4C0BA

Structure of wild-type clp1p-pcf11p (454 -563) complex
Total Genus 131
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
131
sequence length
428
structure length
428
Chain Sequence
TGDNEWHKLVIPKGSDWQIDLKAEGKLIVKVNSGIVEIFGTELAVDDEYTFQNWKFPIYAVEETELLWKCPDLTTNTITVKPNHTMKYIYNLHFMLEKIRMSNFEGPRVVIVGGSQTGKTSLSRTLCSYALKFNAYQPLYINLDPQQPIFTVPGCISATPISDILDAQLPTWGQSLTSGATLLHNKQPMVKNFGLERINENKDLYLECISQLGQVVGQRLHLDPQVRRSGCIVDTPSISQLDENLAELHHIIEKLNVNIMLVLCSETDPLWEKVKKTFGPELGNNNIFFIPKLDGVSAVDDVYKRSLQRTSIREYFYGSLDTALSPYAIGVDYEDLTIWKPSNVFDNEVGRVELFPVTITPSNLQHAIIAITFAERRADQATVIKSPILGFALITEVNEKRRKLRVLLPVPGRLPSKAMILTSYRYLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for ATP loss by Clp1p in a G135R mutant protein.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
molecule keywords MRNA CLEAVAGE AND POLYADENYLATION FACTOR CLP1
total genus 131
structure length 428
sequence length 428
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06807 Clp1 Pre-mRNA cleavage complex II protein Clp1
A PF16573 CLP1_N N-terminal beta-sandwich domain of polyadenylation factor
A PF16575 CLP1_P mRNA cleavage and polyadenylation factor CLP1 P-loop
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.1030 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4c0bA01
3.30.70.2410 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4c0bA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4c0bA02
1DADA 3EPKA 4MGYR 1Q20A 2X8AA 4MH0R 6Q21A 3BGWA 3SYKA 2IBMA 3AV0B 2C99A 4XWAA 2ZRNA 1QHHA 2HLDD 2FNAA 3RAPR 3CH4B 4BZPA 1NVVR 4OQNA 4UXIA 4OHXA 3SZRA 3IO5A 3MD0A 3K0FA 4KLZA 4RFVA 2WJIA 5J47A 4HDCA 3ADBA 2XJ9A 1E2QA 3IIKA 2RGXA 3K0AB 3U3MA 1GZSA 3GJ3A 2QQEA 5J4LA 1NN0A 2D06A 3T1OA 1LS1A 1YZGA 5HE8A 4LJ4A 4TMVA 3O47A 2QM7A 4MYUA 2JIZA 2D7DA 1ZCAA 3UIEA 2WJGA 3NH9A 2X19A 3GLIE 4BZQA 4TT3A 3HR8A 1G8YA 4MGIR 3GEEA 5G3ZA 2IS1A 4IDNA 1S96A 4L9SA 1JJ7A 1OE0A 3LH5A 3OIWA 4PSKA 3KXIA 4FMBB 4B6EA 4Z8YA 3CWZA 4R2IA 3SEAA 3VQTA 4JBYA 3KFVA 2GK7A 3LX8A 4UJ5A 3FOZA 2JDIA 3ONWA 2YC4C 4JLVA 1ZU5A 1IXSB 3DL0A 3NC0C 2IX3A 1KI8A 3BH6A 5FPHA 2D2FA 4TLCA 2FFAA 5EE9A 3GLFB 2FSFA 3N2EA 3I72A 2XSZD 1BKDR 3B2EA 1AIPA 4L16A 1R5OA 3TJZA 2J5XA 4YMVA 1WP9A 1O87A 2ZJAA 3AEZA 1N6KA 3AVPA 4P4UA 1F2UA 1M7HA 2P67A 4WZBE 3KJGA 3EPLA 1R0YA 1OH5A 1S3SA 1CTQA 5KYKA 2BWJA 2ZJOA 4QGGA 4MRSA 3SQXA 4QGHA 1GFIA 5TMPA 5B30A 3UKDA 3DO6A 3IHLA 3M6AA 4KCGA 1CU1A 2PT7A 2DWQA 2QSYA 1R5BA 4BFWA 1K5DA 1S1MA 1OXTA 1KAGA 3S1AA 2HUPA 4KLNA 1FPMA 4Q4HA 1AZTA 1KSFX 2I1QA 1QG2A 4GP6A 4OL0A 3WXMA 1FX0B 4HUQA 4F38A 5J4VA 1EFCA 1Z0AA 4WVFA 3A4NA 2O8DB 4BRWA 3VMFA 1JR3A 1IONA 2JCSA 1YZQA 3VKHA 4G5QA 2JEOA 1CLUA 4UXJA 3FGNA 1YR7A 3EC2A 5LD2B 1E0AA 5FOVA 3C15C 4C0KA 1TU3A 2WJVA 2C03A 4A92A 2XNDA 4TLBA 2CDNA 1JEDA 1IOZA 4JVLA 1KI1A 3BAFA 1RE0A 3CPJB 5GVRA 5HZKA 1I4TD 1KDRA 4O3MA 1KY3A 2O8DA 1LY1A 4XVRA 2QENA 4Q47A 4YDHB 2OEPA 5LPNA 2ZJBA 4WBSA 4DUGA 2A78A 1M1YE 3ZVRA 2YWEA 3QI2A 5EZ5A 2ZSAA 3THXB 2JLUA 1F5NA 2XTNA 2F43B 1OYYA 3LD9A 2C9OA 3CZPA 2KBFA 4MITA 1JBKA 2DFTA 2WSSD 4XIGS 4CT4B 3B1XA 1RZ3A 2FV8A 4NCKA 1ZCBA 2P6RA 1TEVA 3LFUA 2CNWD 1NMXA 1TF5A 1CF4A 1XD2A 1EWQA 2QTHA 2XNSA 3EX7C 2JATA 3QPWA 1FUKA 3A58B 3EW9A 2AD5A 5JSZA 2I1VB 1MABA 1WDTA 3CKLA 5JZVA 2ZSDA 3O8DA 3NHBA 4G5SA 1XPOA 2K5UA 4ZIRA 1E3MA 2ZRMA 1E2LA 4IFBA 1XEXB 1VPLA 2OFOA 2JLWA 4W5WA 1ESNA 3PEUA 5GADl 1TQ2A 1T8UA 3TMKA 4DLRA 1XJ0A 3FHOA 3QE0A 1E4VA 4H1UA 3OIYA 4LHVA 4LPKA 4PPGA 4URZR 5FPYA 3LBNA 2CJWA 4NYMR 1P7CA 3K9NA 1CEEA 1D9ZA 2QUZA 4B3CA 4Z51A 4N0DA 3WNDA 4BLRA 5IT5A 2O52A 4PAOA 4Q4LA 2PCLA 5AUQA 5CDFE 4DLYA 1KDPA 2UZ3A 4LBVA 3B60A 4TL6A 4IHQA 4HZUA 1LW7A 1HEIA 1XEXA 4QBIA 4JLAA 3QKSA 3UMRA 3OEHA 2OAP1 4FCVA 1E0SA 2ZXUA 4QHTA 3EPJA 4NE2A 2P0EA 1G19A 1X1RA 1XD2B 2CHQA 4A8JC 2C8VA 2Q3FA 1DAGA 1N6NA 2BM1A 1XEFA 5FUXA 3VHXA 4BFUA 2IYTA 3LAWA 821PA 2WHXA 3QXXA 5EXTA 4AY2A 5FTMA 2HF9A 2VQSA 1OB2A 2OHFA 1KY2A 3TSOA 3ZJYA 4TL8A 4HLUA 1COWA 2A5DA 4PHTA 2BCGY 4HUTA 2C78A 1IBRA 1J70A 4P4SB 4FWTA 3H1TA 4D80A 5E4FA 3QF4B 1YR8A 1Z6XA 3BWDD 4IW3B 3T1QA 2OLJA 3ZD6A 1XJQA 3X1ZA 1G21E 2BMJA 3AKEA 1GILA 1E99A 1XBTA 2C04A 1XD8A 2JLVA 3IUYA 2AL7A 2NPIA 2IYUA 4EQ6A 1SVOA 2GCPA 3NBZC 4FMDB 1ZM7A 2WWFA 4B74A 1W48A 3GLIA 2IYRA 5TARA 1R8SA 1DO2A 4D26A 1SXJD 3P32A 3P4YA 1VCMA 5LB4A 3ZIAA 3SYNA 4QNRA 4M1OA 1P2VA 4IOMA 1RKBA 2NIPA 2GZHA 1EX7A 1ZD1A 2IHYA 3OEED 4AD8A 3K8YA 1U0HC 1XEWY 3SJBA 3EIHA 1OKKA 2A5JA 2QP9X 1E2IA 1OPXA 3RS2A 3U3RA 1G8FA 1T5LA 2YOHA 4DCTA 4TT3D 1DVRA 2Z4RA 1YE8A 3RS0A 2CVFA 2CK3D 2QA5A 1Q44A 1MO5A 4JZKA 1AS3A 1E9AA 4C7OB 2ANCA 3EZ9A 2E87A 3QENA 1CJVC 1J2JA 4F91B 3K0AA 2BMDA 4RFSB 1D6JA 4V02A 5F9HA 2J59A 1N6LA 2V9PA 4OJQA 1F2UB 2E9SA 4OI4A 2PX3A 3AUYA 3PV0A 2SHKA 3ICEA 4US1R 4RD0A 3D3QA 2D62A 1V5WA 1QZXA 1Z6AA 1H8EA 1Y63A 3SBEA 2W00A 1MT0A 1TAGA 3IBYA 5AUOB 3NBYC 3TKLA 1PZNA 1ZD9A 3WRXC 4LWZA 4I1OA 2XX3A 4TMTA 4TYQA 2ZSEA 3VKWA 2ZRPA 2GDJA 2HYDA 2IYWA 4CYMA 2AFIE 1SVMA 4DIEA 3CB4A 1A1VA 1ZINA 1E2HA 2WM9B 1E94E 4DT1B 3TVDA 4C0BA 1HT1E 3BB1A 3K09C 1P9NA 3RWOA 1XTRA 4B35A 1NNEA 2DBYA 4BWYA 4C30A 2CNWA 2DWPA 2VPPA 2FMXA 5G3YA 4US2R 3OEEA 2EYQA 3OAAD 3Q5EA 