4C0AC

Arf1(delta1-17)in complex with brag2 sec7-ph domain
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
161
structure length
161
Chain Sequence
MRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRHRNWYIQATCATSGDGLYEGLDWLSNQLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Integrated conformational and lipid-sensing regulation of endosomal ArfGEF BRAG2.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
molecule keywords IQ MOTIF AND SEC7 DOMAIN-CONTAINING PROTEIN 1
total genus 49
structure length 161
sequence length 161
chains with identical sequence D, G, H
ec nomenclature
pdb deposition date 2013-08-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4c0aC00
5TXGA 5J4VA 2ZS7A 4ZV4A 3QBTA 1ZP6A 1MKYA 2H92A 3DO6A 3KB1A 4ZI2A 3AH8A 3VQTA 4TZ0A 4ABYA 2WICA 4XVRA 2BKUA 2OG2A 3K0EA 4QGAA 1G3IA 2O8EA 1P2UA 3CRQA 4D4KA 3GPLA 2XSZD 2VSXA 4KV9A 2FDCA 2ZE8A 5GJVC 4KFTA 1ZD8A 4QJ4A 2O8EB 4IOLA 1TF2A 4RD4A 1CTQA 1US8A 3FYHA 1N5LA 2VIIA 1UBEA 1SXJD 2IT1A 1A4RA 2J41A 3D8BA 3OAAD 3RWMB 5H1YA 3LNCA 1NKTA 3X1DA 2FG5A 1RZ3A 1NN1A 5HCIA 3SYNA 4D80A 3K70B 1Z0FA 2AXNA 4KJZA 2CJWB 1OFHA 4RZ2A 1NBMA 2ZYWX 3BH6A 4RY2A 4Q21A 3LRPA 4DC9A 2V3CC 4PAOA 4MRPA 3V4RA 3DKPA 1U0JA 4HLQB 2FZ4A 3IBGA 1XCMA 2VHUA 4DUGD 1ZUIA 4QBFA 4Q4AB 4AG6A 3LXXA 2ORWA 1KKLA 1C9KA 1GNPA 4ILEA 2XGJA 1SVOA 1VG0B 4DZZA 5JFGA 5J4YA 4LY6A 3QXSA 2CCGA 4JJZA 3PEYA 1E3MA 2VRWA 3HWSA 4JVLA 1RJ9A 2QP9X 1IXZA 3GJ8A 4OK3A 3THYB 3LQRA 1S96A 2O8FB 1MRSA 1D2EA 1E79A 4FD2A 5FL7A 5FOVA 4LC1A 2JLSA 3KX2A 3J81k 4JLMA 1PVOA 3ZS9A 5AR1A 4KVAA 2QRNA 2R44A 3GP8A 3QPVA 1GRRA 2AR7A 1NBMD 1P7CA 2Q3FA 3AVYA 2FX3A 1HE1C 3GJXC 4HZUB 3VNVA 3PJRA 4IDQA 4BWYA 2ZI5A 4CRWB 1OH6A 3KXLA 2JLVA 1DAKA 2GRJA 4DXAA 3KKOA 1B23P 3LW7A 5E7IA 1N2CE 2PZFA 1KTVA 3SR0A 3SQWA 5C4GB 4CEJB 2Q6TA 3B7GA 3OFND 2XZPA 4NYJR 2J0UA 3I1FA 2VSFA 2X2EA 1RFLA 1TADA 4GOJA 4ZO4A 3PUVA 1DAFA 1UJ2A 4M2LA 1XRJA 2ZRGA 4DDWA 4C3ZA 4TSFA 1C1YA 3PENA 5TV2A 4EKDA 2NO7A 1U98A 3SZRA 2ZU6A 3PUWA 3TUIC 1ZUNB 1XEFA 1RKBA 3HPQA 2I3BA 3D7MA 4HUTA 5JS8A 1BIFA 2QAGB 1CR1A 3QKSB 1GUAA 1HYQA 4KXFB 1G9XA 1N6NA 5AUQA 4NCNA 2OLKA 4C9BA 1D9ZA 3UWOA 2HXYA 5FBVB 2KJQA 1SXJC 1OYYA 1Y63A 2BM0A 2JJ2D 5KHOC 2C8VA 3EX7C 5DI3A 1ZM2A 4QGGA 3EC2A 2VQSA 1EK0A 3E70C 3Q85A 2JLZA 5DLQC 1VCNA 1JBKA 4HLUC 3CZQA 3LX8A 5AUPB 1N0VC 3DKVA 5LB2A 2W2VA 2ZREA 4JLDA 5EXSA 1E9EA 1G21E 1NMZA 3AV0B 3U3OA 3I8XA 5EXTA 1N6LA 1U8YA 4LSGA 3TR0A 1J7KA 2BVNA 4KYIB 4LJYA 5C46F 1VPLA 5JI3E 3ADCA 5CM8B 2P5TB 1Z6YA 5FOTA 3TK1A 1HQCA 1US8B 2Z0MA 3A58B 1ZINA 3AVUA 1JEDA 2IEYA 3UMFA 2PT5A 2J9RA 5JHHB 5FPTA 2F6RA 3VR5A 3GLHA 2NZ8A 3NH9A 4IVQA 1B0UA 5HR5A 4EJSB 4Q02A 3KJGA 1ZIPA 4GBMA 1PZNA 2K5UA 4NE2A 4RVCA 1G3RA 4XSHA 4Q4HA 1YJ5A 1W1WA 3W5IA 4QC2A 3N70A 3GJ3A 1G17A 4MYUA 3X1YA 4GPTA 3EPKA 3K70D 3CF6R 4DVGA 2XOKA 3MFYA 3CR8A 2NPFA 2CHQA 3K9GA 2OCPA 5JS7A 1VIAA 4B3CA 1JQLB 4M9QA 2XNDD 3GLGA 2R8RA 3X2SA 4ZDJA 2CVHA 3A1VA 5D3MA 3SBDA 3PXGA 1UEIA 2R6GA 3CH4B 4TYYA 1A5TA 1IM2A 1XEXB 3FDIA 5JHGB 4UJ5A 2L0XA 4N0DA 3CF0A 4L9WA 1I2MA 3IKJA 3X1WA 2WJYA 4DLWA 2IYLD 4JMPA 2CBZA 3WBJA 5AJYA 4CF7A 2QE7D 1U9IC 4DSOA 4P4UA 2XTMA 3TSWA 1R6BX 4AI6A 3B9PA 1YQTA 5TMPA 3P20A 1D2MA 1O3YA 2G0TA 2OXCA 1E94E 2P2LA 2WKQA 1MO3A 2FFBA 5E3HA 5G3ZA 3GLIE 3KQUA 3ONWA 1UBGA 4P4TA 1R5NA 2GCNA 1XEWX 4HEJA 3WRYC 1U94A 2Z6VA 3QEJA 3UMSA 2ZXUA 2GZAA 1MO4A 2WM9B 5C18A 4TMKA 2W0SA 5FTLA 1UDXA 3K0CC 1DELA 1XTSA 3MG9A 4V02A 4X8MA 3HR8A 3L0IB 3ZIAD 1OH5A 4GT1A 1MO5A 3QKTA 4DDTA 4AKIA 5DYIA 3DMNA 1GVNB 2BCJQ 2ZRFA 1KSGA 3TQFA 3I61A 4LYAA 5B64A 1WBBA 4B3BA 4DRZA 1KDTA 1JJVA 1H8ED 3A36A 4PAQA 4M1YA 1PJRA 4QXAA 2AD5A 1Q1BA 1P2VA 4U02A 4JL8A 4X8HA 2PCJA 1EXMA 5JCPA 1OXUA 1SZPA 2EYQA 2QTHA 3KXIA 1MRNA 1R2QA 5BYJA 2J0UB 5TB5A 1XB2A 4CGZA 4TT3D 3RSLA 1IXRC 1G291 4PPNA 2R6CA 2GEDA 4V0KA 4EPYA 4RZUA 2XJ9A 1FMLA 2V8OA 3ETLA 3LLMA 4FXPA 2QROA 4IVPA 1DPFA 2J7PA 2AKAB 4Q1EA 5L3QA 1T0JB 4LI0A 4Q7KA 1OFIA 3C7KA 3C5CA 5TVKA 1M74A 3THXB 4RD6A 2D4HA 4JIMA 2D3WA 2QU8A 3IQXA 2W00A 3BFVA 3KJIA 3GQBA 2A5GA 1LW7A 4G1UC 1G8HA 1SVWA 1XJCA 2FJUA 4BZPA 2ZRNA 1GTVA 2REOA 3TR5A 4C4PA 4QM6A 3HJNA 1XU4A 1DG1G 3AVOA 1XX6A 5CDFA 3KQKA 3SOPA 5DN6D 1SQ5A 3BIFA 2D74A 2WPDD 2RGNC 2JASA 5G40A 4YXWA 1QZXA 3REGA 2X8AA 4UKDA 1ZD1A 3CH5A 1JNYA 3AQ4A 3KJEA 4V0NA 1HURA 3U3JA 1IJEA 2C2HA 3KTAB 1KMHB 1FX0B 4KYUA 4XIGS 4FCTA 4DLZA 2X19A 3CBQA 2O8DA 3AF1A 3B1WA 1RRCA 1SVSA 2WWWA 2C04A 3I4LA 4RD3A 2JEOA 3TIFA 1XTJA 1E9CA 4PQFA 5CJ2A 4F4IA 4AKHA 1ZM9A 3SN6A 4B75A 1BS1A 1QRAA 2F1JA 2IYSA 5DYGA 5J47A 3QXXA 1NSTA 2R6DA 2IYXA 1CP2A 5SZJA 4GZMA 1ZVQA 2EW1A 5K8IA 4RFSB 3EWSA 1WB9A 3GEEA 3NHAA 4GOKA 3LA6A 4A6PA 1E2LA 1M8PA 3RNLA 2ZRDA 2Z4SA 1WP9A 3U7FB 5EE3A 4GI7A 2GXUA 2ZR0A 3EZ9A 2HT6A 4FINA 3VR3A 4D4MA 2CLCX 4C7OA 1JEEA 2EWVA 1IHUA 4HZUA 1NL3A 2J45A 1AN0A 2D7CA 2ZI9A 3NXSA 4JKYA 1ZM4A 1TAGA 2YJTD 4M1SA 4CYMA 2H57A 5GJBA 4ZIRA 2AHOA 121PA 2DFKB 4A0RA 2J0QA 2CJWA 3BORA 5A4JA 5TDHA 1OPXA 1EFCA 4DLTA 1NN3A 5P21A 2A7QA 3MCAA 3EZ6A 5JSZB 1EESA 4BFSA 5DHAA 2ZVQX 4YXWD 1OYWA 1K8RA 4IFBA 4LJ6A 1PV4A 5DH9A 2CK3D 