lactobacillus Plantarum Wcfs1
pubmed doi rcsb
source organism Lactobacillus plantarum
molecule tags Hydrolase
total genus 88
structure length 275
sequence length 275
chains with identical sequence B
ec nomenclature ec 3.1.1.1: Carboxylesterase.
pdb deposition date 2013-07-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07859 Abhydrolase_3 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4bzwA00
3O4IA 5ALRA 1QIKA 4L72A 4CG1A 2JGEA 4FWBA 5EIHA 5J3JA 4Y2SA 4QA9A 4FMPA 5ALGA 4K5QA 1R4ZA 4F60A 3EQ8A 4Y9SA 2XUGA 2C7BA 5JZSA 2WILA 4P92A 5AOBA 3IULA 1ODCA 2J4FA 4K6HA 5FUMA 2H7YA 3MGAA 4MEAA 2HA6A 5K3EA 2OGZA 4QEKA 3C5VA 5EGNA 3O4HA 4CFSA 2R8BA 2W22A 1K8QA 2AJCA 3V48A 1N5RA 2XUDA 3JW8A 4H7EA 3WL8A 4Y2RA 3C87A 1CIJA 4EB0A 3VJKA 3G9TA 4EA6A 2WM2A 4AMZA 4O08A 5ALLA 3D7RA 3WL7A 3L1JA 1OXMA 2QVBA 2VA9A 1QFMA 4K2AA 3K2IA 1XZKA 5ALIA 3AZPA 1UT6A 5DWDA 2V96A 4EY6A 1JMKC 2PUJA 1BCRA 2B61A 2OPHA 3GZJA 4DGQA 2XLCA 2RHWA 1RYYA 1TIBA 3PUHA 3M3DA 3ESBA 1LZLA 5KREA 2HFKA 4AZ3A 2HRQA 4EY5A 4U2CA 4UBJA 3I1YA 4J0JA 4AB1A 4X91A 1VZ3A 3V9AA 4PSCA 3E3AA 5E4YA 1FFBA 4G4GA 1MNQA 4DTCA 2OCLA 1UXOA 1EVEA 1QIDA 3LIIA 4MYSA 4HTAA 1CUDA 2P8SA 5AI4A 1JT2A 5DLPA 3C45A 2XUIA 2XMGA 1YA4A 4LXIA 1JFRA 3LIPA 3HABA 5K3DA 2OCKA 3RKSA 4XWGA 3SX4A 2ECFA 4G1FA 1ZJ4A 1J2EA 1MN6A 1IZ7A 1MT3A 4FLFA 3F96A 3WKAA 1WCYA 3BF8A 1LBTA 3ESCA 3VXKA 3NWOA 1SOMA 5LZ7A 4L9AA 4ZGBA 4J3JA 4H7DA 4LHEA 3QBJA 2V97A 1ETHA 2BUBA 5DTIA 3ZPXA 1BEEA 3QITA 3WWPA 2WJ6A 4FLEA 4DNQA 5AJHA 1VKHA 5DNUA 1Q0RA 2ZJFA 5EHXA 1BN7A 4BC1A 4CG2A 2WU3A 3DL4A 2ACKA 2DFPA 4CIBA 1TRHA 1EDBA 2QXTA 5LZ4A 3Q0TA 4ZREA 3W05A 5IKXA 3ZLVA 4ZV7A 4A16A 5EIAA 1UK9A 3WJ1A 1A8UA 4OU4A 5LKRA 4Y2VA 1AX9A 3BDIA 2HADA 3G8YA 3STTA 5JAOA 3HI4A 1C7JA 2ZYHA 1A8QA 2CMFA 2HU8A 3GA7A 1XZEA 5FPPA 4X93A 1U4NA 1Q0ZA 2JEYA 4ROTA 1DWPA 5AI8A 1FFDA 5ALOA 4H18A 3C5WP 3G9UA 5SYNA 1U65A 3DNMA 1LLFA 2ZJ7A 1H2XA 3FLBA 3HYSA 1XZAA 4KRXA 1PV1A 3AJAA 5E2IA 2GBIA 4BP9A 1GKLA 4GLBA 2VF2A 3G0GA 3PI6A 1SFRA 2JIDA 4DLNA 1CFJA 5ALYA 7YASA 5FLKA 1XQYA 1DX6A 2XMRA 2BKLA 5JZ9A 2X5XA 2ONCA 3STUA 3H19A 5K3AA 1GZ7A 4RPCA 1J07A 3CN7A 1DTEA 1ORVA 1N8SA 1EA5A 3HZOA 5HZGA 4X85A 2RGUA 5JADA 3WWCA 4DIUA 2DHCA 3G9ZA 3WZMA 3HJUA 1XQWA 1TCCA 4WY8A 5CT5A 3O9MA 4NMWA 1RWQA 3QPAA 5JATA 2QOEA 5JAHA 5AM3A 2Z8ZA 1JKMA 1FSSA 4KJXA 4PF1A 4QDZA 4F5ZA 2HA5A 3IB3A 1ACLA 2QKYA 4WFIA 5IH7A 2XUOA 1EI9A 1ZD5A 4Y2TA 4OU5A 4DMCA 3FSGD 2XMDA 4AQDA 4X7BA 5AM5A 5HFNA 1YA8A 2PSJA 4B81A 1ZICA 1VOTA 2XMSA 3OURA 5CTAA 5EI5A 2PU5A 1QIJA 2V9ZA 5AK4A 1CLEA 1UOPA 1AZWA 2PSDA 2QUAA 5AM1A 2PBLA 1HL7A 1LPOA 2YASA 5CT6A 1GKKA 3CXUA 1ZGCA 2HDWA 1RP1A 1QIHA 1XZFA 4ZV9A 1W52X 5I9IA 1R88A 4UPDA 4AO8A 1EDDA 4BC0A 4CCYB 1HDEA 1EINA 3I1IA 4Q34A 4QE3A 1T4MA 3ANSA 2ZSIA 3D2CA 4JYPA 4BVKA 1VE6A 3CCCA 5YASA 5JD5A 5H3HA 1UZAA 4AO6A 3WK9A 3AUKA 3H0CA 4MQMA 4QDOA 4Y7DA 2GBGA 5HF5A 3PE6A 5LZ8A 3DJYA 4FBMA 5AKXA 2YYSA 4PNZA 4YK7A 5AIAA 3L1HA 3QH4A 3IBTA 1HQDA 2O7VA 5AM2A 4B82A 1MTZA 3QMMA 4LKOA 1L7AA 4UFNA 4UHCA 1FFEA 4HZGA 2QTBA 1NU6A 5CT9A 1MU0A 3QZUA 2I3ZA 2XMBA 3FVTA 2ES4A 5E4TA 2WHPA 3WK6A 4ZXFA 4UBMA 5AM0A 3R41A 2XUKA 4Y2QA 1UOQA 3I2HA 2EDCA 4L3WA 2BGNA 5ALTA 3SWWA 3H04A 3FBWA 4AN1A 1AGYA 1LNSA 1EB8A 1PJAA 1CUHA 1EK2A 5AH0A 1CUUA 3DOIA 1XZDA 4N8SA 5KWIA 1E5TA 3FOBA 2DSNA 4ETWA 3ZV7A 3CN9A 4EBBA 5CMLA 3AINA 3IIIA 2VAVA 5JZBA 1QLWA 4QDXA 3BIWA 2XDWA 3NGMA 3ED1A 4JH0A 1EXWA 4UBIA 5FXMA 3QPDA 1S8OA 1R50A 5KBYA 5A71A 2QJWA 3DYIA 4W1PA 1QO9A 4EZIA 4G8CA 3PICA 3ZI7A 1JJFA 4AZ0A 3ZWQA 2HA0A 3RK4A 1IMJA 3WYNA 4JEIA 2XUQA 1CEXA 3FWHA 3WKBA 5ALJA 1G66A 1CUWA 4UHEA 4W1RA 5IVKA 2PKYX 4W63A 5AI0A 4UHBA 4GEGA 4Y2UA 4MYDA 1VA4A 3C8HA 1MPXA 1ZIYA 5LIPA 1CVLA 2EDAA 3AILA 2Y6VA 2WHQA 1ZIXA 1A8SA 3F97A 5HKBA 4Q3LA 1LPPA 1CUZA 4EHBA 3IUJA 5FPQA 1UKCA 4BE4A 2X76A 1JJIA 4EUSA 2CKMA 3AFIA 4G5XA 1Z68A 1XRMA 4BAUA 3AIOA 1BN6A 1CPYA 2AJ8A 3RM3A 3WL6A 4MQLA 3A2NA 2QR5A 1TCBA 2FX5A 1XZCA 1LPAB 3M82A 2G63A 2JEZA 1C7IA 5HCUA 5ALMA 1ZD3A 1MNAA 3SC2A 1UFOA 4BZWA 4F0JA 2QUBA 1YS2X 3M81A 2XUHA 4M0MA 1X70A 1THGA 3U1TA 1L7QA 3R3XA 3IUMA 2H9YA 1VE7A 3LP5A 1ORWA 1YB6A 3HEAA 3DL7A 4QLAA 5JIBA 3BJMA 3S8YA 1F0PA 4C87A 3GROA 3MVEA 4C6HA 1CQWA 3ICVA 2ORYA 3EIOA 5T4FA 1R1DA 1DX4A 3WI7A 2VJBA 1QIIA 4KACA 2RIPA 1QFSA 3WLAA 4BRZA 1F0NA 1QIEA 4FLMA 4OSEA 3DCNA 4G8DA 2WJ3A 3MUNA 2G5PA 4Q3KA 4A5SA 2HL6A 3AIMA 3TEJA 1ZI9A 2PU7A 3DS8A 1U2EA 2VJDA 1XQVA 3A2LA 4HS9A 1L7RA 1K5PA 4K6GA 4MWSA 2C58A 2PL5A 5CXUA 5LP1A 5CW2A 2OQIA 3FAKA 2WIJA 2XUFA 4CCWA 3C6YA 3QMWA 3NUZA 2DCMA 1DT3A 4C4XA 3ANTA 2UZ0A 3VDXA 5ALUA 4AMYA 3FCXA 1R9MA 3QM1A 4XIIA 1F8UA 4L0CA 3PUIA 4QWWA 2YH2A 4OB8A 1KU0A 4OYLA 3BXPA 4C4ZA 1BEZA 3OC0A 1XLUA 4H7JA 4J03A 1UKBA 5AIBA 2I03A 4HAIA 1EK1A 5AI5A 4G9GA 4E11A 1FFAA 3UUFA 3D0KA 2IITA 1EX9A 5LYYA 5JALA 3O4GA 1IUOA 2HFJA 4WCVA 4WDRA 3MUOA 4RE5A 3OPMA 3UUEA 1O6GA 4IH4A 3UMJA 4IHAA 5AKJA 5A7HA 3RLIA 1K63A 2DHDA 1LPBB 2XT0A 1CUCA 4B9AA 4WFJA 2VT6A 1A7UA 5AKHA 3V1MA 2B20A 2OGSA 3KWFA 3QPCA 2J3DA 4OUKX 1XFDA 1UK6A 4U2FA 4E46A 2CBGA 5AOCA 