4RD3A 1ZYUA 4PO1A 1BMFD 4YDSA 5DLQC 4C0QC 4TZ6A 3H4MA 4MKHA 1U98A 3H84A 2QSZA 3IPYA 3GJ8A 1S4QA 4N3NA 2ZYTX 2X2EA 4WA7A 4LHWA 2V1UA 4MYHA 5D3MB 3UANA 2NZ8A 3U3JA 2NO6A 2CLCX 1N3BA 1G3RA 1KO1A 5JEEA 4NYJQ 3REFA 1UAAA 1RC8A 1VDZA 2XZLA 2WIAA 2BBOA 1XF9A 4B3GA 3X1WA 2RHDA 1GL6A 3AP2A 1OIWA 3KKQA 4NCJA 3THYB 2QN6A 1LB1B 4B43A 3NG1A 4LV8B 4QC2A 1WF3A 1M6NA 4I99A 2GXUA 4BFVA 3L82B 3Q8XB 1ELOA 2R44A 3OF5A 2ZE7A 1AQYA 2O5VA 1A4RA 1IXRC 2HCJB 3HU3A 5BQ5A 4EPRA 3GPLA 2FFHA 3FMIA 4JYCA 4OHWA 1U99A 3K70C 5EP4A 1HUQA 3UPUA 3GLHA 1E2MA 2BJWA 4TMKA 2O8EA 5J4KA 1IQPA 1UBFA 3HJNA 4PO9A 1EK0A 2OCPA 3P20A 1R5NA 2CL7X 3A37A 4JL6A 4Q9KA 3I5XA 1KMQA 1NJFA 1DPFA 2GBLC 1E9RA 1RJ9B 1K5GA 3I3SR 4LYJA 3OZXA 1SGWA 4URYR 2VHTA 3WYFA 2FN4A 1OIXA 1ZAKA 3AQ4A 5CIQA 2ZI3A 2RGCA 1G7TA 1W36B 2WOJA 5EJEA 2XAUA 2VA8A 1XMSA 5IDVA 3O8BA 4X8MA 1M74A 4DEYA 4RZXA 4XOIA 4IOJA 1UBEA 4DLSA 2AFHE 4B44A 3E2IA 1G3QA 4UQOA 3CX7A 5FOWA 1DAEA 2QMOA 1Z5ZA 1DS6A 1UKYA 2NO1A 4KITB 4RJLA 2GJKA 2W2XA 3UATA 4Q1EA 4TTPA 2QMEA 1P9WA 1ZM2A 4PHGA 4NONA 2G88A 4JVMA 5JJLA 4C0LA 2ZTSA 1WRBA 5FPTA 2F3RA 1ZMXA 3U4QA 2NG1A 2LKCA 2HF8A 5A4JA 1P5ZB 3LQRA 2PH1A 3ND9A 1N0VC 2F3TA 2BMFA 4GZLA 5AJYA 1LV7A 3TUIC 3IILA 4MKGA 3EAQA 1AN0A 1QHXA 4MYCA 1L8QA 3ZQJA 3F8TA 5B58C 2WWXA 3VU9B 4JKYA 3NIBA 4ZO4A 1NIPA 1OHHD 4TYPA 2G1KA 3CO5A 4BFSA 1B23P 4OI2A 2EYUA 2IEYA 1Z29A 4YQFA 3AF1A 1W2HA 1OHHA 4TYWA 3GEIA 2JJ1D 2FA9A 4LV6A 4ZKDA 1K8RA 2H1LA 2ZQ5A 4A15A 4CEHB 1AJEA 3ADKA 4GT1A 5FPSA 1N6IA 1KMHB 4TLEA 4W7SA 2X2FA 1W0JA 3CPHA 4LDJA 1CXZA 1Z63A 5TDHA 1FMLA 3TRFA 1AQUA 1R2QA 5GJWC 2QP3A 1OXXK 4QGFA 4AYTA 4CT5A 4BPBA 3B9QA 1TEXA 1Z0IA 1ZC4A 2GJAA 2Z6VA 2R65A 3IGFA 3K0SA 4LC0A 4IEIA 1CR4A 4GOKA 2YWFA 3EZ6A 3IIJA 2GEUA 4I4LA 4JLMA 2C9YA 4ON9A 3SN6A 5F3WB 1XPUA 1IY1A 3EWAA 1F2TA 4M1YA 4MKIA 4AKIA 3KX2A 3A8TA 1Q1QA 4CEJA 1XXHB 5EZ6B 1KNXA 1ZJ6A 3GJ6A 3D8BA 1G3MA 1RW4A 4IVPA 2R8RA 1YU9A 4HZIA 4PC6A 3QEJA 1DEKA 2OILA 4LJ9A 2R6AA 4JLNA 3KQHA 2QBYB 2J46A 3H0KA 4OYHA 5CK5A 4I1VA 3RABA 1XTSA 1I4LD 4AK9A 2C5LA 3X1XA 5AK0A 3ZZ0A 3AB3A 4XVUA 4F7WA 1OB5A 2J0QA 1KI7A 4M1KA 1RRPA 2OESA 5DE3A 1DO0A 2PZFA 1Q1EA 2CK3A 4YMWA 1GTVA 1IAQA 1VCIA 3ZQ6A 1XRJA 3CH5A 3RRMA 1DG3A 5JECA 5DI9A 1QHYA 2VIIA 4JBXA 4LYFA 3REGA 3TNFA 4KAXA 4JJZA 3WRYC 4QHYA 1LNZA 4ILEA 1J8YF 1UEIA 3BD9A 1GL9B 1SKQA 3DPUA 1X8LA 1HTWA 4IJMA 1IN8A 1NVWQ 1EFRA 5EE3A 3I92A 1E9DA 3LWNA 3IO3A 3WHKA 4CVNA 3E5HA 4UXHA 5DIFA 3FPAA 2GVZC 2B7BA 3ASZA 4Q9IA 2QGZA 2VO1A 2Q9CA 2ZI9A 1II0A 1YVDA 1T8TA 4FD2A 1T3HA 4GPTA 5FTLA 2RB4A 4FWIB 4DB4A 4EFMA 2D2EA 2EWWA 3SJZA 2GWHA 4DHEA 3AVYA 1FQJA 4DIDA 3GP8A 3NEJA 3MWYW 4IDPA 3W8NA 4KU4A 4A0RA 4B34A 1US8B 1VCOA 2MSCB 3U61B 2C96A 3FMFA 4PAQA 1M2OB 3T15A 3A6PC 2GCNA 3PCRB 4Q02A 4M21A 2XB2A 1WE2A 4TYNA 2O8EB 1CP2A 2GKSA 1KOFA 4DCUA 1MO3A 1E79D 1EFUA 5JJKA 1E2JA 3VTKA 1Y3AA 3DM5A 2HEIA 2FSGA 4Q66C 3UK6A 4JLOA 5JI3E 3FDIA 3K9HA 1G64A 2BBTA 2J45A 5E7IA 3CLVA 1WXQA 3SI7A 2ZI7A 4I1UA 521PA 3SU8A 2C2HA 2CHVA 3AF2A 4Q1FA 4PC1A 1E2NA 2HXYA 1U0LA 5KO2A 2P65A 3TR5A 4EIWA 5IF9A 1Z2CA 1DAMA 1OFHA 4DDVA 2OZEA 4HZUB 3KQUA 5EUQB 5JWOA 3MWLA 4KXFB 3ZH9B 4YMUA 1C1YA 4ZV4A 2QAJA 4U7DA 1UDXA 3U6BA 4M4SA 3K0FB 3RSLA 4ESHA 3SS8A 4CEJB 2H16A 4TL7A 3LVQE 4BLQA 1G8GA 1XTJA 4Z1MD 2WJJA 4XSGA 2IUUA 1T3SA 3E1SA 3DMDA 2BKEA 1KHTA 4A0GA 3KTAB 1A5TA 3KZ1E 4JVNA 2WJYA 2GZAA 3KDSE 3L0OA 2QPOA 3X2SA 1SKYB 2G6BA 1NLZA 1HV8A 4IXNA 3LA6A 3F0TA 4O2LA 2IF0A 5HCIA 4ZIRB 2IHBA 1S9DA 5HR5A 2W0MA 1JEEA 1QVAA 4LI0A 1N0UA 4EFNA 2GF9A 2IYZA 2GHIA 2ZYWX 2RGGA 4JLPA 3FVQA 1KIMA 3FYHA 5FI1B 4LX0A 4MRVA 4TMZA 5DISB 4S35A 4ZDKA 4OI1A 1GIAA 2VYFA 3AVOA 1PUIA 5J4YA 3OEHD 4GMDA 4U5XA 3CR7A 2AHOA 1E2PA 4HLQB 1FTSA 3AF4A 1OFUX 1W36D 4Q9HA 1GM5A 1IN7A 1W5SA 1EESA 2V1XA 3SJAA 1N6OA 1G9XA 1G5RA 1L4YA 3BB4A 3RS4A 3SR0A 3WYAA 1IN5A 3SYLA 4QFMA 1XMIA 3DMNA 3MRSA 3W6OA 4KBGA 3TR0A 2QY9A 1D8TA 1F48A 2BJVA 2VP9A 4PSVA 3THWA 2O8CA 2PJRA 1V43A 4QNMA 1JB1A 1KJYA 2F6RA 3C5HA 1SXJA 1UFQA 1VTKA 1Z08A 4V0OA 2QBYA 1K6MA 1KZ7B 3WMGA 4M9ZA 4P32A 4GZMA 3RRYA 5AJXA 2IF2A 2VSOA 1Z0KA 1ZUNB 1G8HA 4KODA 4F4CA 2R2AA 4KSBA 1U9IA 2OCYC 2VHCA 4ZI2A 4JYBA 4LV5B 5AWFC 3N70A 3K9GA 3WBJA 1Q3TA 2F1HA 3SOPA 3EXAA 3GLIB 3TAHA 3I8XA 4DJTA 2JJ2D 3MLEA 3RANA 4Q4AA 1Z6TA 4M1TA 1E2FA 1U8ZA 2GA8A 2H5EA 1MO4A 2PT5A 4ZKEA 3HYTA 3M1IA 1TL7C 1R4AA 2HLDA 2VRWA 4PQFA 4IXMA 5C2JB 2XXAA 5FUWA 4LC1A 4L8GA 1T4GA 1KI2A 1OXUA 3V9PA 5KPDA 3OIUA 2D3WA 3AGPA 1I4DD 5J4HA 1P62B 3SC3A 5FOUA 5A0FA 5FBVB 1OFIA 4R9UC 3C41J 2F7SA 1ZM3A 4OI0A 3AVUA 1NLFA 5KSYA 1EGAA 2FFBA 1KO7A 3PQCA 3RDPA 1Z22A 4JLKA 3PUZA 4BFTA 4GI7A 5IK2D 3TE6A 3CNOA 3KB1A 4ZDWA 2QAGA 2PX0A 5KSPA 1VIYA 2HDNB 3MMPA 4Q1BA 3CNLA 1ZP6A 4FMCB 3RS7A 4TYYA 2BDTA 1Z06A 1KI9A 4N1AA 5SZHB 4DDWA 1NBME 4MA4A 2OXCA 5GVSA 4LK2A 3QUSA 1CRQA 1T5IA 1MRNA 2WWGA 5AJVB 4LHXA 4RD1A 8OHMA 2XJ4A 2B8WA 2R62A 3N2IA 3U7EB 2F1JA 2CVHA 4HB4A 2OAQ1 2RAPA 2ZRHA 4D2IA 4R71A 5ELXA 2WSSA 4LHYA 1CR1A 3BJIC 4KVGA 1F6BA 2ZI5A 3HDTA 1ZIPA 1KKMA 3BC1A 1UPTA 3KKPA 3E70C 5DN6D 5AUPB 1D2EA 1G17A 4US0R 4GBMA 1CR0A 1SQ5A 4DVGA 4KO8A 3ZVLA 1GITA 3BFXA 3QXSA 1G41A 3F3YA 4XD7A 4AURA 3I32A 2LWIA 4LZZA 4C2UA 1QHHB 2F43A 5KPJA 