4BZWA

Complete crystal structure of the carboxylesterase cest-2923 (lp_2923) from lactobacillus plantarum wcfs1
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
275
structure length
275
Chain Sequence
MQVEQRTLNTAAHPFQITAYWLDQISDFETAVDYPIMIICPGGGFTYHSGREEAPIATRMMAAGMHTVVLNYQLIVGDQSVYPWALQQLGATIDWITTQASAHHVDCQRIILAGFSAGGHVVATYNGVATQPELRTRYHLDHYQGQHAAIILGYPVIDLTAGFPTTSAARNQITTDARLWAAQRLVTPASKPAFVWQTATDESVPPINSLKYVQAMLQHQVATAYHLFGSGIHGLALANHVTQKPGKDKYLNDQAAIWPQLALRWLQEQGLLAGN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LIPASE/ESTERASE
publication title Structure, Biochemical Characterization and Analysis of the Pleomorphism of Carboxylesterase Cest-2923 from Lactobacillus Plantarum Wcfs1
pubmed doi rcsb
source organism Lactobacillus plantarum
molecule tags Hydrolase
total genus 88
structure length 275
sequence length 275
chains with identical sequence B
ec nomenclature ec 3.1.1.1: Carboxylesterase.
pdb deposition date 2013-07-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07859 Abhydrolase_3 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4bzwA00
1N5MA 2EEPA 4DGQA 4ZREA 1X2BA 1AKNA 1TCAA 3BF8A 1W52X 3QITA 2W22A 3FVRA 1W76A 3ZLUA 4Y2XA 1TRHA 5DTJA 1D07A 5ALSA 5AP9A 1GKKA 3I2HA 1ACJA 5ESRA 3LIIA 1S8OA 3JYHA 4G8BA 2J4FA 2PM8A 1ZIYA 3C6XA 5JAUA 2WJ6A 2R8BA 4H35A 3BJRA 5HK9A 5IVKA 3E3AA 4X90A 1CUXA 1U4NA 2XUOA 4BDTA 1UK7A 1R1DA 2BGRA 3LS2A 2CJPA 1DU4A 1LZLA 2PUJA 4U2CA 5AKIA 2GBFA 2RHTA 1MU0A 4TGLA 4W63A 2JGFA 3R3VA 4UUQA 4WY5A 4X71A 3UUEA 3K6KA 3DQZA 5IVIA 1JU4A 3WJ2A 3O9VA 1JU3A 2C0PA 5CH8A 3CN9A 1OXMA 1AC5A 4RGYA 5I8PA 3O4HA 3O4IA 2VJBA 1FJ2A 5DYYA 4HRXA 3H2HA 3D4LA 2J4CA 3M81A 1ZIXA 1GQRA 5AKKA 2XMGA 2WG1A 3ESDA 1MNAA 4G8CA 4J3JA 5ALLA 1XZHA 4UHDA 1XZFA 4QDUA 1LZKA 4AQDA 4ZXFA 3FCYA 1E8MA 5JASA 1IZ8A 4L9AA 4Y9SA 1QIKA 3DEAA 1XRPA 5LZ2A 2XI4A 4Q05A 3I2FA 4TVKA 1ZI9A 4NZZA 2O2HA 3GELA 4AN1A 3KWJA 3AINA 1CUCA 3FYUB 4BATA 3ICVA 1R3DA 1G42A 5ALOA 1TCCA 1XROA 5ALZA 1O6FA 1W4LA 1CR6A 5AO9A 5C8ZA 3BL8A 5AI6A 1JJIA 4DTCA 1E5TA 4BE9A 4W1SA 2I3ZA 3BIWA 1WPXA 3PDCA 3OOSA 4TPKA 1FFBA 1QLWA 2AJBA 5ALTA 1H2YA 3WKEA 4LXHA 4X6XA 4B7ZA 2ACKA 1VA4A 4S0XA 4Q82A 4CCWA 1LBSA 1XQVA 1CLEA 2JGIA 1QFSA 1QTIA 5A2GA 3GZJA 5ALJA 4U2FA 1XZCA 4G1FA 1AQLA 4YPVA 4G4GA 4Y2TA 1WB6A 1HL7A 3WK9A 5J3JA 4G5XA 3OC0A 4LYDA 1THGA 1SCKA 2HHAA 4RE5A 2R11A 3GROA 3C70A 4AN0A 4E11A 2OQVA 4WFKA 1JJFA 3G0DA 1Q0ZA 3MGAA 2ZJFA 1CUDA 2GYWA 3D5EA 4KRXA 4GW3A 1E89A 2JIDA 1UK9A 4EY5A 2VAXA 5T4FA 1XRMA 1QIMA 2OXEA 4B9EA 4CIAA 4B80A 3F97A 3IVMA 4DM7A 4X00A 4FOLA 3W9BA 5AJHA 1MTZA 3WWPA 5K3DA 2XMDA 1CUBA 3WKCA 1CUJA 4Q3OA 1FFAA 4LYEA 3WLAA 3WWEA 4FLFA 5LP1A 1EB8A 2OCKA 3VVMA 5T4HA 4GI1A 4LXGA 1K4YA 2C5GA 4KR0A 1LPMA 3QYJA 3N0TA 1P0IA 5CT4A 2HA4A 4DMKA 1ZJ4A 2XQFA 2WUEA 1ZD5A 3EQ7A 2XMCA 3FYUC 1RWQA 4X95A 1LLFA 3KXPA 2HRQA 3QPCA 5JAPA 2ZJ7A 2CMFA 3DNMA 4BAZA 4M0FA 5ALNA 2PU7A 4J0KA 1CUZA 3G0BA 3TJMA 1FFCA 4XVCA 1QE3A 1UOQA 3R3ZA 4J03A 1DT3A 4DSZA 1GPLA 1R9NA 2QXUA 1TK3A 1EH5A 3ZLVA 4OB8A 3KWFA 3E1GA 1W1IA 3K2IA 5HKAA 2OCLA 4ZWNA 1DTEA 2WTMA 2HADA 2Y2VA 5CH5A 3H18A 3Q8WA 3IULA 3D2CA 3H1AA 1UKAA 3I2JA 2ZYIA 2WKWA 1L7AA 3IB3A 3ESCA 4FDMA 4DNQA 2Z3WA 5SYMA 3LLCA 1F6WA 2Z8XA 1YCDA 4XWGA 4H7KA 2C58A 4BAGA 4PNZA 4H7EA 1ZGBA 2GZRA 4B6GA 1ODTC 4PSDA 4HRYA 5E4JA 1UKBA 3OG9A 1KEZA 1RYYA 3G9TA 5AM0A 3HZOA 1E66A 2HU7A 1YB6A 4EY8A 1QO9A 3KDAA 2QUBA 2JGMA 4GBGA 1XLUA 1QJ4A 4NVRA 3H2GA 2X8BA 3H1BA 4J0GA 4IQ4A 5JAOA 3OM8A 1CUIA 1E8DA 1BEEA 2WIJA 4FBMA 3R0VA 1XZAA 4UHCA 1LPAB 1VKHA 3W04A 2GBCA 1U65A 4WDQA 1QIJA 3UUFA 2O2GA 4H7FA 3IUNA 3OTQA 2VJAA 3WIBA 4X3CA 5K3AA 4KAAA 2QM0A 1EDEA 3HC7A 4U2BA 3FVTA 2C0QA 3Q0TA 1AZWA 2XUKA 2HDWA 5DYTA 3CXUA 3PI6A 5AKLA 1GPNA 3WK8A 3ICWA 5C8VA 3DOHA 3OURA 5AIAA 2WFMA 1YB7A 2OGSA 4WFJA 3ZLTA 4QDZA 3F98A 2J3QA 2B4KA 1Y7HA 4FLEA 3KOOA 5HQ3A 4OYYA 1CRLA 1YR2A 2P8SA 1CUWA 2QVBA 5CXXA 5DJ5A 2Y6VA 4B9AA 4XJVA 3RKSA 1WCYA 3BXPA 4I19A 1YS1X 2Z3ZA 4QDTA 5C7YA 1CUUA 3C5VA 2Q0XA 3LP5A 3WMRA 4BCCA 1LPNA 1XZLA 2DR0A 2OAGA 4QWMA 3HSSA 3FYUA 2WQZA 1CUVA 1HKHA 4F21A 1HDEA 1THTA 5JZSA 4P92A 3EQ9A 4BTVA 5YASA 4C89A 2G4LA 3G9ZA 2LIPA 4A16A 4HS9A 4MYDA 1IUNA 4QZVA 3STUA 4FBLA 1SOMA 1XZBA 4OUKX 4AO7A 1X2EA 4N8SA 5HFNA 4WCVA 4RPCA 5ALHA 2ZVDA 4ZRDA 4OB7A 1QFMA 3STWA 1LGYA 1A88A 4QA9A 1TAHA 4H18A 5AICA 4C4ZA 1BCRA 5JZBA 1QONA 2Y6UA 3I2IA 2G63A 3WYDA 2OCGA 3DLTA 5FLKA 3A2LA 5EIHA 2B61A 3F8SA 5FPPA 5EI5A 2XUQA 3D0KA 3VJLA 5ALKA 5ISMA 2O2IA 1OCEA 1EHYA 4X93A 5DLPA 1R88A 2XMSA 2ZYRA 5IKXA 5AK6A 1JMYA 3TGLA 4N8DA 2WG0A 4YX9A 4UBNA 1CUHA 1TIBA 4BE4A 1ZICA 1PV1A 2QJRA 5JIBA 2XDWA 4JH0A 3VISA 1J06A 4J0CA 2WG2A 3C8DA 4BZZA 1BN6A 2RIPA 2RAUA 3WL6A 5ALGA 4GXNA 5AKXA 5AK3A 1HLGA 4AO8A 2WUDA 2RI6A 5DNVA 3G02A 5FXMA 3R3UA 4KE6A 4F5ZA 4H7JA 4Y2JA 1H2ZA 3DS8A 2HA0A 5AIBA 3DYIA 4PQEA 1VZ2A 1WHSA 3G7NA 4CG2A 3CN7A 5AKJA 4L0CA 3QMVA 5LZ5A 1QIEA 4PSUA 4CCYB 3F9CA 4JUIA 2JEZA 4XX1A 1ZI6A 5EHXA 4EBBA 3IUJA 3WIOA 3O9MA 4QWWA 1CQZA 4DNOA 1AURA 5A6VA 4AZ0A 4H7HA 1YAJA 3U0VA 2XMRA 3GA7A 5FPQA 2PL5A 2AJDA 1P0MA 2K2QB 5H3HA 3A70A 2DHEA 1DX6A 3D59A 1CUAA 3B12A 1K6EA 