2B7BA 3GFOA 4R2IA 4ARZB 2CVFA 3H1TA 2WAYA 2ZEJA 2YWGA 1I4TD 4FMBB 4EUNA 1XD9A 2OEPA 3I32A 4AWXA 5B57C 2GJ9A 2WBLC 2Q9BA 4B44A 5EZ5A 4Z1MA 2IL1A 1GL9B 1VG9B 4A82A 1J99A 1KK3A 1QVRA 3F5FA 4C0KA 4I81A 4TLDA 1UF9A 4ZCLA 1FOEB 1E2NA 2IF0A 5AJXA 1KAGA 1BH2A 1W2HA 4OHVA 1QHHA 4LC0A 5FR1A 1ZUHA 4NONA 1TQDA 3E2IA 1FFHA 4PO9A 3QXCA 4WVFA 4XWKA 821PA 1DS6A 5IDVA 2GAAA 2FSFA 1Z3IX 2QI9C 1OKKA 4PC6A 1FW6A 2A78A 1TX4B 2WKPA 1TUEA 3NTUA 4PSKA 2PBRA 4UNNA 2AWOA 3NHBA 4AIIA 4DEXA 1A2BA 1YR8A 2WPDA 4OK6A 1T6NA 2QPTA 1JR3A 3AP3A 5HZHA 4ASUA 2W0MA 2J59A 2JJ2A 4TL9A 4PANA 2XEXA 4MRRA 4JL5A 1CF4A 1T3LA 1Q3HA 1EX6A 1N3BA 4ESVA 2IEZA 5EE5B 1H8EA 5KSPA 2QUZA 1OH7A 4DSUA 1BMFD 2PJZA 2F9MA 2ODEA 3WNCA 1R8SA 4ZKEA 4Q9IA 2F7SA 2O5VA 1QG2A 2V6JA 3ZIAA 3G82C 1YZUA 2CLDX 2J7PD 5UKDA 3HDTA 1A1VA 3L0OA 3AKDA 4PC3A 4GRAA 4UNPA 3S1AA 3EPLA 4A36A 1T0HB 4PAMA 1G8PA 2ZAMA 2WVJA 2FE4A 1ELOA 2NTYC 1E99A 1VECA 2G77B 2NIPA 1HV8A 2QBYB 1EFHA 2IBMA 2GETA 3TNFA 4TLAA 4FN5A 4KO8A 2XZOA 2XTZA 3WY9A 2ZJOA 4ZDIA 5HCNA 4J0QA 3TW8B 3LDAA 3Q8XB 3AUXA 2CXXA 2R6FA 4Z8YA 3RABA 4Q18A 4DT1B 3FMIA 1TTTA 2BJVA 4E03A 4IVRA 1M7GA 3RLFA 2KI5A 2V54A 3EZ2A 2QZ4A 1U0LA 4F7WA 1AKEA 4DDVA 4A0FA 2V4ZA 1T3HA 1OHHD 3BWDD 2EYUA 5GADl 3C15C 4YDSA 1CJMA 3HU2A 3CRMA 3CUEF 1KDRA 2KBFA 2QPOA 4MKGA 4C0LA 3ICQB 3H84A 2Z43A 3K53A 5DI9A 1SGWA 3DM9B 3LO5A 3CM0A 1IN8A 4Q7JB 5BXQC 3ZGXA 1DOAA 1YZKA 1ZM3A 1YR6A 2CHGA 3RVBA 1U90A 3LX5A 4IEIA 3C41J 2EQBA 4CVNA 4A15A 2DBYA 5BN5A 2IYUA 3RRZA 3TJZA 1MV5A 4ARZA 1X8LA 3T1QA 2YINC 3VU9B 1MT0A 3I92A 3RHFA 3OEEA 1NLFA 1D6JA 2J0VA 4JT4A 4M21A 5CITA 1UKZA 1KK1A 4MUAA 1II8A 1TQ2A 2WWHA 3I73A 4U7DA 4D26A 1CKEA 4M1KA 3ZH9B 1LTQA 3PG5A 2WJIA 2VO1A 1X1RA 2DB3A 3SS8A 3DPUA 1YZTA 1NVVR 4A8JB 3LW8A 3N5CA 3FHCB 3UG7A 3WYFA 2RB4A 2FEOA 1W48A 3VX4A 2V6IA 1KO1A 3L8ZA 1DAMA 2JA1A 3KKMA 4RZXA 2IUTA 1PLJA 1AS2A 5EXXA 5J4HA 2X77A 1IY0A 2QENA 1Z47A 3OZXA 4OJKA 3Q9LA 5JWRA 3VKGA 2B6HA 4EFLA 1G5TA 2CMKA 4HSEA 3GMTA 1ZC3A 2V55B 2PLFA 3CWQA 5JECA 4XWOA 5HE9A 3NC0C 2ZJZA 4URUR 5JEDA 1W4AA 3GJ7A 1P72A 4YMSA 2XZLA 2GBLA 2O8BA 5DE3A 4KBGA 1T5LA 1IN4A 2GEUA 4Q9HA 4WZBE 4QJ5A 4OHZA 4A4DA 1XZPA 2GJAA 4YMVA 3EASA 1GNRA 3FTQA 4URVR 2OZEA 4OBEA 1LVGA 3KB2A 4O3MA 4L9SA 2RKOA 3OEHA 1Z5ZA 3G5UA 4M9SA 4LYHA 5H68A 1VCOA 4LYFA 4XD7A 2ZRCA 1J8MF 2GILA 1SULA 1TEVA 3SJBA 3QKRB 3OIUA 2G83A 4DLUA 4IDPA 3VR6A 1W0KA 1P75A 3CRRA 1M7BA 4PZZA 4TTPA 1F2UB 3BB4A 4B6EA 4OQNA 4FMCF 4WZ6A 3Q72A 3CB4A 2C9OA 2HUPA 2ZRMA 1X6VA 3CNOA 3FHOA 3MGCA 4QM7A 4L4UA 4KLNA 3IDQA 2ZJAA 2AD1A 5LD2B 3SI7A 4OHXA 2V9PA 4LOAA 2FPKA 2DWQA 4TMZA 5FL7D 4ZDWA 1CJKC 1DAEA 3HR7A 3U44B 4IOKA 4Q01A 2ODBA 1CBUA 3CX6A 3OFNA 3IO3A 5CB6A 4DB4A 2IS4A 4A0HA 1ESNA 4NCJA 4C2UA 2WWYA 4YC7A 1QHGA 4B35A 1K5DA 1RE0A 4Q1AA 4AY2A 4YMUA 3GLIA 1U99A 2ZI6A 4GMDA 5JWOA 3BERA 1XJ0A 1GRQA 3PVSA 4A92A 5CYPA 4BGDA 1X1SA 2ZRAA 5IRCD 3PUXA 2VP5A 4JVMA 1SVKA 1XEWY 1KSJA 4RKEA 1VDZA 4TTRA 3ZVMA 3NDBB 4UXJA 2YOHA 1DAGA 5AK0A 1YZGA 1ZRHA 2RH5A 2C99A 1IJFA 1ZU4A 4QG7A 3SFVA 1KMQA 3QBVA 4OHWA 1E98A 2OXRA 4EAQA 5FOXA 2PL3A 1DVRA 3I62A 1VTKA 1KNQA 4HAWA 1Q20A 3QNUA 3EZ7A 3ECCA 4OK5A 4DUGA 3SYLA 3BH0A 3A1SA 1DO0A 5KNCA 1GILA 3NBXX 2EFGA 1FTSA 4MDEA 2IYRA 4WBSA 1GNQA 1QHHB 3QUSA 2ZJBA 5KPJA 1X8KA 1E1RA 1Z63A 2N1BA 2PT7A 4DCTA 1W0KD 2HXSA 2CNWD 3UWKA 5KO2A 2QA5A 3PEUA 5LDDC 1SXJA 1IY2A 1VG8A 3QQ5A 2YOGA 3BFXA 4XD7D 3AB3A 5E7MA 2W6JD 4TLCA 2W6IA 3LBNA 1CIPA 3X1ZA 4TQUS 4I1OA 2VTKA 1G4UR 4OHYA 1GFIA 4U00A 4D2IA 2IYYA 3O8BA 4YDHB 1JECA 3NBFA 2H8KA 2LKDA 2MSEB 1H65A 3BB1A 4QGFA 4LX0A 2OO7A 1BYIA 4Q1CA 4B2PA 4Q1BA 5GJWC 4DWJA 1A82A 2ZJ8A 4L16A 3VKWA 2WSMA 1KHTA 1BYUA 4YMWA 3RANA 3P4YA 4BFUA 2C5LA 2JAQA 3A1TA 1IONA 3OESA 2J46A 3M6AA 3W9YA 2J0SA 1CRQA 2BEKA 5EP4A 3NDPA 4MGIR 3EIEA 4Q1FA 5HKKD 3ZD6A 4N1AA 2N42A 5HZKA 3F3YA 2O0HA 3RS0A 3K09A 2Q3HA 2EVWX 2F43A 2H5EA 4MUBA 4D0GA 2NG1A 2VYFA 2P6RA 4G5RA 4D0LB 4HAZA 2WWFA 4FWIB 2VP9A 5JZVA 2E1RA 4NCIA 4Q03A 1KMHA 4AC9A 1JAIA 5FTNA 1XMSA 2FSGA 4MGZR 2ZQ5A 3FGNA 1RVDA 2F55A 1E9AA 2DFNA 3BRWD 4KLZA 3UXMA 2VBCA 2RHMA 2AK3A 2ZRIA 4JZKA 5DSZA 1W46A 2C9YA 2ZYTX 4E07A 2ONKA 4C2TA 2DR3A 2OE2A 5EQTA 2WJJA 1COWA 4HI0E 1IBRA 3B6EA 2IXGA 4DCSA 1Z08A 3WMFA 1OJLA 4M22A 2D2FA 4P3YA 3RWOA 4NKRA 5IT5A 1CJUC 1Z28A 2IX3A 4O0MA 2HF8A 3WBKA 2FU5C 3GLHE 3NC1C 3IILA 2AFIE 3MUFA 1KY2A 3ZYCA 3CW2A 1KI7A 4BZXA 2RAPA 4BRUA 2DPXA 1BO6A 3K9LA 4C30A 3K0AB 4Y0VA 1EWQA 2ZI3A 1Z8FA 3SHWA 3FHTA 1YRBA 2FGKA 3QG1A 2EFHB 4G5GA 4TMWA 1E1QD 3K9HA 2G0NA 2B7CA 1AZSC 2PEZA 3ASYA 3QOFA 4V03A 2IUSA 1AQUA 3K0SA 3R8FA 2CL7X 1TF5A 2BCGY 3VHLB 4YQFA 1G8FA 1OSNA 3EARA 2UKDA 1XMJA 2HDNB 5FBWB 4RD1A 1XXHA 4OYHA 1F60A 2JJ1A 2CHVA 4ITRC 3U3RA 4Y0AA 1N6OA 1G7RA 2V1XA 2F1RA 5FI1B 4BASA 2IS2A 1OB2A 3KTAA 2JDIA 3BGWA 4JLKA 4BEJA 4Z54A 4QGHA 1V5WA 3B13B 3U44A 2D06A 2ZSAA 3SNHA 3MSXA 5JRZA 2NO9A 1KO8A 3VKHA 3TE6A 4LV6A 3HP1A 4GL2A 1XD8A 3ADBA 4RJLA 5JJKA 1DEKA 2QAGC 3HU3A 3PEWA 2Z5FA 3V9PA 1AGPA 1E6CA 3THWA 721PA 3CX8A 1CJVC 3OEED 1FMJA 2MMGA 3UMRA 1UKYA 1XMIA 3DHWC 1KSFX 1VIYA 2ANBA 3ZZTA 4A9AA 3ICEA 4PQRA 1KI1A 2DWOA 4YMTA 