4C0BA

Structure of wild-type clp1p-pcf11p (454 -563) complex
Total Genus 131
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
131
sequence length
428
structure length
428
Chain Sequence
TGDNEWHKLVIPKGSDWQIDLKAEGKLIVKVNSGIVEIFGTELAVDDEYTFQNWKFPIYAVEETELLWKCPDLTTNTITVKPNHTMKYIYNLHFMLEKIRMSNFEGPRVVIVGGSQTGKTSLSRTLCSYALKFNAYQPLYINLDPQQPIFTVPGCISATPISDILDAQLPTWGQSLTSGATLLHNKQPMVKNFGLERINENKDLYLECISQLGQVVGQRLHLDPQVRRSGCIVDTPSISQLDENLAELHHIIEKLNVNIMLVLCSETDPLWEKVKKTFGPELGNNNIFFIPKLDGVSAVDDVYKRSLQRTSIREYFYGSLDTALSPYAIGVDYEDLTIWKPSNVFDNEVGRVELFPVTITPSNLQHAIIAITFAERRADQATVIKSPILGFALITEVNEKRRKLRVLLPVPGRLPSKAMILTSYRYLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for ATP loss by Clp1p in a G135R mutant protein.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
molecule keywords MRNA CLEAVAGE AND POLYADENYLATION FACTOR CLP1
total genus 131
structure length 428
sequence length 428
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06807 Clp1 Pre-mRNA cleavage complex II protein Clp1
A PF16573 CLP1_N N-terminal beta-sandwich domain of polyadenylation factor
A PF16575 CLP1_P mRNA cleavage and polyadenylation factor CLP1 P-loop
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.1030 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4c0bA01
3.30.70.2410 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4c0bA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4c0bA02
4KJZA 2VRWA 5EP3A 4DKXA 5EXPA 4O25A 2YVUA 2EVWX 1N5JA 1X6VA 3R7WA 4WIAA 3BERA 3GMTA 1D6JA 3FTQA 1R7RA 1UADA 1EK0A 5AJZA 2ZSEA 3EX7C 3FKQA 3P4XA 1CS4C 4PC7A 2R9VA 3T12A 3AF0A 4DIDA 3O8DA 2R44A 1R0WA 4TLAA 4I1VA 3SHWA 3U7HB 2QAGB 3CZPA 1G291 4DB2A 3RC8A 3IKJA 3LNCA 1Q44A 4US0R 1VCNA 521PA 5DN6D 3ZS9A 4I81A 4HSEA 1G4UR 5J47A 1OF1A 2DPXA 3K09A 3SBEA 2GK7A 4QGGA 