1R9MA 4MEBA 4C87A 2DHDA 1UZAA 2BUBA 2GBIA 4Y2UA 1SCIA 1EK1A 5KWIA 3WKBA 5CTAA 2RGUA 2XUJA 4FKBA 4CFSA 1MX9A 1MX1A 1CIJA 4B84A 1R4ZA 5AI9A 1QZ3A 4PF1A 5FKJA 5K3FB 4Y7DA 3UMJA 3D7RA 3AZQA 3VVLA 4X97A 2CKMA 1T4MA 1EI9A 4WY8A 1MPXA 1WHTA 1ACLA 3WL8A 5DWDA 5CXUA 2HU8A 2V97A 5ALPA 1WB5A 3ZI7A 1EK2A 4B0OA 5BOVA 4UBLA 5LZ4A 3SC2A 1EINA 2BCEA 5AOBA 2OLEA 1EX9A 1PFQA 2PSEA 3WWDA 1VXOA 1PJAA 1H22A 3WK5A 3H2IA 2DQYA 3A2NA 4DNFA 3M82A 3DJYA 4FNMA 5HK8A 1XRLA 1VOTA 1VZ3A 5BWBA 2WJ3A 3YASA 2AJCA 5A7GA 4FNGA 2IX9A 3RM3A 1G66A 3ESBA 4QE3A 4B0PA 7YASA 4KE8A 5ALRA 5IVHA 5D6OA 4IH4A 2PKYX 2I3DA 1P0QA 5IH7A 3S2ZA 4L3WA 3L1JA 3BF7A 1XLVA 3ZV7A 3C5WP 3NOXA 5CH3A 5K3BA 4CG1A 4BC0A 2ZSHA 4AMZA 2XB6A 2CZQA 2WFLB 2WTNA 4UBKA 5CURA 4HZGA 2XUGA 2BGNA 4FWBA 4ETWA 4X6YA 1BS9A 4MWSA 4G4IA 3M3DA 2JEYA 2BKLA 2UZ0A 3BIXA 4WFIA 3D3NA 4Q1VA 2JGLA 4C4XA 1A8QA 4QDOA 3PFBA 4A5SA 4FTWA 3TRDA 1NX9A 2XLCA 2VEOA 4BVLA 4PSCA 4KACA 4M0EA 1CUSA 2EDCA 2HFKA 4MYSA 3JWEA 2PSDA 3WWCA 2WU4A 3W9UA 1AMNA 4UHFA 4DIUA 2WIFA 4EB0A 2D5LA 1LPOA 4BDSA 3BE8A 5AKYA 1UXOA 2FUKA 3MUOA 4B81A 2XUDA 2WIKA 5AK5A 4KE9A 1U8EA 1GZ7A 5LZ8A 1XQXA 4J0HA 2O7VA 3H17A 3IUQA 4YK7A 2QTBA 2ES4A 2H7CA 2Y1KA 2YH2A 2QOEA 3B5EA 4G9GA 3O0DA 1Y37A 3IDAA 1KU6A 1JKMA 1QGED 3HJUA 2XQJA 1QIIA 2HL6A 2WILA 1F0PA 4BRSA 2YASA 1VA5A 4UBJA 4C88A 1X70A 1UKCA 4G4JA 5D7BA 4DMFA 4EY4A 5DNUA 5JD4A 4J0DA 4UBIA 1B6GA 5AM5A 3ILSA 4EA6A 1XZKA 1USWA 2XUHA 1QTRA 1WOMA 4J7AA 5JYCA 4UHHA 1N8SA 3NUZA 1LNSA 1QIFA 1CFJA 3VDXA 3ED1A 5JD5A 1ETHA 3V9AA 5DYWA 3WWOA 2WUGA 4UFNA 3STTA 4C01A 3C6BA 5D3ZA 1VLQA 4KEAA 1AGYA 1WM1A 2JGJA 1UK8A 3I6YA 2QRUA 4RNCA 4EY7A 4Q3KA 3PE6A 3DKKA 4P9NA 5FP0A 2BUAA 2HIHA 4IH9A 5ALEA 3OPMA 4H77A 4GEGA 1UK6A 1GQSA 2HM7A 1W75A 4JEIA 3V1KA 4Z49A 1MX5A 4I4CA 3AJAA 3FBWA 3C8HA 3QPDA 1XQWA 2XMQA 3BDVA 1W6RA 4OSEA 4MJ3A 1DT5A 3DL7A 3R41A 5EHZA 3I6MA 2VJCA 3SK0A 1FFDA 4OB6A 3P2MA 4ITVA 3R3XA 1N5RA 5ALWA 4QNNA 1LBTA 2X5XA 5AI5A 4IO0A 2QT9A 2VATA 3V1NA 5AKHA 3I2KA 4CCYA 3BJMA 4BCBA 4GWLA 4E14A 3E0XA 1C4XA 4AMYA 1WB4A 3VKFA 3W05A 2VQ6A 1Z68A 5HFAA 4MEAA 5JD6A 4AXBA 2NW6A 1EDBA 5JATA 1EVEA 5ALFA 4LHEA 1I6WA 3L1HA 3BDIA 4L72A 1A8SA 3FLEA 3O4JA 4WDRA 2VT7A 3EIOA 1OILA 4FMPA 2DHCA 1J2EA 1ZD3A 3BWXA 1GT6A 3WK7A 4E46A 5AI0A 5AOCA 3QMMA 2XMBA 5CMLA 1M33A 1QIGA 1XFDA 2QJWA 3EQ8A 4ZV9A 2XT0A 5LZ9A 2V96A 2OAEA 1C7IA 1BE0A 1F0NA 2Z5GA 4AX4A 5A71A 2HU5A 5K3FA 5FUMA 3DCNA 1CPYA 5AI4A 2WIDA 2FX5A 4AB1A 3O95A 2HA2A 3FWHA 1TQHA 5C81A 5HF8A 5CT6A 1U2EA 1VJ5A 5A7HA 4Q34A 2WHQA 4H7DA 1WPRA 4JYPA 5KWJA 4Y2SA 1UT6A 4BAUA 2PSFA 5AHXA 2BFNA 1TKRA 4IH1A 3WKAA 1XQYA 2ORYA 3G8YA 3I2GA 1K63A 4C4YA 4FHZA 2OPHA 1ZD4A 2OCIA 3WL7A 2V9ZA 4LIPD 1ISPA 2PU5A 2BAGA 5LKRA 3AUKA 5AK4A 1UOOA 1Q83A 1MN6A 5EGNA 1BEZA 1LPSA 3H04A 4UHBA 3K9BA 1DX4A 5CT5A 4BTLA 3H0CA 3A6ZA 5K3CA 1K5PA 2OG1A 1L7RA 5JALA 3AFIA 2HA7A 4FFWA 3WQHA 4RE6A 1JFRA 1XZGA 4ARBA 5LKAA 4OYLA 1TCBA 3QBJA 3EBLA 5EIAA 2RONA 4D9JA 2VJDA 3DOIA 2WLSA 3I28A 3H2JA 2WFLA 1YA8A 4E15A 5JAHA 5AM1A 1IMJA 5EFZA 1MJ5A 4KYVA 3G0GA 3AIOA 4Y2RA 1ORWA 1CV2A 5I7UA 3V48A 4KAJA 2AJ8A 3W06A 2WFZA 1BROA 4UFOA 2HA6A 3FYTA 1HQDA 4KJXA 1EDDA 4HXGA 3VXKA 4B85A 4X92A 1LPPA 4ZGBA 3WZMA 3ZWQA 3HI4A 2G5PA 2H7XA 1SFRA 5ALMA 3AILA 2Z8ZA 4W1PA 5LLSA 1CEXA 3DD5A 3STYA 4QLAA 3WJ1A 4PW0A 1YS2X 1UWCA 4YASA 2WHPB 3EF3A 4OPMA 3PICA 1G5FA 3HYSA 2RHWA 3ANTA 3C6YA 4ROTA 1ZOIA 1DQZA 2C5FA 5EHNA 2VSQA 2ZJ6A 4OCZA 4HXFB 4Q3LA 3FCXA 2PX6A 1RP1A 4LXIA 2QR5A 4GLBA 3FLAA 3HEAA 1XZJA 2DCMA 4FFVA 4DNPA 1XKLA 2D0DA 5HQ3B 4BBZA 3WK4A 5BWCA 1B41A 4V2IA 5CW2A 4HVTA 4B83A 4U2EA 4A23A 4M0MA 2XUPA 3G0IA 3V1MA 1IZ7A 3KD2A 2ROQA 3PF8A 2ZYSA 1SCQA 3T52A 3WK6A 1VXRA 3R3WA 3LCRA 3WKDA 2ONCA 3IURA 1GPKA 3HACA 5AI8A 3DYVA 4Y2QA 3FSGA 4UHEA 5ALUA 2FJPA 4NMWA 2V98A 4BYMA 2PBLA 1CVLA 2JF0A 2VA9A 2I03A 2XQKA 4G8DA 4PO3X 1O6GA 5LYYA 3WYNA 3L1IA 3O4GA 3VJKA 5CBKA 3NWOA 1JI3A 4GDMA 3FAKA 3R3YA 4DLNA 1HPLA 2GBGA 4J0JA 1XLWA 2H7YA 4BP9A 3STXA 2HA3A 5A7FA 4N5IX 4U2GA 4QDXA 1GKLA 5KREA 1AUOA 2QMQA 3RLIA 2Y2UA 5AOAA 4K2AA 5K5EA 2G5TA 2YXPX 1XRRA 3G0CA 2JBWA 3AIMA 5FRDA 2JGKA 5IVDA 1LPBB 4XIIA 4ARAA 4BVJA 2C4HA 2WJ4A 3WA6A 1ODSA 3AIKA 3G9UA 2CBGA 4HXEB 3MVEA 1J07A 2H1IA 1BN7A 1MAAA 5AH0A 2IIVA 1JMKC 4X91A 4P08A 1QIDA 1EXWA 4K5QA 5T4EA 2BJHA 4MXDA 4FLMA 2ZSIA 4BVKA 2PSJA 3DL4A 2QS9A 4W9RA 1UOPA 1Q0RA 4Y2VA 2IITA 4BC1A 5FOQA 4G9EA 3QH4A 5CRIA 1ZGCA 2XUIA 3ESAA 2WHRA 4U2DA 4F0JA 4EZIA 1XZIA 1QO7A 4OD0A 4BB0A 2QKYA 3FNBA 1VE6A 4KE7A 2CUTA 4MQMA 1XZEA 4HAIA 1T2NA 3RK4A 1ZI8A 3WA7A 1CUFA 3C6ZA 5LZ7A 5E2IA 2WU3A 1XRNA 3PUIA 2W6CX 2QUAA 2H9YA 1QOZA 1CUYA 3IA2A 2XUFA 3STVA 5LIPA 5ALQA 5HF6A 2ACEA 1IUPA 4X94A 2WUFA 5T4BA 2BUCA 3M83A 3V1LA 1E3QA 3W2TA 1Q84A 2OGTA 5AM3A 2HA5A 3GUUA 1CUGA 1MO2A 3DDUA 4MQLA 2YYSA 1QIHA 1IUOA 2DFPA 3GFFA 3R40A 2HFJA 5DNWA 1FSSA 1Y7IA 3I1IA 3NGMA 4WJLA 5JARA 2XLBA 2CEKA 5BV7A 2PPLA 3DKRA 5ALXA 5JADA 5AKZA 3C87A 2C7BA 3AZOA 4AZ3A 5KBYA 5CT9A 2AJLI 1P0PA 2PVSA 4UPDA 3D2AA 1AX9A 1XKTA 4BRZA 3ZPXA 4F60A 1EVQA 4NS4A 5HZGA 2VF2A 3HLKA 4Y2YA 4W1RA 1YSCA 4EHBA 5E4YA 1DQYA 1EA5A 5C8XA 5AM2A 4ZI5A 4X85A 4DSAA 3WZLA 3IIIA 3N2ZB 3I1YA 