1IY1A 1M6NA 2F43B 2TMKA 5DGXA 4Q4JA 3EG5A 2ZS9A 1Z6AA 4HUQB 1R5BA 3PIRA 3QF7A 3GD7A 2I4IA 4PXAA 2YZ2A 2RMKA 2BMDA 3A8TA 3EIQA 2UVQA 2FH5B 1HQYE 1DAHA 1AM4D 3EA5A 3TMKA 2ZS8A 3U4QB 4KFSA 1IAQA 2OAQ1 2Q3MA 3QKUA 1AIPA 1E9DA 1ZC4A 2DFTA 4Q7MB 2P6NA 4IFEA 3U7EB 4PSVA 5EZ6B 3FKQA 2GCOB 4MRNA 5KNBA 1O87A 2PLRA 3BB3A 3WYGA 5KPDA 4PZLA 1AS0A 3THYA 2O8FA 1F2UA 2RGNA 1G8YA 5FTJA 4BFWA 2GESA 2H1LA 3H4MA 1II9A 3QI2A 2DWPA 4I1VA 2GJ8A 3QF4A 4CEIA 2F1HA 1JPNA 2HLDD 2B8WA 1W0JA 4V0OA 4URXR 1ZBDA 5H70A 2FF7A 4BPBA 3QIAA 1P3JA 2IXFA 1XNJA 1VHLA 1JQJC 1DE0A 1OT3A 5FUWA 2BIFA 3ZZ0A 4JLJA 4WA7A 2HCJB 1DG3A 3ND9A 4GNKA 5G3YA 3A1UA 3FMOB 4Q48A 4JLVA 1P6XA 3B60A 3AF2A 3L2OB 4JLBA 4P31A 3VTKA 1G4AE 1OFTA 4LRWA 3SC3A 3R9XA 1NBME 1TQ4A 3W3ZB 4Q9LA 1JALA 4OKSA 4D4JA 1XPOA 3TSOA 4PPQA 3K1JA 3TRFA 2AK2A 1E0AA 3K70C 4MKHA 4P4SA 1D2NA 4Q4LA 1KI8A 3JZMA 5EP2A 1R5OA 2GXQA 1NIPA 4LV8B 4IEEA 1OB5A 2HYDA 2AX4A 2QP4A 4HB4A 3WRXC 3QXHA 5DNYB 3C8UA 2O8CB 4RSGA 2QGNA 3K09C 3RAPR 1Q57A 2IWRA 2RGGA 4R98A 1ZNZA 4Q19A 1TMKA 3AKCA 2OFWA 3W6PA 1E2DA 1OW3B 1LF5A 2W83A 1GWNA 3W5JA 5C4MA 4ZCIA 4Q9KA 3U3KA 2A5JA 2XB2A 1TEXA 2ZYUX 1XBTA 1DO2A 2QT0A 3WHLA 4MDFA 5AJZA 2IYTA 4HB3A 3FWYA 1ZCAA 4LJAA 3TVTA 1F2TB 2ZYVX 2FFAA 2GNOA 1U8ZA 2IYVA 5C2JB 4KVGA 4EQ6B 3U7HB 3RS7A 3PQCA 4ZDKA 5FPYA 2BBOA 3TGPA 2G3YA 1XFAA 2NO1A 3CX7A 1NP6A 3BK7A 1RRGA 2AN9A 4N0EA 4B43A 2QGZA 2GBLC 4LJ4A 4HAVA 2EFDB 2GKSA 3MD0A 3GLFE 1GITA 4G5SA 3VMFA 2WIBA 3GJ5A 3B1ZA 4FMDF 4GFDA 1GRNA 2H7VA 5B58C 1HTWA 2ORVA 1CXZA 3ZQ6A 2QY9A 4EFMA 1GOTA 4M9ZA 2GJKA 1KY3A 4FI3C 3AEZA 1NJGA 5KUTA 4US1R 1FNMA 4KFRA 3W8RA 2OFXA 2BOVA 1TQ6A 1XP8A 1XXHB 4JYBA 1N25A 2HT1A 2A5YB 1ANKA 1E2MA 1KK2A 1N0WA 2ZE7A 3IQWA 4RZ3A 3SE0A 4B71A 1FZQA 3TW4A 4PHGA 5BQ5A 3KKPA 5DN6A 1NJFA 3FKSD 5EXPA 4QFMA 2A5DA 2QSYA 4KBFA 2B8TA 1W44A 1R8QA 5FTMA 4LJ5A 3LFUA 4KODA 5CK4A 4E22A 2KE5A 1H8HD 4TWZA 4PX9A 4KHZA 1AS3A 3BBPA 1KJYA 1NVUQ 1IQPA 1J90A 3BE4A 1JPJA 5LD2C 4B3GA 2R65A 1E0KA 2FV8A 1OV4A 2QMOA 3AP2A 1TPZA 5FUXA 1WDTA 4UXHA 4DBLC 3GCGA 3U6BA 2OILA 3ND8A 2RGDA 2LCFA 1NNEA 2HV8A 1G5PA 2FFHA 2HJGA 4P33A 4Q4HB 4TMVA 4JSTA 1F6BA 3CR7A 4C0JA 2IK8A 3ZVLA 1E9BA 1FQKA 1U81A 2OESA 3BOSA 5EE0A 3TVDA 2EFCB 1CR0A 1QHSA 2ZUDA 1KI3A 3AGQA 4EPXA 2ZUCA 3EPJA 3CPJB 3U2QA 4LJ7A 1W0JD 1Z0DA 4JLPA 1HEIA 5KTYA 4A1FA 2JLYA 1Q1EA 2BDTA 4NU0A 1XEXA 3JVVA 4AD8A 2FZLA 4PSAA 4W5WA 3U61B 4V0ME 2ZU0C 3JZAA 1XD2B 1Z0JA 2ZSDA 4QKQA 2E9SA 2FFQA 3PFIA 3NVAA 1NI3A 5F3WB 3BS4A 3H2YA 3ZZUA 4K46A 1XTIA 1FUKA 1R4AA 2QORA 1F48A 1HUQA 4ZIRB 4KAXA 4Q7LA 1E2PA 4D4LA 5TARA 1VKJA 2B92A 3IPXA 1W47A 1ZAKA 2V7QA 4ON9A 4WZAE 3W6NA 4K81B 4TYQA 1ODFA 1UKVY 3P26A 2ERYA 3TBKA 4KITB 1W36D 2G88A 3CF2A 4IJMA 2IC5A 1OXXK 3T12A 4ZKDA 2WAXA 3D3QA 3UATA 2VHTA 4XOIA 3M1IA 1R0XA 1E2KA 1Z29A 2JIZD 4DJTA 2QAGA 5IHPA 1P61B 1RPZA 4PZYA 621PA 1H8HA 5FPHA 1G1MA 1WRBA 4G5OA 5FTKA 4BRWA 2OSBA 4IRUB 4BE7B 4QL3A 4BFYA 1JJ7A 4PHTA 3MWKA 4XH9B 5SZKB 2WWGA 2Z4RA 5EUMA 2NGRA 1F5NA 1MO6A 5B30A 3AM1A 1X8JA 2C03A 4JVNA 2ZM5A 2F3RA 3RS3A 1Z0AA 2XXAB 1NN5A 2ATXA 4X8LA 4LPSA 5J40A 4F93B 2W58A 3R7WA 1NMXA 3KJHA 2QN6A 2OBMA 1N5JA 4Q4AA 1GKUB 4Q00A 1FX0A 2AWNA 4RCYA 1W4CA 1UAAA 4F38A 4XJXA 5DISB 3L43A 3LVQE 1EWRA 2CL6X 2ZSBA 2I1QA 4GP7A 1M34E 3X1XA 5E7JA 1QG4A 3NBZC 3B78A 2WWIA 4NL4H 2DY1A 1WCV1 3ZJYA 2QQEA 4DCUA 3ZD7A 4A6XA 1S8FA 3OIVA 3FE2A 3RS5A 1PLLA 1OIVA 2WMNB 3UKDA 2GCOA 1XD2A 4JBXA 1DBSA 3RS4A 5F9FA 2OAP1 2J3EA 4P32A 4B3DA 2QT1A 4JLAA 1EFUA 1WF3A 3QENA 3A37A 2OUKA 3PV0A 4IDNA 5FUVA 4M9XA 2MSCB 4N3NA 4B6FA 1NMYA 2RGEA 3GFPA 4G5QA 3I72A 4KFUA 1Z6TA 4L8GA 4NMMA 1EGAA 1Q1QA 4LK2A 5GVRA 3LAWA 4DLVA 2AL7A 4C7OB 1LY1A 3CONA 2DHRA 3REFA 3LLUA 5EUQB 4L15A 1E1QA 4US0R 1NN0A 4B32A 4EPVA 3T35A 1ZYUA 4BFXA 1YHNA 3LVRE 1NY6A 1TF7A 3MLEA 1NSFA 1W5SA 3KQNA 3QG5A 3V00A 1JB1A 4TLEA 1F2TA 3LBHA 5IK2A 3VFDA 5FOSA 3A4MA 4I99A 3MJHA 3TUJC 2J5XA 4AYXA 2A2ZA 3U7GA 1FL9A 1KDOA 3WMGA 3MWYW 421PA 2J7KA 1FUUA 5BN3A 1UBFA 4HYYA 2O0KA 1KK0A 5TY0A 3H0KA 1CS4C 1OXTA 2QSZA 2Y8EA 4EIWA 5AJVB 2PX3A 3E5HA 2GAOA 1SXJE 5AUNB 4ACBA 1XDBA 2YWEA 1XWIA 3THOA 1G16A 2KWIA 1G18A 2ZRHA 4PQYA 5KSOA 1S9HA 3MJRA 5KDDA 5EP1A 4M8NE 3TUZC 5F9HA 1M2OB 4D81A 1DARA 2O52A 3GJ0A 2ZITA 1X3SA 2GVDC 1OFUX 3EIHA 1RYFA 3C14C 3FMFA 2WMOB 4LHXA 4LJ8A 5DHFA 4DB2A 2VP0A 2AXPA 3AF4A 3AVWA 3LH5A 4OI0A 5CYOA 1AQYA 2W6ID 5DO9A 3I8SA 1S9DA 1D5CA 3KUCA 2IHYA 2JLQA 3TKLA 2GTPA 3FVQA 1T8TA 2ZROA 1E0JA 5KSZA 4II7A 5SZHB 2IXEA 3GLHB 3B2EA 2XJ4A 5EE9A 2ZVPX 4DIEA 2XITA 2ODWA 4H1VA 4JT2A 1Q22A 1NVVQ 4CIDA 4NYMQ 4AURA 3O8CA 3IIMA 1WBDA 2WIAA 4URYR 1IXSB 3T1TA 5K8TA 4FMDB 4PHHA 4B3FX 1ZNYA 2YWFA 2ZRLA 5L3SB 4DEYA 1C4OA 1KJWA 4URZR 2F3TA 4CT5A 1OXSC 1XMVA 4HLDA 3TQCA 1P62B 3DMDA 4CZ2A 1UADA 4GDFA 3EAQA 3CRW1 4F91B 1E2QA 1YZNA 1LF0A 1Z22A 3U3MA 4C0SA 2JATA 4NCHA 5D3MB 5B2ZA 1L4YA 3IUYA 4MRSA 3A1WA 3RC8A 3QXJA 1E1RD 2IYWA 4D25A 2O8BB 4Q4JB 3KQHA 2YC2C 4FWTA 5FL3A 2VA8A 1HA3A 5A5GA 4R9UC 1XXHE 2FPMA 4JSYA 4W7SA 2H18A 3SU8A 5HTKA 1KNXA 3GJ4A 2FPLA 3LD9A 5KDLA 1I4LD 2P6UA 3NIBA 1L8QA 4MA4A 1V43A 2REBA 3EZFA 1NVXQ 4BLQA 4TZ6A 3IGFA 