2F55A 2PL3A 2VP4A 5K8TA 1VKJA 4O0MA 4RZ2A 4NBSA 3QKRB 3GLFE 2VP6A 1R7RA 4FIDA 4HAWA 4JLDA 4Q7LA 1LVGA 5B57C 1DOAA 3AUXA 2HJVA 2J3EA 3NKVA 2ZJ8A 2GTPA 3FWYA 3K1JA 4NYMQ 3BK7A 1FW6A 3U3OA 5L8VA 5L3SA 2PLRA 3THXA 1DARA 1P72A 3CM0A 3KTAA 2QRNA 1SVIA 1DTSA 1D5CA 1E2GA 4DKXA 5C1BA 2ZRCA 3B1VA 4LY6A 3FHCB 1NRJB 4HAVA 4POAA 2EVWX 2YC2C 5FR2A 5DN6A 4D4JA 621PA 4CF7A 3CRW1 4ASUA 2ZS8A 2Z0MA 2BM0A 3JZAA 5CYOA 3RYTC 3TLXA 4JS0A 4DCVA 1VG8A 3GLGA 5DH9A 3BH7A 2JJ8A 2JJ2A 3A36A 3IKJA 3MG9A 2IK8A 2PEYA 4E5UA 2FU5C 4MGKR 3TUJC 2V7QD 1E0KA 3A4LA 4RFSA 1E9CA 2J7PD 3BB3A 2P5TB 1RIFA 2WBLC 5CIWA 2BKUA 2W2VA 1COWD 3KJIA 4BFYA 2IWHA 3FMOB 2GEVA 4WXRA 1ZUHA 4QKQA 4B2PA 4JL5A 1KK0A 5FFMA 1LS6A 2EQBA 2ZSFA 4TWZA 1HH4A 5L3QB 2FG5A 3UMSA 2XTZA 4A2PA 3EASA 2GCOA 2QG6A 3WP0A 2GRJA 2O8CB 1A82A 1WB9A 2G1JA 2NO9A 2ZRJA 2P2LA 4I1SA 1Q0UA 3W5IA 4ZCMA 2IUSA 1HY3A 4U02A 4LHZA 3SHFA 2WJHA 3BFVA 4D0NA 2YVUA 1US8A 3LW7A 3MCAA 2GF0A 3QEOA 1GKUB 3BH0A 4NCHA 2L0XA 1X6VA 3QOFA 4OQXA 4MRRA 2IC5A 2GAAA 4B3FX 1HQCA 1JXMA 2DHRA 1F3OA 3C4JA 2QROA 1P2UA 1CJMA 3CW2A 1PUJA 2ZSBA 4X8OA 1QHGA 2RGNC 3LRPA 3T1VA 3GLHE 4JBWA 5K8UA 1E69A 1Q1BA 3T61A 5HE9A 3QF4A 2UVQA 5C4MA 2V6IA 4CDGA 1VYVA 1SHZA 1TQDA 4M1SA 3C8UA 4DDTA 1YRAA 3WP1B 2J0UA 1S9HA 2BV3A 4Q1DA 4F4IA 3CNNA 3ZZTA 3K70D 1CIPA 5DSZA 1AM4D 1E1RD 1YR6A 2RH5A 2ZS7A 1KTVA 3OAAA 2XTMA 2ODBA 1W47A 4MUAA 2ZRAA 2QRZA 2OO7A 4QM6A 4NYIQ 1L7VC 2E1RA 3VX3A 4UNRA 3QVUA 2VBCA 1N25A 2IS4A 4CRWB 3P4XA 1NN3A 1LFDB 2Z43A 2IS2A 1R6BX 4PZYA 4NL4H 3A1SA 3AKCA 3L2OB 4GOXA 2IEZA 1F60A 1W0JD 4IDHA 2REOA 4OHYA 1EXMA 2ZU6A 4PFSA 1P2SA 3B1ZA 4IKEA 4Q9JA 2OE2A 4CW7A 4Q7KA 4P4TA 5JHGB 4PR0A 2F1IA 1AKEA 2BBSA 1UKZA 2AXNA 2BBWA 3IHWA 3TVTA 1W4AA 1YZKA 4EFLA 3VR5A 1F2TB 2F1RA 3CX6A 3GFPA 4P3YA 4D81A 1G20E 2WAXA 3D6TB 4G01B 4KYIB 1L2TA 5EE1A 5G53C 1A2KC 2QQ0A 3QNUA 2DY1A 2ZRBA 3QPVA 3WNBA 1XWIA 3H2YA 1Z47A 3IQXA 5FOSA 1W0KD 4FMCF 1GG2A 2PMDA 4KVAA 2KJQA 2ZRFA 4B2LA 4EPWA 5SZKB 2ZVQX 1RYFA 4EJSC 1JI0A 3KXKA 1G291 5LBIA 4HI0E 5GJBA 1YHNA 2Q9AA 1UDWA 4W5HA 2VF8A 1ZNXA 3VX4A 2O0KA 3HPRA 1SVLA 2OFWA 4ARZA 4DUGD 2DFLA 4HLUC 4LPSA 2WIBA 4P33A 5BYJA 1MR3F 2J7PA 1E96A 4W9MC 1VIAA 2FEMA 2ONKA 3FE2A 1AS2A 3NHAA 2GXSA 2QM8A 4O2RA 1S1CA 4LOAA 2EW1A 4V03A 2OT3B 5FBLB 4B71A 1CRPA 5J5CA 1MOZA 3D7MA 5P21A 4IDOA 4Q4AB 1TADA 2ZU0C 2I3BA 3B78A 3EZFA 2ZRIA 2RGEA 4NDZA 2JDID 2IS6A 3KUDA 3U7GA 1JAIA 1EFRD 3P26A 1G6HA 4GRAA 3R7WA 1QHSA 2Z4SA 3N5CA 1R10A 3L8YA 3QKSB 4M9QA 4BFXA 5DHAA 1TX4B 2UZIR 2ATVA 3K53A 3QKUA 1J8MF 4M8NE 2AR7A 2OCBA 3CR8A 3L0IB 5KDDA 4B2IA 5TVKA 3B7GA 721PA 3ZVMA 1D9XA 3U2QA 1JALA 3GLGB 5JWRA 3SFZA 5JMTA 1H65A 2ZJ2A 4Q48A 3W8RA 1E2KA 2AN9A 2ERXA 4TMXA 4DWJA 1IN6A 1XCPA 1P9RA 4DSTA 1HE8B 3A1UA 4G0NA 3W3AA 5CDFA 3AM1A 2ZYUX 3VNVA 3PEVA 1VG9B 1NVUQ 4UNNA 5EXXA 2DWOA 1UBCA 1X8KA 4A2QA 5JS8A 1QHIA 3PIRA 4TTRA 4D82A 3B82A 1U94A 3AKDA 1W44A 4C0AC 2PZGA 1Q12A 3HYRA 2C98A 1VHLA 4AKEA 3FKSA 3WMFA 4PANA 4ZDIA 1KMHA 2RGNA 1E1RA 1P61B 1N6HA 2IYSA 3EZ2A 5IK2A 1M7BA 3CF2A 4GMXA 5JLJA 2IXEA 1YKSA 5C4GB 4LYHA 3T35A 3NDPA 2B8TA 4NYIR 1RJ9A 1NBMD 1J7KA 1Z07A 4NTZA 1N5LA 1UADA 4HYYA 5FTKA 4KV9A 2V4ZA 2P3SA 4FCWA 4AWXA 4LJYA 4D4MA 1KI6A 2REBA 5HKKA 2GESA 4XTRA 3NBXX 2HV8A 2GNOA 4NP6A 3QIAA 1HA3A 1N5JA 1G4UR 2KWIA 3THOA 2G9NA 3A1WA 1KKLA 2YJTD 4FI3C 4A36A 4C3ZA 1TQ4A 3K9LA 2EWVA 1ZU4A 4NKRA 5LD2C 4W5JA 3KQLA 2JAQA 1BOFA 3QXHA 2EFHB 4WZAE 1DBSA 1P75A 2GAOA 2H7VA 2VH5R 4HB0A 5TXGA 3U44B 4LSGA 1M34E 2V8OA 3Q7QA 2XITA 3J81k 2FPLA 3DOFA 4V0ME 4MGZR 4OQLA 1J90A 4Q4JA 4Q1AA 2ZUCA 3I61A 1PVOA 1LF0A 3LDAA 2QAGB 4LGMA 3MWKA 3UXMA 3QSYA 4KSCA 1CULC 2BOVA 3GJ5A 1II8A 2P5SA 4F92B 4RCZA 2JA1A 2TMKA 5G41A 1ZRHA 1S3GA 2F9LA 5DYIA 4P0TA 4Q4HB 1D2NA 2VP2A 1ZIOA 3M4YA 3UG7A 1NSTA 2Q9BA 1DAHA 1H8HA 3GMTA 4EJSA 3R20A 4AKGA 4GOJA 5KDOA 2WSMA 4TSFA 3EIEA 2WKRA 2QMHA 3CUEF 1G3IA 1ZNZA 1GP2A 1H8ED 4TLDA 4B47A 5TY0A 3TQCA 4XWKA 2WWYA 2OG2A 5JWHA 1W0KA 3AP1A 4D6PA 4TL9A 1TQ6A 5DHFA 4GFDA 5M04A 1KZGB 3ASYA 4X8HA 5L3RA 4A2WA 4RD6A 5UKDA 2V6JA 4AYWA 2YYZA 1NIJA 3CONA 2HT6A 3PUWA 4DZZA 2CMKA 2OBMA 3CBQA 3GLHB 3QG1A 2YNMA 3WBKA 2LKDA 1T9HA 1G6OA 4BZXA 1OIVA 4YC7A 3T1TA 2QEQA 3IQWA 1OV4A 4IOKA 4L9WA 2CLDX 3SHWA 2I4IA 4G5GA 2FH5B 3KB2A 4DLWA 4JT4A 3V4RA 4MYTA 4HATA 5KUTA 4PX9A 5FTNA 2IYYA 4E07A 1NMZA 4PQRA 4QJ4A 3B8HA 4B76A 1Z6GA 4NZYA 3K0EA 1BO6A 2ORWA 2C77A 4JSTA 2GXAA 2G83A 4K81B 4EJSB 3FFBA 2A5YB 3IPXA 1Z0DA 1DG1G 2IXGA 3VKGA 1CJUC 3DDCA 2FSHA 2XEXA 3B6EA 4OBEA 2X1VA 4IRUB 1Z83A 3G0HA 4M0LA 1WBBA 3FKQA 5H1YA 1GRRA 2VSXA 2FE4A 5H70A 3QBTA 5GJCA 2ZRDA 2RKOA 3B5JA 1Q22A 2HJGA 3NWJA 3IIMA 4ACBA 3KXLA 4JSYA 1SVSA 5EE0A 4D4KA 3I4LA 3TSZA 4Z54A 3RS5A 2DFKB 1UF9A 3DZ8A 2A3RA 4PO8A 5L3SB 3KQKA 2WV9A 3UWKA 5LDDC 5KNDA 3GD7A 1XXHA 2XB4A 2ZAMA 5CM8B 1W1WA 4HAZA 2GVDC 5GJVC 2YWGA 2BVNA 4ASUD 1XXHE 5JRJA 4MRPA 5FTJA 2EU8A 1XCGB 1FQKA 2ODEA 4Q18A 3QKRA 5EXPA 2J9RA 2ORIA 2UKDA 2YOGA 2ZI4A 1ZM9A 3MUFA 4DLVA 4ABYA 4ERNA 3QVVA 4HB2A 4KFTA 2FEOA 3FFAA 4Q19A 3GFOA 1N6RA 3SQWA 1R0ZA 2V54A 2VP0A 5AJWA 2GK6A 2CCKA 2CCGA 2WWIA 1DAKA 2HT1A 2P6NA 1XZQA 2HXSA 4ARZB 1MH1A 3TAUA 2J0SA 2ZJ5A 3NVAA 4RD2A 2VHQA 3U6KA 2HYIC 3L43A 5DYGA 1JAHA 