3A2MA 3VJMA 1XZMA 4BCDA 3S8YA 1FFEA 3H2KA 2JGEA 1H23A 1J1IA 3G9XA 4GHWA 2J3DA 4EY6A 3F96A 4GECA 5ALIA 3F67A 2DQZA 3AZPA 2B20A 2X76A 3JW8A 3C45A 1EB9A 5FV4A 3T4UA 1YASA 4BZWA 5FDFA 3C43A 4QEKA 4N5HX 1UFOA 3FLBA 1BCSA 4H7IA 1DWOA 5ALDA 1E8NA 2CB9A 2GZSA 4C6HA 2HRRA 6YASA 3SWWA 2WM2A 1YA4A 1MAHA 1K8QA 2B9VA 4KAFA 3HABA 3ANSA 1KU0A 2OGZA 3IUMA 5JANA 4OU4A 4IHAA 1F8UA 1ZD2P 2WHPA 3H19A 3PUHA 2WSLA 2EDAA 2XUAA 2VT6A 5F4ZA 3PF9A 5SYNA 1NU8A 5AM4A 3KSRA 1ODCA 2E3JA 5HCUA 3RARA 3QVMA 1MT3A 3MUNA 1DWPA 3HRHA 2XMZA 3QM1A 4EUSA 5CT8A 4B82A 1YAHA 1L7QA 1CUEA 4DMCA 4INZA 2XQIA 3FOBA 4P93A 4LKOA 3QPAA 1JJBA 5HF9A 2QXTA 2DSNA 1N1MA 1DWQA 4W1QA 4UBOA 5HKBA 4H0CA 2ECFA 5K3EA 3GBSA 4UBMA 4CIBA 3WL5A 1H2WA 5ALYA 3LIPA 1HBJA 1C7JA 4BP8A 1VE7A 4HTAA 3CCBA 1A8UA 2VTVA 1BRTA 4MWTA 1SC9A 4K6HA 3U1TA 1A7UA 5EHQA 5A62A 5D3KA 1XRQA 3CCCA 1H2XA 2ZYHA 2OQIA 1NU6A 2VAVA 5I9IA 5AKGA 4JYMA 4N8EA 1ZJ5A 3HXKA 3TEJA 4KRYA 3E4DA 1JT2A 2QZPA 4I3FA 1IVYA 4J0IA 4QLOA 5JZ9A 4AO6A 3I6ZA 1GGVA 4UFPA 1GXSA 2XE4A 1BU8A 5DTIA 2WIGA 3B3QA 4X6UA 2GYUA 4DYHA 5HF5A 3QZUA 3FSGD 1R50A 1G4HA 4PV7A 3WI7A 4CG3A 1DINA 3PFCA 5EIEA 1MNQA 2GYVA 3QMWA 3IBTA 4O08A 1CQWA 2I78A 4X7BA 2PSHA 4Y2PA 2FJ0A 3D2BA 5AKEA 1ORVA 5E4TA 4OU5A 2O7RA 2PUHA 4JNCA 4CI9A 4K6GA 3X3HA 1XZDA 4ZV7A 3SX4A 4DMHA 5ALVA 2AXEA 4K6KA 2XQGA
chains in the Genus database with same CATH superfamily
3ILXA 4YRAA 4DGQA 1J8QA 1G8KA 4ZAZA 4N6GA 1DARA 3OE7D 3RSQA 4CF6A 1RRPA 5AUQA 1PWYE 1T43A 1W94A 3LH5A 2JFOA 4ZMBA 4GOKA 4UDNA 3TOXA 1XVTA 1XZNA 5IF3A 4NECA 5IXYA 3KJEA 1PK9A 1IIRA 1T6NA 2W22A 3BHMA 3DTVA 4IYJA 2P0EA 5D3MB 4UTPA 2A0UA 4I14A 1U8ZA 4EG4A 3U7HB 1QC5A 2D7DA 4P0PB 1O4WA 4R2WA 1IIBA 4B71A 3IP1A 3K8ZA 1ZVVA 1HQKA 1TRHA 3AJDA 1M1NA 3VDMA 1JHQA 1P33A 1W0KA 2G70A 4B3GA 1NLFA 4BNDB 1XVLA 5EMJA 2WVHA 4NZOA 2KX7A 5JJBA 4AJ2A 1KIMA 3HBFA 3KLPX 2CDCA 4UVDA 5GM2A 4RIGA 3UJHA 2CMGA 1E7SA 1Q7CA 2XVXA 3GDFA 1XCOA 3ZE9A 5IK2D 1E1KA 3ZWKA 5K6AC 2AHRA 4B2PA 1FFGA 1ORDA 3QSYA 5ENZA 1BVYF 1DTSA 4WI1A 3JYHA 3IKVA 1V26A 1YOBA 5AK0A 4OJYA 2I1VB 1W4CA 4YMTA 1YBVA 3RS3A 1PQWA 2GETA 4KNVA 3TD9A 2FMKA 1RW4A 1XDDA 1Z7YA 4LXXA 2WJ6A 2AXPA 1IOLA 5C5EA 1ZH2A 1QHXA 2PL1A 1LB1B 4RKEA 5TF4A 4FZJA 4NOLA 5IDQA 2JGNA 3IQFA 2H1SA 5FX2A 5E1DA 2PNFA 5FPKA 3BJRA 1YDGA 2P6MA 3R76A 3KDSE 2EBWA 2FA9A 1OFUX 1BDBA 2VPWA 5EZ5A 2PE5A 2ENWA 3BK7A 3OTHA 4BDTA 1XMXA 4HWSA 5MHTA 1N6PA 3AR7A 5A4KA 5DK6A 1O54A 3NIWA 5C8YB 1QG6A 1QVAA 4US1R 1AQYA 1ZSVA 4XFKA 3N0VA 1LZLA 3DVRX 4CEJB 4MUGA 5IWCA 4U2CA 5IBCA 3ADOA 3FPBA 3T06B 1V16A 2RHTA 4ZCLA 3V4VB 4C7MA 1H5UA 3CSSA 4WY5A 1TEVA 2W70A 3UWMA 2C8JA 3K1ZA 2D2XA 3OZGA 3K7EA 3CEJA 3OEWA 4D9IA 4OO3A 3WG9A 4QD3A 1L5RA 3BGWA 1TE2A 4L5BA 1G6KA 3GVCA 5BSMA 4UTXA 1RC0A 2XNDD 3O9VA 3PDHA 2OUIA 3A6PC 1V0JA 4B76A 4IGKA 2PXXA 3CN9A 4KGZA 4O5AA 4YUZA 5A3JA 3OX3A 2OXRA 4I55A 3AFHA 3BD9A 1X94A 4EUKA 2IXGA 3PKZA 1KZ1A 4DDMA 1KETA 5JHHB 4CIXA 2QQFA 2XNCA 1DRKA 1PG5A 3A4IA 3ADPA 3LHFA 4FZ5A 4IEIA 1USUA 1U7OA 3HL4A 1BDIA 3ZWCA 2WOOA 1O0CA 1ZC4A 3U3RA 1DFHA 1IHYA 3OESA 3ZNNA 2J6BA 3LLUA 2GB4A 2O0HA 2XMGA 1RCTE 4NCKA 1KMIY 1THZA 3B5JA 1JB9A 1UFQA 4QPJC 3RVOA 4Z9YA 2I7TA 2JI9A 2V8BA 5FOWA 2BEVA 1B43A 4MRMB 1RADA 5G3ZA 2WAMA 5HRAA 3FETA 1FDVA 2BFEB 3BZWA 3QY0A 4G8CA 4YV0A 4PIPA 4J3JA 5EERA 2R6R1 2VF5X 1GJRA 4YJ3F 1DIOB 3BMOB 1PLLA 1XZFA 1XHLA 5F5LA 4QUBA 1SBYA 2VBFA 4IM7A 2TMGA 5ERXA 1N92A 1WXXA 4ZXFA 5D8DA 1IXSB 1EYZA 5IJAA 3FNEA 5ITZA 5K8VA 3NYIA 2C4KA 1E8MA 2ZAMA 1VJ0A 4BKRA 5JASA 1L8OA 2B4RO 1IDOA 1SK9A 4LSMA 5JXJA 3L0IB 1XRPA 4LZAA 2ZCVA 2BT4A 3EZYA 3WBFA 1PWHA 5LZ2A 1KJIA 1O1YA 1C4KA 1OAOC 2EYQA 2YN2A 4LX8A 4BLQA 1PT7A 3TJZA 3I2FA 4KDFA 1WVIA 4PPGA 1BD3A 3H0EA 4R16A 2YFYA 3CV3A 3UZUA 4AF7A 4XRGA 4NZZA 4ZYUA 3EYWA 3O1IC 5DULA 3NHMA 2ILTA 4B8YA 3TJRA 1UKVY 3GELA 3O1JC 4LC1A 4Q7JB 2EERA 2IQIA 5C80A 5LQMA 5TVKA 4E4RA 3ZGVA 3SBDA 2A5YB 2BEUA 3ZWPA 1JVNA 4L27A 3BXXA 4OHWA 3AINA 3H11B 4NENB 3ROFA 4D3YA 1OC4A 2Q4RA 2JLWA 5I5GA 2IEDA 4D42A 1QLJA 4BATA 1WAMA 5AVYA 4DIDA 3NHSA 1HURA 2PXAA 4Y67A 4DTIA 3ZCSA 1R3DA 2PVPA 3AW9A 3MZ0A 1G42A 2OVBA 1OFVA 1XROA 2ZANA 1OI2A 3ICOA 3QLUC 4EPYA 1AMUA 3FBTA 5M29A 3NEYA 2IA5A 4LJSA 1U2SA 5AO9A 4M9SA 4DXHA 5C8ZA 2LCIA 4MUNA 5WRFA 1BC5A 221PA 4MZXA 3VC7A 4ZAXA 1OR8A 1AS0A 3WHPA 2FRVA 1F8GA 2I3ZA 3BIWA 4R7ZA 4UDOA 2CXUA 2YDYA 1J9ZA 1SU7A 1UC8A 3PDCA 2GLTA 4IKPA 4LK2A 3DWEX 1KI6A 3WLKX 4GOOD 1LQTA 3K1YA 1WD5A 1GG5A 5H81A 1U7XA 2AJBA 3ACBA 2P7IA 5ALTA 2CL6X 3UKJA 4U00A 1V2GA 1NC3A 4ID9A 4MR7A 4LXHA 4URZR 5GZ6A 2YWCA 4J2TA 4EUEA 1QWSA 4UPVA 5BYBA 1B3BA 3CXRA 1QV9A 5BXQC 3BSWA 3T3GA 3LOPA 1CDZA 2FUCA 1IMOA 2GJ9A 1LBSA 2OECA 2HIMA 2O0KA 4TXJA 2CVOA 3IDSA 2ONKA 1MRNA 2JGIA 3A28A 5BXYA 1XMSA 2IEAA 4RWEA 1T3ZA 1VCOA 4N5LA 3RS7A 3ZXYA 1RYBA 2A9RA 4BOYA 3QWFA 2P5UA 4N03A 4WLUA 1XZCA 2B7CA 4CJXA 3M5CA 5JCJD 3EOZA 3KSZO 5KOIA 3B1XA 3GVHA 4J1QA 6ADHA 2AQ8A 1QCDA 1DAMA 3PGVA 3JQ8B 1BCRB 1X8XA 4UEWA 3EDQA 3ZEAA 1JZSA 3DOCA 2BZSA 1QCCA 2CB0A 2ZUDA 1G63A 2ID8A 3MGGA 2B4TO 1WB6A 2IHJA 2M6SA 2Y1CA 2AOTB 3NDRA 4CMEA 4G26A 5H3LA 4I0WB 5AJZA 5J3JA 3GJ5A 1JUDA 1ZHOA 3KKQA 4IVPA 4L8LA 1M72A 3C1OA 4RK0A 1U3WA 