3AKEA 2X1VA 4B74A 4TL6A 2A9KA 2BJWA 2IW3A 2LKCA 1UEJA 4LHZA 1RIFA 4LBWA 2KSQA 4QNMA 2FSIA 2Q0HA 1QHIA 2OV2A 4B34A 4NP6A 3WHKA 1G5RA 4QHYA 3SFZA 1G20E 2PJRA 1CR4A 1XJQA 1S1MA 3UPUA 1Z83A 3CIOA 3CRVA 3U5ZB 3O47A 4XSGA 1N0UA 4W5HA 1KO5A 3R7WB 4TQ9A 1XTQA 3ZVNA 1FPMA 2PX0A 4K8OA 3W90A 1GDDA 5C1BA 2BKEA 2BC9A 3N2EA 3QVUA 4GP6A 1KAOA 3NBYC 4PFSA 1I2DA 2BMJA 2H17A 4A2PA 3B9QA 1P9NA 1II8B 2P3SA 2VF7A 4OQXA 2OLJA 4U5XA 4UXIA 3T06B 2UZ3A 2HCBA 1E2IA 3Q7QA 1E4VA 2P67A 3KUDA 1II0A 1P2TA 1F3OA 1X86B 1N6RA 2CL0X 1SKYE 4HB0A 4A2QA 3VNUA 3BC1A 4V0MA 4KCGA 1A2KC 4AG5A 2NPIA 3LV8A 5JEEA 3NH6A 2IA5A 1LNZA 2J87A 2QTFA 2C98A 1J8YF 1NVWQ 3KXKA 2QNRA 1CULC 3GEHA 4MQBA 2GZHA 1AK2A 5JRJA 4CT4B 2GZDA 1GL7A 5SZIA 3CNNA 4OI2A 5LB4A 4GSYA 3AKYA 4MH0R 3SJAA 3HU1A 4ZCMA 3TH5A 1U9IA 4Q66C 4OQMA 2OT3B 2QMEA 1E2EA 1QBKC 2NO0A 2ZIAA 4W9MC 1JXOA 4UQOA 1NIJA 5KOYA 4LHVA 1S1CA 2WSSA 3ZLJA 2XAUA 4ACAA 2ZJYA 4WIAA 4ERNA 2KBEA 3K8YA 3AF0A 3EXAA 1BKDR 5BWMA 2VEDA 4IHQA 3VR4A 1RRFA 2SHKA 4A8JA 4A0GA 4EJSC 1VCIA 5CIWA 1IN6A 1WA5A 1YU9A 2RGAA 1UPTA 4RD2A 2ECKA 4RD0A 3GEIA 3MAAC 2WV9A 1JAHA 1W4BA 1VYTA 1RYHA 4UNRA 4MYHA 4YONB 2YYZA 1W36C 2GXAA 3G0HA 2ODNA 1ZU5A 3M4YA 4OI1A 2ZI7A 4LHYA 2OM2A 4LZZA 3AVTA 1L4UA 1P60A 3CWZA 2P0EA 4IKEA 2FEMA 5JWHA 1G6OA 1VYUA 1S3GA 2A3RA 2REXB 1KSHA 1NLZA 3A4LA 5EJEA 5A0FA 4NPHA 1VG1A 2R9VA 1WE2A 3K0AA 2D7DA 2CE2X 3LBIA 3WYAA 1N6PA 2QEQA 1QHNA 2RGXA 1OF1A 3VHXA 5JMTA 5G41A 1Z2AA 2FWRA 3OIYA 2DYKA 1HH4A 3AVXA 4Z8XA 3T1OA 1MH1A 4C0QC 5JJIA 2A30A 5JI2E 2IUUA 1ZNXA 4LDJA 3PR1A 4HZIA 2ZANA 2WJHA 1EG7A 1NRJB 1G7SA 2CEAA 2EWWA 3KKNA 3RRYA 2C9CA 1HE8B 1VCMA 3U6KA 2VSOA 3CNLA 3QVVA 4UNSA 2ZETA 1GAJA 2P65A 2D2EA 2QTVB 1CR2A 1XCGB 5CLQA 1QDEA 5L3QB 3ADDA 1PUIA 2YHSA 4TL7A 2BMFA 2CE7A 1U0HC 3THXA 3WP0A 1ZNWA 3ADKA 4TN1A 4Q9JA 5FOWA 4NZYA 1E69A 3KKQA 3T34A 1VYVA 4DKXA 2QBYA 3DZ8A 4DHEA 1NLYA 1N5IA 4HLUA 4BZQA 2YKGA 2XX3A 3P1JA 1GG2A 5F2EA 2DCUA 1DADA 1OHHA 2XNSA 3OIWA 3UG6A 3R9IA 1E2JA 3QPUA 4GOXA 1QHYA 5FOUA 3IEVA 3F0TA 4F4JA 5CDFE 2WOJA 4RKFA 2QM8A 2YC4C 5M04A 1TU3A 221PA 2QPAA 2ZSFA 3SQXA 1GP2A 1NG1A 1Q0UA 4EPWA 2BHRA 3PCRB 3C4JA 1ZJ6A 1LB1B 2FOLA 4TTQA 4FIDA 5IK2D 1TL7C 3NKVA 3SJCA 4OQLA 4RFVA 5BW8A 4UNQA 5CIQA 1E32A 4URWR 4F4CA 1G3UA 1HT1E 1RJ9B 1P9WA 1NF3A 4Q5IA 4B48A 4BLTA 1SXJB 4LJ9A 1ETUA 1KI4A 3OE7A 4DSNA 4ASUD 3OEHD 4LWZA 2QMHA 1OE0A 1AA9A 4M1TA 2JGNA 4LBVA 1Z0KA 4B33A 5EP3A 1GZSA 2YNMA 5KNDA 4C0AC 5BN4A 1P9RA 4OQFA 3WXMA 2PZEA 3DVLA 4BECA 1E9SA 3IHLA 4MYCA 1G7TA 2PH1A 4NYMR 5FPSA 1BOFA 3PEVA 1J70A 4WW0A 5BYKA 5JSZA 5DIFA 5KU1A 3RC3A 3ZVRA 2GEVA 1BMFA 4IOJA 1KO7A 4R71A 2GXSA 1KGDA 5ANRB 4Z1MD 1W2GA 4F92B 1WQ1R 2VL7A 1ESMA 2IYQA 3W34A 4R2HA 4C0HA 1ZMXA 2OBLA 3FMPB 3SEAA 5AJWA 3R9WA 1FNNA 2ZPTX 1D9XA 2QG6A 2CK3A 4NDZA 4NBSA 4BFTA 5KYKA 1JR3D 2RCNA 1VMAA 4MGKR 3KFXA 1S2MA 1GM5A 1W5TA 8OHMA 4O2RA 2R2AA 4B2IA 1MABA 3HYTA 4NYIR 4HUQA 3GLGB 3PUZA 1Q3TA 4JL6A 4O25A 4JYCA 2RGBA 3QKSA 4EDHA 1JI0A 3BFKA 4NCKA 3IPYA 4EQ6A 1YVDA 4RFSA 3LXRA 4LYJA 4AK9A 1GSIA 1SHZA 1AZTA 3S1AB 1Y3AA 2Z83A 3ZQJA 1CJTC 2BBTA 1YR9A 4A2WA 4NYJQ 4PPFA 2EFEB 3O8RA 1T8UA 2F9LA 4BLSA 5GVSA 5CJPA 1SVIA 2VP6A 1D8TA 5AUOB 1Z6XA 2FGJA 1QF9A 2ZAOA 2JIZA 4CW7A 2XXAA 3DL0A 3U60B 3V4FA 4FCWA 2Q9CA 1KI2A 1E9RA 2QM7A 3M0EA 2WZQA 4M0LA 3KL4A 2KB0A 1GIAA 1KJZA 4HDQB 4US2R 1T3SA 3PITA 4G01B 3MRSA 2QAJA 1GKYA 1YR7A 5ELXA 2VH5R 3Q5DA 2DFLA 3B5JA 3QJYA 2ZSEA 2ZRJA 3IBYA 4HDOB 4QRHA 2WWXA 1RC8A 1G8GA 4QJ3A 5JCZA 2WHXA 2ERXA 1LS6A 4I4LA 1YRAA 4B73A 1UM8A 3T5DA 4TMXA 3CKLA 4D0NA 2ZR7A 1Z07A 2BBWA 4POAA 4PR0A 2W2XA 4DLYA 1G3QA 1AJEA 4IW3B 4DLSA 5GJCA 2ATVA 4UJ3A 3A6PC 1GKIA 3D31A 4HB2A 2VF8A 4JLNA 4P0TA 4BFVA 3B1VA 1ZD9A 2G9NA 2GF0A 1WMSA 1OIXA 1KI9A 2V7QD 2OBNA 2R6AA 2H16A 4LCBA 2HJVA 2OFOA 3L82B 3VX3A 3AVQA 1RW4A 5K8LA 1MABB 1SKYB 5G53C 2IS1A 4X8OA 4IDHA 5L3VA 4TYPA 4MYTA 2YVUA 1OLOA 3QE0A 2QL6A 4IXMA 4ESHA 1EFRA 2W2TA 3VU9A 3WNBA 4DDUA 5FPKA 4XVQA 1S0UA 2X2FA 4BLRA 3EC1A 3FB4A 1I4DD 3NWJA 2D62A 3SDZA 3NG1A 4M1MA 1CEEA 2Q21A 2PMKA 2ZRBA 4XWAA 3B1XA 4PO8A 1YZLA 4PC2A 2O8DB 4JS0A 3BAFA 4MITA 2IYZA 1N6HA 5FBRB 1TNDA 1Q12A 1R0ZA 2GK6A 3P32A 4OL0A 2C95A 3C5HA 3EW9A 2BV3A 2IF2A 2IHBA 3QSYA 1P73A 2GJSA 4LV5B 1Z6GA 2WOOA 5FFMA 5LBIA 3RSOA 1M7HA 3CLVA 3FKSA 4R7ZA 3OHMA 1G6HA 1KIMA 3CPHA 5K8UA 4NHOA 4DCVA 4GZLA 1OKKD 3Q3JB 3WNDA 1G19A 4DT1A 1EFRD 1HT2E 5L3RA 3IO5A 1PUJA 2ZRKA 3GLGE 4Q1DA 3AP1A 4EPTA 3U4QA 1L7VC 1CLUA 2YV5A 3DOFA 4PO1A 3PUYA 4M4SA 1FQJA 1DAIA 4HATA 1L2TA 5E4FA 5FI0B 1TU4A 3C16C 4QHSA 4E09A 4IOMA 3E1SA 4BUJA 1G3MA 4B76A 4PTLA 4TL8A 3JVUA 4XTRA 3Q7PA 2QQ0A 2QE7A 3WP1B 3CPEA 4P4SB 2JDID 1W36B 3THWB 4HDCA 3HYRA 1SVMA 3LQQA 3VR1A 1U8AA 4HAYA 3T1VA 3DM5A 4G0NA 2ZI4A 2Q9AA 5KDOA 2VP2A 1JXMA 2XNDA 2BEJA 2ZJ5A 4MGYR 1XZQA 2BBSA 4LBZA 4MRVA 1T4GA 1W49A 1N6KA 1Z0IA 2GF9A 2C77A 3IEUA 5FR2A 1E4YA 1G7CA 1U2RA 2MSDB 4S2EA 1Q21A 3KZ1E 4BQSA 1KZGB 4QHTA 4FCVA 5FH9A 1N5KA 2FSHA 1KI6A 2PMDA 3B82A 2AFHE 3K0FB 4JJKA 2G1KA 2NZJA 3WMEA 1E9FA 3ZDQA 3R8CA 2JLUA 4DLRA 2GA8A 1SVLA 2GK7A 1CU1A 2OCAA 4V0LA 3QKRA 3W3AA 2PZGA 1DTSA 3B85A 3LY5A 4E5UA 