5T4EA 1U8EA 1O6FA 3DOHA 5C8XA 2C5FA 3HACA 5T4HA 1ISPA 1XKLA 1DT5A 1YR2A 1R9NA 2XQGA 2H7CA 5A6VA 1CQZA 1UWCA 3FCYA 2HRRA 3TRDA 2RI6A 2WUFA 5AKZA 1J06A 2W6CX 3B12A 1BCSA 4BRSA 5JD4A 5DTJA 3WK7A 2HA3A 3IDAA 5K3FA 3WA7A 5CH8A 1CV2A 1GQRA 5C7YA 2HM7A 5I8PA 2JBWA 1PFQA 2O2IA 4X94A 3I2KA 1WPRA 2OLEA 5ALDA 1WB4A 2HA7A 4JYMA 4Q82A 2XQFA 1N1MA 3WK8A 2OG1A 1X2EA 3G02A 1Y7HA 5HK9A 3H18A 3YASA 2CEKA 3BIXA 3VVMA 3FLEA 2WFLA 2WKWA 4H7KA 3G9XA 3WKEA 1MX5A 3DKRA 4S0XA 5CRIA 2XB6A 3FVRA 1HKHA 1QTRA 1XZJA 2ACEA 1DWOA 3AIKA 3C6ZA 1QOZA 3SK0A 2BUAA 2NW6A 3V1NA 3EBLA 2QMQA 4OB7A 4FFWA 2HU5A 1VA5A 4UBOA 1YASA 1ZI6A 1DINA 5CURA 3JYHA 3QMVA 3O4JA 4BP8A 1WM1A 1Y7IA 2E3JA 4H0CA 5HQ3A 2BJHA 3VJLA 3F8SA 3KOOA 2I78A 1TCAA 5HFAA 3DDUA 5DYTA 1MAAA 5BOVA 1XKTA 2D5LA 1ZI8A 3R3WA 3RARA 1QIGA 1THTA 5ALQA 2QS9A 3L1IA 4ARAA 2PVSA 3FYUC 3KD2A 3G0BA 1DU4A 1DQYA 4QLOA 2QRUA 4RGYA 3FYUA 3WWDA 1AURA 1E89A 1W76A 4P93A 5I7UA 4DMKA 5LZ9A 2VQ6A 3DKKA 4Q05A 5JANA 5HF6A 4WFKA 4XX1A 4B6GA 3C6BA 4QDUA 2WUEA 4GWLA 4E15A 2WQZA 2VJCA 1UKAA 1GQSA 2Z3ZA 4TGLA 1H2ZA 4MXDA 3IUNA 3C8DA 1DQZA 4EY4A 1J1IA 1H22A 1ZGBA 1WB5A 5ALFA 1M33A 4UBNA 3I2FA 4B7ZA 2WTNA 3STYA 1QJ4A 5AKYA 1CUYA 2GBFA 2VSQA 4X71A 4BTLA 2C0PA 1W4LA 2WIDA 3WA6A 4BCDA 4PSUA 3BWXA 2Z5GA 3R3VA 4HVTA 4JNCA 1QTIA 5AK5A 2J4CA 4J0DA 3ZLUA 5D7BA 5A7GA 4XVCA 3W9UA 1MX9A 2Y2UA 3O9VA 1P0MA 3AZQA 5LKAA 1CUBA 2C4HA 4IO0A 5AHXA 4ZWNA 4DM7A 3QYJA 2C0QA 4AXBA 5ALHA 3G0DA 1UOOA 2VATA 2V98A 4J7AA 4QNNA 2WUGA 2WIKA 4BDTA 4HRXA 3KWJA 1B41A 2JGLA 5CH5A 5BV7A 1SCKA 5AK6A 4X6YA 3DYVA 2WG1A 1HLGA 2XQJA 4Y2XA 2Q0XA 1VZ2A 4W1QA 4N8EA 3T4UA 1QE3A 3GBSA 2XUAA 3BE8A 5JD6A 4TVKA 5ALKA 2WU4A 1JU3A 4BYMA 1LPNA 4C4YA 1IUPA 3OG9A 5AICA 4GXNA 4BDSA 3IURA 1G42A 4KAJA 3VVLA 4HXFB 1LBSA 5K3BA 2B4KA 5IVDA 2WHPB 5ALPA 5AI9A 1GPLA 4B9EA 1N5MA 4DSAA 5FP0A 4NVRA 1ZJ5A 2CJPA 4HXEB 1T2NA 2GYVA 4M0EA 4DMFA 4WJLA 3N2ZB 2ZYSA 4DNPA 4YASA 1QIFA 2AXEA 5AKEA 4DNFA 1YAJA 5AKKA 1Y37A 4G4JA 1YSCA 4LIPD 2WUDA 3BDVA 2OAEA 5LZ5A 5ESRA 1XZLA 1P0PA 3N0TA 3H2IA 4KAAA 4RNCA 5D6OA 2D0DA 5FDFA 4TPKA 5HKAA 5C8ZA 1XQXA 2OQVA 4KE7A 2RHTA 4W9RA 4OYYA 5ALXA 1E66A 1XRNA 3B3QA 3OM8A 3STWA 5ALSA 3QVMA 5DYWA 1F6WA 2JGKA 2WTMA 4Q3OA 1JMYA 4DSZA 4X92A 3G0CA 3VKFA 4YX9A 1GPNA 4BAZA 2JGFA 4UBKA 4IQ4A 1NX9A 1HPLA 3DD5A 3I6YA 4NS4A 3V1KA 5LZ2A 2VT7A 3K6KA 1XROA 4Z49A 5FKJA 3WK5A 1XLVA 2EEPA 3D2AA 2QXUA 4GDMA 2AJDA 4KYVA 2WIGA 2WSLA 3WL5A 2O2HA 3EQ9A 3M83A 2DQYA 4Y2JA 1W75A 3KXPA 4X97A 4X90A 4UFOA 4X6XA 3BL8A 4GHWA 1BROA 4WY5A 2O7RA 3WQHA 3H2JA 1K4YA 1G4HA 2CB9A 1WHTA 4Q1VA 2BFNA 4FKBA 1JU4A 2GZSA 3A70A 2XUPA 4X6UA 1LPMA 3U0VA 1LGYA 3F67A 3A2MA 3I6MA 3NOXA 4X95A 2WLSA 2AJBA 5SYMA 3WWEA 2G4LA 1EH5A 2XLBA 4F21A 3JWEA 4C01A 3GELA 4JUIA 3BF7A 2QT9A 4MEBA 1E8DA 3WWOA 4K6KA 5JASA 1H2YA 4H7IA 2ZYRA 5DNVA 4BCBA 4B83A 3IUQA 2IX9A 3W2TA 1MO2A 4BATA 1VXOA 4KAFA 5JAPA 4I3FA 1AUOA 2JGMA 6YASA 3O0DA 4ITVA 2G5TA 2I3DA 4CIAA 3HRHA 1CUFA 3H2KA 1YS1X 3H2GA 5AI6A 2BGRA 2ROQA 3FYTA 1TKRA 5IVHA 5F4ZA 2C5GA 1MX1A 4ZRDA 5AOAA 2OGTA 4LYEA 1E8MA 2XQIA 5EHQA 4AN0A 2J3QA 1OCEA 5JYCA 1JI3A 1AMNA 2H7XA 4B0PA 4X3CA 2OCGA 2FJ0A 1GT6A 2RONA 2VTVA 4U2DA 5IVIA 2XMCA 4UHFA 5HF8A 2O2GA 5K3CA 2GZRA 5AKLA 1CUVA 4QZVA 3D5EA 2WG0A 4DMHA 1XZGA 2OAGA 2AJLI 2XI4A 1ZD2P 4U2GA 3X3HA 3FLAA 2B9VA 4FDMA 3D2BA 3DLTA 1FJ2A 2WFZA 1C4XA 5D3ZA 4OB6A 3WJ2A 4KRYA 4BB0A 1XZMA 2Y6UA 3LLCA 5HK8A 4E14A 4AO7A 1XLWA 4H77A 5DNWA 4YPVA 3CCBA 3R3ZA 3A6ZA 2PM8A 3WIOA 5DJ5A 1MAHA 2PPLA 3D3NA 2YXPX 2DQZA 4J0GA 2R11A 1CUJA 3I2JA 4MWTA 5AO9A 1BS9A 4INZA 1NU8A 4G8BA 1H2WA 1TAHA 5LLSA 5CXXA 5ALVA 3D4LA 4G9EA 1QIMA 1USWA 3W06A 1DWQA 1W1IA 4HXGA 3LCRA 1MJ5A 1BRTA 2HU7A 3TJMA 1R3DA 3W9BA 2XUJA 1OILA 4D9JA 3EF3A 4B84A 5EHZA 3HLKA 4U2EA 3OOSA 3F98A 4BAGA 4BVJA 1XZIA 2ZVDA 4BCCA 2CUTA 3ILSA 1SCQA 4UHDA 4KEAA 1WHSA 5CBKA 4KE9A 5K3FB 2Z8XA 3IVMA 2K2QB 5CT4A 1ODTC 2WFMA 4FFVA 4DYHA 3R3YA 1AQLA 2PUHA 4B85A 1B6GA 3T52A 3TGLA 5EFZA 1XRQA 2DHEA 3KSRA 1TQHA 1CR6A 4EY7A 4G4IA 4Y2PA 1ACJA 1E3QA 3PFCA 3C70A 3FSGA 4X00A 5AK3A 2CZQA 4PQEA 1XRRA 3AZOA 4WDQA 2WFLB 5BWBA 4CG3A 5JARA 5AKGA 4FNMA 4ZI5A 5ALEA 5EIEA 3E1GA 1EVQA 3WYDA 2HA4A 3I6ZA 4LYDA 2WG2A 3C6XA 2DR0A 1K6EA 3WMRA 3BJRA 2Y2VA 5FRDA 1EHYA 1FFCA 1CUEA 4J0HA 3HSSA 5BWCA 1ZD4A 2H1IA 5AM4A 4OD0A 3WZLA 3FNBA 3LS2A 4BZZA 2FUKA 1QZ3A 1A88A 1ODSA 1XZHA 1WB6A 5HQ3B 2ZSHA 2WHRA 4C89A 1CUXA 1AC5A 5E4JA 1IVYA 5EHNA 2ZJ6A 3WKDA 4C88A 5CT8A 3HXKA 4A23A 5JAUA 4CI9A 1P0QA 4EY8A 3R0VA 3PF8A 5A62A 3FYUB 4GBGA 4CCYA 3GFFA 4J0CA 1I6WA 4PSDA 2JF0A 1G5FA 4W1SA 1XZBA 3STXA 2GYWA 5C8VA 4P9NA 1CRLA 4UHHA 1QONA 4I4CA 2WIFA 2Y1KA 2OXEA 4FTWA 2XMZA 3O95A 2XE4A 1XRLA 1AKNA 3P2MA 4NZZA 5AP9A 4H35A 3IA2A 3D59A 4IH9A 3G0IA 1IZ8A 4IH1A 4N5HX 2PSHA 3C43A 4GECA 4UBLA 3ZLTA 2BAGA 4PV7A 4PW0A 4BE9A 5KWJA 1H23A 4FOLA 1VLQA 1Q83A 1LPSA 2WJ4A 4GW3A 2VJAA 1IUNA 4DNOA 4UFPA 1CUSA 3H17A 1D07A 1UK8A 3ESDA 4BTVA 4RE6A 2PSFA 1YCDA 3PFBA 4U2BA 1YB7A 4M0FA 2LIPA 3B5EA 1SC9A 3PF9A 4KE8A 1LZKA 5DYYA 5FV4A 3Q8WA 3HC7A 2BUCA 3E4DA 4XJVA 4QWMA 3I2GA 5ALWA 2VAXA 