2P6UA 2ZS9A 2O8FB 3UG6A 221PA 1U9IC 5E7JA 3W9YA 1E2DA 4NCIA 5H68A 1AK2A 1HURA 4HSEA 2J1LA 5TB5A 3CWQA 2W6JD 2VHJA 3H86A 4A0FA 1G8PA 2H17A 4DLZA 1W7AA 1KK3A 2MMCA 4F93B 4OK6A 4OJKA 2NO7A 3A1TA 2CJWB 3SNHA 2B21A 4LBZA 2G0TA 4FCTA 2C9CA 3Q9LA 4L4UA 1LTQA 2O0JA 3DZDA 4V0MA 4JMPA 4B6FA 3HWSA 4AC9A 5CM9C 4LUCA 3V00A 1FUUA 1DAIA 2A30A 3ZDQA 1T0JB 1KI4A 2QI9C 3QG5A 1JQJC 1Q1ZA 3T34A 3DVLA 2PBRA 4OK3A 3R7WB 4NU0A 3I73A 4YXWD 4QJ3A 3B1WA 4FN5A 5AJZA 5C18A 3Q85A 1ZM4A 4NYJR 1DE0A 2OSBA 3U7HB 1NP6A 1PJRA 3ZGXA 3HR7A 4H1VA 5FL3A 4LBWA 2BEJA 1W5TA 4DDUA 2CHGA 1G5PA 4OHVA 4ZCIA 3CF6R 2HCBA 1NSFA 1S2MA 3HP1A 3LXRA 3PUYA 3L0PA 2IYXA 5JS7A 4C2TA 1NVXQ 1MRSA 5HCNA 1N5IA 1HQYE 2GXQA 2R6GA 1XJCA 4UNPA 2RHMA 1RYHA 4Q4JB 1Z2AA 5HZHA 5KHOC 2ZANA 3BIFA 3NC1C 4M1MA 4Y0AA 1RPZA 4RKFA 2JLXA 4WIAA 1W2GA 2WKQA 2H18A 5B64A 4E09A 1Z8FA 1GRNA 4M53A 5TV2A 5FL7D 2ERYA 1S0UA 1UEJA 4HEJA 5EUMA 5E95A 2KB0A 2YINC 1C4OA 2J87A 2OBLA 4AG5A 2Q21A 3BOSA 2IWRA 2OXRA 2ECKA 4BLSA 4CGZA 1XMJA 2WVJA 1NF3A 3KJEA 5EE5B 1XTIA 4LCBA 1E32A 3EC1A 1XZPA 4DLUA 3K0CA 4Q21A 2QT1A 1FP6A 2GILA 5DGXA 4AIIA 4BUJA 5L3QA 4EDHA 1ZBDA 4X8LA 1KO8A 2A7QA 4MQBA 4NPHA 1T6NA 3U3KA 3R9IA 1NJGA 1P2TA 3C5CA 5JSZB 4A82A 5JCPA 2CXXA 5BYKA 2CBZA 1J99A 1FOEB 3PJRA 1CJKC 3MJRA 4DC9A 1W49A 4JIMA 4II7A 4QJ5A 1ANKA 1KK1A 2WWHA 1G16A 1WQ1R 2OUKA 2RGBA 5D3MA 4JKIA 3K09A 2J0UB 4G3XA 1Q21A 2IYQA 1OYWA 2A2ZA 5HTKA 3WNCA 4K8OA 3DKPA 3C16C 1EG7A 4B48A 1Z0FA 3WHLA 1JR3D 4NHOA 2J0VA 2XGJA 3RSOA 1TPZA 1OJLA 4URXR 3QY0A 1WBDA 2IA5A 3OHMA 3KKMA 4LJ6A 3NXSA 5DI3B 5CB8A 2FX3A 4Q1CA 4B73A 1XNJA 4NMMA 4DT1A 1QBKC 2QNRA 3QBVA 1M7GA 1GRQA 1AGPA 3PITA 2WMNB 4AG6A 4V0NA 1L4UA 1BYUA 3RRNA 4UJ3A 1G7CA 3AH8A 3Q3JB 3EWSA 3K0CC 3Q72A 2ASEA 5EP1A 1MKYA 4KFRA 3GJXC 3G5UA 1G3UA 4DEXA 1SZPA 4BLPA 4C0SA 2FWRA 2ZE5A 4OK5A 3ECCA 1NL3A 1IY0A 5F2EA 4Q00A 3I62A 1EX6A 3NEYA 1G18A 2ZIAA 1WMSA 3ADDA 3UWOA 2BHRA 3ZYCA 1X8JA 3GLGE 4RZ3A 3MAAC 1SKYE 2OLKA 1N6PA 2WPDD 3R8FA 3QF7A 4FINA 3U5ZB 2JLRA 2ZJZA 4FMDF 5D3QA 4UKDA 3TGPA 1NG9A 2YWHA 2ANBA 1P6XA 3O8RA 1P73A 1OXSC 3CX8A 1CJTC 3BXZA 4JJKA 2QPAA 3EA0A 5AUNB 3DHWC 5C46F 5JJIA 4HDOB 4OQFA 2YV5A 4B3XA 2YZ2A 4DSUA 2AKYA 2CE2X 1CR2A 3C14C 3M0EA 2ZRLA 4KYUA 3TH5A 4BQSA 4PPFA 1KDOA 3B13B 5FUYA 4DSNA 1BS1A 4PZZA 3MSXA 1XCMA 2ZR7A 1OH6A 2Q6TA 2XOKA 1SHKA 4Q03A 3RS3A 1Z28A 5FL7A 4IOLA 1KJZA 3GJ0A 1BH2A 4G5RA 4YMSA 5J40A 2WKPA 3U60B 4P4SA 4MRNA 3UMFA 1R0WA 1X3SA 2D4HA 2ZPTX 5SZJA 3LX5A 3PUVA 3LVRE 2GCOB 4PC3A 3HU2A 2WPDA 2CL6X 2MSDB 2ZRKA 3HPQA 3RHFA 5BWMA 3PEWA 1E98A 2GZDA 4XWOA 4E22A 5BXQC 1A7JA 4D0GA 2WZQA 4BASA 2DB3A 5HPYB 3W3ZB 1UJ2A 1VHTA 1KI3A 4JL8A 2OV2A 5KSZA 1IHUA 4IFEA 2REXB 4TZ0A 2KE5A 2WWWA 2BEKA 2QL6A 4XSHA 3TW4A 3TK1A 1QF9A 2VP5A 5FH9A 3U7FB 1ZC3A 4YLGA 4BLOA 2QE7A 2FOLA 1II8B 1N0WA 2A5GA 3LQQA 3T06B 1OSNA 3LLMA 4URVR 2JLYA 1T3LA 2Q0HA 4V0LA 1U2RA 2JIZD 3FB4A 1A2BA 1XTQA 2W0SA 2B6HA 4Y0VA 5FBRB 2OFXA 4KBFA 2QZ4A 3HU1A 2JGNA 3QXCA 4RCYA 3QKTA 4U00A 3VR2A 4MDFA 3JVUA 4QBHA 4Q5IA 2PCJA 1Z0JA 2AD1A 3OFND 2AK3A 5KNBA 2QPTA 3BE4A 3X1YA 1VMAA 4DSOA 4B75A 3THWB 5F9FA 5CJPA 1GUAA 1AZSC 3ZD7A 1RFLA 4A1FA 1FTNA 2FPKA 3IEUA 2R9VA 4Z8XA 2C95A 4QRHA 1YZLA 4CEIB 1IJFA 3FKSD 5EQTA 5FBQB 4PC2A 3OIVA 2ORVA 2QT0A 4D4LA 3ZS8A 1OF1A 1VYTA 2NTYC 3W5JA 5JI2E 4IEEA 4KJZA 2WAYA 4KI0A 4FW9A 5FR1A 1FMJA 1QG4A 1PLJA 4H9GA 4LYAA 1JPJA 5JCZA 3D31A 4QOSA 3VNUA 4PXAA 5H8WA 3NDBB 1JPNA 2IL1A 5EP2A 1JNYA 2FDCA 1ESMA 1XTKA 4A6XA 1KDTA 1G5TA 3RLFA 1ODFA 1GWNA 4XH9B 3ZZUA 1NKSA 2VSFA 2FGKA 4DCSA 4M2LA 4OHZA 4JT2A 2B92A 1ETUA 3LXXA 3FMPB 2CEAA 4MUBA 4WOPA 2AX4A 3KUCA 2QGNA 3GFTA 3LLUA 2ODNA 3AP3A 2H92A 4QBGB 4N0EA 1G1MA 1E2EA 2B7CA 2KBEA 2ZITA 4Q01A 4QGAA 1HYQA 3CRMA 2ZYVX 4BLTA 1EFHA 2NPFA 3SFVA 2BIFA 1KO4A 1PLKA 1SXJB 4DB2A 1NG1A 1QVRA 1JR6A 2R6CA 3EZ7A 2KI5A 3BERA 4YMTA 2PZEA 3R8CA 2BCJQ 3T12A 1VCNA 2N42A 4AKHA 2JJ1A 4EPXA 4I81A 4HLCA 4L15A 3TBKA 1JJVA 1FX0A 2Q3MA 4HUQB 4RSGA 4HAYA 3I5YA 1P4SA 3KKOA 3TW8B 2ZREA 2Y8EA 4ACAA 1XMVA 3BBPA 2BC9A 2JLQA 4RZUA 3S1AB 1ZW6A 4Q7MB 3WYGA 1G7RA 2VF7A 4DLTA 1KO5A 3MJHA 2AXPA 2BMEA 2W6ID 3A4MA 4A4DA 3RC3A 2VTKA 3ZS9A 1R0XA 3A1VA 3OE7A 3TIFA 1XFAA 3TSWA 1SVWA 1ZVQA 3RRZA 4P31A 2V3CC 1N5KA 1GKYA 4WXPA 1YRBA 1CS4C 2IXFA 2ZR0A 1WCV1 4NCNA 1DAFA 1NN1A 2XSZA 1G7SA 2G0NA 3EARA 4RVCA 5EXSA 4WZ6A 1BMFA 5KDLA 1TF2A 1E79A 3LBHA 3ZVNA 1II9A 2EFDB 1TF7A 4BGDA 5JHHB 4NH0A 2ZEJA 5FOTA 4IDQA 4UNSA 3SJCA 2VHUA 1Q3HA 4Z1MA 5JBQA 2DFNA 3ICQB 1OKKD 2WMOB 3MFYA 3THYA 3VAAA 1TUIA 1ZNWA 3P1JA 5JRZA 2YHSA 3CRRA 3CRVA 2QAGC 2N46A 1RRCA 3ZLJA 3AVWA 1KSGA 1QDEA 3GJ4A 4EPTA 3EG5A 3GQBA 3CPEA 1KK2A 3DM9B 1OFTA 1CBUA 5ANRB 5FUVA 2O8FA 4LJAA 1JQLB 2R6FA 4M1WA 2ZJYA 4A0HA 2PMKA 4EUNA 3O8CA 2JASA 3EA5A 3KKNA 1XEWX 3CRQA 1BIFA 1SULA 2CL0X 2ZETA 2IYVA 3RC8A 1NI3A 3GJ7A 2QP4A 2VL7A 3DOEA 4F4JA 4RY2A 4QG7A 5KTYA 1OH7A 1Z6YA 2XZOA 4PZLA 1W46A 3PVSA 4G1UC 3TUZC 1HE1C 4JLBA 1IXZA 1HT2E 4JVSB 1P3JA 2W83A 1NY6A 1U8YA 4JLJA 5FBWB 2ATXA 3U44A 1EFTA 1E1QD 2JLSA 1KYIA 2GJ9A 2ZE6A 3P27A 2MSEB 3B9PA 2A9KA 3LV8A 4XJXA 3DEFA 1B0UA 4TN1A 121PA 2NO0A 5SZIA 3BS4A 4LJ5A 2X77A 4G5OA 4EAQA 2DPXA 3R9XA 2IW3A 4GSYA 1RRFA 3Q7PA 3CZQA 1KGDA 2W58A 3GCGA 