3GLIB 4Z51A 3DOEA 2ASEA 1ZIOA 3A4NA 1Q1ZA 2C96A 2IS6A 2JLXA 2P5SA 2AKYA 3L0SA 5J5CA 4TLBA 1TUIA 2GDJA 1R10A 3VR2A 4TYWA 2ZE6A 3MMPA 3BH7A 4NYIQ 1OH8A 3SJZA 3T61A 3I5YA 2QP3A 1UBCA 1COWD 2GCPA 2PEYA 2N46A 3DDCA 3MWJA 3AVPA 4M1OA 3ASZA 3GLFA 2XTNA 2ZE5A 1XPUA 5JJLA 1E96A 1XCPA 2XB4A 1E2FA 2XOKD 3P27A 4YLGA 3W6OA 4CEHA 2QMUA 2JCSA 1LFDB 2O0JA 1KZ7B 2A5FA 1P4SA 1UFQA 1ZCBA 4Q47A 4WAUA 2WJGA 3QEOA 4KU4A 4QBHA 2JJ8A 1GL6A 4KI0A 4AYTA 3IHWA 1KYIA 3AUYA 4G3XA 4JBYA 3RRNA 3GFTA 4WXPA 2HYIC 1W4RA 5CB8A 1VHTA 1CRPA 4PC7A 3KDSE 2OCYC 3SHFA 4BFZA 5KSYA 2MMCA 3BXZA 3KQLA 2FNAA 4QBIA 5D3QA 3DZDA 1Z2CA 4D6PA 1N6IA 4ZPXA 4I1UA 4I1SA 2F1IA 4H1UA 5E95A 5L3SA 1LS1A 5HPYB 1ONBA 2CDNA 3L0PA 5FBQB 2B21A 4M1WA 4D82A 3MWLA 2EU8A 1LV7A 1XTKA 4AYWA 1OXVA 3QPWA 1IOZA 1G64A 3H86A 4LGMA 5JLJA 1E2GA 1JR6A 4AKGA 1KKMA 3AVVA 1YE8A 4PHFA 2HLDA 1NG9A 4TT3A 1UDWA 2VP4A 3ZS8A 3T5GA 5CLLA 3F8TA 1AKYA 1MR3F 2NOAA 3OE7D 4GMXA 1M1YE 2UZIR 4CEJA 4AKEA 3TLXA 1EFTA 2W6JA 3K0CA 2IWHA 2NQ2C 3VAAA 4DCNA 3I5XA 2FN4A 2WJVA 1AGRA 5IF9A 4RCZA 1K6MA 2BM1A 2CNWA 4HLCA 3IIJA 1SKQA 1WXQA 4IDOA 4ZI3A 2ORIA 4WOPA 2OCBA 4MKFA 3UIEA 4EFNA 1NY5A 4L5BA 3QF4B 4CEIB 4TQAA 3RYTC 3SYKA 5J4LA 1YZQA 4LBYA 4BLPA 5LPNA 4TSFD 3GJ6A 2RHDA 5JBQA 3SBEA 3TAUA 1ZW6A 3BD9A 1XF9A 4B3XA 1S3SA 2GVZC 2VHQA 4KSCA 5F98A 2YWHA 2E87A 4TMTA 2OHFA 4JKIA 3K0FA 1K5GA 4HAXA 4LPKA 5CM9C 4DLXA 3K9NA 2VPPA 2YOFA 3CZPA 3LWNA 4DIDA 1R0YA 2HEIA 3FPAA 4H9GA 4S35A 1EX7A 3D6TB 2WTUA 1MOZA 2GWHA 2BMEA 3AF3A 5L8VA 3RS2A 5DI3B 3GLFB 4XVUA 3P4XA 1FP7A 2BWJA 2JLRA 4FW9A 4MKIA 2V1UA 3UK6A 4A8JC 2ANCA 4EJSA 4EPRA 3L8YA 5J4KA 2ZR9A 3O8DA 2WKRA 2PCLA 4IXNA 2NO6A 2ZUBA 3R20A 1E79D 1FP6A 2VLIA 2JJ1D 4OJQA 1NKSA 4CDGA 1E0SA 1IN5A 3RDPA 4C0BA 2J1LA 3FFAA 2CCJA 4BEBA 5H8WA 4OI4A 2WSSD 3NEYA 4CEHB 1R0WA 1T91A 5EE1A 5FBLB 1S4QA 1XTRA 1ZM7A 4B2LA 1P2SA 3EA0A 3QY0A 4JLOA 4PC1A 4JBWA 2FA9A 3EPHA 1FTNA 2VHCA 3TAHA 2G6BA 3KFVA 2O8CA 3HPRA 5FUYA 3FFBA 2ONJA 3FOZA 4QNRA 1J2JA 1RRPA 1T5IA 3B8HA 6Q21A 3Q5EA 2RGCA 3DEFA 4M53A 3OAAA 1KDPA 1SHKA 3I3SR 1YKSA 3EWAA 2CCKA 1E2HA 1QVAA 2JLWA 1T9HA 1QHXA 4LHWA 5HKKA 3T15A 1A7JA 1KOFA 3W8NA 2R62A 2HF9A 4FMCB 2XSZA 1XPRA 2G1JA 3RRMA 4TYNA 4JVSB 4BLOA 1G41A 5AWFC 4B47A 2ZJ2A 1Q44A 3AGPA 5HE8A 1PLKA 4O2LA 1HY3A 3NEJA 4HAUA 2I1VB 3OF5A 4W5JA 4KSBA 2ZRPA 4WXRA 2CLSA 5CK5A 1OIWA 1W7AA 2VHJA 3B1YA 2ZTSA 1IN7A 1Z06A 3TSZA 2GHIA 1P5ZB 4NTZA 1JR3E 4XTCS 3UANA 3BJIC 4LUCA 2QRZA 3N2IA 3IIKA 4QBGB 1UKEA 2NMVA 4PPGA 3CO5A 2C78A 2FMXA 4NH0A 2LWIA 521PA 1KO4A 4QOSA 4DSTA 1KI6B 1R7RA
chains in the Genus database with same CATH superfamily
1VIVA 5TXGA 3CH6A 1XZJA 2BKAA 2ZS7A 3PBKA 1YFLA 3VAZA 1ZP6A 4TZ0A 3ZJ5A 1U1GA 5DIZA 3AH8A 5KNBH 2AG5A 3L7JA 1E5XA 2GPBA 2OG2A 3P9XA 1JRLA 4BBAA 4OG2A 3R7FA 1YJBA 2VSXA 1MT3A 1PT6A 4Z7OB 2QN3A 2HQOA 3FCCA 1NKVA 1CK4A 4CM8A 2ZUEA 1P3Y1 1O57A 4I6JA 3QWFA 1UJ4A 4I9HA 1J24A 3VHRA 3LYLA 2ATIA 2XDAA 3TG2A 1OVMA 1EJ6A 5LQAA 4RD4A 1HNWB 5EEGA 4U7JA 1DDIA 1P0QA 2ZPUA 1UPAA 3KR1A 4FNOA 3HZRA 2IT1A 2VTVA 3WR5A 3RADC 1QJ4A 2POCA 3RWMB 1PFVA 5I9BA 4I19A 2PGOA 4MVYA 3ZCVA 4Y6GB 5C52B 2J9FB 3GEDA 3NTRA 1E3IA 3PQ3A 3U3DA 4N76A 2AXNA 2Q5QA 3NALA 4N9WA 4BVEA 4RZ2A 3ZY6A 1IK4A 3CGGA 1YD7A 3LRPA 4DC9A 3BCSA 1FFYA 2FZGA 1EJ2A 3V4RA 4HLQB 1TVKB 4IIBA 1YDGA 5IVDA 3VO9A 4DUGD 1B3BA 1SUDA 3F6EX 4IG9A 4QBFA 1R0SA 5T64A 5JXHA 4UTNA 3E81A 2Z2IA 4WASA 4ILEA 3BE8A 3SQOA 1VG0B 3FGZA 1DIGA 2O50A 3KT3A 4RGYA 4LY6A 5LYJA 4LQ4A 5HUHA 3LCUA 1H6CA 4YUYA 5AVVA 4Q3BA 3HWSA 3W5VA 1O8CA 3DE3X 4OK3A 4JT8A 3K0HA 2B61A 3L6OO 4YJHB 3GR6A 1H2FA 4TVKA 2QRUA 4UMDA 4PXYA 1QU2A 3KU4A 2OYCA 1UOOA 1Y3HA 2WF5A 3WRXA 4WI1A 1P7CA 2Q3FA 2VDWA 3AVYA 4MS4B 1P7YA 5HBGA 4EVRA 2EHDA 1IL0A 1VLHA 3O03A 4DPMA 3AZOA 2B83A 1UAGA 4OQQA 4X91A 2GAFA 5DHUA 4YASA 2IHKA 4B4WA 1OAKA 4DXAA 1YDHA 3KPWA 4E7PA 1GSHA 2B9VA 2OBBA 2XLCA 2Z98A 4L72A 4AP9A 5E7IA 3FCEA 3S2IA 1KTVA 1VL5A 5CBKA 1F8YA 3SQWA 2DECA 4AVYA 3B7GA 2EGGA 4G1VA 4DQ0A 1HL3A 3IJ5A 1J42A 1XK6A 2VSFA 1TADA 1W9HA 1Y48E 3EVFA 3PUVA 4HNHA 4ZO4A 1U3TA 2OK8A 3ACCA 4C3ZA 4OX9Y 2GCIA 5LZ2A 4F3CA 3PR2B 2NO7A 2PLWA 5E8RA 1YR1A 1ZUNB 3WLRA 2C4TA 1VKOA 2JGEA 3IIEA 5HXAA 5JS8A 1BIFA 4IL5A 4XQGA 3MS7A 1JE1A 4YIHA 2VHEA 3D6AA 1WCXA 3MCTA 3TGLA 3NNNA 5L6MB 4OEHA 3RJZA 3NR2A 3B48A 1WHTB 5AUQA 1XROA 1BFUA 1TPYA 3QGMA 5BVHB 2Q6LA 4DAOA 2WQ7A 2DULA 2C92A 3H5LA 3B70A 3BMQA 4F6RB 1XMQB 1Y63A 1OYYA 2ID8A 1O9HA 3CE9A 2C8VA 1A98A 1DX6A 1A9QA 4MUJA 2PXAA 4BAZA 4DV5B 4N7BA 5EI5A 3EC2A 2VQSA 5EKDA 4Z49A 2GJ4A 3ELWA 1Z2NX 3JQCA 3TSYA 5DLQC 1VHDA 1JBKA 1HX7A 4HLUC 2XI4A 1T4BA 2VDMB 3GGPA 1E5TA 1RMYA 1SHTX 2ZREA 5LB2A 4JLDA 1N4AA 1K6JA 2QM0A 3L9XA 3U3OA 4V1CB 4LQDA 4Z4FA 3ZZMA 4LXUA 4LY0A 1Q7EA 4MWBA 5F21A 4KMSA 2GLTA 3D6FA 4KYIB 5C46F 5JI3E 2PBFA 3R3JA 1ESDA 3TK1A 1DLJA 2SCUB 1US8B 2C1ZA 1ZSYA 2I7TA 3P5BA 4B6JA 4HGNA 4FYHA 3FG9A 3CFYA 1DDOA 4HTAA 4G1BA 1VJ0A 1Y1LA 3UV3A 1YAHA 3KUUA 2J9ZB 3FBGA 4FN4A 4WBNF 5KKCA 1A4IA 4RK7A 1C1XB 1USGA 5H83A 1M6VB 1SQFA 2YICA 1R50A 2C2WA 3D7RA 2ZUTA 3UH1A 3NH9A 3C8HA 3UWMA 4EH1A 3L1VA 3K2EA 4IVQA 1B0UA 5FFNA 1ENOA 1M2WA 