1THGA 1MO5A 4JLKA 3A4YA 1R18A 3WR5A 3DUFB 1RE1A 5J63A 1JI0A 3JAWB 1DOAA 5BMVF 3GIWA 1E3JA 3DHEA 3IUSA 3JRNA 2V1XA 3V7UA 3FTPA 1ORHA 1ZVKA 1GNQA 3KB6A 4WESB 3WJAA 1I14A 4WFKA 3MGAA 2C03A 1A50B 2CHQA 2Q1YA 3TLCA 1GRNA 3FA2A 2ZIFA 1VYUA 1XXHE 4OV6B 3U48A 3D5EA 5HE9A 4GW3A 3EQZA 1E89A 4GDFA 1SXIA 1GUZA 4H1VA 3TZHA 4Z2YA 1PWZA 5B7NA 1U3FA 5HXAA 5CD1A 4D0RA 1YZVA 3EAFA 3L82B 4P31A 3D3WA 3UA4A 1HTWA 3IOYA 4D9EA 3O8OA 1WE2A 4B9EA 1S2DA 3KKKA 1DAGA 2OHJA 4B80A 1I3LA 4DILA 5K09A 4BASA 1LH0A 2F59A 3F97A 4L5YA 4TS1A 4WLEA 5ANRB 5CA0F 1DTWA 3O75A 4DM7A 4DSUA 2M98A 4QFBA 1EUCB 4G0YA 2Z58A 5HG0A 1VP3A 3UGQA 2D74A 4WQMA 1O97C 2FOXA 2VDWB 3OQJA 3O2QB 4IIVA 4P98A 3VI4B 3W9BA 3WWPA 2IPNA 3E2PA 3GRZA 1DE0A 5CFLA 4NRDA 4QUAA 2QG4A 5GM1A 3WKCA 4NX2A 4NATA 3SR3A 5GJBA 1YE5A 4Q3OA 5IT0A 3WWEA 1A5AB 3ZK8A 2W2XA 1GFIA 2JAPA 3P0EA 1V3VA 4ZVVA 4Y1GA 2OCKA 2C04A 3T5GA 1SOVA 1Z0IA 2UVPA 3I1JA 4MWGA 5T4HA 1PJ8A 1UXJA 2C2OA 3DHWC 4L4ZA 2YIVX 1K4YA 1UDXA 2C5GA 2QTAA 3ELDA 4HGYA 1U6JA 3TAHA 4D8WA 3EGIA 4ID3A 4MVJI 3ZNPA 2YY6A 1C80A 1UM8A 2GBLC 2ZJ5A 5BUSA 4MI6A 4PTLA 2MSLA 3CWZA 3IPAA 3RRMA 3U7QB 2ONYA 3HR4A 3CZQA 4U6SA 2V6FA 5CT4A 2JZNA 2XCLA 2WUEA 1MFZA 1Z4MA 3C2QA 2IP1A 2O0MA 4HGQA 4D6PA 2G77B 2H4XA 2F90A 1O87A 4ZQFA 1E0JA 3A6KA 3QPCA 1KEEB 4H08A 1U3DA 1XDBA 4IDBA 3UJNA 1N77A 4U63A 2RGCA 1G7RA 3U5TA 1E3SA 3CLHA 4V02A 1RXCA 1KP2A 1R64A 1VKNA 1XKQA 2WLTA 3P0FA 4U8HA 3DDSA 5JT1A 2FSSA 3GH3A 2I65A 5BURA 5KYYB 1S02A 4CCSA 1XCJA 3H4TA 3KE8A 4EGQA 4K1XA 5EWJA 1N3LA 2HR1A 4C0KA 5LLDA 4J0KA 2CXSA 1SY7A 1AZLA 1E58A 3RSFA 1EIWA 1JKXA 3CUTA 3EVDA 3R3ZA 3GJTA 1UAYA 2AS0A 4HG2A 4H1TA 4J03A 4D82A 1DT3A 2ID9A 3A37A 2E4ZA 4N47A 4FUQA 1NYTA 1PR9A 2WW8A 2DE0X 4M8LA 4DSZA 4FD2A 5IXSA 3BSFA 4N3GA 1TK3A 4HNHA 1EH5A 1E4EA 1YU6A 1G8MA 5JNLA 2P6RA 2O3SA 3I6QA 3ZLVA 2GM3A 4MRSA 1P4HA 3KWFA 2B7BA 4GXTA 4OX9B 1D03A 3NI2A 3NX4A 4IF6A 3OY7A 4XA8A 5TJ9A 2II6A 4E21A 2YHIA 3B20A 4G5SA 4ZWNA 4DQKA 5FWXA 4TUYA 2HDOA 2HUNA 4O2AA 1T1RA 3MCWA 4KO8A 4PX5A 1J7JA 1DEHA 2R85A 4O25A 4N3CA 1F8FA 1VGRA 3DAFA 3EZNA 3BEOA 4NOJA 4AJLA 3TLGA 5JNTA 2ZZMA 2N1MA 2ZQYA 2GN4A 5JZVA 4MV9A 2ZRDA 4I2NA 3JVEA 4E30A 3D2CA 3ISVA 1A7KA 2FK7A 1RWBA 3TG8A 1LLDA 1UKAA 1A9SA 3VFDA 3GX1A 3I2JA 5CX1A 3AI1A 4HVAA 1AGRA 5KOJA 5MN4A 3MJFA 5BOSB 2FU5C 2WKWA 3TUZC 1L7AA 3MCAA 5J5VA 3OCWA 3DMFA 2Z3WA 4FILA 4ZV4A 1ECJA 4QU9A 1E3TA 1S8FA 2VQFB 1U9IC 1P2TA 1K98A 4DLWA 3G2QA 2J7KA 4XUGB 3ZIUA 1Z7BA 2ZE5A 2IDKA 3S1AB 4CLEA 1U5AA 1F6WA 3B53X 5FJIA 3CTPA 4XWGA 3K16A 3UBTA 2VXBA 4XUEA 2IYLD 1FC0A 3B2NA 3F8WA 3FPAA 4H7EA 2ICAA 3LC0A 5U4XA 5LOVB 1IAVA 2FV8A 3QX8A 1IK6A 3IJEB 2HJ9A 4XWKA 2NACA 1RKQA 3W6UA 1CNFA 4KZKA 2H4HA 3G9TA 3HVUA 3W5HA 3HZOA 5D3MA 2O2XA 4KK3A 2VZEA 4NCXA 1ZCAA 4QUIA 4RFSB 3TAXA 4I1VA 5DCYA 2C9CA 1XP5A 4UZFA 3CLSC 2QUBA 2I4MA 4QYTA 3HB1A 2ARKA 3KOUA 3SC2B 1WP4A 1Y6QA 4P5EA 4W5TA 4ICIA 2QUHA 3BRCA 4QREA 5DM70 3M6FA 4CKCB 4A1OA 4KSYA 3BZUA 5JAOA 2BDUA 2JCSA 1KL7A 3F8TA 2Y92A 3ZJTA 3K0FB 3G5TA 4EI2A 2XVYA 4MMZB 3T7TA 2QZ4A 4YN3A 2A58A 4BB6A 1HWYA 2D00A 1V35A 3PJFA 4RYLA 4KAXA 3EFBA 3ELYA 1NN5A 3QBDA 5K99A 1EHIA 4RY0A 1ZK1A 4RSRA 1JAXA 2AN9A 1AU9A 1ZH8A 2QMOA 3RRZA 1SB8A 2WIJA 2ZI6A 3T99A 2X42A 3A2KA 3DHVA 5K5EA 2ID7A 3GAMA 3ZD9A 1E1DA 4B35A 5K01A 1M75A 2H4JA 3L1VA 1PR1A 2CSXA 3RAGA 5AVUA 1UQRA 4KK4A 3NUGA 3KUDA 4K9RA 2QWXA 1HKUA 3U6BA 4MPPA 1U65A 4WDQA 3CU5A 2GK7A 1EHCA 1XQ9A 4UTOA 2WY2D 4LKRA 1T9DA 1V5WA 1ZIDA 2ZUFA 5C8YA 1GAXA 5B2FA 2ENUA 3N2LA 2AA3A 4Y8VA 4CEJA 3N8NA 1G2QA 3IUNA 3OTQA 1U0HC 3DO6A 1A95A 3D8RA 4EPTA 1XZ8A 2M6RA 3KRTA 3MXOA 3E4CA 2O1SA 4KAAA 1XDSA 2F17A 2CVQA 4BMCA 1EDEA 4K03A 3KSAC 3HK2A 3ABZA 4O4JF 2FN7A 2DH6A 4RIIA 4Z4GA 3LY9A 1A77A 4UQPA 5ESXA 4E13A 3MQFA 1OB5A 1G6OA 2QYOA 3P52A 2C0QA 2EEZA 3HDYA 3WYGA 1FX1A 3EA5A 3OQPA 3IRVA 3KLNA 4LYHA 5KQSA 2B36A 4DR1B 5G40A 1Y6RA 2JDID 2YZ7A 4RHFA 2GLUA 3QVSA 2ZYWX 1MD9A 2J3HA 4B74A 1TM3E 1GPNA 1WUTA 3W5BA 4ML3A 3E03A 1M54A 1AKYA 1JG7A 1EAMA 2JRLA 3HCOA 1MO3A 3OJWA 4GI3A 3ZG6A 1DC5A 1W48A 4XIYA 5JOQA 3GRRA 3OURA 3K32A 2WP0A 4Y2HA 5AIAA 5DOVA 5JU6A 5JD3A 4PG5A 4Q6BA 2Z2XA 3G7SA 4QKQA 4L76A 2ZTMA 1HYBA 2GXAA 1TVEA 3MT0A 2ZJAA 4I66A 4C43A 1VMAA 2AOUB 3H65A 2XECA 2EKQA 1T8UA 3O93A 4MRMA 4RMJA 2PANA 4CKEB 2BFEA 3KYIB 3LRXA 1XPOA 2C0CA 4C78A 1NE7A 3KV3O 2L19A 3RQSA 3WLHA 5TPZA 1V48A 3BMOA 3WQRA 1U90A 5E0OA 3S2EA 2UUOA 4KL8S 1Y7HA 2FUG1 2ZLBA 3A3YA 4FLEA 4Q4HB 2HW8A 5ESWA 3BGVA 1N8TA 2O3UA 3RWBA 5KTKA 5HQ3A 2VIIA 1T9GS 3AUAA 1UL1X 2R25B 3AR8A 3KLBA 4OP3A 1OXTA 2P8SA 3R5FA 3QNMA 3RC3A 3PG5A 4FE3A 4AVYA 5U1PA 1EJ2A 3EXG1 1A76A 3AEKB 1QHGA 3A9CA 3EDYA 1E1RD 5DHAA 3EC1A 4NDAA 1Z2OX 4JUBA 1W1WA 1FJGB 4I19A 1W29A 4X62B 2ZWOA 5C7YA 5KWEA 3GLQA 1O95D 2A8YA 4OXXA 5HBGA 1BO6A 3QFRA 3HFJA 4Z9AA 3ACDA 3KXLA 4Q00A 3NWPA 1GPWB 5E9WA 2YMMA 2HYDA 3BFPA 2ODWA 3VPSA 5LPNA 3NIDB 2DR0A 2OAGA 3H11A 4GP7A 4NENA 1SU4A 2O07A 2PQ2A 3D3JA 3L3BA 2GS9A 3T7AA 5THXA 4PAMA 5ICGA 3DPUA 4JR2A 1ULUA 3WQSB 1TZJA 1HDEA 1THTA 4NYIR 4V3CA 5J4LA 2VHWA 1O5OA 2HWWA 3ZU3A 1OYVA 4P92A 1LXCA 1YO6A 2CNBA 2Q9CA 4JWKA 4W5JA 4BTVA 2C2YA 5B53A 1JF8A 3FGPA 3G9ZA 4HXYA 2LIPA 3INTA 