4DLWA 2ZRIA 1XPUA 3TR0A 4DDTA 3B1XA 4FW9A 2FSIA 4RZ3A 4K46A 2WIAA 2ODWA 2ZE6A 1Q3TA 2HUPA 4M8NE 4DT1A 2ZAOA 4LHXA 4KYUA 3BB4A 1AZSC 3B82A 3K53A 4AIIA 4KSBA 1JJVA 2A5GA 5TV2A 3UPUA 4XIGS 3TQCA 4IOMA 4DLZA 4N0DA 3EZ9A 2NO0A 2X77A 2NO9A 3T35A 3H0KA 2FFAA 5CIQA 2XX3A 4Y0AA 2FPKA 4DT1B 1XU4A 4QGFA 3PEYA 2IHYA 2DB3A 4B34A 3O47A 3DMDA 3I3SR 3T1VA 1XTKA 1P9RA 2ODEA 4G3XA 2O5VA 2P5SA 1JEDA 5KOYA 4MRVA 1LV7A 3MRSA 3GJ4A 5C4GB 2VA8A 3WBKA 1O87A 3SEAA 4ERNA 1S9HA 4RSGA 2IF0A 2F1HA 2ZJ5A 1KO4A 4AYTA 3AF3A 3CB4A 1EWRA 4I4LA 4LBVA 4DLYA 3OE7A 5D3MB 1YZGA 3GLHB 4Q4HB 1ZMXA 2GEDA 1Z0AA 2HLDD 3CW2A 4HAWA 3SI7A 2AXPA 5F98A 3BB1A 5J4VA 1Y63A 4S35A 3QPUA 2OSBA 4OQNA 3VKGA 4ITRC 1NMZA 3Q3JB 4GMXA 5KU1A 4O2RA 4NZYA 4B6FA 1W4CA 3TUJC 1XD2B 1P5ZB 2WSMA 2WJYA 1VPLA 5GADl 2FPMA 4YC7A 1SVLA 1KI7A 4MGZR 3U7GA 3W5IA 1Z2AA 2VSXA 3QVUA 1G64A 1U98A 4M2LA 5F9HA 4A9AA 5CB6A 5FPHA 5TVKA 2XXAB 4AKHA 1LVGA 4WAUA 1P73A 5FBRB 3WP0A 1E96A 2GXUA 4MQBA 4W9MC 3AP2A 1Q20A 3GLIB 4C3ZA 2WAXA 4M9XA 1N5IA 5L3VA 4RFVA 3WHKA 2EWVA 2ZEJA 3BGWA 1E99A 5FOXA 1XTSA 3MWLA 4BZQA 3QXHA 3SJZA 1P9NA 3A1VA 4PSKA 2X2EA 2CLSA 3AP1A 2FPLA 1GNQA 5C1BA 1KK0A 2A5JA 2YWEA 2D62A 4XOIA 2J7PA 3UMSA 2BC9A 3PCRB 1G8YA 3ZZ0A 1TQ6A 2AKAB 3EAQA 1TQDA 5F3WB 1E9FA 5C4MA 1JR3D 3KL4A 3IILA 4RKEA 4XD7D 2C96A 4Q7KA 2QM7A 1C4OA 1TUIA 4NYJR 5H8WA 2ZR0A 4JLNA 2IYVA 4PAQA 4Q4AA 4HLCA 1T4GA 1NVVQ 1ZD9A 1KSHA 1CRQA 4M1OA 5BN4A 2JLYA 1G3QA 3P20A 3QKTA 3FHTA 2E1RA 1KI1A 1OT3A 2F1IA 2OXRA 4Z1MD 5J4YA 1OH8A 1PLKA 1DAKA 1ONBA 4L5BA 1FTNA 4X8MA 1VG9B 3QI2A 5HZKA 2C5LA 3R9IA 4M9QA 1GP2A 4W5JA 4D6PA 2W2VA 3HYRA 3NKVA 5SZIA 1NMYA 4LYFA 4A36A 3AVVA 4QGHA 1T91A 1XEXA 1Q1ZA 3HPRA 4XH9B 5DH9A 2ZJYA 4V0OA 1II8A 4W5WA 1RE0A 4C0QC 4JLJA 5E7IA 3BWDD 2XNDD 4M21A 2CJWB 1Z0KA 3KUDA 3I32A 4CYMA 4ZIRB 1F6BA 2P6UA 4FWTA 3OF5A 4A15A 2RB4A 3L82B 