2CLKB 4EWLA 3KJGA 2P9CA 4GBMA 2OZVA 1B8OA 2FP4A 2RH9B 5JCOC 1Q15A 5ENVA 3TPFA 3M9WA 3UA4A 5HVNA 3N0VA 2HSEA 3N70A 1WU8A 4ZOCA 1SU4A 2Q49A 1LK0A 4MYUA 4L08A 4WX2B 4GPTA 3X1YA 1W52X 4KZPA 3K70D 3E84A 5C31A 3COJA 1YR3A 4IX9A 4JMLA 5PNTA 2QRKA 2FSVA 2JZCA 4CL3A 4R3UC 4EGAA 2EV9A 3K9GA 1ACLA 1SVUA 2VWQA 2A0YA 1V2HE 3DBLB 3REOA 5FI5A 1KKUA 2QN8A 3N8IA 1LSJA 2CLFB 3WL5A 2FKNA 5KNCH 5DXFA 3RRXA 4ENPA 3CQ9A 3D81A 4MINA 2JG3A 5IWCA 1NR1A 1MB2A 1UP6A 4ZDJA 5HGXA 3PXGA 4H7KA 1UEIA 2R6GA 3CH4B 4L78A 3KEFA 4G1EB 4TYYA 4R9SA 5F64A 3FDIA 1PDOA 4UJ5A 2XYVA 3PRJA 1J25A 3TYXA 1SK9A 2PPVA 1R0CA 3HN6A 4N0DA 1X19A 2KPOA 1RLIA 3FTFA 3CF0A 3L4JA 5KWVA 5KJCA 1PIWA 2JK1A 2WJYA 4PX2A 2IYLD 3WBJA 4XZ3A 5K0SA 1M75A 1RLOA 2ZIVB 3FF4A 4MW0A 3TSWA 3LPLA 2G0AA 1V3VA 2ACVA 2RI6A 3N8GA 4G0XA 1YQTA 3GBPA 1SBZA 4KB5A 3UXYA 4HGZA 1RHJA 1FNSA 4MS3A 2G0TA 3W05A 1E94E 4CKCA 2ZJ0A 1GPAA 2FFBA 4QTXA 4RMJA 5G3ZA 3F78A 3B6ZA 2FUCA 3JAWA 1WZUA 3LGSA 3C4VA 4JC0A 2Z6VA 2Z9CA 3DZKA 1Z5NA 5C18A 2NYRA 4X93A 4G97A 3K0CC 1DELA 1YIDA 1ZLXA 4JI6B 3MG9A 3O4VA 1ZOSA 3NIWA 3GEMA 4I4CA 1D1TA 5LU8A 1X70A 3ZIAD 4LE0A 2DUUA 3I34X 4GT1A 3QKTA 4DS3A 1OH5A 1JVNA 4J0IA 4AKIA 1OZGA 1SPBS 1WXGA 2BCJQ 3K8QA 3KDPA 1MB0A 3V4PB 4BXOB 1DX4A 3NGXA 5B64A 3Q3VA 4L8WB 5K8CA 3C5EA 5ENZA 2EF0A 1N0IA 3D2BA 1JFFB 1H8ED 4E1VA 5JJCA 2GPSA 4B0PA 4S12A 3JQPA 1Y3DE 1FK8A 4CKWA 2AD5A 2OHIA 4U02A 3PFKA 4ZYWA 3H1FA 5E3IA 3R7DA 1EXMA 1K7FB 1VP9A 4TUYF 1GCAA 1OX4B 2IHVA 1SZPA 4F0JA 2RD2A 3VDQA 4XR9A 5AW9A 3KXIA 3S4YA 1MRNA 1BQ3A 1HKHA 1QX4A 1U0RA 1ND6A 2J0UB 2R5NA 2OB2A 1CUGA 3ELUA 2EC5A 2M2IA 4TT3D 4WN9A 3SHOA 3TVYA 3VR6H 4KE8A 1VSBA 2NTVA 1S6YA 3OEWA 5KWIA 1RAFA 4FXPA 2VP3A 5B37A 3SNKA 2JAOA 1KXJA 1X7YA 2NZUG 1I5EA 1S8NA 2Y92A 1VL2A 3K4PA 1JYSA 3O90A 3QUAA 4BLWA 1T0JB 1BE1A 3EDCA 3D64A 4QJIA 4Q9AA 3G2LA 4HPXB 5JSUA 1M74A 2AOTB 4O4HB 4Z9AA 3C7DB 2D4HA 4JIMA 3RFTA 1ZRNA 1YJXA 3KJIA 3DBRA 2LTAA 5AD1A 5LQKA 1G8HA 5DX1A 4ZMBA 4Q3NA 3BGIA 2AYZA 2REOA 3KEMA 1NWCA 3ABQB 5JNWA 1XU9A 3E8SA 3EGVA 3USZA 2FFJA 2G9QA 5CDFA 3WLOA 3KQKA 5DN6D 1SQ5A 1DFHA 2EF1A 2Q5HA 2CWWA 1B2LA 1EEXB 1KZ1A 2ZSKA 4O1IA 5LBUA 4L22A 1FTWA 1ZD1A 1RZUA 3AQ4A 3PKJA 4KR7A 1HURA 1WV1A 4QFBA 1GQQA 2I1WA 1IJEA 4ZZ3A 1WSWA 3KTAB 2NZXA 2VCEA 3PLRA 5ADWA 3NP7A 4CMIB 1PD1A 4XIGS 1YK1A 3OI7A 3WOHA 2LR0A 4ZGGA 4KMRA 3B1WA 3UC5A 4NCAA 3AWIA 3MT8A 4W8HA 2QRGA 4LZWA 4R2MA 4RD3A 4S24A 3NASA 2BFPA 2JBWA 3D8SA 3EGIA 4UEKA 1UJNA 5F78A 4AKHA 1EUCA 1VGQA 1AGYA 1PS9A 3C3DA 1BS2A 3OJCA 3QU9A 1QRAA 5FXMA 4KPEC 4X6XA 1A97A 3UK1A 4BQOA 1ZMOA 2CZGA 1Y4ZA 1KJ8A 2I6XA 3PQ8A 1PUXA 1N2BA 3B6IA 3BSWA 2PU7A 3PDWA 4GZMA 4KXLA 5T57A 2PS1A 1WB9A 1Z6PA 1PR1A 3GUYA 2YZNA 1EXDA 3LA6A 1P31A 2PUBA 1A8HA 4RADA 1E2LA 1ADJA 1K7EB 3L77A 1RZRD 3MSCA 3HDGA 2ZRDA 1CDOA 2Z4SA 2RHCA 4D3SA 2EBHX 2JCYA 1AB6A 1CZOA 4ZODA 6LDHA 1NQWA 1C4WA 1RJEA 3BILA 1USWA 2GPAA 2CLCX 3BXGA 3DC2A 3QHQA 3A1EA 4FINA 4RSMA 5IC4A 1FXWA 3ZHYA 1YA8A 1EHCA 1ES9A 1U0NA 4XRGA 4OXYA 1ZM4A 1TAGA 3UPDA 4CYMA 5DNUA 1FP2A 1P19A 4LMAA 5FORA 1XDSA 2AHOA 2NYVA 3DT6A 3EBLA 4UVHA 3NNDA 4OJMX 1NXWA 1VA5A 2AN3A 3AILA 3ECSA 1OPXA 4WNAB 5AKXA 5BNFA 1VL6A 4ZCPA 1J6UA 3KEOA 5TDHA 3WFIA 2E4VA 3WIBA 4DLTA 4KFCA 2PVCA 1KPHA 2Y1CA 4HXEB 2H9IA 4UNIA 5ADUS 3EZ6A 1JZSA 3EXHA 3N8NA 4U2CA 5CVUA 3N58A 2PWZA 3C39A 4LOKA 1EWTA 2AGVA 3C98A 2P1DA 1YUBA 3F5DA 4R2IA 4YJ3B 4ZT7A 4BMCA 4ZICA 2XGJA 4DY4A 2OD9A 4DJAA 2QZSA 1H4VB 2CLMB 3HLYA 2LE0A 2AN4A 4FMBB 4R1LA 5KAPA 4NHEA 3IFSA 3FFWA 1O58A 2EWMA 4FXOA 1KE1A 2GJ9A 1L1QA 2WBLC 2X9NA 4INJA 5EZ5A 3SXPA 5G1OA 1UT8A 3OQJA 1VG9B 4A82A 1J99A 1KK3A 1D09A 1QVRA 2P4QA 1U0GA 2ST1A 5F51A 4AU1A 4OF4A 5AJXA 5ALWA 1M1NB 2ZK7A 3VH2A 1EA7A 2XNHA 2ESRA 2YJZA 4BX8A 1TW3A 3S81A 2O7RA 3BE5A 4ZOLF 3MZ0A 1NVEA 4NONA 5ER9A 2ZZNA 3B5EA 1FFHA 3IOCA 821PA 1XCOA 4TKVB 5TEWA 2WINI 4N4AA 3R3SA 4TTJA 2WF9A 2GAAA 5BWNA 4EYQA 3DT8A 1OKKA 2GD1O 2A78A 4Q3LA 2EEZA 5AJUA 1TX4B 3NTUA 1EQAA 4UNNA 4JKOA 3TPZA 4RHUA 4AIIA 4Y6OA 3S68A 1MV8A 4IJQA 2G04A 1RCUA 1EDDA 1T6NA 1YQXA 2FG6C 2QPTA 3CINA 3L6UA 4QYXA 2GEFA 5ALEA 4CIVA 4D92A 1OI7A 1NU6A 2HCFA 2OFFA 2Q7XA 3JWEA 1CF4A 1Z2DA 3PQEA 3LXUX 2OHHA 5BWBA 2HX1A 4WNAA 1A9YA 1AV6A 1EX6A 1N3BA 3EJWA 4X20B 3R3ZA 2JJMA 2IEZA 3HCAA 3HCDA 5KSPA 1OH7A 2ASVA 2X9GA 3ISJA 5CVJA 1R66A 2ZUFA 4CLOA 5J1SB 4PE5B 1R8SA 4GI1A 2ZBPA 1WAMA 3ZIAA 3B1FA 3C3PA 3DMFA 1Z7EA 3JAMA 2V45A 5UKDA 3HDTA 3C8MA 3I58A 5HFAA 4W6ZA 1UMCA 3L0OA 5FNVA 1QH0A 4A6EA 3PZBA 4UNPA 3DFZA 3S1AA 1RJGA 5F2NA 3A6KA 3GA5A 3AR5A 3HUFA 1H69A 1V5FA 1VLJA 1DGQA 2WVJA 3HKCB 4TSRA 5LZ7A 4AUNA 2QRPA 1RTKA 1Y1TA 5EFOA 1ZIYA 1KVSA 1N57A 2G77B 1LJLA 1MORA 4B3JA 5BWLA 2HMAA 1Y8RA 4P3PA 1QQ7A 4CLOB 4RVOA 4WTOA 2BEWB 2XXBA 2XTZA 1NNUA 1I6WA 1KORA 2YJ6A 3I1JA 1X94A 5BUSA 1MN6A 2A9QA 2CXXA 4CMHA 1Y6QA 2GBGA 4HS4A 4PWZA 2W2KA 3H8JA 1AD2A 1ESEA 2BJVA 1L5GB 3DWFA 3L1IA 4IVRA 4EO4A 2BSXA 3NBQA 3B12A 3DLCA 2NV2B 2R7KA 2Y0EA 3CZ4A 1RC1A 1RIIA 3EZ2A 3LY9A 4FVTA 2M1ZA 4YRQA 2QM3A 3ZCUA 1CS0B 4K5QA 2V4ZA 3CIFA 1T3HA 4ZV9A 4DE5A 3KCQA 2RAUA 3BWDD 3JWGA 3JU3A 1JS1X 1H4TA 2PM8A 3EG9A 2P5YA 4OSPA 4F2DA 4CG0A 