3H2HA 3I28A 4QDTA 2RAUA 5T4BA 1TK3A 3VISA 2X8BA 3R40A 1YAHA 1XRPA 4I19A 5K5EA 2PX6A 3H1AA 1VXRA 4KR0A 4BVLA 2QM0A 1GGVA 3WK4A 1JJBA 5FOQA 3S2ZA 2XMQA 2VEOA 1GXSA 2GYUA 4PO3X 2BCEA 3V1LA 2IIVA 3R3UA 1HBJA 3ICWA 4J0KA 5ALNA 4B80A 3STVA 3EQ7A 2HHAA 1CUGA 1GPKA 4UUQA 5C81A 2QZPA 1CUIA 5ALZA 1WPXA 5A2GA 1BE0A 4LXGA 5ISMA 4KE6A 2HA2A 2Z3WA 2PSEA 4OPMA 3WIBA 1QGED 2OCIA 4BBZA 1EDEA 3W04A 1ZOIA 1QO7A 4J0IA 1KEZA 1VJ5A 2HIHA 3OTQA 1SCIA 4H7HA 4N5IX 4H7FA 1Q84A 4FNGA 2JGIA 2QJRA 3G7NA 1CUAA 2XQKA 4AX4A 4ARBA 3DQZA 1E8NA 4GI1A 1P0IA 3F9CA 4FHZA 4V2IA 5CH3A 1W6RA 4MJ3A 1BU8A 3WKCA 3GUUA 2GBCA 4LXHA 4OCZA 4Y2YA 4B0OA 1KU6A 4HRYA 3I2IA 2JGJA 3K9BA 1UK7A 1WOMA 1EB9A 2ZYIA 5A7FA 3PDCA 4FBLA 3E0XA 5AKIA 3VJMA 3DEAA 5D3KA 3KDAA 5HF9A 4N8DA 1X2BA 4P08A 2FJPA 3H1BA 3ESAA
chains in the Genus database with same CATH superfamily
1C29B 3USCS 1P80A 3IJPA 2YZGA 3AEUB 5DBHX 4AULA 3DE2X 5KTNA 1QBKC 1W4BA 1ONNA 3STHA 1U0LA 1K5DA 3IXLA 5LA6F 1IPFA 3RSZA 2OENG 2YUTA 2Y1DA 3UH1A 2WPNA 5K0FA 4WZBE 4EPRA 2K87A 3NHZA 3Q1KA 5CLQA 4FWBA 2AFRA 1T1RA 5J3JA 3UJ3X 1BQEA 3E23A 4FMPA 2GCPA 3DCIA 3FMPB 4CKZA 3W6UA 4RHUA 3OA0A 3HCOA 1KY2A 2JFXA 4CQJA 1XX6A 4K5QA 4PXSA 1D2EA 2C4MA 2NYRA 3CEMA 2P5TB 5J5AA 4TN1A 4GZMA 3H9UA 1KYYA 2VWPA 2J5QA 2R6DA 2PMDA 4KCGA 4IWNA 4AU1A 4RKFA 2A5JA 1NRWA 2B94A 4B6RA 2R4QA 1U2TA 4P5EA 3W77A 1Z5GA 4Q3BA 1H6CA 5ITSA 4EKNB 4ZK6A 5BVHA 2DOKA 2JZNA 1Z16A 5A5DA 1EVYA 3C4QA 1PR3A 2EU8A 3IULA 1ODCA 1M8PA 2DAPA 4K6HA 4M7RA 3MGAA 1VDMA 1W0KA 2VWGA 2OM2A 1WVGA 5K3EA 1CZRA 5JR3A 1IOZA 1ZQ9A 3V2UA 1FSPA 3B6IA 4EF5A 4PPFA 1JNYA 1GV0A 1NF2A 3RYHB 1NNLA 4PEVA 3THWB 4MS4A 2CK3A 3BMOB 3GEMA 3O4HA 2QTCA 4O33A 2W93A 4DV5B 1MAUA 3N2KB 2I8AA 1Q74A 2W2KB 4DV7B 1AUVA 2W22A 5KNDA 2H1VA 4MP6A 2AJCA 5IKEA 3SLGA 2MYTA 3JQ8B 2X41A 2XHZA 2XUDA 5K0ZA 3QVSA 4H7EA 3QSYA 1VHWA 2BEWB 3IMGA 3JR3A 4RTSA 3H84A 1CIJA 4MVCA 2O05A 1NDQA 1NJGA 4KQGA 5FL7D 221PA 2WWWA 3ZV5A 5LXTB 3K72B 4N3NA 4DCGA 2JI4A 3OOWA 3ZCPA 4CMKA 2VSYA 2VA9A 2DC1A 2GBPA 1O95D 1GPJA 3QUQA 4GX0A 4D80A 4TV9A 2AKYA 1W59A 4A5OA 1P2SA 1C41A 1E79A 2KQUA 5JV5A 3K2IA 1H5NA 1SBHA 2EYUA 5KWSA 2ID9A 4OQLA 1IWBB 3CNQS 5IDQA 1XFAA 1KK1A 2IHBA 3AR2A 5CLGA 5EINA 3VX4A 3FNEA 1OREA 2NZWA 2EQAA 1OX5A 3IIJA 1JR2A 1DC4A 3N28A 3VJRA 2UKDA 2ZTSA 2GN0A 3PUVA 4YA6A 3DTYA 3NH6A 3PIIA 4OXYA 4BASA 1PWEA 2QK4A 3UK6A 4PNHA 1NOIA 5J59A 3SHQA 1WKVA 4LXQA 4PRLA 2WINI 4PINA 4REQA 4TMTA 5JVDA 4MLZA 5I51A 1FIUA 2BR4A 4EYQA 4RBNA 2Z04A 3KPWA 5CD9A 2XCSB 3A4VA 1AKRA 2E82A 3OOEA 3RIGA 1JXQA 3FMVA 4KUHA 3M3DA 1ZONA 1U2DA 2XZPA 1TA9A 1W1UA 4XGKA 5KREA 1T24A 4IQ0A 4WRRA 1U0TA 2HRQA 1JLSA 4EY5A 3ZE6A 3JQ9A 4P32A 2VDNB 2QRKA 4JBXA 1VP3A 4OV6B 2OFFA 3HH8A 4KIUA 3PNYA 5K20A 1IUKA 1UINA 1VZ3A 3V9AA 1UFQA 2ZYTX 3D3WB 3C3CA 3LVFO 4PSAA 4EHAA 3PEYA 4LPSA 2P9YA 1N6NA 3T7RA 1E9DA 1MNQA 2X0IA 5T5QA 4JI7B 1UXOA 4F12A 2P65A 1VJCA 3VYSB 2A9KA 2H4WA 3LIIA 2IPXA 3L43A 4DYDA 5LQNA 5CA0B 3OJXA 1L3IA 3IUSA 4Q6BA 3DH0A 4KKVA 3MT9A 5AI4A 4HVCA 3MINB 4LJLA 2M1ZA 4NRDA 2X4IA 4GOOD 3ZD9A 2XMGA 1YA4A 1XGKA 2JATA 2XUZA 4AZSA 4DQLA 4CXMA 1BFKA 3H4VA 4FR2A 4LI3X 4E5UA 4Q7MB 4F4DA 2EJBA 3PUWA 3ZDDA 4Q1CA 4C43A 5TF4A 1KDTA 3C3JA 1INLA 2WJWA 4G1UC 4EA9A 1HQKA 5K3DA 4PGHA 3BJEA 4HWGA 4YO8A 5J9FA 3X1DA 2PXHA 1GUBA 2H8KA 5EVCA 1MOPA 3U17A 3PC3A 2X0RA 5A02A 1MN6A 3UT0A 1AQUA 1MT3A 2X5JO 4FC6A 3HJCA 3QXCA 4ZJPA 3A1WA 3WISA 5CBPA 1A77A 2B8WA 3BRWA 3BGSA 1C9MA 5JYDA 1UBCA 3HCEA 1MLDA 4YTEA 3OPYA 4FUQA 2VK2A 1UBNA 1F4LA 3ESCA 3K0HA 4MV6A 5EPUA 4P7GA 1GZVA 1XXHA 3VXKA 2BFMA 4N49A 1EXVA 1SOMA 2X4DA 1U8AA 5EWMA 1E7YA 1RQRA 1R5BA 4YMVA 2V97A 2WJPA 3UA3A 2G71A 2AC4A 2NU7A 2AXNA 1S3IA 2W6ZA 3GRPA 5DTIA 2ZRHA 3HU5A 3IPYA 3NM4A 1Q22A 3TOZA 1JQDA 1JALA 1QHSA 3KZMA 1IB6A 4LOAA 2CLLB 3GJ0A 4RD2A 5AJHA 2B3DA 2C3UA 3FCAA 4GOJA 1ZR2A 4M36A 3DZKA 4TYPA 3VR2A 2O2DA 2F8TA 2ZJFA 3KUCA 4R8MA 4H0FA 3VZPA 4D0RA 5AUQA 2OSBA 2QAJA 4M49A 1Z82A 3LH5A 2ZTUA 2K7FA 1M34B 2G3YA 1TVCA 1JJVA 4JLMA 4GYYA 4NEHB 1BHO1 1Y9JA 3NW9A 1WY7A 2NXCA 4O2BB 4RMIA 3TKLA 5B1YA 3DMPA 4QPCA 5C3UA 1PR5A 1RRKA 2QNBA 3C1UA 2O0JA 5KOHB 1KXJA 1X8LA 5AXDA 3NH9A 3UOWA 4I50B 2OD9A 2R8XA 2RAVA 3TOVA 4PG4A 1WV0A 4NIMA 4RADA 3UOGA 1FQWA 1EDBA 2QXTA 3H1FA 4HRAA 1VPLA 2LGJA 4EI7A 3Q0TA 1SURA 1JIVA 4PQFA 5CHYA 5BOSB 2WTXA 4QBTA 1BYIA 1S1CA 2J5BA 1QUEA 2ZBRA 3CRVA 4J0QA 1KFKB 1N3BA 3G1TA 3NNSA 3HM2A 4ZV7A 1OZ0A 3PKZA 3QMPA 3RFVA 4YXWA 3UUGA 1HZZC 4I6EA 3Q8LA 1SXIA 4R51A 5F9HA 4P22A 4LY6A 2Y9MB 1HDYA 5ENZA 3RD5A 4M89A 5EUBA 4EQ6B 3Q3VA 4BYGA 2O07A 5LKRA 1MJFA 2PN1A 5BRNA 3C6MA 3JYPA 3QV2A 3GVHA 1ML3A 3VNAA 4HSGA 4F1KA 3URMA 4Y2VA 4EYEA 3PKJA 1FE8A 1V7QA 3CLHA 3AJ9A 2HN9A 1KAMA 1XTIA 2FTKE 3BDIA 3ICPA 4RY9A 4S1OA 2OFOA 1E0JA 4R2MA 5E3IA 5JAOA 4EJMA 2WHYA 2UAGA 4NJEB 1A9XB 1SKBA 3D0QA 1IY8A 1JEAA 1QYIA 1YR7A 2Y9PB 3A1SA 4YN3A 2Z6VA 2B7BA 4L8GA 1N6HA 1U4NA 2DCUA 2JEYA 3FNFA 1DRJA 1YE5A 4ROTA 5FHQA 2GO1A 1NMZA 4BJ3A 2ZJ2A 1N7HA 2CLSA 3DZDA 5AI8A 3OFND 3VNRA 4I1RA 2C7GA 4G24A 1F2TB 2IXTA 3F73A 2ISQA 1VI2A 4URYR 4Y0NA 4C29A 5JYEA 3IKLA 