3M9LA 3WTBA 4G25A 3RADC 2VS1A 3RSCA 2NSDA 1ZY2A 1GU0A 1IY9A 2R8RA 2Y1FA 2R00C 4PRZA 2BSQA 3K92A 3HMKA 2BTOA 1N0VC 2EGGA 2Y99A 2OA0A 4RTQA 3RNOA 5CB0A 2XCSB 3DMTA 3H84A 1MO6A 1ZBDA 4FBLA 3UYLA 3I42A 3S7ZA 1VJTA 4LOHA 1Q3HA 1E62A 5D51S 4Q4AB 1VE9A 2AR0A 4MO2A 3BIFA 4N8SA 3P71T 4WCVA 4YH1A 4DLSA 1GPMA 1PK8A 2Y1OA 4INOA 4ZRDA 2BMJA 3E5MA 3Q7EA 4TQUS 4AU1A 4TTPA 4CR6A 2R5WA 3M6XA 3Q9LA 2OYSA 1A5ZA 3P5SA 4GI7A 5K0GA 5J43A 3I9V6 4L16A 3MT9A 4DWOA 1XTJA 3STWA 3NTRA 1LSUA 5EP4A 3U26A 1VI6A 4KV9A 3THRA 1RQLA 2I2CA 7REQA 2GI4A 1E79D 1Q7EA 1GCGA 1TA4A 1TAHA 3WISA 5KOHB 5AICA 3OZTA 3DBIA 3UJBA 1U31A 3JQ8A 1BCRA 3BH0A 2QEQA 3EGCA 3K4PA 1FXSA 4EYEA 3SVLA 3U7EB 1O8CA 5JZBA 1HL3A 1QONA 2Y6UA 1YI0A 1DKUA 4DRXB 1T0JB 3HYCA 3I2IA 2AOTA 2DKOA 2H11A 4A6XA 4YMWA 5I9LA 4NULA 5ELMA 3TQHA 3DOJA 2NT4A 2BFAA 1W30A 4OLFA 4F7WA 1OIWA 3OP1A 4PLTA 1NNI1 2C2BA 4KQXA 2GVZC 2EHDA 4JLPA 4XUCA 1V4NA 4JP1A 1JPVA 1YKFA 3B1ZA 3V34A 4H3KB 1ESNA 3DUFA 3USES 4QOEA 2ILVA 4YJHB 5EIHA 5JFOA 5LUAA 1VB3A 3JAWA 3DCYA 3F8SA 2Q3BA 2XGJA 5JNSA 1XV5A 2QIPA 4JP3A 4PGFA 4BJ3A 3AVUA 1H6CA 1YVDA 1CCWA 4PX9A 1B4DA 3H6HA 2FVYA 1SZJG 1WDWB 2YY7A 4WESA 4EP1A 4QPDA 3JR3A 3K2QA 2QG6A 1OPRA 2ECOA 2J1LA 3HQ4O 3CUUA 4OKIA 2QTZA 2EQAA 3L7LA 4XEHA 5CDYA 2ORIA 4NKRA 4WCFB 5TQ0B 3RU3A 4FYKA 4GZLA 1OXBB 5DLPA 1D2EA 1ZGGA 2XMSA 4JJEA 1OXSC 1ORRA 4XWTA 1HUQA 2CCJA 3IP6A 3HZHA 4OMUA 2QN8A 3NPMA 4URWR 2IYNA 1JMYA 4F3YA 1ISFA 2IY8A 2A9PA 2GSWA 2JIZD 1E60A 4A0HA 3UTCA 1SBTA 3ZWVA 3TB6A 3LQ1A 4LMAA 4C6TB 1AKTA 1GG9A 4XCXA 1EE2A 2VQEB 4BE4A 2ZRLA 1O94A 5GINE 2RGGA 4G41A 1ZMRA 2GEKA 4NZNA 2KW5A 1EUCA 1Q5PA 1TYZA 4E2XA 2VDLB 2P11A 1XT6A 2VDWA 3GJ4A 4JC8A 4UEJA 4JH0A 5T5QA 4JBXA 2GWRA 1QOPB 3PXAA 4YI3A 4DV0B 1CQIB 1M0WA 4BNGA 3VHQA 1CDOA 4HTFB 2C4TA 4BZZA 5HMMA 3F2VA 3GGGA 5JZOA 4LY0A 1YVRA 2PWPA 3M7IA 3SP1A 4A0RA 1ZCZA 4PCUA 2EP7A 5F5XA 821PA 4EG6A 2I2FA 4GXNA 4KQKA 3WLOA 1KTIA 1UMKA 4IJWA 5AK3A 3CVOA 1CDEA 1EDZA 3BRSA 1Z5GA 1A9TA 4KQFA 4Y9RA 5AVSA 2WB2A 1PBTA 2KS6A 3B82A 3KQYA 4B3HA 3NUQA 5EUQB 2RI6A 4AG6A 1NY5A 2IYYA 5DNVA 5EESA 1GVHA 2A6PA 1QKKA 1QGDA 1SVSA 1OIVA 3C7KA 3FPEA 3G5UA 4LBVA 3U7QA 1PX0A 4LDPA 2L18A 3D8UA 3CS3A 4IEFB 2ZREA 4RHUA 2EF0A 3ZZ0A 4D46A 4F5ZA 3DS8A 3ROEA 4GRDA 4CPDA 5AIBA 3DYIA 4I5IA 2AWOA 3UC5A 1ZIOA 4TZTA 1M1UA 2DBRA 3H1GA 3QEMB 3M1LA 5BRAA 5AVKA 3G7NA 3GZTB 3CN7A 4CG2A 1KEEA 3HNOA 1HLPA 3AUXA 1IHUA 2B5OA 3QMVA 2OORC 3Q3CA 1Q22A 3QJYA 3U09A 4I5FA 1I0IA 4F85A 4YYZA 3C14C 1WW2A 5KYYA 1JLKA 1LBEA 2J5XA 2J6IA 4H1WA 3OZBA 2JLBA 3GAAA 1JIXA 5IJXA 3LYAA 1A96A 1DEXA 1M8JA 4IJ6A 1YKGA 3C3KA 4HQFA 4NEQA 3BRQA 4PYNA 4FHEA 1R8JA 1V7CA 1YU9A 4WLNA 4BWYA 4NCBA 1MC4A 3O9MA 3UQZA 4XFDA 1OKKD 1X42A 1Y1TA 4HL6A 1ZN9A 4XX0B 1PWXA 5A6VA 2J67A 2GUWA 3EXAA 5EL0A 1TFRA 4MA5A 1RPJA 5CM2Z 1Z4JA 1KVSA 4NICA 4Q16A 1Y6JA 3LQKA 3QBEA 2PL5A 2VQSA 3FBGA 4M9XA 4QBKA 1X3SA 1I2MA 2V1UA 3IESA 2IYTA 2IZZA 3GH1A 4LY3A 3RVRA 4BO6A 4JWTA 4CKYA 1VQ1A 1GO2A 3NVDA 1IFXA 1RQPA 3A70A 2FN3A 1E96A 5H3HA 2XRMA 3AEYA 1QFZA 4B7XA 1I3MA 3UY4A 3CF4A 1CUAA 3D59A 1LCIA 2JA2A 1N9GB 4GICA 2DB3A 3ROQA 3B12A 3CW9A 1QBGA 2QPTA 4RZ3A 5CCXA 1O9HA 2E4VA 2DYKA 2X7XA 4JQZA 3ZV6A 1KERA 5K0ZA 2WD8A 4U39A 1VTKA 4BGEA 2FJUA 3LX8A 3PLNA 3PHHA 5BOSA 5CTAA 1I2DA 1SKUA 4DIFA 1B16A 3RU7A 2RGUA 3L7BA 4UTZA 1GU1A 4JNKA 1E4OA 4NY1A 4FP9A 4Z1MA 4PZEA 3UJDA 4BMSA 1JPUA 1E6EA 3WWYA 5BQXA 3SVTA 1E9FA 2Q1SA 1MX1A 3S1AA 4UOZA 4B84A 5JPIA 2O6LA 4QYWA 4DE5A 2P9FA 2IDZA 4YRPA 3VPBA 4DLAA 2FEWB 3RSSA 4TYNA 3H05A 2GHRA 4QARA 3C3DA 1EFRA 1CYDA 1T26A 1VL6A 3GPIA 4D4JA 2XRYA 3ZHTA 4JVLA 5LOVA 3D6JA 1H0KA 1P2UA 4YJDA 4EUFA 4JROA 2LW7A 4BVBA 3COVA 2CKMA 4OXYA 3KZNA 1J97A 5BR7A 3TRHA 1T4MA 4D02A 1OH5A 1R6VA 1ZXXA 5A0TA 1Y98A 1NN0A 5DNDA 1NBMA 1Y9DA 5DWDA 1K86A 1XTTA 3E7FA 2DR2A 1ENPA 2V8OA 1P80A 1S3SA 2V97A 2WD9A 3CH4B 3E1KA 3SDZA 4RFSA 3OEYA 5BO5A 3NGXA 1TYEB 2IUEA 5ALPA 3GL9A 2FVXA 1P4AA 2LXNA 5BOVA 2BOVA 2GVDC 4YRLA 2CE7A 3SC2A 3TDKA 4MVJE 5HSGA 3BGSA 3IRUA 2RK4A 2WWRA 1ZQ1A 4WT7A 5EP1A 4YRSA 1MHTA 3SYMA 2HPZA 4KXUA 4CKCA 2GZMA 2BI4A 1KIFA 4TLBA 1EX9A 5F7ZA 3QU4A 3K0FA 1U04A 5A9TA 4JXJA 2HWKA 4YAFA 5FLEX 3SYNA 3KAQA 1R8SA 3DE1X 4LZZA 1BWPA 3WWDA 2D1QA 2DOKA 3EPJA 4GZ6A 1D6NA 4B40A 5IM4F 2ZBGA 4AP5A 4AMBA 4JHLA 1FYVA 1SOWA 3M82A 2SNIE 3RIMA 3JCZA 3DJYA 2FHSA 4FNMA 4OHYA 1SD2A 9MHTA 3OZVA 5IJ0B 2JCXA 3ZZTA 1BH2A 2XAUA 1YRYE 1FP6A 3FPGA 1VZ3A 2CVFA 3PQEA 3YASA 3CZPA 5FH9A 3IUBA 4C6RA 4NFYA 4OHOA 4FNGA 4BECA 2EP8A 1RE0A 2RAPA 1HEIA 3HFGA 5EE0A 3ZJ4A 1QO0A 2DLNA 4FGLA 5DSXA 4EEZA 1G66A 1ZU5A 3INGA 4FR0A 3H99A 3MUEA 3ERCA 3ESBA 3EG9B 1R10A 3IV6A 4WLOA 3U2QA 4CFYA 5C1PA 2I5PO 3TLZA 4AULA 3GLGE 2VNKA 3MJCA 3FKJA 1VG1A 1WMFA 4NCIA 3R0ZA 1UJ4A 2WSBA 3DH0A 1F2DA 2HRZA 3ONWA 3T3IA 3L4KA 4FDTA 1TB4A 3LBAA 5TSDA 4QBIA 4XVHA 5JISA 5IH7A 2BVNA 3F90A 4RZXA 5EE5B 3S2ZA 1I7DA 1NNLA 3AEUB 4ZTBA 1ZMXA 1LLUA 2Z57A 1LW6E 3KFLA 3TKYA 4E2WA 1W8IA 3L1JA 1CRPA 3L0BA 4BX9A 3ZVKA 1FK8A 1VLZA 1C1YA 3G2IA 2ZB4A 1II8B 3BK1A 4OYHA 5K0LA 4AS2A 4DCJA 1CFZA 3NOXA 4HRAA 1GRRA 5IJWA 5JXHA 3EVEA 1J2RA 3PGKA 1QDLB 3W77A 4ZKEA 4CG1A 3CX8A 4EVSA 1KQOA 3CVUA 1GZ6A 2XXAB 4IZ6A 