4TV9F 4MLPA 4JJ4A 4YDSA 2D1FA 3U9TA 3WVNA 4JI8B 1L7NA 4JNKA 2KBFA 2BEUA 2QPOA 1EK2A 3T0FA 1G2PA 1ODKA 1GSAA 3D4NA 3DM9B 4QLAA 4PS0A 3CM0A 2O2DA 4MROA 4P98A 5FBZA 1IN8A 4CFZA 2NO4A 4L4YA 4TTAA 3ZGXA 3ZWYA 1PJ2A 4BC1A 2YIDA 1JLSA 1H05A 1X7WB 2V74B 3UA3A 4E46A 3FYSA 1RNLA 1U90A 2RC5A 4IF4A 4IEIA 3RTCA 2EQBA 4A15A 2WD8A 2YY7A 1XVVA 4RY8A 1K68A 3VU9B 3PFHA 3ZD9A 1XRRA 4M55A 1Y6ZA 4IGFA 4TV9B 3BWCA 4LGCA 1BMDA 1YDWA 3OETA 3KB8A 4G85A 4H4EA 2DUNA 2ONYA 4CCYA 1UKZA 2WNHA 4MUAA 4YRZA 3BJMA 1II8A 1TQ2A 2G5PA 5CA0A 2LZ0A 3UWSA 1QGUA 3CT4A 3OCCA 2B4AA 4KR9A 4M1KA 1N33B 3Q9SA 1TOAA 4HDKB 4WXHA 3NHYA 1R0LA 4AZ3B 1DRKA 2VWPA 4P5DA 2ZWAA 3OQBA 3TMYA 1OX5A 4EX7A 2JI9A 1UBMS 4X7PA 2I3GA 3BPSA 3FWZA 1GPH1 3CGWA 3RKUA 5EJ6A 1QXSA 3HUUA 5ITSA 1URPA 2RARA 4A26A 4M9UA 3NHKA 1Y7LA 1M10A 4NPCA 3TFOA 3FRIA 5HOQA 3F73A 4E4YA 2V6IA 1DAMA 3FWPA 3IL2A 4NAVA 5EWMA 2CNKA 3HKEA 1Z73A 2NSYA 4H7IA 1EJBA 2IUTA 1B8UA 1PLJA 2QD4A 3PD7A 3AOEA 2HWUA 1RE1A 4M0FA 1Z47A 2YFQA 1O7JA 3OZXA 5F5XA 3ZNOA 2JFUA 4WOCA 3EODA 3O1IC 2I3ZA 3EA4A 1TZ2A 3K5HA 4KAFA 4EFLA 3FYUC 3NPMA 2ZW9A 2PMEA 3RJ5A 1SU7A 2C5BA 1C0PA 2F1OA 3BCRA 3CWQA 3GMTA 4PRZA 4XWOA 5HE9A 3NC0C 5K0JA 3T0IA 4FBGA 1Z38A 3S0JA 2AOUB 4NJEA 2HK9A 1W4AA 2HY7A 4MVJH 3M3PA 4E4RA 2GBLA 4EYOA 4M9CA 1IN4A 4KO2S 1ADCA 3ZNNA 3TZKA 4Y2SA 3EVAA 1E89A 4XAQA 4G0ZA 1T8YA 3DE7X 4YMVA 3BM5A 3CMMA 4IV0A 3UC9A 2OZEA 2A6PA 3AF5A 2ZBDA 3IE1A 1DIRA 1KMIY 4FNGA 4ZEMA 4ZT3A 3HR4A 3KB2A 2BFCA 3K72B 3LUCA 1HRKA 1UWVA 2EQ5A 2JH8A 3BIWA 3HG7A 5DGCA 5H7XA 3ZLTA 1ZRSA 5T3UA 3ZCRA 4LYHA 2Z04A 3IAS1 1KDVA 1FFXA 5JAUA 1E8NA 2AJCA 2GK3A 2HD4A 2IXBA 2ZRCA 2GILA 4WK0B 4X9XA 3QKRB 1RVV1 1T36A 1OFVA 3OIUA 3VR6A 1BDJA 2WQ6A 3GAMA 1C4KA 1W0KA 1P75A 3CRRA 1M7BA 3NX4A 1TCUA 5TVGA 3BB4A 5C37A 1EP3B 1Z17A 3FZNA 4C4SA 3CR3C 5C1DA 3ENVA 1XZAA 1JQBA 3H3FA 5KMGA 3MGCA 2F3QA 3OF2A 4L4UA 4KLNA 2XA2A 3WE7A 1YVEI 4ZYYA 2ZJAA 1J5XA 2AD1A 1J2RA 1VLZA 4QREA 5LD2B 1ENYA 2IBTA 3LPAA 4LOAA 1I32A 4D6XA 2B5OA 1FY2A 4J16C 1CJKC 1V9SA 4ZDWA 4AAYA 3HBLA 5A1TA 5KTSA 3U44B 3JQBC 1QRUA 4MIKA 3RUEA 3TL2A 4DL9A 1QG6A 1YSCA 2XUPA 4DILA 1CBUA 1QQ6A 3BMQB 1Z4JA 3ICCA 1JLRA 1ZK1A 3LYUA 4Q05A 3RIEA 4A0HA 1M9NA 1JW9B 2DR0A 1UJCA 4V2UA 1T0BA 1SC1A 1GZ3A 2O2ZA 3IMGA 4YC7A 1SRRA 3CB2A 4YI5A 5ENDA 5JAQA 5BQXA 1RQXA 2XA1A 2Z2JA 2G72A 5CNKA 2I4RA 1JSRA 4YMUA 1DBRA 3GLIA 2HH9A 2ZI6A 4FGZA 4GMDA 3BERA 3L7CA 4Q34A 5EHNA 3T3MB 4MAAA 4X5OA 5CYPA 1X1SA 1NHWA 1NVDA 3A9TA 2VP5A 3PUXA 4JVMA 1V7PC 2V7WA 3RT9A 1XEWY 4F86A 1YZHA 4RKEA 5AI8A 1YVUA 5AI0A 4Z0PA 5HKBA 4TTRA 4HMOA 4BRZA 1YOBA 4I46A 5AK0A 2YOHA 3T3GA 3WYBA 2XCLA 1YZGA 1UC5B 5CB4F 2ENUA 4O29A 2ZCVA 1P4HA 5B53A 4DMHA 4G4JA 3QBVA 3VGJA 5GGXA 1RWNA 4CQMA 3GLRA 2P3OA 4D9KA 4MA0A 4E6EA 1IVSA 1P7WA 3O7WA 2VUTA 3I62A 1VTKA 2A5LA 4X63A 1TUGA 4TKLA 1Q20A 4Z5XA 4OFBA 5BVHA 1Q84A 2VXCA 3BXPA 3ECCA 4MNTA 4OK5A 3TBHA 5DF1A 5KNCA 1ZW1A 1QZTA 3GAAA 3O5AA 2VDWB 1U2GA 4WBSA 3TQHA 2PXXA 4FGWA 1CWUA 1E1RA 3KOZA 4ZMSA 4DNFA 1E18A 2A59A 2PT7A 2DQYA 3H9BA 5DOZA 4J0DA 2O7SA 4OMUA 1U8EA 3K73O 4OXNA 3W7AA 2CNWD 5MFPA 1AKVA 1DC8A 1GNVA 3QVTA 3L4BA 5F7XA 3KSUA 3PEUA 1KY5A 4MV1A 1T1EA 1SXJA 3VPDA 3SICE 8LDHA 2YOGA 3EISA 2W6JD 2X0IA 1J07A 2CFCA 2DHCA 2C3OA 3LBNA 4KRGA 1K4YA 3HB1A 5JVDA 3P0EA 4V2IA 1JLKA 4OX9B 4ZRNA 2BSQA 2PS0A 4FLFA 3IJRA 3QFFA 4IHJF 3KYCB 3LUFA 2XQGA 2BN4A 2LKDA 3RAJA 4B45A 1ECGA 2WYUA 1GRVA 3CZAA 1RACA 2AT1A 2GO7A 3H9GA 3I9NA 3KVYA 4C7JA 5IX8A 1RQPA 1ILEA 4F2HA 1U8TA 3OT1B 4RABA 4Q1BA 3Q11A 4DWJA 1EI9A 1UZUA 2OR3A 1BXKA 4TKUA 1TB4A 1LI7A 1RRVA 1FJ2A 2WSMA 1KHTA 1X1CA 4G26A 1CRZA 3L1HA 1NW3A 3KVNA 2C5LA 3I2JA 3WKDA 2J0SA 1CRQA 1U2TA 2HQ1A 2C57A 4G63A 2CUTA 2EBUA 3NDPA 4KWTA 4MGIR 4K86A 3JRXA 4Q1FA 4NZOA 1HRDA 4E30A 5CTJA 2Q45A 3SHTA 2XIQA 4EL5A 4N1AA 3GNLA 3ZD8A 1RYZA 5JARA 2A9FA 5C5CA 4K9QA 5TQJA 4MR7B 4N6OA 2EVWX 4NV1A 1WDWB 2OHVA 4IIUA 3IS3A 4RE5A 5DM2A 3ZHVA 3HUDA 3OPNA 2WWFA 1DBVO 2VP9A 3ZWDA 5JZVA 5BRJA 4XYMA 2E1RA 4XLZA 3DAHA 4LF5B 4NCIA 2C9ZA 3ERCA 5FTNA 4MGZR 2WKWA 3HUEA 3R3XA 1RVDA 1S2GA 1E9AA 2ZIXB 3BRWD 2Q3CA 3ZHRA 4Y1GA 4IQ0A 4IGAA 2AK3A 1WD7A 4JZKA 5TPWA 1D4FA 4JX8A 4UBKA 1F38A 1Z7BA 2QDKA 3FYUA 1XMOB 1LPOA 2CXUA 3IT0A 3OPYB 4HI0E 1IBRA 1JDTA 1Z08A 3QLVC 2QVZX 3VVMA 5K45A 2JGKA 2AFRA 1BVUA 4NKRA 5IT5A 1CJUC 4L7VA 4FGKA 1A9RA 4NZZA 2HF8A 1Y1QA 3WBKA 1N1EA 5CFMA 2BFBB 4QDOA 4ZVOA 3H3JA 1L8XA 4I6GA 3CW2A 1AHIA 2Q2WA 4YUXA 3DG9A 1J8DA 4E2FA 1J5EB 2P4HX 2QQFA 5DTMA 2H2GA 1ZJ5A 4BRUA 4RTSA 2DPXA 3EUAA 3HKDA 3H8SA 4OCZA 1IZ0A 2JI6A 3AZQA 4R01A 5DBFA 4A2CA 3NB0A 3EDRA 3LF1A 1QGYA 1SC4A 1Z8FA 2QQGA 5REQA 3ASVA 2C7PA 4ZZ2A 1DX9A 1A9ZA 1E1QD 2VHVA 4ETNA 3FH0A 2B7CA 4HEA1 3QOFA 4MXDA 5DNVA 1EQ2A 3RBZA 4BO6A 4IQ4A 5HWSA 1EE2A 2VDOB 4QVGA 2QNBA 3VHLB 3ETCA 4YQFA 1G8FA 2Q27A 5FB3A 4EW1A 2NXEA 1XMJA 2UKDA 4AULA 4CUKA 1B43A 2A4MA 5E38A 4JYZA 2HM7A 3FCUB 3UJ9A 4KQCA 1L5RA 3LTNC 3V8NA 2EP8A 1BRTA 3R5JA 4I4NA 2V1XA 3D2CA 2VCHA 4WXEA 4JB2A 5FI1B 4BASA 1U9JA 3C2QA 1QV6A 2FQ1A 4JLKA 3ZI4A 1HI9A 2I91A 1V5WA 3B13B 3VSEA 3MSXA 2NO9A 3MTEA 1KO8A 4TROA 5EJ9A 4R51A 3TE6A 3U13A 2AJBA 3Q3CA 