3JYQA 4DR5B 5GV7A 5SYNA 3L6UA 2ZWIA 3MGBA 1T1SA 3DNMA 4QYWA 5EIBD 1PT9A 5EZYF 1K08A 1H2XA 3A37A 4CLDA 1Y1QA 4W9NC 1G5IA 4XUDA 1G20E 1ZNXA 1XZAA 3A4LA 1C8LA 3DBRA 1GPWB 1JHQA 4X1IA 3UWKA 3VPSA 1FUUA 4LVCA 5EMLA 5AW7A 1U1EA 1UQRA 4FI3F 4YFYA 1GRNA 3ILVA 5E2IA 3TLZA 1I10A 1RC1A 4XLTA 5E0KB 3MTIA 3ZEIA 2LP4Y 1RJ9B 3W5HA 2HY7A 2VF4X 1VLMA 3Q3HA 4AY5A 1T25A 4POAA 3A6PC 2QYOA 3CF6R 3K9FC 1BVHA 4DLYA 1DKMA 3GMIA 4M1ZA 1WHSB 2MINA 1T3GA 4LFCB 4NEQA 5CJPA 2VNKA 3CSSA 2FEOA 4KQFA 1S7CA 1J23A 1V1JA 3DEKA 4CMAA 3SZ3A 1HF3A 1W88A 3ETJA 1RLMA 5E6SA 2X5XA 1ADJA 2HF2A 3IOMA 3JPWA 2R8PA 2XYRA 5K7SA 3STUA 3H19A 5K3AA 4ND2A 1GNRA 2C07A 4LQCA 2YY7A 3HKEA 1DTEA 1F06A 1AO3A 5IMBA 2VIIA 2HXGA 3KSZO 1L5FA 1GITA 2B8EA 3HBAA 5D5HA 3LQFA 1XU7A 1EA5A 3VV2A 3OQIA 3DBLB 4UW9A 1KE2A 5CLJA 4ZQIA 4JLDA 5JSZA 4DIUA 2M9MA 1NM5C 1I30A 1YJ8A 2X8WA 3PSAA 2DHCA 3G9ZA 1KHHA 1JPJA 5GWXA 1EUQA 2QX6A 3HJUA 3X44A 1XQWA 1D0IA 1TCCA 1CD5A 1R4MA 5L45A 1A82A 3SSAA 2A7QA 2PT9A 3GLHE 5CT5A 3BXZA 3CFYA 1V2GA 3B9BA 5TNXA 3TCKA 3U80A 1G21B 1USVA 4NMWA 1RWQA 2YJ4A 3ZIAD 4EZEA 4R2WA 3K8QA 3QPAA 2GT1A 2LWIA 4OGFA 4PHCA 3C7TA 1PKEA 1OWMA 2C4WA 1CVIA 2FHPA 3CWQA 3DKIA 5JAHA 2AEJA 3BQMB 3JQQA 4Q3NA 1PQUA 4H17A 2Z8ZA 5CTJA 4W5NA 2W2TA 4RU1A 5FNVB 3L41A 3G7SA 4F2PA 1A8IA 5TV2A 2XB8A 3V97A 4A03A 2P90A 2RK6A 4AZVA 4BGVA 2O23A 4PRZA 3OJCA 3HI6A 3RS4A 3TTUA 1GD1O 3FZEA 2H59A 5KWEA 4UDYX 8LDHA 1IK6A 2IF2A 2QN6A 3AF3A 3HCPA 3PNLA 1E1LA 4PWZA 4WLUA 2P9HA 3BYZA 1Z07A 4FYXA 5CFZA 3SC3A 3U2QA 5LUBA 5JY1A 4J7UA 2X14A 1ES9A 2IHZA 1VRWA 4ROSA 5EFOA 4NARA 4AYWA 1EI9A 4YBRA 3GVPA 4YHHB 3LQRA 2RGDA 3BXFA 4DMCA 1US8A 2AWOA 3GD5A 3K0EA 3PKIA 4XB1A 4ZHQF 4KNYA 5HFNA 3L77A 5C1BA 3THXB 3OURA 1FZQA 2E18A 2D59A 3QKWA 3U61B 2PU5A 2GM5A 3AEKB 3E8SA 1U99A 1VGRA 2JH9A 4IP0A 1QP0A 2II6A 4OEHA 1W94A 5JASA 4ND4A 1AZWA 1UM9A 1XDBA 3C3BA 3SX2A 3WGNA 1RFGE 3CQ9A 3L0IB 2ZB8A 3L04A 5IKMA 3S7TA 1X1DA 3TLAA 3O3MB 1HL7A 1LPOA 3UBMA 4M8NE 5CT6A 4LV6A 3RIXA 4S05A 1A5BB 1NSTA 3CXUA 1ZGCA 3RTCA 4PLCA 2IHUA 1ZW6A 1KFCB 1ZN7A 1RP1A 1QIHA 4HDNA 1I7PA 1Z2EA 4Z8XA 2PX2A 1FSFA 2H5EA 3AKCA 4ZV9A 3TIVA 2YHSA 3E9EA 3EJWA 3N8IA 2J7KA 4O2AB 4U5QA 2ZSBA 4DW8A 1RWVA 1E63A 2RMKA 4EARA 2GETA 5I9IA 1NN3A 3T9FA 1E1MA 1IEXA 2XDQB 4WH0A 4WGFA 1F8XA 3ZDRA 5EE5B 3ABOB 4CCYB 1HDEA 3AFOA 3WDSA 4TXNA 1EINA 3AV3A 5EHIA 4Q34A 3DMRA 3SCZA 4B7XA 5FOWA 1T4MA 3A0UA 4V3CA 3B60A 4K9LA 1FMCA 1VBNA 2AZTA 3JRWA 2G04A 3A06A 4M60A 5F7XA 4KB5A 1IH8A 2QW8A 2RGGA 1KJIA 1UWLA 4GRAA 3WLTA 1HXHA 3I05A 5CIYA 3D2CA 3Q98A 4JYPA 5C51B 4RHTA 3KNZA 3A4IA 2PMKA 3DZBA 4DR1B 3AL0C 2UZIR 3LVRE 1KNXA 2Y71A 1UEXC 3LK7A 1GR0A 2I7CA 1LNZA 4GMXA 5EWJA 3N53A 6REQB 1PHRA 4CIWA 3B48A 3MWGA 1G19A 1G8PA 1AHHA 3VKVA 4DWOA 3C85A 3L9WA 3N6RA 3VI4B 2AUMA 4ZPJA 2M6LA 4MQFB 4OOFA 1G3QA 3MW8A 5JPCA 4RK6A 1RVDA 4UMEA 3L3BA 2QTWB 5HF5A 2Q5LA 3K6JA 4JC0A 5LZ8A 1EFCA 1Z2OX 1YZFA 2A1TS 5AHOA 4XGQA 1EFVA 1I14A 1NJ2A 4YK7A 5AIAA 5G3ZA 3PXAA 3U4HA 1DHTA 4LFAB 4U4AA 3QH4A 2QXYA 3DV0B 4LOJA 1J99A 1RWMA 5KNCH 3ZG6A 4B82A 1V3TA 3OJWA 2F3PA 2HWXA 4CN9A 3HVRA 4B6OA 1MTZA 1OFUA 2X0JA 4JX9A 1MO6A 1Q1AA 4RY2A 1L7MA 2XWJI 3TJZA 4ZZ3A 2FW9A 3W2IA 3EHDA 5AVOA 3A6JA 4FYVA 4RSRA 2QTBA 2O0MA 2B2NA 3AY0A 4NBUA 4RF2A 5DGCA 2WY2D 4AY6A 1UDBA 1ZH6A 2JDID 3QZUA 5FJIA 2EF0A 1Z2CA 3FHCB 4P4SA 2GNAA 3RUEA 2WHEA 3QTBA 4ZEWA 1W87A 4Y18A 5E4TA 3P2KA 3HVKA 4LOHA 2JFHA 1QYWA 4G63A 1L5KA 2CE7A 4CR7A 1U0FA 3TSZA 3UB3A 3MPUA 4UBMA 1FP2A 1K2WA 1A2QA 5AM0A 4MS1A 2CSXA 3HO1A 3EVFA 1LJUA 1P2VA 2AOTA 1FMTA 4NOJA 4Y2QA 3VBEA 2PIAA 4DSUA 1FMLA 2IOHA 3FCUB 3V2GA 3W78A 5HSGA 3PNOA 1U3DA 2UYYA 2C00A 3I2HA 3IS3A 5AQ1A 5JFGA 1CQPA 2ZWVA 4Q1EA 3D6JA 1DWUA 2GBLC 4O5OA 1ISFA 4CIYA 4E2FA 2P6OA 4IDBA 2B99A 2AR7A 3AF5A 4X44A 4YVFA 1R6BX 1N75A 4E2WA 3U9LA 1PL0A 3SXUB 1K0UA 3ADKA 4GI3A 3OCUA 4W9MC 2XXBA 3FVVA 5G3YA 3FBWA 3K9HA 1Z0JA 4MLPA 4GLOA 2JLXA 4MVXA 4AN1A 1C1XB 3ERCA 3O2JA 2I2XB 1LNSA 2GCOA 3SBOA 1I0IA 2J46A 3LPLA 4KX5A 4Q9IA 2PBRA 3GLFB 4JLJA 3DOIA 4O2LA 5A1TA 2VPYA 5B3LA 2OZLB 3ZDEA 1XK6A 5B3JA 3L7NA 2C31A 4JB0A 1OH7A 1GNVA 3ZV7A 2XGGA 1BJRE 2MYNA 4MVWA 4D96A 5J4VA 4LFBB 2WP8J 1B73A 4DDHA 3GJ7A 2WM9B 3IIIA 4WLFA 1VI5A 3E5NA 3D8HA 2GKOA 5LMUB 1GCGA 4CU2A 3BIWA 3JQFC 3COJA 1P9WA 5BYBA 3NP9A 3ED1A 4KQ1A 4RFSA 1QKIA 5AYVA 2E85A 3LC2O 2YZNA 4UTZA 2PH1A 1ZLXA 1JDBC 4FFNA 4TQ9A 2OMKA 1LK0A 3NTUA 1S8OA 3PD1A 3TF5A 1E9VA 4ZCPA 1OVGA 4QGGA 3QE3A 4JJIA 2B0JA 3ACDA 4B71A 1KY4A 2G72A 2O8VA 2PKQO 4BMXA 3THSA 1PNTA 3MT8A 2RHBA 4EIWA 4ENRA 2R5NA 1GCUA 4R83A 2VOJA 1BMFA 3DYIA 3GFSA 2PLAA 1NPDA 4IXNA 1TTTA 4S1WA 2FX3A 1YGPA 1EQ2A 2QV0A 3PXXA 3PA8A 5THQA 2NP6A 1NJ1A 1PJ2A 4FOOA 1K89A 2DVMA 4F56A 5K6AA 2B78A 4ZVUA 4GSLA 3PEWA 3I64A 1E9SA 2R7AA 2WICA 3OI7A 1WCWA 4BNJA 2HJWA 5MGBA 3WYNA 4GWKA 2XUQA 4P0QB 3FWHA 3BAZA 4AAYA 1E62A 1E9EA 2C5AA 1DBQA 4V1CA 2AOUA 3O1IC 2H0RA 1CUWA 2EYQA 1P0FA 4AT1A 2R48A 5E9JA 1DC3A 3F3KA 4R84A 4Z54A 2NU8A 3EWSA 2IEIA 1ZVMA 2MIIA 2WKPA 3PZBA 3A7DA 4NK5A 1B14A 3SZOA 3WE7A 4E33A 3U7FB 2VUUA 1OW3B 5JROA 2PKYX 2ZIAA 5TQ2B 3KUKA 