1F5NA 2WTUA 3QXXA 3I73A 4FMCF 1C9KA 4POAA 4QBGB 1QBKC 2ZPTX 1KSFX 2ASEA 3KDSE 4HAUA 2O52A 2BEJA 3AVTA 1T5IA 1E2FA 3A1SA 1LY1A 2WJVA 2BDTA 3UG7A 3S1AB 2N42A 1XP8A 4AKIA 5LBIA 3O8CA 1TPZA 4RD4A 3MCAA 2PCJA 1Y3AA 1M7GA 1P6XA 2PT5A 1VIAA 4Z1MA 2ZYUX 2IYXA 3BJIC 3REGA 3L0PA 3RAPR 1G7SA 2OHFA 4P0TA 3AKCA 1Z0JA 3Q9LA 1FL9A 1E9AA 1XX6A 3QSYA 1IJEA 3K70D 2IS6A 2J0UB 4LJ9A 3WMEA 1CKEA 1YHNA 1DVRA 2VQSA 4JKIA 3EPLA 1SVSA 2ONKA 1KJWA 3Q72A 3EW9A 5FR2A 1XDBA 2AXNA 2H7VA 5TDHA 5JCPA 4JJKA 4ZPXA 3DOFA 5CDFE 5FR1A 1OIXA 5JRZA 4WZ6A 2WSSA 5BN5A 5IRCD 3X2SA 2BBOA 2EFGA 3RWMB 1Z06A 2OBMA 4HEJA 2QP3A 4DDWA 2G9NA 1UKYA 2EU8A 2IEZA 3GLFB 4HAVA 1U90A 1XCMA 5FOWA 2FFBA 3SJBA 2IYSA 4LJAA 1AIPA 1P60A 4RD0A 4PX9A 3EPHA 3KUCA 5FI1B 4MRNA 3BFXA 4OI0A 1NIPA 2RGCA 3OEEA 1KO1A 5SZJA 1W0JD 4MRRA 2QI9C 1F2UB 2VO1A 3UMRA 2GDJA 1S3GA 4LUCA 1VYVA 5G41A 2HT6A 4QBHA 4TZ6A 4DUGA 1KAOA 2J46A 4XVQA 5JI3E 2CLDX 1NVUQ 4JVNA 5TB5A 5BYJA 3U5ZB 1W0KD 1TL7C 1MRSA 4V0ME 2MMGA 4M9SA 4QHSA 4URYR 4NCNA 3KQHA 4TYNA 1SVIA 1T0HB 1OXUA 2D7CA 1LB1B 4LJ4A 3GLFE 1UDXA 2QTVB 4I1SA 3B60A 5CK5A 2IYRA 5L3QB 2R6GA 2JLSA 4BFVA 5TMPA 2QQEA 1KK1A 3CUEF 1W36D 1R8QA 4O3MA 4U7DA 1SVOA 1JB1A 4EPRA 1VCOA 4CEJB 1NSTA 5JCZA 2FWRA 3LH5A 2RMKA 2VHUA 3AGQA 1N2CE 1PUIA 3AB3A 2QE7A 3REFA 1DG3A 5E7JA 2HF9A 1Z6GA 2IEYA 4IFEA 2ZRBA 1DAHA 3D7MA 4OYHA 4PXAA 1S4QA 1NBMD 4ZDJA 2FEOA 4C2TA 1N0UA 2OO7A 2O8FA 2NZ8A 2ERYA 2W0MA 3BC1A 1P62B 5K8LA 2CVFA 2X1VA 2YYZA 5FBVB 3ECCA 3BRWD 4B3CA 4GT1A 1RW4A 2WWWA 4NCHA 2R8RA 4OJKA 4KBFA 3RANA 4BLPA 1AS3A 1RRCA 1GILA 4OHWA 3BH6A 1EG7A 2GNOA 1T3LA 1BS1A 4JLVA 2QAGA 3RS2A 2L0XA 3CRVA 4Z8YA 3IDQA 3R20A 1Q57A 1G5RA 1G8FA 1M1YE 3A4NA 3U3OA 1DAEA 1BO6A 2FH5B 3KKQA 3AM1A 2RHMA 5J5CA 4DRZA 2W0SA 1DARA 2XNDA 1M7BA 4JVLA 4B2IA 2GCOB 3GP8A 5GJCA 3HWSA 1P2SA 3D31A 2QMHA 4A0GA 4AG5A 1F48A 