1KI6B 1W4RA 2ZVPX 1FL9A 2RCNA 4XVQA 3Q5DA 2GJ8A 2WTUA 4PSAA 4MKFA 3L8ZA 4LRWA 2PEZA 2F9MA 4WW0A 3VFDA 4LBYA 5A5GA 1I2MA 3VHLB 3PENA 4TQUS 2ZUDA 1EWRA 2CCJA 3PG5A 2ZR9A 1S8FA 4PPQA 4CZ2A 3VR1A 3AVVA 1RRGA 2OBNA 3LW8A 4ZPXA 3B1YA 2DR3A 2R6DA 2YKGA 4R98A 4A8JA 5HKKD 2O8BB 1XDBA 1E9BA 3L0SA 4DXAA 3BORA 4WAUA 1E4YA 2FFQA 1O3YA 4YXWA 4PHHA 1DELA 2DCUA 3LBIA 1I2DA 1U8AA 3SE0A 4DLXA 4TMWA 4BECA 4EPYA 2NQ2C 2WICA 2YOFA 2ONJA 5CLQA 4B32A 3AVQA 1FNNA 4C0HA 5KU1A 2N1BA 2W6IA 1GSIA 4LJ7A 4DRZA 4PPNA 1M8PA 5FOXA 4M9XA 1TMKA 1QHNA 4B33A 5DNYB 3AVXA 4OQMA 1E9FA 3VR3A 3WY9A 1WA5A 2PJZA 3KFXA 4RD4A 4QL3A 1IY2A 4LJ8A 4D0LB 2WOOA 1XU4A 2NOAA 3X1DA 3PEYA 4C4PA 4HAUA 1H8HD 2GEDA 1IJEA 3AF3A 4ZI3A 2AKAB 5KSOA 1OH8A 1T91A 4BEBA 1UBGA 1FP7A 2CLSA 4TTQA 1NKTA 2Q3HA 4PAMA 4EPVA 1TTTA 1VYUA 1MO6A 4B3DA 1OW3B 1VECA 4UNQA 3KJHA 4CEIA 1XB2A 5DI3A 5BW8A 4GNKA 4A9AA 3EIQA 4KHZA 3NTUA 1SXJE 4TQ9A 3B85A 4BRUA 5CK4A 1ZUIA 2RMKA 1NY5A 3ETLA 3RVBA 1FNMA 1VG0B 2G77B 1QRAA 2V7QA 3QQ5A 5CITA 1VG1A 4RKEA 2OCAA 4BE7B 2J7KA 4GL2A 1YZUA 2QTVB 3V4FA 4URUR 3OE7D 1IN4A 4HAXA 4TLAA 4HB3A 1RVDA 3TQFA 1JR3E 1GVNB 2J41A 4ITRC 1GDDA 4GDFA 2ZUBA 1KAOA 4YONB 3EPHA 1Z3IX 2O0HA 4ZDJA 1P60A 3QXJA 4R7ZA 2RGDA 3LO5A 4V0KA 2FF7A 3AKYA 5B2ZA 5KNCA 1UKVY 5CYPA 3W6PA 4DBLC 3T5GA 1E1QA 2ZAOA 3C7KA 1OT3A 2JLZA 3DKVA 1GNRA 1GL7A 2QU8A 2Z83A 5CJ2A 1E0JA 3W6NA 2FSIA 1YJ5A 1AKYA 1X1SA 4Q7JB 4PTLA 2ZI6A 1T0HB 1OXVA 1NVVQ 1ZD8A 2D74A 1SXJC 2NGRA 3BRWD 5F98A 4O25A 3IEVA 1GKIA 2FPMA 4C0JA 4M9SA 1JECA 1FFHA 2IYLD 2W2TA 4C9BA 1R8QA 3QJYA 3QPUA 5AR1A 2AWOA 3NBFA 4DCNA 2EFGA 1AGRA 3PXGA 1MABB 3AGQA 3I8SA 2FJUA 2RGAA 4OKSA 1GOTA 2CE7A 2H57A 4QHSA 3KQNA 2KSQA 4E03A 1W4BA 3AF0A 4CIDA 4IVRA 1UKEA 1GAJA 1W4CA 2ODWA 3KL4A 5FPKA 1NN5A 2ZROA 4ESVA 4IVQA 5CB6A 4CEHA 4XTCS 3SDZA 1U81A 2ZE8A 4PHFA 3NH6A 5CLLA 2VEDA 4XD7D 2IT1A 2D7CA 3F5FA 2AWNA 2W6JA 2NZJA 2XZPA 1BYIA 2FZ4A 1JXOA 1G4AE 2QORA 3OESA 1Q57A 2LCFA 5BN5A 1N2CE 5JFGA 2MMGA 4QM7A 4BEJA 2G3YA 1PV4A 1NBMA 4D25A 3BFKA 2Z5FA 4HLDA 1KSJA 1C9KA 3W90A 3PFIA 5KOYA 3VU9A 4MDEA 1IM2A 1XD9A 2H8KA 2XXAB 1TUEA 1AS0A 5IHPA 3SBDA 1U0JA 2V55B 3MWJA 3VR4A 4URWR 4QBFA 2AK2A 1YQTA 1CKEA 3RWMB 5EP3A 1TU4A 2EFCB 3U4QB 1YR9A 3MGCA 1GNPA 2ZRGA 4QXAA 4K46A 1E9EA 2DYKA 5BN3A 2ZM5A 2IUTA 1U90A 1YZTA 5G40A 2XNDD 3T5DA 3K70B 4KFUA 3OFNA 3IDQA 3ADCA 5IRCD 1MV5A 3LNCA 5JEDA 4HDQB 5K8LA 2QMUA 3PUXA 4ZCLA 4R2HA 3VR6A 3GEHA 1PLLA 1XPRA 1ZNYA 3FTQA 3IBGA 1X86B 3G82C 3JVVA 3ND8A 4PQYA 4S2EA 4C7OA 4BFZA 1SVKA 1D2MA 2EFEB 4B3BA 4M22A 5K8IA 2OM2A 1LF5A 1NMYA 2A5FA 3PR1A 4FXPA 5FI0B 4A6PA 3JZMA 4EKDA 5E3HA 3R9WA 421PA 2FGJA 4A8JB 3W34A 1W36C 2NMVA 3CF0A 3AVTA 4J0QA 3CIOA 5LB2A 1XP8A 3GLFA 4Q9LA 2GETA 4AYXA 2VLIA 1OLOA 1E9SA 4GP7A 2O8BA 1KNQA 1UM8A 4L5BA 1NLYA 1FZQA 3FHTA 2QE7D 5BN4A 3WMEA 2FZLA 1ONBA 4TSFD 2QTFA 2PLFA 1KJWA 1E6CA 3RNLA 4EQ6B 3LY5A 4KFSA 1GNQA 1YZNA 5DO9A 4AI6A 2GJSA 4TQAA 1KSHA 1XX6A 2GBLA 5E7MA 4PC7A 3ZIAD 5L3VA 3I1FA 1TNDA 1AA9A 2XOKD
chains in the Genus database with same CATH superfamily
2C9KA 5EIWA 3FEZA 1CJDA 2Y67A 2V96A 1HNIA 1L7AA 3EXFB 1F0PA 4JOQA 4F21A 1B1CA 4BZPA 1PHRA 1W6PB 1MD9A 5TQVA 2PKYX 3IO5A 2WJIA 2K2PA 3EM1A 4JGGA 1WA6X 5FZ8A 3FWZA 5TQ2B 3H1WA 4FN4A 1JFFA 2CVOA 2V7WA 2CV1A 1ZUWA 3GNEA 1OE0A 3JSRA 1MOSA 3RF7A 1NJWA 3OXFA 1U0RA 4AZTA 1GMUA 1SCAA 1SA0A 4WFQA 2O19A 2CFOA 3COWA 4XGNA 3AEQA 2IX3A 2D2FA 4TLCA 1U2GA 3ABSB 4LFAF 4L08A 2FDIA 3LOIA 1RXGA 5A6WA 4JMLA 4BXOA 1OQ1A 3ZOIA 1X2BA 1JHXA 4GAEA 3DYBA 3IHLA 3HY3A 1QYWA 1SPPA 1R5BA 3PYLA 3CXUA 4GP6A 4AVCA 2H11A 3SV4A 3HKZD 3CZ4A 3P0RA 2GASA 1Y5IA 3JZVA 2B4PA 2VQ6A 2GSYA 1R3UA 2EIGA 1RAFA 3VKHA 4RPJA 4CTEA 3MECB 5IWAF 2QBXA 2YKAA 2FW6A 2AW5A 4YUAA 2WJVA 2VWPA 5LSOA 1T3NA 1OLSB 3DSRA 4P7TA 3VHOA 2QENA 2ZYHA 5LPNA 4WP3A 2DU1A 5BJRA 2ZGUA 3ZVRA 4DXDA 2JFZA 3IWLA 2JH3A 4WACA 1PJ6A 1XA4A 5C25A 2C4HA 2QLFA 5DAPA 4KIUA 4XEHA 2VDQB 2GKGA 2XWBF 5ILOA 1O96A 1KDKA 1Y5MA 3WX5A 2E4VA 2O0MA 4PI0A 3BHMA 4JBLA 3HHLC 1O4VA 4W5WA 1P2GA 4YDQA 3QUAA 4B3RF 1V48A 4F5EA 5H3LA 1C1HA 4EYIB 1VE7A 1Y1PA 2ORXA 1YRZA 3LCVB 2IJNA 2QX8A 3PC4A 3DT9A 1MJGA 4C7BA 1KJQA 4OIFA 1L7OA 3H3FA 3FY4A 1OVMA 4HNGA 3VZHA 3E5UA 5FT9A 1PRYA 4EMSA 5T6BA 3RE1A 4LHSA 4ZICA 4FP3A 3G5MA 3TA1A 1JB0C 4WYWA 1OV6A 3H2KA 3QF4B 1YR8A 4S1PA 2B6NA 4BM8A 1ZGHA 2AE1A 5I0TA 2IXBA 1ZTWA 2HK7A 4CLXA 2AN3A 4F12A 2NSJA 3GH1A 4HETA 4F3QA 1BROA 4XVCA 4YRJA 1YHQS 1UJNA 3CCMS 2UYBA 1M6HA 2IU0A 1SXJD 3GJZA 1JZ5A 3HMKA 1SUFA 2F8SA 1K8YB 1EX7A 4I4CA 4NRQA 3CMMA 1CP3A 2J0XA 3FG9A 1DCFA 2KDOA 2CJXA 3ZKAA 3EXIB 2UVVA 1YQEA 5CB4F 1IEXA 4CPDA 4ZDNA 1IU9A 2P1BA 3DQPA 3GUCA 1J2JA 4AGGA 1VBD3 4RFSB 3S2EA 3R4VA 3GCXP 2Q07A 4NA3A 4FYWB 3N7TA 4O0LA 3WLUA 2EXUA 2IM1A 2A6ZA 1PZNA 2BGRA 2PE8A 3T1MA 3VKWA 5M34A 1XNQB 4GAZA 4OREX 2XIJA 5IM4F 2ZTVA 2VYNA 1U8TA 4D9JA 5CYMB 2DWPA 3MA0A 3ZLVA 3TX8A 4C0QC 1DKNA 2GTIA 3MCOA 2EWHA 5CFNA 3KYCA 3MIBA 3QATA 2C2ZA 5JEEA 3REFA 1ILWA 4BJ5A 2UUAB 5BSFA 3ZR4B 3OWOA 3V3TA 4DMCA 2AIRA 3AP2A 2HMIB 1V3TA 2JIQA 4LG1A 1AQYA 4EPRA 5BQ5A 4KZPA 3G96A 2FFHA 3TWZA 3DMFA 3UW3A 4GPIB 2WNVA 1W6QB 4QE3A 1R5NA 2GD0A 3I5XA 4AKSA 1NVBA 4TYAA 1GR1A 3FZGA 1E9RA 5IJ0A 3G9XA 3EBPA 