1OFHA 5AMXA 1PJTA 5AI0A 1GAXA 2A2ZA 1K9VF 1ODKA 3JS5A 4MUYA 4QO8A 3KL2A 1L8XA 1ENZA 3FOCA 2JA2A 1JQLB 1PYGA 3AHDA 3ENKA 4X20A 4XWYA 5ELXA 4FSDA 4MYDA 5GADl 3JWIA 3C8HA 2YYAA 1V8ZA 2WRZA 2V6FA 1CF2O 1CVLA 4YAFA 2WHQA 1ZIXA 1Z0UA 4KLZA 2CYBA 3F97A 3NS7A 4FGSA 4HNAB 3SYRA 2V6MA 1KQFA 1IBKB 3RVMA 1FNMA 4NBSA 4XGNA 1U3GA 2CMDA 2JI7A 2PRZA 2ZBEA 1EGAA 1WBBA 1UKCA 4EMTA 1Y5IA 2OCDA 1UUFA 4HYYA 3ABSB 4RIFA 1E2BA 4F3CA 4I4NA 1KEEA 1I2ZA 4M88A 1YU9A 3HDTA 1ENOA 1HE4A 2C98A 5JSKA 1XLTA 3AFIA 1X1SA 3CIOA 3ETLA 3IAAA 2F3QA 3AX6A 4G5XA 5T8KA 3TMAA 1Y1RA 3W5BA 3E84A 3QRWA 5JO9A 2H17A 3CURA 1IIBA 2AJ8A 3MJFA 3KTFA 5J5CA 1WXFA 3T7KA 1PGJA 2QD4A 4A6XA 4IEIA 4KN8A 5JQWA 2GJ9A 2A9JA 4IZOA 4UNNA 1SVLA 2BFDB 5E6UA 4PTYA 3AF0A 2NZ2A 4DLTA 1QV7A 4KDEA 4QUEA 3UGJA 1VYTA 1LPAB 2VF8A 1Q57A 4YRNA 4F93B 2XRZA 4H08A 2R6GA 3EIEA 2QMYA 1W5AA 4PZDA 4N7BA 4FZVA 2JEZA 3DJFA 1YDGA 3HJTA 3GB9A 1C7IA 1RE0A 1SUEA 2P9QA 4ZI7B 2HMAA 3DVSX 1BG6A 1NBWB 1FP1D 3QU9A 2DPXA 3SC2A 3LW8A 1NY5A 1BOFA 5EKDA 3WBKA 4M9CA 4EGFA 1APBA 1ADYA 3JY6A 1HNNA 2FSUA 3NBYC 3O38A 4F0JA 5TMBA 4BQFA 2TECE 2O4CA 2XUHA 3Q5GA 3JAKA 3HFSA 1L5HB 2QN7A 3LX8A 4QXMA 1THGA 4YRZA 2Q99A 3JR7A 3U1TA 1RBYA 4WV3A 4XYBA 1XYVA 1UKVY 2Q3BA 1VE7A 3SVZA 5HS4A 3CEJA 3AI1A 3BAFA 3BK2A 1HDXA 3DL7A 4HEA1 5EP3A 3WLJA 4NDAA 2KSQA 3UHAA 4JP2A 1I3OA 3N70A 4BVHA 4AL4A 5JIBA 2JFUA 1ZNQO 1E7MA 3BJMA 3NYWA 4RVGA 2XKBA 1NFFA 3AB8A 3EEYA 5IC4A 3AQIA 4L3OA 2NWQA 4LRSB 3H8VA 2BSQA 2A1UA 3Q7EA 1QQ7A 1CDOA 3MVEA 4KC0A 1WSDA 3OPNA 2IV2X 5LP6C 3RG8A 2HX1A 2ORYA 3JSAA 5TC4A 1FQKA 3NMUF 1R1DA 3DOCA 2AOXA 4QT0A 3LCVB 4EM6A 1LBIA 4PLTA 3S2GA 2OP1A 5BSRA 3LFTA 2ZAYA 3IVRA 1EUCB 2YV2A 3OPXA 1CB0A 1C81A 2NN3C 5BO5A 3H65A 1JH9A 3UH0A 3O4FA 4P4UA 2ENUA 1VKZA 1BVRA 3HBMA 1JILA 1VPEA 1OU0A 3FTNA 4JJ6A 4KHZA 1EJ0A 4QXOA 4FGJA 1C9KA 3V46A 4DM4A 3S4YA 3GFGA 4D42A 1QIEA 1X7YA 4FLMA 3FHLA 1GNLA 2BE9A 4RLQA 2FRDC 4JUDX 5DN6D 2ZYGA 1JBKA 1Q44A 1BXGB 1EESA 5JXHA 3REGA 1H4VB 5CX1B 3UXEA 3A9SA 4B7CA 3VH4A 1I1OA 3LBHA 1NKVA 2G5PA 4YRLA 3OOJA 4YMSA 5IW8A 4LHZA 5KJEA 4WOCA 2WHXA 1V3UA 2I91A 5F7OA 3T3OA 3ZWVA 4AUNA 1M83A 1DI0A 1TO6A 1QYVA 3L0PA 1L5NA 4ESEA 4IJWA 4Q3AA 1NX6A 2XTZA 3SC4A 1Q6ZA 1YXMA 3KZOA 4U00A 1FP4A 2PU7A 2H0QA 2QE7D 3I0ZA 3I9V6 3HFGA 1U2EA 2VJDA 1XNQB 1B74A 1XQVA 2WBLC 3RJZA 2W2OA 4EEXA 2QBYA 1XT6A 3LBNA 4MCHA 4Z1OA 2VXYA 3NX4A 1SUCA 1QVAA 1U5BA 4MWSA 1LSOA 1XQ1A 1KEKA 4ZP1A 1XA3A 1YUMA 1C1DB 2VDWB 5CW2A 3ZLJA 2M1XA 1GPMA 4PGGA 1FVXA 2JFNA 1CDEA 4Q3DA 4DVGA 3PWSA 2X15A 2PGLA 4TMXA 3UF0A 5B6JA 4KFSA 4S0ZA 3B6ZA 3BJZA 3C3YA 2HO4A 2QPAA 5EJFA 5ARCA 4BNTA 4YJFB 4TKUA 4X62B 2O1WA 5EL0A 3VR5D 2QTFA 4PQYA 5LQJA 1IQPA 3ZGXA 2G17A 1DKQA 1SK9A 1VRCA 2B1QA 4OHKA 4YQFA 5JQGB 1H4SA 2BDEA 3Q2OA 4XIIA 5G40A 4QWWA 3ZQ6A 2CUKA 4DDVA 3O3NB 3Q9NA 1L3BA 1Q7CA 3KV1A 3UAWA 1Z22A 1TGYA 5E1BA 1SPXA 4REOA 4L6IA 3GJYA 2NO4A 2XWPA 4MQEA 3X2EA 1XLUA 4H7JA 4TSRA 2BGUA 4KGDA 1AF7A 1L2TA 1UKBA 1A4IA 2O7QA 1VLHA 3PDJA 2YYYA 4KYIB 3R7DA 2G82A 3GFRA 3KR9A 4G9GA 4O4JA 3UUFA 2UUPA 1E59A 1T8WA 2IITA 8ADHA 3N6VA 4YDQA 2NG1A 2ZAGA 4YYEA 2FPIB 2P78A 4KQWA 1E6LA 3FG9A 2V1UA 2VAMA 1XVUA 1DGQA 4DC9A 2W6NA 2R6CA 3OCXA 3Q6MA 2FGJA 3U39A 2W90A 1M75A 1G8JA 4WDRA 3MUOA 1PT7A 3KFLA 1YWGO 3E2IA 2IYRA 2AQHA 2R47A 4DE5A 4EVQA 3L0BA 3EEFA 1WXIA 1UDXA 1QK5A 4PNEA 5HGJA 1G6KA 1OOEA 3G8BA 4QPPA 4UPVA 1D4ZA 2Q2QA 1NW3A 4IHAA 1JDVA 4BIMA 3P0RA 3ROPA 4OKNA 1YGYA 3OM0A 2O8EB 2EX1A 3RLIA 4TOIA 1Y80A 1AUPA 4P81A 4MV8A 2XYQA 3IEXA 3KKKA 1T36B 3UTDA 5BORA 1NJSA 1EP1B 3L1UA 1TJNA 3U4QA 3SSOA 3BX1A 3OM9A 1HWYA 1ZCJA 2KLBA 2V03A 3SM3A 4QEZA 2BKVA 2R65A 4I1IA 4DJFC 2Z2IA 3CPHA 2FMIA 1EVKA 2V8OA 1Z5WA 3JD2A 2QVCA 3KR0A 4LRWA 2PLNA 3CBGA 1T4CB 2GPJA 4FFSA 2IBMA 2HLHA 3HFRA 1KJQA 3PPWA 1OU4A 1XFDA 2GXUA 2X3UA 4U2FA 4TMYA 4JSRA 1Y3AA 1WNTA 4RTRA 3DOHA 5I01A 1K7SN 1JP7A 1KO7A 1MA0A 1OUMA 1SXJE 2VHJA 4RXTA 3OZDA 1VDZA 1BH2A 4O6VA 3SPXA 4LDNA 4ZVSA 4TYNA 1RRVA 5F5LA 5AW4A 2C5FA 5KU1A 2XY4A 1TDJA 5T4HA 1DCKA 1ISPA 4YRGA 1DT5A 5D84A 1SHTX 4J49A 4LJ6A 1XNJA 3VKUA 2UZ1B 3ZBUA 1Z4LA 2B83A 3IT0A 1KEPA 3IVAA 4ZPXA 2R3SA 5EJ8A 2QTRA 2MDTA 2XQGA 1KJWA 4G1EB 3SC6A 1CZUA 2R62A 3MOGA 2F1RA 4R1OA 1T4BA 5EUQB 4TMFA 3N74A 3D4OA 3JZFA 4MW9A 5H3LA 3FAZA 4EOGA 2PUFA 2OHXA 5AVUA 3EVAA 3IOYA 3FCYA 2RE8A 4L5AA 2G40A 4PNPA 2JFZA 3BZUA 1R0XA 2WUFA 3UMGA 4G84A 4ZZ2A 3RRFA 1YRHA 2BRUA 2QRVB 4O0LA 5IFKA 1FVOA 3EVBA 4M53A 2NO1A 3GP3A 3UWMA 4FEYA 2NPFA 1JHZA 1KOFA 1N5DA 1PVVA 3EZ7A 3QVWA 3EA0A 3O21A 5DO9A 5FPKA 3WA7A 3RRJA 1RC0A 4LBZA 4I9UA 5IBRA 5CH8A 3GT4A 4O1HA 4F7DA 1X0VA 3GCXA 2YWBA 3NVDA 1SUDA 4K9QA 3MLEA 3PL1A 3QE4A 4D4HA 4E3WA 3EXG2 5I8PA 1Z8HA 1KS2A 2VDMB 4ASUA 2JBWA 2O2IA 1TTPB 2JH8A 2QZSA 4G0QA 4HYQA 1EGHA 5EXEA 3I3SR 3OHSX 2JLBA 3NT5A 2FOLA 5T6BA 1T9GR 2HD4A 2IU4A 2RHRA 2ZTLA 5AXCA 3QQPA 2PUWA 4X64B 4OAOA 1JXOA 3RSFA 1NFQA 1N3LA 1QG6A 2FDRA 1Z7GA 2BZSA 2HA7A 3AR6A 3EXIB 4I3GA 2RJNA 3WYFA 5EJ5A 3LDHA 3LQYA 1CYEA 3FWYA 1N1MA 3U44B 1CDZA 3V4VB 3I9KA 4Q4DA 1X2EA 3ZHSA 1FSZA 2KB0A 3IAM6 4YC7A 1S8AA 1OAOC 2BFOA 4DCSA 