1NP6A 3C7KA 2QRNA 4RZXA 4B2LA 3LRPA 2BOVA 3RS7A 1EESA 2G1JA 4P3YA 2I1VB 1XRJA 2REOA 2QP4A 4BEBA 621PA 121PA 2CK3D 1O3YA 2WKRA 1TUEA 5TY0A 3QBTA 1YKSA 2RCNA 3AVOA 3ZVLA 5FL7D 1LS6A 2QT1A 1KO8A 2QU8A 4NE2A 3X1ZA 2GCOA 2WOJA 4TL6A 2Q21A 1S3SA 3SC3A 3TW8B 4QNMA 3V4FA 3FDIA 1ZM4A 1MT0A 4Q7LA 4BEJA 4BLQA 1LFDB 1CR1A 2ZU0C 1JPJA 4NH0A 2Z43A 4GFDA 4GBMA 2FU5C 1E2IA 1KDOA 5UKDA 5DN6A 4AC9A 3A6PC 1KK3A 1N25A 1H8EA 3T61A 5J4KA 3NG1A 1Z3IX 1IXZA 3HR7A 4YMVA 1E2EA 5FH9A 2CCJA 3LX8A 4LYAA 3TLXA 4D80A 4LBYA 4PC6A 5HCNA 1P75A 2XJ9A 3CBQA 1R0ZA 1E79D 2ZI4A 1U0LA 4KLNA 1NRJB 1VG0B 1YRAA 2F3TA 1LS1A 3CO5A 3I92A 4CT4B 1ZAKA 1Z5ZA 1HYQA 4B3BA 2HV8A 3U3JA 1DO2A 1N5LA 821PA 4PPFA 3OEHA 2V3CC 2H18A 3L2OB 3C41J 4LBWA 3C5CA 2EFEB 2R6CA 4C0KA 2UZ3A 4L9WA 3RS0A 2FZ4A 3DZDA 2XXAA 4EAQA 1U8ZA 1N0WA 3PUYA 2KE5A 3P26A 2NGRA 5DE3A 3GLIA 4QG7A 4US2R 4G5OA 3AF2A 2PH1A 4JSTA 3GLGE 4DJTA 3UKDA 2GVZC 4Q4JB 2JDID 3B85A 2GILA 3U2QA 3VHLB 3GEHA 3CNOA 5K8IA 1MOZA 4NPHA 4QJ5A 5JHHB 5JLJA 1V43A 3EZ2A 3IBYA 3B1VA 3RNLA 1Z63A 1E0AA 1BKDR 1XD2A 1OW3B 1FUUA 1ZM9A 2DY1A 1Q1EA 3RS5A 2ATVA 4X8OA 4LPSA 2DFKB 3FHOA 4PHTA 4BUJA 4LJ6A 4DLVA 1QRAA 3NHAA 3U60B 4BLRA 1AQYA 2C9CA 2IS2A 1J8YF 2AKYA 4Q1CA 3VU9A 2A5YB 3K0CC 4FIDA 3THOA 3U3KA 4ASUD 3OIVA 2VHJA 1RRPA 4Q02A 2JLQA 3MJRA 4C0HA 4HB4A 1AS0A 4UJ5A 2IUSA 1ZRHA 1AQUA 1TU3A 3ADBA 2YWHA 4K81B 4HUTA 5JWOA 1NG1A 2RAPA 1Q21A 3EC2A 3KKOA 3U7FB 1KNXA 3WYFA 4C4PA 5AUQA 3BK7A 5KSZA 3BE4A 4RCYA 1P2UA 1FX0B 4F7WA 1G6HA 1ZD8A 2W2TA 3E70C 4Q01A 3FPAA 1P4SA 4KFTA 2H17A 1CULC 4F91B 3GLGB 4C7OA 1UBEA 4CZ2A 4PHGA 2F9LA 2PZFA 1D8TA 1UBCA 2DFTA 3ZDQA 1ZVQA 2IT1A 1KI6B 4LC1A 4ZDWA 4TMTA 2DFLA 3KQUA 1W5TA 5KSYA 3MD0A 5CYOA 1Z6TA 1VCIA 3B13B 4NL4H 1X8LA 4N3NA 4QXAA 1L8QA 5KSPA 2QL6A 1G3IA 1Q12A 3HU2A 4A2PA 2CBZA 1HURA 2CL7X 3GQBA 2OILA 2QZ4A 3S1AA 2CCGA 