4ZXPA 3FZ2A 3ER9A 1N8SA 2VYQA 2XE4A 1GR3A 1L1FA 3TAMA 4X1IA 4G4GA 3JAKB 4WESB 2IVFA 2YGLA 5GAGI 3WGHA 2CG4A 3GUYA 5I9TA 4II2A 3E2IA 3EDMA 5FLJA 4E5VA 5J2QB 3RYHA 5BRAA 5DYTA 4UUOA 3YASA 3QEAZ 3U4QA 3SH4A 4NFSA 3TD6A 1PO23 5FPBA 3ND9A 3DLJA 2C9DA 2AQ4A 2MZSA 2A88A 1SKAA 3VV1A 4QPGB 4O8ZA 3NIBA 4JP8A 3O8WA 2LRHA 4TXSA 3LFMA 1NIPA 1WU7A 4OUDB 3H2BA 3MIEA 2FJAB 1W8OA 1OHHA 3LUPA 2RILA 1GU1A 1TZ0A 2IPLA 3M3DA 2PHTA 3MR6A 3CPHA 2IFTA 4LDJA 5BRJA 2NSBA 3G0OA 3LE0A 1I7QB 5BT8A 3PZPA 4S3MA 3GWGA 3RHTA 5K1ZA 4AYTA 2KVIA 4KTVE 4D8XA 2FEWB 5JIBA 4JYPA 2H2GA 4LC0A 1QXSA 1NPPA 3QWHA 3K3PA 2YWFA 4U39A 3PRKE 1PHMA 2PXJA 5DRTA 4C6TB 3BRCA 3IOEA 4XDCA 3ZO0B 3UGTA 4U6PA 3T9EA 1DEKA 1ORIA 4QPIA 3ABOB 3ZHYA 3MM8B 5IN5A 3WB1A 4NI2B 4PIZA 2CJPA 4XEZA 5K0BA 4JJZA 3INTA 3VR5H 2BEVB 2RG7A 4NE9A 1IBMJ 5FA5A 4CQMB 1S1VB 2GVZC 1SCJB 3NNDA 4R8UA 2DWCA 2GYVA 2Q9CA 3ZXFA 1PQ4A 5BNQA 9LDTA 1YQDA 1J83A 2EWWA 4TRRA 5LLDA 5EZYA 1GPH1 3D43A 5KJ1A 4XF9A 2J6IA 2I8AA 1MO3A 5HIMA 3M2UA 1AKWA 1T05B 5A7QA 3NSTA 3FTFA 1S6PA 1ZMBA 3KV6A 1JDBC 5B0GA 2VH1A 3LUHA 4IKPA 5TF0A 2YNFB 1EPZA 3EF1A 2F4FA 1EPUA 3N36A 2A8YA 1ORVA 1HYSB 3AZYA 5GJ6A 3I6BA 3QO9A 4F11A 2Q1XA 4AL7A 1TU0A 2BKVA 1T9BA 2K1RB 2P6CA 4OLAA 3TLKA 3FBYA 3A2NA 2JZCA 1NQTA 1I1NA 4IDEA 4UARA 1WC4A 5CTAA 1NXVA 1Z2EA 1ZZ7A 1GPBA 3KVVA 2WQZC 1BMV1 3Q9OA 5K9YA 1MLDA 4QUJA 3X2SA 1DTTB 3K73O 4WZZA 4FPKA 1OWNA 4JYAF 2PFSA 7AT1A 4PF5A 3OPZA 1GPKA 1GG9A 4AHZA 3ZQKA 1DGWX 3AVOA 2P5YA 5CCDA 1VBNA 3EUEA 1JLLB 3TSYA 1YB5A 5DLPA 1IN7A 3E5XA 4F1KA 3P9CA 2P2DA 1H93A 5CBPA 3R3VA 4USVA 1G9XA 4P9IA 3WYAA 2Q6VA 4EA9A 4DANA 1KS2A 1ZK1A 4NROA 3MTJA 3I97A 3MSCA 4I1YA 2RV9A 4BNDB 2DGQA 1PFKA 2A9JA 4M9ZA 5DT2A 2WDPA 3FBMA 2RAFA 4B9NA 3JSBA 4CF4A 5FZ3A 2LXIA 4URAA 1X4AA 5B2GB 5GMOA 4D98A 2IVMA 4P9YA 4ZKEA 1R4AA 2LYVA 5KPDA 4WCFC 5DTQA 5TNXA 4E08A 4OGLA 4X7BA 1GNTA 4ZK6A 4I5IA 3MOSA 3UKJA 1ZM3A 2PL5A 4IMPA 1PK6A 4D3YA 2MZJA 4O3NA 2AT1A 4C8KA 4BYYA 4GOOD 5K8NA 4COVA 3CNOA 3FYSA 4OLJA 4JB2A 1IBKJ 2EL9A 3VTAA 2BDTA 2JKBA 4PQUB 3NGSA 4AW9A 1ABEA 4LHXA 4Z4CA 2YC2A 5JFOA 4C9DA 3W2WB 5I9BA 4M8LA 1S0DA 4DPOA 4IJ5A 2DPHA 4LHYA 1CR1A 1DCKA 2LRPA 1AUQA 3BC1A 3R5AA 5CVVA 2XUQA 3OBIA 3CDZB 4Z0TA 3GE9A 2XTAA 1QHFA 1MS9A 1MORA 3O2SB 4O4HF 1KFDA 4L1KA 2MZRA 4Y67A 4CF6A 3KEFA 2B9YA 3AUXA 3OT1B 5I42B 3GALA 4XCQA 4MPTA 3MOIA 2JJ4D 1YUNA 1DHRA 3L6CA 5C9AA 5HK9A 4B80A 3QZ8A 2Z0MA 3TLXA 3GLGA 2OPQA 4MG2A 4CIWA 2NS1B 3VGPA 4PQAA 2J5BA 4IZHA 4YAUA 3IG1B 4J9MA 3DBIA 1IKYA 5HQ8A 1H9BA 1ADYA 3HDGA 3A4LA 1RIFA 1H2MA 4HZFA 3JSXA 4MFBB 3QELB 5H5JA 1UZ0A 1PU2A 4F4WA 1C4AA 2ZSFA 1DLOA 3FJOA 4DNXA 1I0ZA 1U2SA 3PXGa 1XVAA 4ZCMA 2CNDA 3BFVA 1EXDA 3DLBA 2FPGA 3PGJA 3N6NA 1IB0A 1FTCA 4N5DA 4I55F 3ENKA 4UEWA 5J59A 1UNBA 1HQCA 3JQ7A 2H6CA 2F3JA 2ZWPA 3C46A 3KLHA 3EVZA 1HKDA 1SN7A 5CW2A 5K8UA 5IK4A 1POV1 3M8KA 5C4MA 4RDCA 1TQDA 3FVVA 4F60A 2MNGA 1U1EA 1XGKA 3WP1B 2C5BA 3WG4A 3L6RA 4GPBA 1CIPA 4D3SA 4PNPA 4ZVSA 3IUEA 3WWOA 1IPHA 2E2WA 3F44A 2JG8A 3H3XA 1XP5A 5FYQA 1U1KA 1R6BX 4K4XA 3RIXA 3ET6A 5CHYA 4W6WA 2CGEA 4B0PA 4MDYA 1XZFA 1K1QA 5FFOC 3STXA 3GG9A 4U96A 1QYRA 1DKRA 2VFUA 3RIYA 4D81A 3OP1A 3RSSA 1VQKS 3FNGA 5GV7A 1R27A 3UJHA 1XWIA 3PQ3A 4H0FA 2PMDA 4NLRA 4TN7A 5C5IA 5D6NA 4HI0E 1YHNA 1K0VA 3WGJA 2DO4A 4RIGA 3VBHC 3FVWA 2C2OB 2OFWA 4A26A 2DFLA 2CNNA 3SEQA 1VIAA 1UIKA 1GLNA 5LJ5Y 3OZGA 3GEPA 4B3MB 4IDOA 2Z6QA 2P9HA 2C4WA 2R66A 1S12A 2PEBA 4CCMA 4YRAA 1AV7A 3P26A 4UZFA 1R10A 3RDIA 4YVSA 2WJAA 1UXHA 1S9EA 1X19A 2X5IA 4L4SA 4DR1F 3QGHA 3R05A 2V5YA 2JGAA 1ACMA 4A47A 4DRVA 4UNNA 3N3AC 2CA9A 4QQOA 4JWKA 2J0QD 2RF2B 3EO6A 3LWDA 1ZOOA 4YV1A 2RGNA 3TGWA 2CADA 2ZUVA 1M7BA 3CF2A 4BBYA 4GMXA 1PIWA 4LYHA 1YS1X 5T4EA 3T35A 3LSYA 4NYIR 1Z07A 2O2ZA 1AL0G 3LUYA 1QDOA 3PR5B 1GGFA 1NF9A 2P3SA 1OVPA 4EWDA 1KI6A 2JCVA 5HKKA 1QU0A 4DSLA 2O8NA 4AAYA 2NQTA 1PJ4A 2NO4A 4FI3C 4RGAA 1PW7A 1TQ4A 3C8ZA 3K9LA 2RH4A 3DCAA 2AREA 1BOFA 3BALA 1EHWA 1PF7E 1KKUA 1IBKB 1MNQA 2OZ6A 5JVHQ 4NCGA 3VGTA 1M34E 2ZKTA 1N4AA 4MUKA 1DHKB 1RJGA 3EDRA 3RB8A 2FPLA 3WLJA 3MV01 3Q7EA 3LDAA 5ABJB 4BRZA 1HWYA 4WECA 2JA1A 1D2NA 3BU7A 3OY8A 1WF0A 2VP2A 3KG0A 2C7PA 1NSTA 2Z79A 1H8HA 2R4QA 1R4MA 4LFCJ 3HDJA 5F8LA 4IR9A 1ZQ9A 2NSYA 3UN5A 2WONA 4YVWA 2WZPP 1KWKA 4B47A 4TLDA 3L40A 4FGKA 2GO9A 3C6ZA 2VAUA 3ACDA 4DCPA 1W0KA 3AP1A 3F9RA 5IAAA 2FUKA 4X8HA 3VAFA 4LF2A 2E6KA 4EG6A 2EWMA 1HBOB 3NOVA 4DX7A 4BQ1A 3CC2S 3R0VA 1EP9A 3IQEA 3T1TA 4UOJA 3O9MA 3ZFFC 5PGMA 1I3OB 2QJOA 4CLUA 4WCEQ 4GPZA 2JFDA 4QJ4A 2GN6A 5T57A 5HV4A 1ZN9A 2GXAA 4LBQD 2XRZA 1JK9B 2WK4A 3ZX5A 5JZMA 1N34B 3F6BX 3ZNQA 4IRUB 3MIFA 4KV8A 2O4CA 1U7XA 3IAAA 5FP8A 1QFZA 2AG6A 4ENSA 4M8KA 1TE2A 2AYEA 2RKOA 2NLRA 3IIMA 2RDSA 4Y4YA 2VBPA 2OR3A 1D0SA 4OYWA 4KKOB 1MS4A 5FTJA 2G07A 2ORIA 2CD9A 4BO7A 4P22A 1O03A 2PWAA 2YB7A 2TYSB 2DYCA 4ROTA 3EJMA 4AXJA 3RIEA 2BJ3A 2CNKA 3U1VA 3IP0A 4YAFA 4KK3A 1REDA 1J5OB 2XA2A 3WQ7A 3OCZA 3B8EA 4QHBA 1D0HA 2YMQA 3I4PA 1KEPA 1OH4A 2R5FA 1JG1A 4G6ZA 4C78A 4ES6A 4CKBA 4BQOA 3K77A 2JLBA 2WR9A 1T6ZA 3MDPA 2F5GA 4F93B 2XUDA 4OJKA 4FF3A 3SNHA 3OX4A 1NLKL 1DC6A 2C9CA 4M00A 2QUAA 4FZVA 3RD5A 3T5MA 4WY8A 3W7VA 3V00A 1WW5A 4NOKA 4GRSA 1IOLA 2ZZKA 2FDGA 4OK3A 4H7JA 