2C8KA 3VVMA 1Y4AE 5I7OA 2VSFA 1J39A 2GN9A 2CVZA 3X2FA 4LK2A 5LL6P 2WD8A 1TADA 4Q4AB 2WFLA 1GA6A 1Y8ZA 1KDOA 3MRVA 1J42A 3IELA 3UTCA 2YY6A 3U9TA 5ER9A 3FZQA 1VYHA 3K0CC 4IMRA 4AJEA 4I8XA 3WKEA 1MX5A 1P5JA 2QF7A 1Q0HA 2WAMA 4I5GA 4XLLA 1U3VA 2BYTA 5IJZA 5EZ6B 1MB4A 1RM5A 4CCAA 3ZN2A 1QTRA 1TMOA 1WDTA 4CMCA 3SM9A 4RJLA 2J32A 4Z4EA 3S44A 1YNSA 4DA8A 4NU6A 4LG1A 2GYYA 2J31A 4A92A 5BWMA 2YY5A 5DKFA 1YI1A 5JAQA 4BLVA 4CMGA 3BD7A 3V1NA 2Q9UA 4UZSA 4YBZA 1SCAA 2GM3A 5GONA 2Z9BA 4IJ5A 5I7HA 4DBZA 3JQGB 4Z5XA 3ACCA 4UBOA 3ZWAA 1B93A 3FZYA 4UARA 2DR3A 5KTMA 5L3VA 4OLHA 1YR3A 4GR4A 2CV1A 1UAYA 1I80A 1NATA 2BI8A 4RVSA 1KMMA 1Z5VA 2Q6IA 3LHSA 5CAEA 1C14A 2FN7A 4FYKA 5FOVA 5EKTA 4FN5A 3WWYA 1MP0A 3JQBC 4OLBA 2F43A 4E7PA 3LT0A 1UEIA 4R8RA 4AXXA 3L5KA 2OO7A 3NASA 4IL5A 4IIFA 1Z4JA 3RU2A 5IWCA 2IHNA 1ATZA 3T7JA 1P31A 2F67A 4ND1A 2DECA 2FY8A 2RCYA 4OHVA 4TM7A 3OUZA 4X1YB 1TYBE 3EWAA 2EZ8A 3MEQA 3UAZA 4C2TA 3QTTA 1EE1A 4L27A 2IP2A 3KQYA 2IPMA 3MUFA 5C5DA 1AGNA 2O8CB 2DQ4A 2ODNA 3C8UA 1JAXA 1JDNA 1OYYA 1SVOA 4IV5A 4JKIA 2NSYA 2G06A 1EIZA 1AQ6A 5DDIP 2FUG6 4OVKA 3ZHYA 1ZX1A 2X6RA 4ARAA 4RX1A 1RYMA 3L1IA 2GTPA 3KDSE 2PVSA 3ONVA 4BO6A 5A06A 1U0OC 1VCNA 3TX6A 1GSAA 4XZ3A 1TM3E 2V6IA 3HKCB 4QLOA 3QW2A 1UC5B 3L2OB 1KHTA 4UM5A 3M5PA 3OMXA 3FYUA 3WWDA 3JATA 4IIUA 1FDTA 1ZYUA 1MVLA 4JUFA 3T7SA 3V8RA 1OKKD 5I7UA 1U9YA 1UBGA 5JPIA 1UADA 1D3AA 2BBOA 2FNAA 2FZVA 3KDPA 2VQDA 1M1ZA 1RXIA 1VSUA 4BBAA 3AHHA 1BXRA 5BV0A 2GK7A 4NENB 3EVNA 5FTNA 1AQJA 1EJ6A 1F60A 5JANA 5BSTA 4KDFA 4UASA 3WS7A 5HF6A 3UPUA 4WFKA 3RK0A 1HI9A 5ICFA 1P29A 1TYZA 4V1CI 4EHDA 3DLPX 2RCNA 3T5PA 1SR8A 1AHPA 4H3VA 2PNFA 2WUEA 3LCMA 1YR8A 4GWLA 1P4RA 1Y4DE 1YMQA 2CJFA 4RPKA 1GTL1 1ZAKA 4ZO6A 3M4JA 5DM2A 4CUKA 3VZSA 4D8VA 5CD1A 1N0IA 3VU9B 4HN2A 1PJ8A 2VH2A 4Q9AA 4TGLA 3EPKA 1ID8A 2XTJA 2A4KA 4UHJA 2FP4A 4MXDA 1CF9A 3C8DA 3NEYA 4UEOA 3G13A 10MHA 4EVRA 3IALA 5HIJA 3RK1A 1J1IA 1L8QA 4HD8A 4PFSA 3EDYA 3CV3A 5EP4A 4YUXA 3W5DA 5HKLA 2CVFA 1PZGA 3LC1O 4GL2A 1RCUA 4WADA 2Y27A 5ALFA 1G0OA 1VMIA 3KVRA 2C2GA 2O59A 2OD7A 4UBNA 2A58A 1W4ZA 1HLFA 1CY6A 1L5MA 4B7ZA 4G67A 5I7RA 5LOVB 4EQ6A 2H6EA 4TZ0A 1W1WA 5G1NA 3AM1A 4ZDWA 8OHMA 1QJ4A 2XTNA 3A9RA 4NAHA 3I2YX 1YK0A 2GO7A 1M6HA 2ZU0C 3QI7A 4X71A 1QG2A 4ZC8A 4BTLA 4C7VA 4DA6A 2C77A 3P1JA 2IY7A 3VZQA 3BRQA 5DNCA 4LW8A 5GGYA 3Q12A 5KVAA 3KZKA 5F3WB 5KOJB 5KMGA 1UT5A 3TECE 3V8QA 1I3MA 1Z62A 3I01A 3ZNQA 1NVMB 2A3RA 4H16A 3ZLUA 4OOEA 3FMFA 1HX7A 1UMCB 1Z8DA 3UJCA 1JHUA 2IZ5A 1BW9A 4IDFA 4DHEA 3ACBA 3TW0A 2OZVA 3WB2A 1A7JA 4DR4B 1CZOA 4MSUA 4ZO7A 1RAEA 1AM4D 1ZCBA 4QUKA 4QOHA 1QVZA 3A8TA 4ER0A 1UJCA 4KV9A 1P0MA 1Q0QA 3O2NA 1K8XB 1SXJC 3GNLA 4PGMA 4H60A 5B7QA 3AZQA 5JI3E 2A9FA 2PVCA 5LKAA 1E3IA 3EXFA 3VBCA 1S3GA 1WSBA 2C59A 3R5HA 4LV8B 3COVA 3PC4A 1IN5A 2ADOA 4LY3A 3ZWXA 5DNEA 3ER8A 2PX8A 4KLRA 2YN0A 1XZQA 3AUSA 2GJSA 3ZDXB 5JISA 4CEIA 2WV7A 1T5SA 3VMFA 4NZPA 1Z15A 1TRKA 3L8YA 3QYJA 2C97A 3RRBA 2PBFA 2VHEA 3ZH9B 3L7IA 4NBRA 2QZZA 2D54A 4BOYA 4TMZA 2RHHA 4NKRA 1NXPA 4YCMA 2A5YB 4KN6A 2C5LA 4J7AA 3ZZUA 2BHRA 2QN3A 1M2NA 3KPUA 3VUFA 5AUNB 2UUBB 4L74A 4B3RB 5F9FA 3MJRA 1ORHA 2IP4A 3PEVA 5FFFA 3VTAA 1NXVA 2WIKA 3BH0A 3I4LA 1LC3A 421PA 3DZCA 3ASUA 5GJCA 1Z88A 5KSZA 1RT9A 4JT8A 4ZMBA 2PUAA 3FTEA 1G8AA 2Z1NA 4P34A 1KAOA 1M1XB 1TW3A 3GAMA 4ALJA 2JGLA 1YOVA 3EIHA 2FSVA 1VMKA 2PQ0A 5DHPA 1DAEA 2GD2A 3GRCA 2PQ2A 2ID7A 3FM9A 3DNPA 3UHJA 2QV7A 2YWRA 1V7CA 4X6YA 2P27A 2REXB 3DYVA 2M6KA 3GUVA 3PPVA 4XPIB 1HLGA 4FR5A 2OBBA 2HBQA 4PZ9A 3E3OA 1Z56C 1BOOA 4W8OA 5FLYA 1DV1A 3QEKA 3TE7A 4E5VA 4MCAA 1GLVA 1VZ2A 4PTZA 1ZZGA 3K0BA 1U98A 4B4DA 5AD1A 1X1QA 4NPCA 5BR7A 2OZPA 3VSCA 1DQNA 1BYUA 1OI7A 3ELWA 5ER6A 4FMCB 4WVLA 3GGDA 4N8EA 2WPDD 4L2IA 3PQDA 3T4UA 3GXBA 3L0ZA 1RD4A 1XPOA 4KR7A 4Q7LA 2CFSA 3IRUA 4ISBA 2JLCA 4RCZA 1M54A 3UCEA 2YWHA 3AR4A 3QE9Y 3LUDA 3MD9A 4X1KA 4IHJB 3B1JA 4GP9A 4UUAA 3RE1A 2C3OA 1TJ5A 2WU4A 3OZXA 5HWSA 2JBAA 2Y05A 3KKEA 2GRUA 2QPLA 3AY6A 3R09A 2IS2A 4C4YA 2GCGA 2RAPA 4EB6B 3C2QA 3N05A 3A1EA 4G36A 1YTUA 1H0RA 5FLEX 3D3EA 3G1WA 1K2VN 5EAIA 2J33A 1TU4A 1HTTA 3ZWMA 2ZRLA 5KYXB 3CUVA 3VVLA 3MA0A 1CS0B 1GG5A 4JQCA 16PKA 2B4KA 3GLRA 2WHPB 3AY3A 3FF1A 1A50B 1XVAA 1M0SA 3GP5A 4B9EA 3GC6A 1N5MA 1L0BA 2FR0A 1MR3F 2VWQA 4Z6KA 5C37A 4LF9B 4PPQA 4TV8F 1IM2A 3II6X 4OJKA 4DSAA 1PV4A 1AHNA 1M8JA 2CHVA 3KBBA 3KQVA 4GR5A 5FP0A 3FKSD 1M2JA 4AN4A 4BVEA 2V5UA 3FHTA 1EFPB 2LR0A 2D2XA 3TQRA 5EIFA 3OX2A 1O96B 2K2WA 3HMKA 3VQTA 3UWDA 4FCWA 1DPGA 2QRJA 3DNFA 3T8YA 4HLCA 2FZCA 4GM1A 4E08A 2DFNA 4LY0A 3ORFA 4DMFA 5L7TA 1D4FA 1P33A 2HRZA 1RABA 4YJ3B 5I4KA 2AXPA 4X8OA 3MMPA 2AMYA 4E4TA 4R0MA 5AQEA 1GGFA 1QQBA 2BSAA 3S81A 4PG7A 1F14A 4WQMA 4DNFA 1YAJA 1T4DA 3IKMB 3IIEA 3ZCUA 1JTVA 4L4ZA 4GRIA 1GDTA 4GL4A 1OMOA 2AG0A 2I1WA 1O9HA 1ZCZA 1TF5A 1YSCA 2PANA 2GF2A 1SUWA 3OCJA 2QSUA 3R20A 4P98A 3ZZ1A 4E5YA 1SIOA 3DEHA 3SX0A 3CVWA 2EBFX 2OAEA 4GP7A 4RZHA 1PSWA 1XZLA 5ESRA 5LZ5A 3MIZA 4RTQA 1XAIA 4I1OA 2ZVJA 3P2YA 3K9LA 3N0TA 3H2IA 3MMNA 3LRTA 1SZJG 1C3JA 4P4GA 4JHXA 4Q01A 3WQRA 4CMEA 2XNDA 