1E2PA 4AKGA 4NONA 4TQUS 3U4QB 1G3MA 5AJYA 2WM9B 2H5EA 4UNRA 4HYYA 2O8EA 1GNRA 3VKHA 3OAAA 4IOLA 3KQLA 4GOJA 4LK2A 1YQTA 3EIHA 3THYA 4GOKA 2FSGA 5A0FA 1XEFA 1E3MA 1DG1G 3AV0B 4HB2A 5CB8A 4WZAE 1MABB 4ZI3A 5KNDA 3CRMA 1G3RA 3DVLA 4IDOA 1HH4A 1NN1A 1RVDA 2ZRCA 3GFOA 4QFMA 2GJSA 3EZ7A 1VHTA 2ZE5A 2RGGA 4RKFA 1CEEA 3CONA 3CH5A 4GPTA 1GRRA 4Q48A 4Q1BA 2Q9CA 3QJYA 3T1OA 4J0QA 4JL6A 2PX0A 3PUXA 3KB1A 1WB9A 4EFLA 5KNBA 3HR8A 2GXAA 1YJ5A 1ZCBA 2ZITA 4PTLA 3AVXA 1KY3A 2ZRLA 1IY1A 3NH6A 3CF2A 3UANA 3TBKA 1SXJE 2EFCB 3THXB 2RGAA 3NEYA 5HCIA 3RC3A 3UATA 2V6IA 3X1WA 1NKSA 2J59A 4NYMR 3CPHA 1FX0A 1E94E 1HEIA 4WA7A 4LPKA 3GJ0A 1G16A 1Z6YA 3R8FA 2ZQ5A 2QGZA 2ZVPX 1NIJA 3FMPB 1UDWA 4M1SA 1S8FA 4YDHB 5CDFA 3IPXA 4WXRA 4IVQA 3OFNA 2Z4RA 4URWR 4KSCA 3RABA 3RRZA 2QORA 2HJGA 2ZR7A 3L0IB 1B0UA 1UEJA 2ZJOA 1COWD 3W8NA 2WWYA 1OH7A 2QTHA 3VKWA 1XJQA 1S2MA 2OBNA 4FMCB 2KWIA 2VPPA 1YZUA 3DM9B 2J9RA 4B32A 1OXVA 5FTKA 2ZXUA 2GXQA 1M74A 2D06A 4KVGA 2VP0A 4CF7A 1Z22A 2JJ8A 5KUTA 4D81A 1XJ0A 4P4SB 1XZPA 4D82A 1Q0UA 3PIRA 4HLUC 1W49A 3EIEA 3Q5EA 2GJ8A 4D0NA 1HT1E 1ESNA 2CVHA 1SVWA 3B78A 4DB4A 3KJIA 2AK3A 3KKMA 4HAYA 3K70C 1CJVC 2QTFA 3TAUA 1G8GA 1JBKA 1KNQA 2IXFA 5HKKA 4UXHA 1FP7A 1OHHA 2ZIAA 3JVUA 1G8PA 1TF5A 4B3GA 1ZJ6A 2ZRGA 2JJ2A 4MGYR 5FTMA 4JIMA 4CT5A 4BFTA 1R2QA 4KAXA 3ETLA 1L4UA 4QOSA 4YXWD 1EGAA 3P1JA 4HLUA 1PZNA 4HZIA 3IBGA 4G0NA 1U0HC 3IIMA 4OI2A 1FP6A 2B92A 5EP2A 5AUPB 1TX4B 2V4ZA 4LYJA 1Z0IA 1UBGA 2GA8A 2K5UA 3H4MA 2GXSA 4Q00A 4G5SA 5DI3A 5B2ZA 1XCGB 4Q47A 3B1YA 4EQ6B 2B21A 5C18A 5L8VA 5B58C 4G5RA 2A5FA 3T15A 4BFZA 3GD7A 4CEJA 4RVCA 3TKLA 4OK6A 1KTVA 2BKEA 1FW6A 1Q1BA 3QEJA 3AEZA 3WRYC 1DO0A 4YMWA 1XFAA 5K8TA 4TL9A 3R8CA 1YE8A 4BFUA 5EZ5A 2GVDC 5CIWA 5CLLA 5EZ6B 5C2JB 1XCPA 1G20E 2OUKA 1W48A 3QKSB 3IO5A 3DO6A 4JJZA 1GTVA 1JAHA 4XD7A 2C77A 4OQFA 1WQ1R 3QF4A 