4JLNA 1A27A 1Z8NA 4IFTA 2WTEA 4BC0A 3O0TA 2E7ZA 2XB6A 1VMEA 1HDGO 3QY9A 1ISJA 4LNUB 2J59A 5CURA 5K6AA 3KB1A 2BY4A 4NMLA 3QVWA 2M6LA 3IBGA 2VJOA 4UVEA 4B3FX 2XUGA 2E85A 5DNAA 3M34A 1UQUA 3ZUPA 1NP6A 3UK6A 4L74A 4ETWA 2PCLA 1XO1A 1P6QA 3OZIA 1BS9A 1DEAA 3AJ9A 3G0HA 1U98A 2AOUA 1YXMA 3ZGXA 3S4YA 4CKEA 2IPOA 1IXKA 3M3DA 2VC2B 5LP6C 1DO2A 2UZ0A 1RHKA 3BGIA 3GFRA 1ADFA 1KVQA 4J4HA 3BIXA 3NT4A 3NB0A 1V96A 4JX9A 5K8UA 1CG6A 4WFIA 2JJQA 2GOYA 2JGLA 4GOXA 4KIUA 4Q4HA 2FUNB 3PL5A 4R1LA 4RM3A 1DDIA 3T7IA 2ONZA 1OYOA 4QT4A 1I51A 1RAHA 4OOEA 1J2YA 4HH4A 4LPSA 2CLLB 4A5SA 4NE2A 4UM5A 2Q1UA 3HLTA 1NX9A 2XLCA 2NZUG 2PH1A 2VEOA 1PR6A 1I1QB 1BIFA 3LT0A 1Q2XA 4MYRA 1NDHA 3KQSA 1RAEA 1G5QA 3E7DA 3AEKA 4KACA 3TTYA 1CUSA 3ETGA 3JWEA 4FDVA 2PSDA 4I55F 3NXKA 2BWJA 4UM9D 4I9HA 2C9ZA 4P0QB 2Z43A 4CF7A 2C5BA 3PYLA 2C54A 4P2BA 1ZEJA 4UHFA 2HMTA 1PW5A 1YS6A 3PGJA 4JX8A 4EB0A 3ER8A 1LPOA 3BE8A 3BFXA 5AKYA 2WJPA 1SHTX 2RHMA 1AKUA 1JKFA 3KHKA 4NU8X 3RC7A 3W6PA 1JGTA 2XB2A 5B1SA 2H16A 2XUDA 3QKUA 4OXKA 3A6JA 3T8YA 1U0BB 2I0FA 1U0RA 4Q37A 1SVLA 3PFNA 3HJNA 5CITA 4JOQA 4L4UA 2PUFA 3UXEA 2COEA 3IKMB 3N2KB 5LZ8A 2O7VA 4NG5A 4AJ1A 3SY8A 4HJRA 1OD6A 3H17A 3IUQA 4H2DA 1YQTA 3R7LA 3UIEA 1PLKA 3B70A 2VKQA 2H7CA 2X5JO 4B7UA 1SQGA 2YH2A 2AQKA 2R7AA 3UT5B 5KHAA 4OFWA 4D9NA 3NBFA 3IPRA 2XAAA 3QYFA 2P69A 1Y37A 2AFIB 3HDGA 3OFVA 1C0IA 4KSBA 3IDAA 2IS4A 3E1SA 5BQOA 4AUEA 4WZAE 5D86A 4E1BA 2EQBA 5FBLB 1H0HA 1BH6A 4MGYR 4JV5B 4HBGA 1CY0A 1H6AA 1YZNA 5CVVA 1F0PA 1CJBA 1FLNA 1U4SA 5JJLA 2PR7A 2DGDA 1YVEI 1KAEA 3WFZA 4QVKA 4COOA 3KFXA 4Q4AA 4EBFA 2WIAA 1IATA 3D31A 4YWJA 3TL3A 4C88A 1Z0SA 3L4EA 4HT3B 2YVQA 4W5WA 3RK1A 2H52A 4DCVA 1JHPA 4Y6QA 1U2TA 4LWQA 2B5WA 3PEEA 4PO8A 4YJ2A 1JA0A 3NV9A 1HE3A 1NQOA 3F7MA 1B6GA 1I4TD 1IB0A 1OU0A 2ZI9A 4G37A 4GM1A 4YACA 1PE0A 4GR5A 4EB8A 2AZTA 1TEZA 4EA6A 3UJ3X 2JVIA 1XZKA 2C1EA 2HT6A 3HBLA 4JBNA 3OFJA 2OG2A 1KAOA 4KGXA 4XIGS 3V9PA 4DWVA 2XUHA 5KOHA 1OTHA 4YV2A 1QTRA 4U7DA 1S5PA 2QP4A 2Z6VA 4MOWA 1OBHA 2IQ5A 4J7AA 3WJ7A 5C8DA 1UM9B 4MKRA 2WC1A 3IE2A 4DRXA 1DMRA 4TT3A 1CDDA 1UF9A 2EFGA 2PKRA 4NSNA 1HDYA 3PB3A 4PZZA 1WO8A 1LNSA 2VFAA 1JDBC 1PJLA 1D6MA 4QPPA 2ZPAA 1BAPA 4HDSB 4HV4A 3VDXA 5DGHA 1E2DA 3E61A 4Z7QB 1E3LA 2V0CA 1C81A 4PZ9A 5B7PA 4DR4B 4YJHA 2RB5A 3K05A 4KQMA 3QLUA 1U1CA 1Q0UA 2I2WA 2J0SA 2RGRA 1DUSA 2WUGA 2F3RA 3WB9A 1U8TA 4A03A 3L7JA 3FHCB 4TYPA 4AY4A 4RHTA 3NQ41 1Q15A 4PHFA 2I62A 2QUJA 3F4LA 3X2SA 5P8WA 4ES6A 1WM1A 1FB5A 1T0HB 2JGJA 1UK8A 2ZE7A 1RPAA 2GDJA 1GA4A 2QRUA 2Q50A 4KQ1A 4YDSA 4CMEC 5CFRA 1KNXA 4A36A 2IIBA 2LZ0A 4UVGA 4DPLA 1VHJA 2WWFA 3BHNA 4WCFA 5TQ0A 3WYCA 1YB2A 4YQYA 4E46A 2V7XA 5A04A 4IV8A 4QYXA 1ZINA 3V32A 4IYRA 3QRWA 3VR4A 1VP9A 5J4VA 2C5SA 3UN1A 2QW0X 4TROA 4FW8A 3OPMA 1DC4A 4JJ6A 4H77A 4MAAA 1YE8A 3W3AA 3TE7A 4GEGA 3LHSA 4GMXA 1UK6A 3DFZA 3USCS 4YRTA 4C6TA 2N1BA 4DR5B 2C9OA 4UJ3A 4BWGA 3PYMA 1W75A 2AUTA 3IT1A 4XLTA 1KR5A 3KAPA 3KKZA 2RJOA 4G8JA 5JJCA 5LR6A 5GONB 1MC5A 2VO1A 4IXWA 1U0TA 4M1OA 4OI4A 2VP3A 4I1YA 3IAUA 2P3LA 3GHYA 4JC4A 3ZK7A 5IJ9B 1MX5A 1P7CA 1NHGA 2ATXA 4MV4A 3VZSA 4F04A 4W5NA 4E31A 1CQIA 3V2IA 2LUOA 4PG4A 4YAOA 3LD9A 4HTFA 4TSRA 1VCNA 1YR9A 4FONA 1TA9A 1DEOA 1T1IA 1XQWA 2XMQA 3FOCA 1V8FA 1PN3A 3JPWA 5AYVA 4TRRA 2M1ZA 5T3YA 5F4BA 2YYYA 4MJ3A 4WGGA 4KWHA 1OQAA 3T7JA 2G06A 3KEFA 3RVNA 3IT0A 4L50A 2DEUA 1TM1E 2I3AA 2PAAA 3R41A 5DW3A 4EZEA 2VZ0A 4AFNA 1TVKB 2XB4A 2QW1A 3Q9NA 3FM9A 4P5DA 1J90A 3KR0A 3VR6D 1TK2A 3ASVA 3MRXA 4Z4CA 4I81A 1ML4A 2FWIA 1UUFA 2K87A 2C4MA 2ZETA 5KWVA 3JX9A 1OJ7A 1TO6A 2PWYA 3KU4A 3R9XA 3P2MA 5I5EA 1RXWA 1TW3A 3OQIB 2VSOA 3W6OA 1P5JA 3PWTA 2JIOA 3K5IA 4O2BB 3TW6A 4DA7A 5JTTA 3A4VA 3WOHA 1JIUA 1W73A 4HKTA 4TTVA 1MEEA 1QPGA 3QEMA 4IO0A 3ZWAA 5BP7A 5I4CA 3NH6A 5BNWA 4FNOA 2PX8A 3WNZA 2VATA 4ZDJA 1EGHA 3I2KA 3UHJA 3F2IA 4LBYA 5JRZA 2FGKA 3OO0A 1I9GA 1DBRA 4QGFA 5IANA 4XPIB 3E81A 3ZDDA 4E14A 1E3WB 3BTOA 2BFDB 3LPCA 3VO2A 4DB2A 2W2KB 3E0XA 4DHWA 3ZXXA 4J2HA 5IS2A 1TPZA 4PYIA 4ODIA 4KFTA 3MSCA 2VQ6A 5HFAA 5JD6A 1EDBA 1C1XB 1IN6A 2PS3A 1Z28A 3MB8A 1JWLA 2AFHB 3SCZA 1FQOA 4U7WA 1SUBA 1RKBA 2RMKA 3QWAA 4XX0A 4LV8B 4WIAA 1ADBA 3TINA 1BE8A 1YUNA 1D2RA 2BEKA 1EVEA 2PLAA 3PT5A 3RRJA 2VEDA 1LY1A 3AGQA 4LHEA 3ZCVA 2P30A 3KXIA 5PGMA 4EYQA 4Z7NB 4L1KA 1I6WA 5AVVA 4CLXA 3E18A 3TIFA 3WIUA 2X7JA 4EPXA 2BYTA 3FLEA 1M1YE 2VT7A 4YRNA 4LBZA 3AHIA 3HXPA 4UASA 2ZR7A 3NH9A 3O83A 3GWZA 1VSVA 3AG6A 3L01A 4FZRA 1E2KA 3B7WA 1DKLA 5BSTA 4FMPA 2I67A 4OHKA 5IZCC 4TZKA 2FPOA 3VVCA 1K3FA 3ZY3A 4FJ2A 1N9GA 4AT1A 3DLHA 2FWMX 4TL8A 3HE3A 3AP2A 1G5RA 4QATA 5IDVA 2OBNA 4QGHA 3LC1O 3TTTA 1M33A 3V4SA 2P5TB 5CFZA 3SZMA 5CGQB 2DFLA 1YK1A 1JSLA 2XT0A 5LZ9A 4YAKA 3LX6A 10MHA 1V8DA 1R27A 4CMHA 2GBLA 4BMPB 5TS2A 4QAQA 1C7IA 2WJIA 1R6XA 1T91A 2I22A 3K2BA 3KQWA 5A05A 2AFVA 4X1IB 3V2UA 3LKBA 4C2AA 1AXEA 3JQBC 2REQB 3D3EA 4AF8A 3KT0A 1RQRA 2LKCA 2GCEA 1Q17A 2XV1A 1FTQA 4DSNA 1QDUA 1VRCA 2UDPA 1FU4A 3A9WA 5FUMA 3TTWA 2YIJA 4J43A 5IFKA 4QXQA 2ZTSA 2WIDA 2QQ0A 4MV8A 5FPTA 3FN4A 3T5CA 3O95A 1OOEA 1OT3A 1VBMA 3FWHA 3X1DA 4CVNA 1CU1A 5CT6A 5KYUB 3CINA 5D5HA 4KBYA 3BREA 3KSMA 5SYAA 2R4UA 4I6EA 2PXCA 2VLIA 3VOAA 