1PO7A 5LD2B 4UM8B 1WZ2A 3NIFB 4RNCA 1SNYA 1JEOA 3HU3A 5EP1A 3DVLA 1ZD8A 1WWKA 4MB2A 1F2UB 1EPUA 4B3DA 4LYAA 5FWXB 5HKAA 4P3YA 4MVJA 4N47A 3EVDA 1LDGA 2C20A 2GEDA 1OHHD 1AKYA 1U0GA 1GTRA 1RFLA 4QOGA 3IP9A 2XOEA 3DEFA 3RVDA 1EAMA 4OYYA 4DIDA 5LPNA 1UC8A 4CR6A 1Z6QA 2W5UA 5JMWA 2PL1A 3EGIA 3RREA 3OM8A 1I5OA 2HCRA 3I9MA 3P9YA 5DM70 2I1QA 3U7EB 3IEUA 4MVYA 1OXBB 4JT2A 1OYWA 4XFKA 4KXNA 2PGJA 5CLIA 5EA2A 2VPWA 3U3RA 2F3SA 4G3XA 2C2MA 4JWTA 1G38A 4YCJA 2DFLA 3NIBA 3E15A 4BLRA 1NI4A 4Q3OA 2VOEA 5IUJC 2EARA 4DSZA 3GA5A 3FDZA 4YJGB 1H9AA 5B4VA 4ZT6A 5J47A 1NC1A 3AB7A 4XVRA 4YX9A 1RXEA 5L3ZA 1PL6A 2R2GA 2ZPUA 4UBKA 3B6KA 3ZDFA 5HW0A 4XCQA 1QV6A 3BA1A 1Q91A 1D03A 2KPOA 1PHPA 3TZHA 3RYCA 1H66A 1NPTO 3O4RA 1SIUA 3WJ7A 3V1KA 4BB9A 3LTNC 3OMWA 3TLEA 4GM4A 3RVJA 3MJ4A 4QREA 2NSHA 4KO2S 4WK4B 3SOZA 1XVLA 3I9V1 1W34A 3OP1A 1FNSA 3QU7A 5FKJA 1CEEA 1I01A 1KI6A 3AUYA 1QS0B 1XLVA 2VNHA 4RJ2A 4RESA 2PTGA 5D87A 4IW3B 2I4NA 2NYVA 4WL0A 4FFOA 1MHPA 2O8BB 3TLGA 3NTRA 1TK9A 3W6OA 4KVFA 5FTJA 2WSLA 3WL5A 3DTTA 1ZGZA 1RWNA 3E5MA 1D1PA 4GS5A 1SVMA 3RBXA 3U37A 3KXPA 4GPBA 5DBOA 4DIKA 3I4FA 2Z43A 3BMNB 4GHWA 4MS3A 4WY5A 3C5HA 1E0DA 3KXIA 5L4LA 4WT7A 4QLBA 4GMKA 1I2DA 2JFQA 2IYSA 2PV0A 3RRYA 2WSYB 4NL4H 3QTLA 3HBLA 3UKJA 2X1HA 4HNVA 1O08A 1K3UB 5C1OA 1G17A 1G4HA 1R0LA 2ZROA 3DQQA 3CPSA 5DHSA 3IEKA 1CDDA 2BFNA 1RYHA 3AEQA 1HYEA 1V7PC 3W4KA 1ORIA 3FLMA 1GUZA 4HB0A 1LPMA 3IDFA 4PX9A 4BL5A 2X6QA 2O57A 2WIAA 1LGYA 3CG4A 2VHTA 4Q9NA 1QZUA 4OH7A 2X0DA 4TMWA 2EW8A 4X95A 5D5PA 5CB0A 3U56A 4MAMA 1QR2A 5JYBA 1PEYA 3DM9B 5LYJF 1L3CA 1LFAA 1M6WA 1UPTA 3H0EA 2HMYB 2QL7A 1MXFA 2WLSA 1FEZA 1TPYA 2AJBA 2PRYA 3MLAA 2Y93A 4C3ZA 1BH6A 2E1RA 3F5QA 4WBXC 3WWEA 1K66A 3N39C 4E5PA 1JI0A 3P52A 1LSJA 3JSXA 3OZVA 3IUPA 2G4LA 1HH4A 2XLBA 4OMDA 4F21A 4BJ5A 4BNGA 4OYRA 5I3CA 2WWGA 4C01A 2O7NA 5DT2A 2N1BA 3WYGA 2VXOA 5DX8A 3BERA 3TG8A 1FLDA 4KLAA 3KM0A 2QT9A 1WY5A 3HY6A 4MEBA 4L16A 3HHPA 1TZCA 3HXLA 1VHTA 1PV2A 3N8NA 4K6KA 4MRNA 1H2YA 1WDMA 2HF9A 4QXAA 4X1OA 4JB3A 5CLHA 4R69A 4RKEA 3C8MA 1QFZA 3RUPA 5C8YB 5DNVA 4OSPA 5B7GA 1PZHA 4DJ5X 5KHLB 3N2LA 4TWJA 4K2HA 3TTYA 4Z4CA 2ZBDA 5PNTA 1MO3A 4YPOA 4V02A 4CF7A 3BXHA 3EXHB 4UULA 4D45A 4HGRA 4I3FA 1W36C 1J21A 3DFKA 3Q7TA 3OFJA 4BUZA 1YB1A 1G16A 5I4BA 4DR6B 4MKZA 4TTVA 3IMEA 4PFQA 1Y8CA 3KQQA 3D6AA 4X0EA 4QU5A 1DRVA 1YS1X 3H2GA 3AHFA 5DNAA 3RDPA 3CLVA 5B6PA 3BICA 3GY0A 3PSHA 1YKGA 2QSJA 3OEYA 4KO8A 4DNPA 3HDHA 2NMVA 5I9TA 1DPFA 3G2QA 4MUIA 3LYUA 3BIFA 1JDJA 3VRHA 1C0EA 1FRQA 4NZNA 2GWHA 2ZI9A 2ROQA 3NHUA 4M54A 5GQSA 3FYTA 5G1PA 2V4UA 5GY7A 4Z1MD 5BMOA 3KQKA 2BP7A 2GAAA 1RIIA 3WRYC 3ETGA 4DAOA 1HNZB 2C5GA 5C18A 1E7WA 5CFRA 3D64A 2PHZA 2CNWD 3DBVO 4FCTA 4DIOA 3N0VA 4HWRA 1IZ9A 2LCIA 1E1CA 2ZQ5A 1WJGA 3E61A 3VOSA 3ZI0A 5KX5F 1C9DB 1TUIA 4ACAA 3C14C 4J75A 3UFBA 3EOBI 3D8BA 1I7SB 1UQUA 2Y0EA 1OCEA 3BB1A 1JA9A 3DBOB 5A9SA 5JCOC 2W8BA 5U4QA 3WRVA 1JI3A 1GYRA 1T2DA 1VGVA 4M7PA 5JYCA 1ZXXA 1A2OA 5AVSA 1EFAA 1QYDA 4IPTA 3VZCA 4BP8A 5FQOA 3O8BA 3QKIA 4D1YA 3L8EA 1PLLA 1TYDE 1H5QA 3K8ZA 4XQEA 4OBXA 1X7XB 1L5OA 2E4XA 1R6UA 3GPCA 2V3WA 2VKQA 4IFTA 1NVWQ 3EFOA 2VTVA 3ECCA 4WK2B 5IVIA 2XMCA 4GPZA 5HG0A 2O2GA 5HF8A 4CKEA 4ED9A 1IHOA 4C04A 5K03A 3UPTA 3LVQE 4BX3A 2QA5A 3NAQA 1F48A 3OAAA 3Q7QA 3ZJUA 3TSAA 4WJZA 5B7PA 1J0CA 4A27A 4EL0A 1G8SA 1ZC3A 3CW9A 3DBIA 1E2NA 5I8WA 1CEQA 4D99A 3LYAA 1BDJA 1PEDA 1ZD2P 2BTOA 4HEQA 4RV4A 1SB9A 2FGKA 4Z9AA 3WLRA 3NR2A 4AM8A 4P6VF 4CT0A 3BSFA 1XWWA 2VA8A 4URXR 5I4CA 2JW5A 3C15C 2QSYA 4RCYA 1FYXA 2Q8NA 2V4MA 3L79A 4QHSA 4WCFB 3IAM1 3HVIA 1OYVA 3DLTA 1H8HD 1RQ7A 1WCXA 1FJ2A 5TX7A 1G7TA 1Y8QA 4R1LA 1GGNA 3U6BA 5CLFA 1K5GA 1FXWF 2I0FA 3E27A 4OB6A 1R5NA 3SI7A 4JXZA 4IFBA 4BB0A 2CXQA 2POQX 4TUYA 3BEDA 1HYHA 1HA3A 1JUDA 3UV7A 3K9WA 5LM3A 1AV6A 5GPBA 1XLWA 4RH0A 1MB0A 1UC4B 5DNWA 3DAPA 3X2SA 5BPFA 4N76A 4ZVNA 1CTQA 4JUBA 5HTOA 1O58A 3NGLA 3GJ5A 4LYGA 3AM4A 3P9XA 1FP6A 2BONA 3DGEC 4LHVA 4M55A 4UU0A 5DYGA 3AU8A 3EXEA 3OKFA 2GXSA 1ABBA 3GEPA 2F1JA 1P2DA 4MINA 4XD7D 4XR9A 3D3NA 3IAS1 4HNRA 5LNK6 3B2EA 2DQZA 1L7DA 3VPHA 1GG2A 4NZMA 1CUJA 3DO8A 4RS3A 4O59O 1AU9A 3FDFA 4NJOA 1MDFA 3DWIA 3AJRA 3I5MA 5ELLA 1BS9A 3QFSA 1U0RA 4INZA 4TS4A 2PFKA 1V11A 4FCVA 4OLAA 1G6Q1 4G8BA 3WDMA 4F3YA 1H2WA 1TAHA 1A5AB 1ZWLA 2NACA 1ODJA 3FPHA 4IIJA 3TJRA 2Z8YA 1PN3A 2H54A 1CU1A 3ADOA 3D4LA 4E30A 3D4BA 1JVNA 3T4PA 4MIOA 1DWQA 3Q88A 3W06A 4HXGA 4BUJA 4KJZA 1FFXB 4JB8A 3NYQA 2FF5A 2PGOA 5CM8B 2C7RA 2C5EA 4NBNA 1QSGA 2IYZA 3TJMA 1YRAA 3TXAA 4ZXPA 1PD1A 5COBA 2XA9A 3VYTB 2DRIA 1U0JA 3HL0A 3PFGA 3ONFA 5DU2A 2GR9A 3AY7A 4YMWA 2VF7A 3DXYA 2ORED 4DQVA 2V1XA 1E2DA 4AQYB 4BAGA 2FUG1 1DOHA 3QF4A 1XZIA 4MPJA 2IF0A 1P8JA 1PDVA 1CULC 2OY0A 4RM3A 5CVCA 5M3BA 3PFNA 3W5VA 5A6SB 1J7JA 3K4PA 3JQAA 2MWMA 3FF4A 1OR8A 5CGQB 2WM8A 1NY6A 2BEVA 2D5CA 2C3YA 1MC4A 1P3Y1 2PZBA 4NAUA 1XMQB 3ER6A 3UYKA 1E61A 1G6HA 1SIBE 1X3LA 5LXTF 1B1CA 4CKWA 2R66A 2C04A 3CUKA 2YRXA 1V5FA 4IILA 1H1LA 5CHEA 2I7DA 3C3AA 2JHAA 4FFVA 4DADA 2WWVD 2PUHA 4WASA 4TL6A 1RXWA 3WHLA 4B85A 1ZUIA 4GOLD 3PXCX 3AH8A 