1TQ2A 3LBHA 3QG5A 1BMFD 4Q9HA 1GDDA 1DOAA 2W6JD 2V6JA 3QBVA 5JRJA 1N0VC 1XD8A 4TQ9A 4V0KA 3VX3A 4RY2A 2HYDA 2DWPA 4LRWA 2ZI5A 1FNNA 1OH6A 2J0VA 2C98A 5CM9C 3MWJA 1GL9B 4IEEA 4OHXA 2H16A 1ZC3A 4W5HA 1X86B 1R0YA 4PO8A 4BFSA 4ESHA 1XXHE 5EXXA 4URUR 1J2JA 3ZZTA 1MO4A 1RKBA 2JLXA 5FUVA 1K8RA 4XWOA 5DIFA 1X3SA 2F43B 4TWZA 4C30A 4TMKA 3KXLA 1E2JA 2BVNA 3K0CA 3FVQA 2WIBA 2KI5A 2WBLC 2RGXA 1ZUIA 3EC1A 2WPDA 3X1DA 3P27A 3QENA 1RZ3A 1H8ED 4DSNA 1KMHA 3RS4A 2FGJA 4EJSC 5GVRA 1OHHD 1G6OA 2IXGA 2KB0A 5FL3A 4OK5A 4UQOA 4P4TA 1D2MA 4TTRA 5JSZA 2GWHA 2V1UA 1YR8A 2G1KA 2LKDA 2WWGA 3LAWA 4KO8A 5AR1A 1KSGA 1XPRA 4CEHA 4G01B 1RPZA 1XB2A 5AWFC 1L4YA 2YOGA 1IOZA 4B3DA 1R10A 3PEVA 4MA4A 3AVQA 5BN3A 4CEIA 4P31A 1E1RD 1ZNXA 2J7KA 3W6PA 4QKQA 4P4UA 4ZDIA 2VP2A 2DFNA 3WP1B 3Q7PA 1SXJA 4PHFA 3LLUA 2VH5R 3AVWA 2BMFA 2ZJZA 3LXXA 1US8B 4AWXA 4KITB 3TNFA 2ZM5A 3ZVNA 4LBZA 2V55B 3RDPA 3IGFA 3MWKA 3OIUA 4XTRA 5CJPA 2B8TA 2KSQA 2VSFA 3A58B 3Q8XB 1KI2A 2QY9A 3NBFA 3HDTA 4UNPA 5FPTA 1YU9A 4Z8XA 3GEEA 2C03A 2R6AA 1IN8A 4JBYA 4UXJA 4FMDF 4H9GA 2FE4A 4II7A 4UJ3A 4XVUA 3LW7A 4PAMA 5BWMA 5KDDA 4Q1EA 3N2IA 2P3SA 4A0RA 3CX6A 3R9XA 3QIAA 4ZIRA 3ND9A 2MMCA 1KKLA 2GEUA 4GZMA 2FV8A 4JYCA 4A8JC 5JBQA 2HF8A 2XOKA 1BMFA 2ORIA 2XTNA 3RLFA 4B75A 1P72A 2P2LA 5DLQC 4V02A 1ZP6A 1ELOA 1G21E 3VR2A 4RFSB 3L8YA 3QKUA 2XAUA 4WBSA 3AH8A 1E32A 3DPUA 4L9SA 4MKGA 4A8JB 5H70A 1VDZA 5GJVC 2I1QA 4YDSA 1N6PA 2GBLA 1AZTA 1ZM3A 3PUZA 3RHFA 1UAAA 1E2QA 4HDQB 2FFHA 5BW8A 1P2VA 1D9XA 5FUYA 1E2DA 2FDCA 2AHOA 2JJ1D 2ZUBA 5AUNB 2CHVA 4L16A 4MYUA 1JPNA 1IHUA 3B5JA 5F2EA 2AFIE 3RRYA 3OAAD 4DVGA 1Z0FA 3V9PA 4D0GA 2IW3A 3ZJYA 1C1YA 2CXXA 3NC1C 2BEKA 5EJEA 3WNCA 2ZI9A 2OXCA 1ZUHA 1ZINA 3C14C 4TMZA 3K9HA 1K6MA 2JATA 3SYKA 4FD2A 3W3ZB 4CVNA 2GJKA 2PEYA 5DGXA 4CEHB 1AN0A 3QKRB 4NHOA 1XWIA 1OLOA 2JEOA 5EE0A 1JR6A 