2JW5A 1O57A 3E22B 2WQ7A 4TUYF 4EX7A 1VYTA 4O2AF 1WDLA 4Q34A 2PGLA 3RUIA 3M4XA 3R7DA 1E6UA 1Y34E 2I4TA 4Y2SA 4P22A 1QB8A 3NFYA 3TSZA 3UK0A 4DMLA 5JFTA 4JL8A 3WFIA 1WW3A 3C6QA 4UREA 1DG9A 1X1DA 3CT4A 5JMWA 2FZVA 1YRHA 4PIVA 2QN6A 1KZ7B 2CLDX 3IQIX 1M73E 3QWIA 4IILA 4C4YA 4PVDA 2NT3A 1OVMA 1CJCA 4JSTA 2OPHA 1O0BA 3R77A 3IUEA 1ZD4A 2J9XB 3DHYA 3UV3A 5FWXB 2VDKB 3DWIA 1HFWA 3DQPA 2PUBA 5FORA 1WEHA 1S2OA 1SUFA 1ZN7A 4ALMA 1SQ5A 4DADA 3OFND 3F6RA 4Q1DA 2OAQ1 3AUKA 1KBOA 5FADA 1UOOA 1EZ1A 3MILA 4FYHA 4JB3A 2NQ8A 4JKIA 4MV6A 5E9QA 4E2YA 2QE7D 1C3XA 4US2R 4RL4A 1Q16A 5IJ0A 2J0UB 4CDMA 1EMDA 4AJKA 1ATIA 4Q47A 4PVCA 1NKVA 1AZSC 2FB9A 2YMPA 4MVJH 2ZKIA 1DBIA 4IMPA 4WKNA 2DQ4A 1SN7A 4D8UA 2G7MC 4W5OA 5HKKA 3RG2A 1Q2UA 2PS1A 2FEXA 4XR9A 3L6UA 3PXDA 5J5CA 1WXQA 4CL3A 1JAYA 1UFKA 2BBSA 3T95A 4BFZA 4QEDA 4R5HA 3ZXSA 4X84A 1XMOB 3AFIA 1B8VA 1FUKA 1NBIA 2GK4A 3EG9A 3GCDA 3EF0A 5I9BA 4COKA 2EFCB 5CFNA 1PLJA 2FY8A 3BOSA 5ITWA 2XCTB 4RE6A 4XDZA 1GA1A 3ZVNA 3HA7A 4OL0A 4HEA6 3M6WA 4UUBA 2YJ4A 2BBTA 1XZGA 3CLRC 3A1DA 2XZDA 1OMOA 3DULA 1FVHA 4WZBB 1TKBA 1U80A 3ZDFA 4ZVQA 3AEUA 1DIAA 1HT0A 1P75A 2CK3D 4FCWA 2NZWA 4F2PA 1FIUA 4YQFA 5CCDA 1OWLA 2MMCA 2WKPA 3NKFA 3NIGB 1AHPA 3RIHA 2Z30A 3J80A 3EBLA 3QK7A 1II8A 4Q24A 2RONA 2VLBA 2ERYA 4R05A 2AEEA 1GFWA 5DLDA 4LSWA 1K4MA 2QN2A 3OU2A 4OQEA 1LNQA 4Q21A 1YBHA 2VTKA 2XVZA 4OJQA 2HHHB 1MP0A 2XXAA 3QVJA 1M74A 1CEQA 1BOFA 2J3IA 3LUBA 1D2NA 2PXHA 1KK2A 2XTJA 4YUVA 1MOSA 1N6NA 4LNUA 5BNZA 5EYPB 1WU7A 4PBSA 3HCFA 2ACWA 2K6GA 2O3TA 5EKDA 2I80A 3DMRA 5JAHA 1PNTA 1FZQA 4D4IA 4YRKA 4MDEA 1QORA 1GHTA 2WT8A 1VJCA 1F51E 2X0NA 1VCIA 4KWIA 3BJIC 4UUAA 4M54A 4OMDA 3VPHA 2UYHA 1YR8A 1JZQA 3G0GA 3ONEA 2YZMA 3N2YA 1OU4A 3DDHA 2FR8C 3R23A 1XL1A 3R7SA 4DCUA 5CB4B 1I2CA 5C8YF 4PICA 2IEYA 3NMUF 5EQJB 3CRRA 4ARCA 1DBVO 2VWQA 4CM5A 4MINA 2QX8A 4ROSA 2RD2A 1GCOA 1X8LA 1EA7A 1YC5A 2DECA 3A31A 4TXLA 1YJ5A 4IDNA 1PL6A 1RJWA 2YFHA 1BROA 4UFOA 1Z17A 5JLAA 1ZCBA 1KYYA 3GPBA 3OBBA 1ABBA 3RO7A 1ZD1A 4DV6B 2WRZA 4XI9A 5K0BA 4WUVA 2ZBQA 3A27A 2BM0A 4XGKA 2VPYA 1XA3A 4MS3B 1PJSA 3A58B 4C22A 5IT9A 1JQ5A 2AW3A 1YZ3A 4X6LA 4Q9IA 2QRJA 2YV3A 3EBPA 4HXGA 1OYWA 2FUG6 3EVBA 1YQXA 3VXKA 2PA3A 3QJGA 2REOA 4FC7A 4IIJB 4B85A 1FFWA 4MLDA 4C7KA 1VG8A 2QMUA 3MWYW 4U4AA 1J0EA 4ZVNA 1SELA 3ZWQA 3DEFA 1QP7A 3TWOA 3GLIB 2ODAA 4BWVA 4YT4A 4QOJA 1ADGA 3AM3A 5LD2C 3MT7A 2NX2A 2IOHA 4JLMA 3T3MB 4BNHA 4JI2B 5HIJA 1RXSA 3GRCA 2AXQA 2NO7A 4RQUA 1Z18A 4W1PA 5JTUA 1D4FA 3GQBB 2ZUEA 4U7FA 3I37X 4KWTA 2EZ9A 5F78A 2LP4Y 1Z07A 5TC4A 5EJ9A 1WETA 2WHPB 2PG3A 3A6LA 4CL0A 2QA5A 1X15A 2RBKA 3H4VA 1JRLA 4N7BA 1J8YF 4G4SP 3OVMA 4JI8B 3TLXA 1HFEL 3O4VA 3BB3A 1LRJA 1VJRA 3N2KA 4YCAA 4DSAA 3ZBUA 1G3RA 3OFSA 3AHHA 3WDLA 5ES4B 5EVJA 3FPJA 3LBIA 4DVJA 1D1TA 2I1LA 4NTZA 3TFQA 1NPDA 4YAWA 1OGIA 4HSGA 2J3MA 3AVVA 3UT5A 4I36A 3FIUA 1E2BA 1P1HA 1RM4A 2AFIA 2VSQA 4MR8B 4BP1A 4UU1A 2O8VA 4RC9A 4WRRA 1W96A 2Z2YA 3WHLA 4XR4A 1TL7C 1P72A 1E64A 1UQTA 3B38A 5AJVB 1ZEMA 3V1YA 5A06A 3JYLA 4HMOA 5HJ7A 5KJEA 1KK1A 1QOQB 3FNQA 4KYIB 2QR5A 1NJ8A 3FOAA 3K73O 2O6HA 1UDRA 3UB2A 4UQLA 2D59A 3ADCA 4BMOB 3P20A 1OT5A 4JLBA 3ZJYA 1P44A 1Q1QA 3G1UA 3JYOA 5KYGA 3ABIA 1J70A 4R1NA 4HAXA 3PUYA 2WPDA 4YUYA 1EBFA 4ZIRB 3FGOA 4R8KA 3AW8A 1EVYA 4S1PA 3WK4A 5AW4A 5H3CA 3MLAA 4LF6B 4JC0A 4PR3A 2TRSB 3C7DB 3I0ZA 4PLGA 2HK9A 1D2HA 4G81A 1FMCA 1QR6A 4FCVA 1DCFA 4HVTA 1KXZA 2OHFA 4RS3A 5D6NA 1IJEA 3FTDA 1EBUA 3GT7A 4A23A 4EFNA 5DTMA 3O8DA 4M0MA 2EQ5A 1UM9A 2JHFA 2XUPA 2Z2IA 1IZ7A 2G04A 3DAPA 3ONNA 4QBTA 1BU5A 3K0BA 4HB3A 3P9KA 4TWZA 5K4HA 2D3WA 1PSWA 3ZDCA 2RJ3A 4GG1A 3VTFA 1SCQA 2JFGA 3T52A 4YMHA 2G1KA 3KDPA 3QW4B 3WKDA 1MOPA 2ONCA 3IURA 4HDSA 4KZPA 4RDIA 1P29A 2VZ8A 2W37A 3PPVA 4LGMA 2WNSA 4XEUA 3SVZA 5KPJA 4L78A 3U81A 1GL9B 1R8QA 4RQBA 1JNYA 1EP1B 1XTIA 4QJIA 5H8WA 1T9CA 1MORA 3ZTYA 2CLKB 1K08A 3PA8A 2R79A 2XDAA 2FJPA 5ECDA 3MCZA 4UE2A 4UHJA 4ZALA 4DZTA 1OBFO 1XMPA 4NAUA 1E61A 1YONA 2QLNA 5FL7A 1L8AA 4BYMA 1YGPA 4ENTA 5G02A 4GAEA 1PR3A 4EJFA 3DAHA 1J8FA 5DYNA 3O3OB 4C4TA 3DLPX 3S44A 5KPDA 4MARA 2J6HA 3N0RA 4UUMA 4WFQA 1KO5A 5LYYA 1MDBA 4R40A 4ECAA 3WYNA 1XLTC 1O58A 2R00A 1IN4A 4HH3C 4E70A 4J1NA 4M22A 3O4GA 1R0ZA 5CBKA 1YFLA 1IN1A 3G82C 3QE9Y 3NWOA 3KVVA 3I04M 4RLSA 3SC4A 3ZOZA 4D4HA 1E2EA 3MOIA 2JIRA 4YECA 3W2GA 3BULA 3HPRA 4J0JA 4JI4B 1G8SA 3MLBA 4M7WA 4P33A 4ZI7B 5FA6A 4WSOA 2JEOA 2FZCA 5KTMA 4B73A 2H7YA 2JFFA 4XB2A 5GONA 4OFXA 1E2GA 3STXA 4KXLA 1HLFA 3PSAA 2B98A 2RHBA 5E1MA 4F1WA 1E59A 2C2WA 1O3YA 5IJ9A 3QFTA 5DYIA 2OWDA 3ZH9B 3AWIA 1YCGA 4TLCA 3U13A 1PWEA 4OX9Y 1AHNA 3K0AB 2QMQA 3GAZA 3L7DA 5BW6B 4PTZA 4O8CA 3UNXA 1AE1A 3TSAA 4CMKA 1V3TA 4UOEA 5ICCA 5ILGA 1VBNA 3R5JA 2G5TA 1KJ9A 2YXPX 2ZDQA 1XRRA 4FYVA 2ZSEA 4I4NA 1JFFB 1JDBB 4X8LA 3T6KA 4ZHQB 2BKVA 2LRHA 1TVKA 1CZOA 3UFXB 4LDAA 3VU3A 4QG7A 4Q3BA 5GIPE 1TA0A 4YS6A 2JGKA 1VHDA 4BEVA 3W8NA 1LPBB 5CNIA 2X9QA 4FK8A 3HU3A 1SC1A 2GJKA 3QIAA 4OQDA 4XGIA 1I1OA 5G0WA 4WD3A 3OQIA 3FJYA 1NVVQ 1PTJC 4ARAA 3PXEA 4O2BA 5BQFA 3QXCA 3SR4A 2RSLA 1SHZA 1R4AA 3AL3A 3NJRA 3SLGA 5MN5A 4FSDA 4ZZ0A 2QRMA 4UC0A 1V9CA 3AR4A 3FSRA 1FW6A 3FW1A 1P4GA 2GNOA 1JDSA 4CUKA 