3V7UA 5LKAA 2UUCB 1H3EA 1QX3A 3ZLBA 3G0OA 4RLSA 4I4TA 2V96A 1SWVA 1MA0A 4RJLA 5TR9A 3HU3A 4COKA 1HM5A 4LECA 3ADBA 4WLOA 5CB4B 3KQOA 1NFRA 3AIKA 5ED4A 3GU3A 4BEVA 2KW5A 1CJVC 1ZR4A 4HEA6 3OEED 1FMJA 3UMRA 4FE7A 1U5BB 4GQAA 2CDRA 3FNFA 3K5IA 2QZ9A 4B7XA 2NYUA 4A9AA 4PQRA 3ICEA 2DWOA 4CBVA 2X86A 4UCXA 1JR4A 2JCGA 2LV8A 4HY3A 1IWBB 4ESOA 4Q4JA 3RYCB 4RK1A 4HUQB 3TD9A 1R5BA 3PIRA 4IS2A 4LF9B 4ZQCB 5IYZF 2I4IA 3I2IA 2XGMA 3ZLUA 1P39A 4V38A 4PPYA 3A8TA 5I4IA 4N5HX 5CEFA 2FH5B 2ZJ4A 3TM5A 1QTNA 3U4QB 1CT9A 1OBVA 2ZS8A 3MBIA 3M6LA 1KARA 2EW8A 2QYOA 4ZOLA 3RYIB 4KFSA 1IAQA 1ZKMA 4WVLA 1H6BA 4XPZA 3K2IA 5D51S 2Q3MA 4BMOB 4S1TA 2QUJA 4XI9A 4LX8A 5CDHA 2P6NA 1UMKA 5EZ6B 1QRSA 2GCOB 4IINA 4MRNA 1XYYA 5KNBA 3C6BA 3BAZA 1PWZA 1AS0A 1E6MA 2O8FA 2J5KA 5I8ZA 3TW6A 2RGNA 5FTJA 3B8EA 4BFWA 2VNHA 1II9A 2B1IA 3NGMA 1JU9A 3QF4A 1Q95A 2WJWA 3OLCX 3R5XA 4MX8A 4QYSA 4LMBA 4ZC8A 3PXXA 4CTMA 4W5QA 3DO5A 1Y5LA 2HMUA 2COEA 3WTCA 2CN1A 3P9SA 3LPDA 3TEJA 2EERA 4YBZA 5H70A 3JD4A 1BE0A 3W5DA 1FDIA 1IZYA 1TK9A 4TXMA 4V39A 1JQJC 4NC9A 4N3AA 5FUWA 3ZZ0A 5IHXA 4WA7A 3LC7O 4GNKA 3FMOB 1NF8A 2F59A 1JAYA 4M0PA 1JI3A 1KAMA 5HJ2A 3L49A 3AF2A 4P31A 2Z5LA 1B6RA 1LPBB 5KWEA 4HX9A 4LRWA 1NM5A 3W3ZB 1NDQA 1ZA1A 4L0CA 4Q9LA 3TD6A 2Y1LA 3IJEB 4D4JA 3SC2A 1I2CA 3TSOA 3COVA 2IU4A 2YHUA 5HZGA 2AK2A 4N48A 1R6DA 3C48A 2CUZA 3DF9A 3N86A 4MKHA 4X1KB 3NONA 4R9RA 1TAUA 3VR2D 2O54A 1B8PA 3JZMA 5G4LA 5DNAA 2IUYA 3OQPA 3MINB 5JU6A 1EFLA 3HB9A 1OB5A 2P6OA 1REQA 3D43A 3JVDA 2V7TA 3HKDB 4HB4A 4REMA 3QXHA 3WRXC 5DNYB 4A0QA 2IODA 2IY9A 2ZG6A 4U3JB 1WHSB 2QGNA 2QZJA 2C4UA 3H2HA 4DADA 3K09C 1SQGA 2IWRA 3QE2A 2E4ZA 5LQNA 1O5TA 3GVCA 5KC8A 2AB0A 4H59A 2B4TO 1ZNZA 4WZAB 3U7IA 2HL6A 3O2JA 3AKCA 2OFWA 1V1JA 1E2DA 5F52A 2NQ8A 4D43A 3CZ9A 4WD3A 2QNIA 2W83A 2R8PA 5IEJA 5TMEA 3W5JA 5C4MA 4ZCIA 4JU9A 4P92A 1VFPA 2A5JA 2XYHA 3SQDA 3IC5A 4FDMA 3FHJA 1XBTA 4ECAA 1DO2A 2QT0A 3GDFA 3OZEA 2BGGA 5AJZA 4XCXA 3INTA 5IZ4A 5CNJA 2ROQA 4OM8A 3TVTA 2BFEA 1F2TB 3P0IA 2FFAA 1BRMA 1U8ZA 1DJQA 1GQYA 3FNIA 4KVGA 3U7HB 3RS7A 3PQCA 4ROTA 4Y6SA 4BKOA 2Q4OA 1NP6A 3AINA 3BK7A 4FEAA 4MMZB 1IBKB 2V8BA 3EIWA 1N1DA 2HADA 5A71A 3JQEA 3FZYA 4LJ4A 2HR1A 4KR0A 5FO0A 3KZMA 5G0WA 2GN0A 2BEWA 5K20A 2ID4A 1KMNA 4PLVA 3GLTA 4FMDF 1CY2A 4GFDA 4HVTA 1WIWA 5ALSA 1FX1A 3PD1A 5T7BA 1U11A 3UJ3X 3WWCA 2WU3A 3A6EA 4FI3C 2X0DA 3AEZA 4KRXA 3ZE2B 1THZA 5KUTA 2PWAA 4H7PA 2JIDA 1XP8A 4K2HA 3ZDFA 4DJDC 1N25A 3M5WA 1QYCA 3EXHB 2L19A 1W93A 4MHSA 2AE2A 2IOFA 2PTGA 3VZBA 4BO7A 4YREA 2H11A 1GGFA 2XMDA 3DMPA 4JJ8A 2P62A 3IRUA 4BE4A 3KYDA 1C3OB 2HWXA 5BQ5A 3KKPA 2XY4A 4KQ2A 5DN6A 4EB8A 2M32A 3NS7A 3FKSD 3P2EA 1I3KA 3NTQA 2HKIA 2QPLA 4Z2YA 2GOYA 1ZFNA 3WYDA 2CLOB 2L69A 5FTMA 1SO8A 3SS7X 1GQRA 3RYHA 4KODA 1H8HD 3CUTA 4YV7A 3PR3A 3T7TA 1N4DA 4EB3A 3HEMA 2WAMA 4E5NA 3M7IA 3ML1A 3NWPA 3STWA 3PHGA 4FP9A 3KUXA 1QE3A 3RBXA 4PLFA 5BSFA 3V8BA 4MZDA 4W6QA 3OZGA 1IATA 1PQPA 4B3GA 4J2TA 4MPRA 3W2FA 1E0KA 2FV8A 1OV4A 4M0UA 1TPZA 3GCGA 4QOHA 4IUDS 2HRQA 2ORED 4DYDA 1EVYA 1XO1A 4LN1A 3R8XA 2PPLA 4GS5A 2AYYA 2CMGA 4FJ1A 1Z2EA 2VXYA 4LXYA 3P97A 5C4IA 3R3HA 4AQ7A 1G5PA 1PYOA 4ZALA 4YP6A 3R3YA 4P33A 4RIIA 3X3HA 5CDGA 1CP3A 1UKCA 1TVEA 1E4EB 1LZKA 4KSYA 3QEBZ 4LJRA 3ZVLA 1FQKA 4MCJA 4Y98A 2OESA 4ERNA 3H2BA 2DBQA 3FCAA 3P9KA 2XQJA 1V8FA 3ZTWA 3VAYA 1XZLA 2VK4A 4ZI7F 1K8YB 2ZUCA 1UXGA 2GPTA 1NFFA 3CHYA 4ER5A 4HVAA 1WPXA 2B7LA 3PX7A 2PBZA 2CXSA 2W43A 2JLYA 4NU0A 1ZD5A 3JVVA 3AHEA 1SBTA 1X14A 3QU2A 2FZLA 2QTWB 3MFQA 3R5HA 4W5WA 3U61B 2PAFA 1T15A 3DXFA 3JZAA 3SXUA 1G8JA 1I7PA 4KMOA 1Y3CE 3GRCA 1PGOA 1E1YA 2QW8A 3PFIA 1D7OA 3FSJX 5F3WB 3RODA 3WSTA 5IM4F 5A0VA 1FUKA 2AI3A 3V1LA 4WFJA 1N32B 2PIDA 3NANA 2C7QA 2J85A 5F1OA 4KAXA 1S2DA 4D4LA 1VKJA 3ODGA 2ECQA 3WWDA 4K03A 2CV1A 2V7QA 3W6NA 4FFBA 5LP6B 2N75A 1JFVA 4ITUA 5F2KA 5MHTA 1DRUA 3GWZA 1QK5A 2ERYA 2J5QA 2SKEA 3CZ5A 3IB6A 4IH1A 3AERB 5TC4A 3RSSA 5I7OA 2X4LA 3R1IA 3OECA 2QYTA 2JGRA 3T12A 3ZXXA 3UATA 3AHJA 1OV6A 1YQEA 1NUUA 1YQ9A 1R0XA 2JIZD 5K4HA 4NWIA 2QAGA 3RVSA 1P61B 3FX2A 3UOWA 4B79A 4C4TA 1RPZA 1XUOA 1H8HA 1G1MA 1WRBA 2QRVA 1EGHA 4JHXA 5FQNA 2ZJ6A 4E33A 1YE5A 3HSKA 2OSBA 2RSLA 5CX4A 4BRWA 2JGMA 4BE7B 3NBAA 2C4KA 2JH9A 2QXUA 2I7VA 4PCVA 5KB3A 2IX9A 4X1KA 2FZ5A 4HFMA 5EYPB 2YV1A 2WWGA 3IP9A 4HWPA 5EUMA 2VDRB 5CB4A 1F5NA 5A2QA 4JQYA 4LCEA 3AM1A 1X8JA 2ZM5A 1TXGA 3C70A 3U4AA 5LC1A 2WF6A 2WMYA 1RAEA 4RSHA 4HEHA 4F93B 5HS4A 3BGSA 1SA0B 1OBFO 1TFUA 4HX5A 3ZQUA 1P4JA 1FVFA 1JKJA 1T6ZA 3IAHA 2W2OA 5K3AA 4Q4AA 5AYVA 5I9NA 2GZ2A 5EHXA 2O3RA 1IUKA 2ODAA 2VBFA 3JXEA 4WUTA 3QYFA 4YAIA 5DISB 1UBUS 1QIIA 1U8CB 1WVIA 2HA2A 3IAS6 2HQRA 4WT7A 3CKKA 4RTQA 2DFPA 3HL0A 2NT3A 2RHLA 2LXNA 3AWDA 5LIPA 4MS3B 1ISPA 1KYWA 3LK6A 3NBZC 4QEDA 4XGRA 2J6IA 3VBCA 1PWYE 2DY1A 5LQSA 1A96A 1GGKA 1ZGJA 2FSVC 3OZCA 3VPGA 3FE2A 3EH1A 3RVOA 4JQCA 1XKLA 1FBNA 2PUJA 3G9TA 2QUKA 5LWQA 2GCOA 2IITA 3ACBA 5F9FA 4AY5A 1QZZA 1TRKA 1TA0A 1UFOA 4B3DA 4QXPA 1JBQA 4FOPA 4JLAA 4IWYA 3VR4D 4QWMA 2PH7A 4NCXA 1XWFA 1E7RA 4G0VA 3KLMX 2OG1A 2FLKA 2RGEA 3DP7A 3LS2A 2VYQA 4HP8A 1FRNA 1PJTA 1YE3A 1OYOA 4G5QA 4JBGA 4KFUA