3AP3A 1QG4A 1Q3HA 4PO9A 1KO5A 3AVUA 2FSFA 1Z6AA 2CE7A 5LD2C 1CJUC 2YC2C 3ZYCA 1KHTA 5EUMA 2CCKA 1UEIA 4Z54A 1GM5A 1RRGA 2ZS7A 2G77B 2AL7A 3NH9A 2ORWA 1KIMA 2HDNB 4GRAA 4M0LA 4DLXA 2PZEA 1E9BA 3DKVA 1D2EA 2J5XA 4EJSB 4IDPA 4Q7MB 4DIEA 3K0FB 3TSOA 5ANRB 3PENA 3RVBA 4BRWA 2J0SA 1TEXA 2YINC 4A1FA 1CBUA 4A0FA 3ONWA 2A2ZA 1ZNWA 3CLVA 2GAAA 2RGDA 2WOOA 5CJ2A 3T5GA 4ZCIA 1XMVA 1GKUB 2IXEA 2HCJB 2WWIA 1IN7A 3PUVA 3CKLA 3K70B 5LPNA 1PJRA 1ZU4A 3B1WA 3WHLA 2V7QD 1QHIA 2FMXA 4JLDA 5FOTA 3K0AB 2NOAA 2ZJAA 3WY9A 1EX6A 2FOLA 3TW4A 3I72A 4JLBA 1SZPA 4DCVA 1HE8B 1MR3F 4QNRA 1R0XA 4A92A 3QF7A 3MLEA 4R71A 4PHHA 2O8CA 5B30A 4B6EA 2YZ2A 4B71A 2AFHE 3LDAA 4HUQB 1XF9A 5EQTA 4DUGD 1OYYA 2EW1A 2Q3HA 1J99A 3SDZA 4TMVA 4HAZA 5EE1A 1F3OA 1U2RA 3LVRE 2XEXA 3NDBB 2W6ID 4PQYA 2AD1A 4HZUB 1NI3A 5P21A 2WZQA 4NYIQ 4ARZB 3C4JA 1DTSA 3UK6A 4KXFB 1V5WA 5FFMA 5AJXA 3VNVA 2QBYB 1KJZA 4ZV4A 1IXRC 3BFKA 1VMAA 1M6NA 4GDFA 5FBWB 3THWB 3KJHA 5H1YA 2B7CA 4B47A 5JEEA 1SXJC 1I2DA 1E6CA 1E2GA 1Z0DA 2BM0A 2V54A 3K9LA 3MUFA 3PEUA 4M9ZA 4Q9LA 5KPJA 3AGPA 2Q0HA 3FE2A 2JLZA 4DSTA 3THXA 2MSCB 4CIDA 2QAJA 1QHHB 1R6BX 5EP4A 2WJJA 3CR7A 4R2IA 3VHXA 1W36C 1G18A 4IVPA 3BAFA 4TTQA 4OHVA 3SFVA 1W36B 2F1JA 3KFXA 5FBQB 2ZE7A 3TGPA 1CJTC 3B7GA 2QMOA 2C9OA 1MRNA 1W44A 3GJXC 3UWOA 3SOPA 2PCLA 2A78A 4BQSA 2IBMA 3M1IA 5TXGA 1Q22A 5GJWC 4D4LA 3KXKA 1UKVY 3SNHA 3AKEA 2XJ4A 4TL8A 1J7KA 1MV5A 3L43A 1VYTA 4H1VA 2RGNA 1EX7A 1VHLA 4QGAA 3CF6R 2ERXA 4JYBA 2F3RA 2GZHA 4DLRA 1LTQA 3K9GA 2OE2A 2YWGA 2WV9A 3F5FA 2IF2A 2ZI3A 2PLFA 2NO1A 2QE7D 4GOXA 1W46A 4OHYA 2MSDB 3D8BA 4F38A 1RYFA 4JLAA 5E95A 3OE7D 1HE1C 3FWYA 1YVDA 3PXGA 2DWQA 3KFVA 5DHAA 3PJRA 2Z6VA 1A1VA 4MRPA 4E09A 2BWJA 3H1TA 3MGCA 1JAIA 1KDRA 2IYUA 3OHMA 4HLQB 5TARA 3I4LA 3WXMA 3KB2A 4FXPA 2XOKD 2A7QA 3IQWA 4OKSA 5HPYB 4OQXA 3SFZA 2GF0A 1II0A 5SZHB 