3MTBA 1G2IA 3D1OA 3BM5A 2ZJRQ 2VS1A 3P19A 1Z45A 2HCBA 4N8MA 3L0PA 5EJ1B 1JXQA 3ASVA 4FT4A 2C82A 4DQQA 1XNAA 4DDKA 1OYEA 1SOVA 3NAPB 4IDZA 4CGYA 2Q4TA 1YZFA 4OP2A 5CYQB 5JMOA 5B53A 1Z8FA 2OWDA 3PNKA 1ZA4A 2ERYA 1UEJA 1GZ3A 4N47A 4FR2A 3H4TA 2W2IA 3QVSA 2BD0A 5JQWA 1J23A 4NXMB 3VVTA 2QPLA 3JV7A 4Q21A 4G1IA 4X8LA 2WT8A 2HKIA 2I2SA 3BGLA 2OV8A 1P2TA 3I12A 4X41A 3VSEA 3SX2A 3ZWQA 3V0BA 5J1EA 4G3XA 1Q21A 5AKKA 1UBOS 5M2UA 3DRPA 4C06A 4NHOA 3HHNB 2LROA 5KT4A 3ONVA 1RHRB 3KKMA 2OGSA 3HDQA 1US2A 1FP2A 3D66A 1NAQA 1OQ6A 4WIQA 4ZVQB 4NXMJ 3K1ZA 2HSDA 3W4IA 1APNA 1HBMB 1EQ2A 2NSHA 1TTHB 4URSA 1CJBA 4DJDC 1QIFA 1SZPA 1JLKA 4C0SA 2PYTA 3S2IA 2ZH1A 3K9WA 2RKWA 2W1UA 1BH6A 4UUNA 1IQAA 1EX6A 3HYSA 2ZH8A 3FGOA 4RZ3A 3Q9UA 2GX8A 4AY3A 2C3PA 1V3UA 1RJEA 2XNQA 1ZMTA 5LXTF 4JJKA 4OLLA 4R2WA 3OUIA 4EI7A 1S2BA 2HU8A 3CC7S 2YHAA 3AKQA 1T8YA 3LA2A 4DUZB 3OQNA 3WO0A 3ZO7A 2HGMA 3GQVA 4PIVA 4V3BA 3GNSA 3L7BA 5ESDA 4Q03A 2FPHX 3LT5A 3RS3A 3SY8A 3DW3X 1V6CA 5KEIA 4WBNF 5E1RA 1UKAA 3TLMA 2DR6A 4LFBF 2ZPTX 4ZT5A 4IL7A 3LVRE 4Q4V3 3V48A 2HCRA 4D6SA 5EJ7A 1E5RA 3L4BC 4F5ZA 1R5JA 4RV9A 3AKSA 1X9HA 1ZI8A 5F2NA 1NEEA 1WPGA 3PRJA 5HRAA 1ZC3A 3G23A 1V9U2 2JLYA 1K06A 1R6YA 1Y3BE 1SEVA 4LTDA 2QZ4A 3A6KA 2DT9A 2CDAA 4XLZA 5L3ZA 5ELLA 3TTUA 1C1DA 4ZAWA 5C80A 5I0UA 4ZT2A 1VS3A 3ZD7A 3RYLA 3GCZA 5EWJB 2OXTA 4O4IB 1CR6A 3RGWS 2GZ2A 3ZYIB 1VOMA 5FBQB 4N9HA 3JYTA 2RDJA 5IT9A 2O7QA 3RI3A 4UTZA 4LXLA 2R4FA 4K05A 3N7MA 3EWIA 2NYIA 3OSPA 1M1KT 1INLA 2BM8A 3OTWA 4IQXA 1GT6A 1RBYA 1JPNA 3VAJA 4MX8A 5EP2A 1B0PA 2QQMA 3BSFA 3DWFA 3HJBA 1ODFA 1NKSA 4M8SA 5KFJA 2ZXEA 4TTAA 3P3NA 2BMWA 2ZX3A 3FMPB 3K5NA 2HYXA 5KVCA 4QBGB 4UY8T 4QGAA 1HYQA 4FNMA 3FWPA 4L72A 1EK5A 4RUAA 4FBFA 4CKCA 2QGFB 3TEHB 3BIXA 3AP5A 4W6YA 4GLJA 1OU0A 3ZX7A 5FADA 4NEQA 4HAYA 1XNRB 3ZXWA 2ZREA 4Q7MB 2ZK7A 3ZDEA 2PZMA 4MVTA 1N9ZA 3TIFA 3POIA 1W88A 4BMPB 4IV3A 4YREA 2QT9A 1B6GA 2VYND 4WZFA 3FDZB 2BGJA 1PG5B 2VQFF 1U0OC 4KP7A 3KF5A 5K3EA 1NW7A 4K40A 3IM8A 1TF2A 5D6OA 3SP1A 3RYRA 2GHWA 1OOEA 3FJYA 1JE1A 2UAGA 2YHSA 4HH4A 2N46A 4CLZA 4DIOA 3EG5A 1VMIA 3MPUA 5F8PA 1CBUA 5G1NA 2O8FA 1JQLB 3ZN6B 1TW3A 1XEWX 3PWKA 2WVFA 5IZCC 1NDLA 2EGGA 2VMGA 5FZCA 1WMAA 1W46A 1JHUA 1QGOA 3OTDA 4M1QA 1E92A 2W83A 2W22A 2VH9A 4QPNA 4KY3A 2VOXA 3U44A 2BYVE 3G6KA 1REVA 3SGLA 2YQZA 3PW2A 3RR8A 2X9VA 2L2QA 2X0JA 4YP7A 2NO0A 4ZWNA 4EY4A 5I3QA 4NATA 1GT8A 4QYTA 1MX1A 3VGSA 3E82A 4D3HA 4JENA 4XVQA 4XYMA 3V1TC 1I2MA 4Z5XA 4ONUA 2I3AA 5HXVA 2RDRA 4CE6A 3HB0A 2R6DA 1X33A 4GLFA 2GPSA 4P2GA 2EL7A 5J58A 4YXWA 2NR0A 3LBIA 1H1IA 4QR0A 2NQ2C 5GAHI 3BQ2A 1NASA 4B32A 2GEBA 1DV1A 1QDUA 4Q0BA 2N1BA 5JASA 2BKLA 1XYNA 1WLDA 4PPNA 3NCTA 1ASJ3 4ZI7F 4DYHA 4CU8A 2JVRA 2OY0A 4C97A 4XILA 1CY1A 3BDEA 3O1IC 3W0LB 1Z68A 4EROA 3S2YA 2CLSA 3FDZA 3AI1A 4MLZA 1MO6A 3UQZA 2PA3A 4A9AA 4AY6A 4Y5TA 2RC6A 1KJJA 1CJUA 1IBCB 4BZ4A 3IDOA 4RY8A 3TB0A 3KSZO 4AFCA 4FF1A 1WZCA 4HK4A 4DSAA 2XMBA 3C87A 2I80A 2QGFA 1A8IA 2FF7A 2LXNA 3TFOA 1HLWA 2AI1A 2EKBA 4JI3J 4RLEA 1MOQA 1HQ2A 4U7JA 1E0JA 2B4VA 3N9NA 1S10A 2X1FA 3OL6A 4QX8A 1NVVQ 3D68A 3AEXA 2BV4A 5I9SA 4Q26A 1HNWJ 3AR5A 1RXVA 3MZIA 3SWWA 1YJWS 4C8ZA 4UUMA 1XUOA 4KR6A 3LEKA 4DV0B 1RHJB 5FDLA 3AF0A 5I0SA 3EVNA 3IAXA 3TDKA 2QRPA 3DRSA 2WYSA 1VMHA 3SDZA 1U81A 4NIIA 4QUAA 5FD1A 4NU8X 5IJ9B 1W1UA 1AMNA 1YAHA 4HQFA 4DAEA 3DR3A 4W5NA 4J9OA 3PUSA 2MT9A 2PKCA 1NHUA 3H7IA 1NVDA 4U3JA 1TUEA 2VZOA 1K44A 2O2IA 4D3FA 5IHPA 4BVGA 5FPXA 3VR4A 1A72A 1CY6A 2AJCA 2JFQA 1IVSA 3D5MA 3OJCA 4ND3A 2K8GA 4NZZA 4EY8A 3ADOA 1IN1A 2IDMA 3T5DA 2R7NA 3IPLA 2A9QA 2FZCA 3OGVA 4GKVA 4BIOA 4KACA 2KXFA 5LZ9A 4EHAA 4R2HA 4HQKA 2PGIA 2OP1A 3IBGA 3JVVA 3ND8A 4G5XA 3WLNA 2JKXA 2A3JA 3I23A 3PR1A 4JI5J 1ZR2A 3AK4A 3BGUA 3GEBA 3SHVA 3A3OB 3CCRS 3VAYA 1SLLA 3NS5A 1ST2A 2FXVA 4L7QA 3NKFA 4B3OA 2DJIA 4GP7A 1JLCB 3FHTA 2QE7D 3BCRA 3RVHA 4ES2A 3NNAA 1F4HA 5DO9A 2FPIB 2C9MA 3O0WA 5FY5A 1KSHA 4EENA 4B3TB 1UAIA 3I1FA 2XA9A 4CT0A 3VBHB 1T3TA 5A4FS 1OI4A 3RAPR 4LPLA 2ON6A 4OHXA 2UU8A 3K0FA 5T41A 2X0IA 2EGUA 4JGIA 5EWLB 2VJOA 1XDDA 3D1VA 3DBRB 2E9RX 1B35B 1EVEA 2JIZA 3ZFGC 1L0BA 2CC2A 4LNUB 2ADDA 4MGIR 4EUVA 1EBBA 1JIQA 4DR2F 4MUMA 4ZP6A 3PQDA 4R2IA 1TA9A 2AN4A 1GYRA 3HHLD 1NGSA 3SEAA 4LVOA 2PTGA 2VQAA 4AI0A 2PYIA 2VJXA 1S49A 2IPAB 5EE9A 2O3DA 4ASMB 2AMYA 3FR8A 3ZQUA 4JX0A 3F1KA 3ABQB 2QQWA 2RH3A 3DAPA 1KTIA 5LMCA 4QQ2A 4BQYA 2V8PA 3ZPOA 3MTEA 1XOYA 1LU2A 4MFBA 2VC0A 5B30A 2O2DA 2WG1A 2DWQA 3CQOA 4B9TA 4Y4RA 2BFEA 1ZAVA 1GU7A 1KAGA 1FJCA 1FPMA 4Q4HA 4ZCRA 3MM9A 1Q92A 4Z1OA 3DTVB 1ONNA 4F38A 5FP7A 5CDYA 1UBJS 1ZSVA 3ZU3A 5DWQA 3WZ2A 1JR3A 1IONA 2EXIA 3L7UA 5C9AB 4R84A 5IK5A 1YR7A 1E0AA 5LA2A 4K6GA 1OQ3A 2OZPA 5BORA 4DV6F 4BXFA 4O3MA 2YBDA 4RDIA 2ZWMA 2OEPA 1X1EA 4L85A 1SQ0A 2DPMA 2JLUA 2WINI 1CVRA 5C1IA 5DP2A 3PI6A 3LJKA 3T5TA 3TNLA 4D7AA 1TF5A 3IR6B 2RHWA 1MA3A 2BR4A 2CJYB 4YHBA 1KLMB 3V4IA 2OC9A 2ZSDA 3NHBA 1JZ6A 1XPOA 3KJQA 1GLGA 4J7AA 2AOXA 2WA3A 4FYVB 4Z4QA 1K4YA 3I28A 4ZT7A 2RBGA 4AQ7A 3AYDA 3UESA 3DMRA 5FPYA 3IXQA 1AX0A 3WKBA 2YWXA 5LCWL 4DUPA 4PBTA 1AVTA 3W5AA 1NDUA 5DDRC 3L4SO 4M0EA 4UTGA 2UZ3A 2BRLA 2YCBA 4LBVA 1WW4A 5KIAA 4ENQA 4YO8A 3GIMA 1YG0A 2VDPB 4QPGC 4QUEA 5D5HA 4QHTA 