1O97D 3EAGA 1GZ4A 2XX3A 3IX7A 4JJAA 2M98A 5IT9A 4GWGA 1V4BA 4I81A 1XRQA 4WVFA 1HOTA 1Z28A 1UXJA 3BGOS 1ARZA 1C0IA 3E2MA 3NO4A 3GT7A 3UWPA 3QUSA 4HV4A 1OLXA 3IJ5A 4RY8A 1B2RA 4EY7A 2HXYA 3HB5X 4P31A 3ZU5A 4E5NA 3MWEA 1BXZA 2IXEA 4QHTA 4RETA 3FMOB 2XXJA 3OQPA 3RVOA 2HPZA 2GQ0A 3PFCA 4WY2A 1X39A 2LCFA 3TG2A 3C70A 4ALNA 3BM5A 3L8HA 3ROGA 1A71A 1RHQA 4CM4B 4EH1A 7GPBA 1UIRA 1EUYA 1U81A 3AZOA 5FX2A 1M8FA 3RTDA 2H18A 1SC6A 1NSFA 3AONB 4HTFA 2EL9A 4RSHA 4DCCA 1T0HB 3A14A 1MVNA 4MO2A 4CG3A 5BWBA 1YRBA 4FVTA 3S1AB 3AO0B 1SWVA 5AKGA 3N2GA 4TV9F 1BU5A 1D6MA 4ZI5A 5ALEA 3QG1A 2EFCB 3E1GA 3R7BA 3BOSA 3EVTA 4Y1RA 2R6AA 4DCPA 4FHFA 1GR1A 1JWLA 3D02A 4B6SA 3KEFA 3ID6C 4NHOA 2NVWA 4LYDA 4EYKA 2R96A 2CUNA 1ZOOA 1T26A 3AV0B 3U13A 5H59A 2GB4A 3UJPA 4PN3A 5HRCA 4PG5A 2HIAA 3GPIA 4F5WA 5CA0F 3BJRA 5DGXA 3WMGA 4Y67A 4HH1A 3LJKA 2O14A 5JVDF 4XWWA 2JGDA 1IXSB 1F4VA 1Y33E 1V8FA 4J0HA 1PJ3A 5KUTA 5D2CA 4E1BA 3HTXA 1ZD4A 1JX6A 3WBFA 3SR3A 1X7ZA 1OLSA 1ZUHA 5E9AA 4DC1A 1DBIA 1PJBA 3LS2A 5DM1A 5L4SA 4GKKB 1QZ3A 1A88A 1U7TA 2GZAA 2XNCA 4HG2A 4MR8B 2BD0A 2J3LA 3MCWA 2Q3DA 4PFJA 1SOAA 1WCIB 3RR2A 2FPPB 1KI4A 1P9LA 3IV7A 3M1AA 4PO1A 2WHRA 4CNQA 2J8ZA 3U4MA 3OLYA 3RRNA 2IWRA 3U9SA 5TJ9A 1SUPA 3ZE8A 1B2LA 3CH5A 1KVRA 5BT8A 2QRZA 2NZJA 3D0OA 3PE4A 1ABFA 2HI0A 3HU1A 4XR4A 1IVYA 2YZMA 4MX8A 3EODA 7MDHA 4TL7A 3HXKA 3VYUB 6NULA 2GD1O 3IJRA 3NP7A 2I7XA 4EHFA 1D7OA 1PZFA 5AVJA 4ARCA 3L5OA 5JCXA 3FJOA 1SHJA 2NYAA 5JAUA 2DGDA 4CV1A 1XELA 3FPEA 1FJGB 4E0BA 5DW0A 1XK7A 3O8OB 4CU5A 3GJ8A 4HB2A 2RH5A 5KTOA 4RA9A 5L6LB 5C32A 5JLJA 4YCSA 1W0CA 3IQIX 1Q7TA 1QKKA 3B38A 2Q1XA 3QLTA 1I6WA 2VUSA 2WEKA 3T6KA 4AG3A 1VJRA 2F1HA 1S9HA 2OAP1 4W1SA 4ID9A 1J90A 1Z6TA 4U0JA 3WP1B 4X84A 2O2JA 4F2DA 3PRJA 4DZZA 5CB4B 3DFFA 4J3FA 2B6NA 2LKDA 2W48A 1XVIA 2X2EA 3GUCA 4CL0A 2IL1A 2Q3CA 2ZPAA 3ZGYA 4LDRA 1UBEA 3CR8A 4MQBA 4FM9A 3JARB 3E9QA 2OE2A 3ONEA 4IUDS 4I50F 2XA2A 3ET5A 2HBYA 4V03A 2FFQA 3PHIA 1FDOA 3BCUA 3GUYA 2PD3A 2G0TA 4LZJA 4Y1EA 4ZEVA 2OXEA 3CRRA 5FWYA 3V7UA 3DMNA 2NUAB 2O3SA 1OFTA 1SG0A 3KSUA 1XTZA 4F6CA 2O5EA 3QPUA 1FSGA 3T3DA 1YA6A 5LDDC 1B3BA 2IJGX 4GE0A 2I9KA 2A33A 4C03A 4A9AA 5F5NA 4F3RA 1USGA 3P2MA 3OTOB 5DCWA 2A0KA 2G25A 3AXSA 4NV0A 2FSSA 2I3BA 2Q07A 3I9OA 3QXXA 2QTVB 3F6EX 5BW6B 3VX3A 4RTPA 5CCBA 3V7WA 2IH5A 4ZCTA 2VUTA 3AERA 2C9OA 3MGCA 1W8IA 4XGRA 2EQ5A 5DP1A 4DLAA 4DMUB 2QWXA 4JUCA 2QLBA 3ANLA 4GI7A 4I9NA 5AJWA 1DE0A 4TXLA 4C7OB 4RF3A 2X9NA 1H4QA 1FLNA 4PV7A 5CFNA 4BE9A 2GN2A 1H23A 1E7SA 3FJYA 4O5AA 5DYIA 1CG6A 1J22A 5FBQB 5C34B 4S04A 4GW3A 1LPSA 3F6RA 1J8MF 1VYUA 1NXOA 2RKWA 1J09A 3E7PA 3ZU3A 4L6AA 4ZAXA 3N8KA 3UJDA 4MNTA 4MR9A 1A5SB 4XM2A 1TEXA 4A91A 4IYRA 4UFPA 1T3TA 4U8GA 3LAWA 1JG2A 1QH8A 3ESYA 3ESDA 2YOFA 2OCBA 4MQ6A 4BTVA 4C6TA 3NDRA 2QTMA 4B1FA 4X7MA 1R0ZA 2ARKA 2ISCA 3ANXA 5EOVA 1O7JA 1JFVA 1ZU5A 5FO1A 1PSDA 3R5TA 1HGXA 1YCDA 3NTXA 4JJ7A 1VYVA 2G9RA 2W9XA 2Q1TA 4G0XA 2CVQA 2N42A 4ENWA 1YB7A 1P2GA 4UOQA 4CQNA 2IT1A 4M0FA 3ZV4A 2LIPA 1WF6A 2R85A 3PF9A 5IH3A 1LZKA 4OYHA 1ZMTA 4BLSA 2JD0A 1IK4A 4RTOA 2X3YA 2ETXA 2C2XA 1U7DA 1IJEA 4OAQA 4P7JA 1NYTA 2P2SA 2BISA 2P30A 3DZFA 4F6RA 4X5OA 2VJOA 4HAZA 3MF4A 3NM6B 3RFCA 1PSZA 2DEUA 2P0YA 4A2PA 2GLXA 4UJ5A 3E8MA 2C94A 3A4MA 5ALWA 5TRTA 2ZIFA 1QK4A 3H2HA 3DCJA 5HBRA 1OWPA 2HZBA 5KHOC 4LJRA 1FMFA 1JR6A 2FLVA 4FEGA 4OHOA 3CW8X 2R00C 3EUFA 4BMZA 2JG3A 4RTMA 1Z6AA 4RIGA 4UCXA 4DXDA 2XZDA 1XC7A 4A8HA 5LFAA 5LB4A 2PL3A 1X86B 3QIVA 2IH4A 3RLFA 2EIXA 1XRPA 3EC2A 3EG9B 3OD1A 4MW2A 1LKZA 1T1JA 2PX6A 2HMUA 3C0KA 1PFGA 1MD9A 4YNBA 3GDOA 3DR3A 3MWDA 4NH0A 1N9ZA 1N9GB 3KWMA 1JG7A 1JKFA 2LXNA 3WK4A 4MS1B 3AXTA 5FOQA 1GTJ1 2QW1A 2W98A 5P8WA 3WHKA 1GXSA 1XPJA 4PO3X 1PI3A 2CZGA 1PTJA 4QPZA 5FI3A 1N1GA 4AMGA 2BCEA 4W8GA 3EF0A 3FBGA 3GDFA 2QX9A 1ZP6A 3BKXA 1OXXK 1RWWA 3ICWA 4J0KA 1G20A 2XTAA 3HB1A 1DIOB 4CTJA 1GZ3A 2BC9A 3EQ7A 4JOCA 4UTNA 2CL5A 3A1UA 4EDHA 3D3QA 4PTLA 3DO6A 4IVRA 3R9KA 2A9QA 4JELA 1NUUA 1SZDA 4W5OA 5CXQA 3A1VA 4KE6A 3KB2A 5F23A 4DC0A 1DQSA 1MFZA 2FPKA 1YJ5A 4P0PB 1QGAA 3GVCA 2ZOSA 5LD2C 2AFHB 4V0KA 1QJCA 6Q21A 2FPXA 1EVIA 5FNVF 5H1YA 3JQDA 3L6OO 1STOA 3CM0A 4O4IB 3P4UA 2OCIA 3WIBA 1TTHA 3AFNA 4FB5A 4IJKA 1XMXA 3ONDA 3KLPX 1XXHE 2WU0A 1ECLA 1PLKA 3OIFA 1BJKA 5ADWA 1Z29A 5AW2A 2XITA 4QUHA 2AK3A 2PJZA 1NBEA 2FRXA 3EHEA 3RSCA 3U26A 3QVLA 4J29A 4G0UA 4J0IA 1DEHA 2L2QA 2MSDB 4MYCA 2HIHA 5AK0A 1ESMA 3HKDB 4G1VA 4LJ4A 4Y30A 1SCIA 1OV4A 2OBNA 5DTEA 1YMUA 4F5EA 3OO1A 4G56A 3ZIUA 3B1KA 5EXPA 1J0DA 1MKYA 1P73A 3H5TA 4H1WA 1SHLA 2UYGA 3K7EA 1GUYA 4YCCA 3LUKA 4ACBA 2NVOA 3G7NA 4J4TA 2BLNA 4YROA 1QP7A 1HYGA 4DRZA 1ISJA 4J07A 1LLCA 1ZJYA 3PP8A 3SYTA 2PX4A 3NOVA 2ZXEA 2JAUA 1Z8FA 3K1ZA 5CK5A 4D3SA 1NF9A 4MJ3A 3W2GA 2GBCA 4OCZA 5ILQA 3FPGA 1G5TA 4Y2YA 3A58B 2FN9A 3ZWKA 4B0OA 1NBMA 1FRVA 1KU6A 2ZRFA 3G79A 3GLHA 5P21A 5JI2E 3THRA 4BVFA 2A35A 4CW7A 1MW9X 4P3OA 1KDPA 3K9BA 4A8PA 4YJ2B 4ZCLA 5HKOA 4EUFA 1VG8A 1DFIA 1UK7A 3QVKA 4EHIA 3WNQA 4WCDA 3AOEA 1NL3A 3AUUA 1LU9A 3AVPA 5KQMA 3JQ7A 3CWZA 1GCOA 1WF3A 2IKSA 1PGNA 4O2AF 3SJCA 3U3OA 1WOMA