5CIQA 3WLEA 2EBFX 4XPIA 4FHCA 2AKAB 1E3WA 2X41A 2BFDA 2P27A 3GJ6A 4JGBA 2W2KA 4TRJA 3EISA 2BJVA 2Q07A 3L7MA 4EF6A 3VR1A 1Z37A 1U0JA 2YJ5A 3R1IA 3RJ5A 3IP9A 3O47A 3V3TA 1YDFA 4LWPA 4KR3A 1C1XA 1WS6A 3QHAA 2ODEA 2W8BB 1QIDA 1N57A 1QWOA 5T4EA 1TZCA 3TS1A 2AFHA 3O82A 2BJHA 4ZQBA 3KQNA 4OQPA 3SC6A 3QVLA 4F2DA 2WDPA 1II9A 5EG5A 5FFNA 2Z9BA 4PGMA 2FRDA 2LPMA 3IQXA 4FLMA 5A3QA 4K28A 4YMUA 1IM5A 1GNLA 1W0CA 1QR2A 2ZRAA 2OV4A 2ZI4A 3FD8A 2XITA 4I7EA 3ND5A 3I6IA 3BYZA 1Z2CA 3R9IA 2J4DA 2QL6A 3EUFA 5J2UB 3HP7A 1YTUA 2CMDA 2IITA 3ZCPA 4IGAA 3WYAA 3ISJA 2PGOA 5CEJA 4DV3B 3DMGA 1XPRA 1KKLA 5NLLA 1KYVA 9GPBA 1Y5NA 1ZGCA 4AP9A 1JE1A 5KNDH 3ESAA 4EZIA 5TPZD 1PNQA 4LQDA 2G9QA 3H1EA 1PV4A 4NR0A 5KNBH 2H8GA 2JCGA 4BVHA 2GAJA 4JT4A 3EZ2A 1EFTA 3V8VA 3SYRA 2GUGA 3G1WA 2FQQA 4DN6A 1FUYB 3FNBA 4MP8A 1BMFA 1BXKA 1LFDB 4EJMA 2PZFA 2W2VA 1L8XA 2HT1A 4X1IA 3BRWA 1XYVA 2GPBA 1BXGB 1XZEA 2GRUA 1E0AA 4YRRA 3TM5A 2REQA 2YS7A 4US0R 1UEIA 4I50F 2ZR9A 3RK4A 2P67A 4QUEA 4A92A 4DIOA 1A5TA 3AEQA 4JJGA 3WX0A 4L85A 3F4BA 5E2IA 5LZ7A 1GCIA 5F7OA 2X2FA 2PH5A 2YHUA 3K0CA 4TL7A 5DZSA 4MK4A 3LA8A 2C77A 3DBLB 1FTNA 1FVFA 4K6MA 3V8MA 2BL4A 1K89A 5KYUA 1BGVA 1TUGA 3NS7A 1OBCA 3IX7A 2JFNA 1NMZA 2BCJQ 4IDCA 5E2AA 1GIAA 1UP4A 3VAYA 3ZHXA 3ZOKA 1QOZA 4RIEA 3E22A 4K81B 3ABOB 4E88A 3AP3A 3KKNA 4XE5A 2HUPA 4KXWA 3P2IA 2GMWA 4W7IA 3STVA 1NNEA 3AVWA 4ZVKA 3WDSA 1ZJ6A 1RTKA 1V6AA 2Q3EA 4ALKA 3K31A 2ACEA 5DBHX 2OMKA 1IRXA 2PLNA 2Q3MA 3G49A 1T2UA 4RKWA 3OQOA 1PZHA 1B7GO 5T4BA 2BF4A 1K3TA 2BRUA 3WIVA 3N2GB 1MVNA 3E5HA 3DM9B 3VJRA 3GJ3A 1Z39A 1E3QA 1ULHA 1RS0A 2OMEA 3DDNA 3D02A 3E84A 3JZDA 4FYPA 1G5IA 3TH5A 4BLUA 2P75A 3IQHX 1ZN2A 2NUPB 4LHXA 4DIEA 3GEMA 3E6AA 1MO2A 1VCHA 3RVBA 5KNCD 4JJFA 1GKUB 2ZM5A 1MQ8B 1HXHA 2QZZA 2R2AA 4XGNA 2W0MA 3R40A 4EO4A 2W2QA 5LU8A 4NZ9A 4X54A 2NTEA 3M2TA 3W2HA 1FSSA 2BGTA 4RZHA 1HZJA 1Z6TA 1SCJA 2J0UA 2YWEA 3VVBA 2XLBA 4KN9S 2CLCX 4X7PA 4BKMA 2RAFA 3O8BA 2Z9DA 5BV7A 4JJIA 3FNFA 1HORA 4OBBA 5BQ5A 1IBKB 1RM3A 4A0GA 4ERNA 3R8FA 4RFVA 2ETXA 3B6MA 4OF4A 4RD1A 2C7BA 1HFKA 3AZOA 421PA 5LIRA 3OFKA 1Z0JA 5CT9A 3M89A 1N4AA 3NYQA 1L4KA 3AG5A 4XVQA 4J7UA 3FTNA 4FN4A 2JI8A 1A9ZA 4PLZA 4UPDA 3RFXA 2E55A 4RTJA 2RARA 3D2AA 1ZDMA 1VGQA 2NV2B 3GRUA 1R0WA 2WJJA 4BRZA 1V95A 1GZDA 4XQ0A 5DT2A 3SOZA 3T94A 1PS0A 3BB1A 4WZBA 4IXTA 4F60A 2PZBA 4NS4A 3KQVA 1NRXA 5H7XA 1IC6A 1FXUA 3JVUA 5CCEA 1VJGA 3TKLA 1XKXA 4HX9A 4JR1A 4C20A 2YV2A 3J81k 1E99A 2AC4A 1YSCA 1Z45A 2JI7A 4W1RA 2AJTA 4A6EA 2DFVA 5B6IA 4KUHA 4RHYA 3H4IA 1EA5A 4EEKA 4EF4A 3N87A 5AM2A 1GTRA 1XYYA 2BD0A 2OHHA 3ON5A 4KGDA 3HB9A 4Q03A 2H0AA 4TS4A 2WWGA 4RH3A 3D5QA 5F1KA 4NZPA 5TMDA 3UICA 3WZLA 3ITKA 3PRJA 4M1WA 1Q0QA 1P2SA 4PU0A 3KO8A 1R6DA 1YI8A 2G40A 5HX7A 1E1QD 2JK0A 5FFMA 3H2KA 1BKDR 5EYPA 1U1EA 3D7KA 3TMKA 5B36A 5C53B 2WQ6A 4DSOA 3G5AA 4YCMA 1J1IA 4ZOLB 3VU8A 2J3DA 2WU0A 1K6XA 4GS5A 4R68A 2A92A 1GRCA 3ZI4A 3NIFB 2IYFA 1GD1O 4OBXA 2DM6A 1MJGM 2DQZA 4EHDA 5CB4A 2YWFA 2CNDA 5K4AA 1HT1E 5GOTA 1DJQA 3VGPA 1SHKA 3LCJA 1L7PA 4Q9NA 1JECA 3FZNA 3KC2A 1ZMTA 2GPYA 1LFAA 1RYFA 2P6PA 5DB4A 4O4HB 4J94A 1Z8FA 3GLFB 4B47A 4FJ0A 1U1DA 3C43A 3E3NA 4U0JA 4BFCA 1KPGA 2A88A 3FLBA 5FDFA 3K35A 3IQGX 2YJ6A 1DWOA 1T36B 1YA6A 3DOOA 3QA3E 5LSAA 5EKXA 1L4LA 4JDUA 4C6HA 2HRRA 3N8DA 2A7QA 1XEWX 4IOKA 4MS3A 4DDWA 2B0CA 4QUHA 3OPYI 2OV1A 1HTTA 2WM2A 4ZT4A 2ALJA 3QI7A 3GRKA 4IIJA 3RAEC 2F9MA 3BM5A 3GJXC 4AC9A 2GRAA 2NXCA 3GLIA 1E3DA 5FFFA 1ZUD1 2RH8A 3OCYA 4Z0TA 3ANSA 3GHHA 1KU0A 2OGZA 3GEPA 1JXQA 1D0VA 1O96B 3F78A 3GFBA 3MRVA 1QZXA 2H1HA 3GVXA 2X0IA 3R5SA 1DKRA 1Z5UA 3IUMA 4OMFG 5JANA 2D1SA 3GQBA 1TUIA 1U2QA 2PZMA 3OM9A 4IHAA 1NHWA 2I71A 3CBQA 3I45A 1SOUA 5JSYA 4CM9A 2GKOA 1KRWA 2VQ3A 4V0OA 2IHTA 4UNQA 2WHPA 2JZCA 3GFTA 4RK4A 3PUHA 3BSSA 5LQJA 2NP6A 4WOCA 3NHKA 4IHQA 4N7JA 4D26A 1ODCA 5TRTA 5HCUA 4PAWA 3FWNA 2PT5A 2F3TA 5H0IA 4D25A 2UU9B 1VG0B 2I7XA 5AVTA 2C2MA 1NXPA 2FSIA 1ZL0A 4D56A 4ZCIA 1DWPA 2JAQA 1MZVA 4BMNA 2XMZA 4W5RA 1UPUA 2Q99A 3I9LA 4JLUA 4MR8A 2OD7A 1X7DA 4DMCA 5LMUB 2R6JA 4KQJA 3ROXA 1Z2AA 5HWSA 2PV7A 4X8HA 4RY2A 1PFGA 4P93A 5L4LA 1M34B 4BLPA 1JSCA 2NO9A 3SBOA 3KPJA 3U39A 4A10A 2VTBB 2IWHA 4OLBA 3PNOA 2QXTA 2DSNA 1NTRA 3HV0A 4TL9A 3Q1LA 3H2BA 1WZUA 4W1QA 1ZSYA 3CZCA 2GWHA 3BHJA 3R20A 4UMFA 4H0CA 1KEWA 4NPHA 5EE9A 3NBUA 5KVAA 5ARBA 5M2QA 1P5FA 1YRBA 1CZHA 4CIBA 4J3NA 4ZIRA 3Q0IA 4DUGD 1YOVB 1H2WA 4RCVA 5JBQA 4FDLA 1K06A 5ALYA 3ASYA 1NQWA 1FE8A 1HBJA 1VE7A 1DZIA 1POXA 3GJ8A 3CO5A 3CNHA 3ZWOA 3U16A 2HCJB 2WSMA 2ZOSA 1ST2A 1IN5A 2XZPA 4ED9A 2Q9AA 4B8ZA 4DBVO 2JG3A 1SPBS 3I4LA 1TF2A 2XPCA 5LQNA 1I7LA 1H3NA 1MC1A 1R0SA 4TVBA 4HB0A 5EHQA 1C0EA 1U81A 3PHCA 4Q9JA 1XA4A 2OO3A 1KZ9A 1L7BA 3A7DA 1VB5A 3JWHA 3NHFA 2BN4A 5D3KA 5EQTA 3FNHA 3LUJA 5BSRA 4BV2A 4IDHA 2PSSA 2VAVA 1WABA 3JSAA 3K5HA 1C50A 4G9BA 1WMAA 3G6WA 1RIIA 4NZMA 3EIQA 3TEJA 3IDOA 3ME5A 3E4DA 3H8VA 5LCXA 3JQFC 3HI6A 5FHRA 1IVYA 4HLNA 1XNQB 1RAFA 4IHJF 3BE6A 1SAYA 3OOWA 1RLJA 3MBKA 4AO6A 5L7WA 1EFRD 3DC2A 5I7AA 1B8NA 1GGVA 3B48A 4KQIA 4YIKA 5DBEX 4WNIA 3ZE0B 4IWYA 3U6KA 2C7PA 5DTIA 4I5DA 3L8MA 1UT8A 3MERA 3D7LA 2X0KA 1NRJB 3G85A 3II6X 4X6UA 1TJ3A 4YJ2F 2GYUA