5C8XA 2QL7B 4Z4IA 3MI8A 2CHQA 3NJYA 2CNKB 2C8VA 2OO4A 4LBIA 2PUTA 3QXXA 5C25B 3NJ8A 5FTMA 5C3UA 1OI6A 1X5OA 4JUZA 1U65A 1KU6A 1J2YA 1O6BA 2VBXA 1Y3CE 2FJPA 5JR7B 2G1DA 4B4PA 1CETA 4AS2A 3SFUA 5CZKA 2F9DA 2O8VA 4B74A 2XWYA 3WKEA 4CV3A 2BT4A 3U17A 2XWQA 3QWUA 1EGQA 1HOTA 1X80B 4N3CA 1P5JA 4J0EA 4DMGA 3T7KA 4HT3B 1P2VA 5I51A 1VE9A 3HJUA 2NIPA 1PD1A 5LP1A 3A7DA 1NDQA 1JZ7A 1X0VA 3EIHA 1OKKA 3K35A 3KLVA 2VCMA 2W7PA 4DCTA 5JNUA 3IKVA 1YE8A 5D1IA 4H4EA 3RQ0A 2XBO2 1MO5A 5J36A 1WULS 4ZU6X 2IU3A 3OA0A 1AS3A 3OCVA 1C1XB 2EC5A 2L41A 5A62A 2ZAAA 2NU7A 1WCQA 3I6ZA 1YQCA 2X58A 4RD0A 4YP1A 1UT5A 1V5WA 3ZBQA 1TAGA 1WCYA 2IIBA 4ENOA 2TEPA 1MQAA 4BRSA 4TMTA 3OGGA 3VHPA 2XMPA 3CB4A 3N79A 3ZV4A 1P2BA 4H4KA 3O90A 3WIVA 4EVIA 1VBC2 4WZAB 2HBTA 3FMWA 1Q5YA 3LFHA 3Q5EA 1C9YA 4RHYA 1VBC1 1BMFD 5IV4A 4WA7A 3DTVA 3PNOA 3CSSA 1XF1A 4YXFA 2AFIA 1VBYA 2AX0A 1KIAA 5I48A 4HAIA 1RI7A 4NCJA 2V03A 4QOGA 2EX1A 4O4LB 5MFZA 2QA2A 1YQ8A 1Q7CA 2VTFA 3NM6B 4DSKA 4MWOA 4N7JA 2QS9A 3FMIA 3UH0A 4JP1A 2PX8A 2BJWA 4TMKA 4EELA 5A4MS 4PO9A 3RH0A 1S97A 1CY2A 4XUOA 4RLFA 1I3LA 4M60A 5KBYA 5IH7A 1DPFA 3OCCA 1Y48E 4MUEA 2ZP1A 4KH0B 1KVIA 3WYFA 2E9ZA 3S7IA 5T5LA 3KQRA 4DCOA 5I7WA 4KGXB 1O0BA 3LZCA 3GV5B 2HB6A 1S89A 1UBEA 4R3UC 3Q12A 2FP3A 3HBMA 5K2MA 4RHV3 1QIGA 2F3RA 1XK8A 1C8M3 2HF8A 5LQJA 2F3TA 4GZLA 2YASA 1VP3A 3THTA 1RUC2 1HHTP 4AXBA 2OZLA 2JEFA 3EMDA 3E7PA 1AR83 3WA7A 3AF1A 2VTXJ 4FJ2A 3NONA 4RVHA 1ZJ5A 5FA6A 1SQ4A 3DXTA 5LDGA 1GUZA 2F4LA 3EVDA 4TLEA 4AEDC 4GU5A 3T6JA 1CUEA 4I50F 1JFVA 5EWJA 4CT5A 4RS5C 1NSQA 3WLMA 2GJAA 1CVLA 3IIAA 3P9ZA 4EO4A 1CR4A 1ASJ1 1ULZA 3DKWA 1JXVA 4C7KA 4QUBA 2WA1A 4HMQA 1F2TA 1S0VA 1QWOA 3AH6A 4GX2A 3UB3A 2ZPUA 3RJ2X 4EP1A 1K0UA 4E5YA 5I3ZA 5GGXA 2J3KA 2Y8WA 3JXEA 5CK5A 1PYSB 4I1VA 4N8DA 4WFYA 1YL6A 2UDPA 4I9NA 4XVUA 5DE3A 3RUFA 1DO0A 2C57A 1YFYA 3ZQ6A 1ONOA 1YMUA 3T9DA 4RFT0 3P0JA 4LSLB 4W7IA 3RFXA 2MEV2 4CUBA 1CY4A 2ZKIA 2XVLA 1T8PA 1ZA1B 3UUWA 4IJMA 2MOKA 4PE5B 1BEUB 1TEHA 4WMLA 1FDVA 1X7ZA 1U1RA 1ECLA 4KGXA 3K9FC 2J3LA 5EGSA 5HHTA 5IZHA 1K9MT 3UMVA 4LMAA 2AEZA 1FKPB 4WVLA 4P10A 2X0FA 2QIOA 1MS8A 1EK1A 1NRWA 4DZ6A 2GAFA 3U61B 4IILA 5ALYA 4Q02A 1L7LA 4M21A 3PMSA 3B9BA 1RAHA 1D8AA 1C3LA 1E2JA 1YQUA 4EUFA 1MOPA 3LRXA 1KJRA 4GMP1 4QEKA 2J9ZB 3LYAA 4N12A 4ZMMA 2X53S 1WOMA 4I1UA 3FLPA 3ZMNA 2OSRA 4G56A 4IGKA 1DAMA 5J1PA 3BA6A 2PKWA 1CD5A 5EUQB 3ZQ4A 5AW3A 3RNOA 1VBXA 2E6UX 3DECA 3DDKA 2QFIA 1YO6A 4MKRA 2YS7A 2I74A 4PYQA 3KTAB 3KZ1E 1K8XB 3KFWX 5JSKA 4ZIRB 5AHKA 4DNPA 1DNPA 1C80A 2IYZA 4LX0A 3MOZA 4TMZA 4WZBA 5F51A 4OI1A 3UGHA 2G5CA 2HGZA 1HDYA 5F52A 9ATCA 5JNWA 3D5OA 2V6FA 4GWIA 1E1MA 3MRSA 2LP4A 2P2ZA 3GV0A 4AROA 3ODGA 1L4EA 5EHHA 3IDBB 4HEA6 2PHWA 1VTKA 2VTEA 3OETA 2O66A 3ZK9A 1UU4A 4P32A 4BX8A 3RRYA 2GN8A 4PZ9A 3AX6A 4OV6A 4KODA 3NMUF 1I9CA 1I3MA 1WNEA 4KOEC 2XE6A 3I7DA 1O95C 3RANA 4M1TA 3VR5D 1MO4A 2ES3A 3NBPA 2ZYIA 3AUTA 4YDXA 4WNCA 5L7OB 5AJHA 3DYPA 1VL5A 4MZUA 2I76A 8ADHA 3U4SA 3UN3A 4FKMA 4R9UC 3MS4A 3BCWA 1E3IA 2P3JA 3FOCA 5T7BA 3DOLA 3TWOA 4JLKA 1P81A 3PJXA 4AEMA 2YWWA 2NZ4A 1Z74A 2PX0A 2YVAA 5E3IA 1R9GA 2IEGA 1E59A 3RUBL 1OLXB 2WWGA 3U40A 4RD1A 4WXWA 4LHLA 3DL7A 3NW9A 4NR1A 3CG0A 3KK3B 2BPA2 3O7WA 4G26A 5E3AA 4U4AA 2XADA 1WCWA 1D2EA 3DFUA 3MCWA 1U0HA 3PXEA 4N5MA 1YF3A 2IYNA 3GIKA 3CLRD 1SB8A 2VDKB 1JXNA 3BVPA 3IR7A 3TZ6A 4HAWA 4JLDA 4ZVUA 2ZJ8A 2VRCD 4M46A 1YRWA 1K66A 4QDJA 1U8CB 1MFPA 3M32B 2I2YA 2QYHA 1N2XA 2EVWX 2OV4A 1QV7A 2X5IB 5DN6A 3KE8A 3L1JA 5I47A 1VG8A 5L1JA 1K8AT 2JJ8A 2XJSA 2AG5A 4PLZA 3MAAA 3MG9A 2KI2A 4LDAA 4YVSB 3N7LA 1QGDA 3F7NA 3UMJA 2ILMA 4FKBA 2RM22 1GKBA 4FJ0A 4TVKA 5BSMA 2NNWB 2EQBA 1N5DA 4J2TA 5B0DA 2CPHA 4JIGA 4Z92B 5LOQA 3CDUA 3W2GA 1RVF1 4KQ2A 2DUMA 1GKUB 2G17A 2XY4A 1STMA 2ZSBA 1TUWA 1QHGA 1Y33E 3NIGB 1VJGA 3P2YA 4FP2A 3Q1LA 3NWGA 2ZW9A 2JJ6A 2DX7A 4PLPA 1YRAA 2HWF2 4Q1DA 4DUWA 3KAJA 1N48A 2RH5A 3BN6A 3POGA 1GZDA 4M0DA 3HHDA 2FYXA 1I4WA 1NN3A 4TRJA 1EUCB 1ND3B 1F2NA 3DL4A 1D2AA 3DMJA 4JB3A 1NKEA 3IA0A 4DV2B 2A86A 1ID8A 3STVA 3WB2A 4RQPA 3BDVA 4OUEA 4C6TA 2F1RA 4P3YA 3J8F2 2P2NA 4XUQA 2EFJA 1SIZA 4GH5A 2O2JA 4RVSA 1EV12 4BMDA 3CGIA 4HDRA 3Q15C 1Z47A 2L69A 2ZVQX 3WW2A 4YT2A 3FZQA 4DKJA 1NQAO 3BDAA 4ZPDA 4LPSA 1MR3F 3KJFA 3FE2A 2WWRA 1JXEA 2P7IA 3QJPA 1VQ7S 3D7MA 2ZC4A 1T5OA 3C8HA 5DM60 3OPWA 1N9GB 2VP3A 3X3HA 5GLWA 1U7DA 2Z4SA 1V7PC 4RR3A 3JS5A 2AXQA 3DE7X 1WVIA 3QFRA 4RFLA 2AR7A 1NR7A 2BEUB 3WMRA 4F25A 1OFVA 4BNTA 2AMFA 5JWRA 4XPIB 4RXTA 2BN4A 4Q48A 5A3QA 1DJMA 1LZLA 1FKAF 2JI6A 4CR6A 4XF1A 1RTDB 1GCIA 4ATEA 2YN4A 1GTHA 1FX4A 4OQ9A 1LHNA 1T9AA 3PEVA 1FUYB 2RR13 1UBCA 1X8KA 4A2QA 1ULGA 4JI0B 2Y0EA 3AKDA 1CNMA 3OM0A 4Z7QB 2RU9A 4C0AC 3WCRA 4HN1A 2WSCC 3MIGA 2IYSA 3QNMA 5IJ9A 2UUBF 5CIYA 4CU2A 2MGZA 2DFPA 5JCJD 2W37A 2H1YA 5JXSA 1ENZA 2I4RA 2YV8A 5IS2A 4YVFA 4K2HA 2REBA 4HNUA 3NBXX 4NP6A 4A48A 3ZE0B 1N5JA 4Q4V1 2VDLB 1JLBA 1YQ6A 4M76B 3A1WA 4RJJA 2YJTD 4DMKA 1U7LA 1DIBA 4K7JA 5LD2C 2JGEA 5ABJC 2FHOB 2KXHA 5FZDA 3HD8B 2EFHB 1OSDA 3B5EA 3KCQA 2O20A 3U44B 2D6NA 2Q1UA 2ZCJA 2IITA 4I6GA 5EHXA 4AD6A 1PSDA 3L6UA 4KAFA 5EN4A 4N3AA 4XW2A 2QAGB 2RUSA 4H7PA 3GJ5A 3BWYA 2A3XA 2G5PA 1ZRHA 2JRSA 1TG7A 2Q9BA 5KDOA 2AD9A 3ZR6A