1HUQA 4URZR 4WXPA 3EXAA 5E7MA 1A2KC 1T8TA 3A8TA 2VP9A 1P7CA 5HE8A 2OLKA 1QDEA 1OIVA 2VHQA 1AJEA 1GIAA 4TSFA 1KGDA 2ZSDA 3FMFA 1R5NA 4DLSA 1N6HA 5GVSA 2W6IA 5L3SB 2J87A 2HEIA 2OFOA 3WBJA 3I5XA 5FOVA 1XTQA 1YZLA 2A5DA 2QMEA 3KTAB 2OCBA 1GL6A 1W5SA 1A2BA 4TLEA 2OCYC 3EG5A 3TQFA 3J81k 3GEIA 5KTYA 1IAQA 2JGNA 4IHQA 1HTWA 1E4YA 3NBXX 1R5BA 4PSVA 4Q9JA 1FMJA 2ANCA 4TLCA 1E9EA 2KBEA 1GWNA 3TVDA 3C8UA 2QEQA 2C99A 4IDHA 5FOUA 2HT1A 1NY5A 3EA5A 4YONB 2AWOA 1QVAA 3ZQ6A 1FQKA 3QKRA 4EFNA 2XZOA 1OV4A 1TU4A 2J45A 5DISB 3CRRA 3GLFA 2BIFA 1U8YA 2OCAA 5LB4A 4ABYA 5JJLA 4Q66C 1PLLA 4LV5B 3ICEA 4V0MA 1Z2CA 4V0NA 1UM8A 4ZDKA 1CR0A 4M1WA 1RJ9A 1CLUA 2ECKA 2IYZA 5DI3B 1TF7A 3X1YA 4MH0R 1CP2A 2GEVA 2I4IA 1MO3A 1FUKA 4Q1AA 3A1TA 1NLFA 1E2MA 3BB3A 2YOFA 3GCGA 3GJ5A 4KLZA 4DDUA 1WXQA 2G0NA 2RGNC 1U8AA 4I1UA 4QBFA 3LXRA 4JL5A 3D6TB 3ZGXA 3C16C 2ATXA 1KOFA 2Z83A 3E2IA 3FMIA 1AK2A 3LFUA 1OFHA 3EZFA 3TRFA 2R6DA 5EP1A 1DADA 2XSZD 2Q9AA 3BH7A 4OJQA 4AI6A 1KY2A 1KZGB 2NQ2C 1CR2A 3CH4B 2ZS9A 5JS8A 2ZJ8A 3NDPA 3AKDA 1W2HA 2BJVA 5H68A 3UWKA 3CZQA 3X1XA 4JL8A 1GVNB 4BFXA 2GESA 1T5LA 1D9ZA 3MAAC 4RZUA 3ZD6A 4WW0A 1F2TA 2FGKA 5D3QA 4DEXA 4YMTA 4LOAA 2XB4A 4KFSA 3KX2A 2LKCA 3A36A 5IDVA 1OE0A 4L15A 4N0EA 4MGKR 1IM2A 1NMXA 3Q7QA 2XTMA 4Q18A 4B48A 1T9HA 4DZZA 3DOEA 3MMPA 4JSYA 4AKEA 1K5GA 3SJAA 2P6NA 4A2WA 5KDOA 4TYPA 1SVMA 1NVWQ 3TVTA 5JEDA 1EFHA 3T06B 1Z29A 2WMOB 1US8A 4V03A 1QF9A 4F92B 1QHSA 1SXJB 1U99A 3T1TA 2KBFA 4P33A 4AD8A 1XMJA 2VEDA 3SYNA 4IOJA 3TH5A 2FSHA 3I1FA 2IYTA 4MKIA 4G1UC 1JALA 2AK2A 4MDEA 3DEFA 1JEEA 3BH0A 1DAFA 5ELXA 4IDNA 4Q21A 4JT4A 2QROA 2QT0A 2ZVQX 3SU8A 5JHGB 1G5PA 2NPFA 2DR3A 4C0BA 1W4AA 3GPLA 4C7OB 2XSZA 2PMDA 1N6RA 1GOTA 1WE2A 5K8UA 3KXIA 4L8GA 3I61A 4ESVA 1U0JA 3G0HA 3H2YA 4XWKA 1E0KA 1KYIA 4IVRA 3SS8A 4NBSA 2PX3A 1MH1A 3RSLA 3BIFA 4PC2A 4F4JA 1XEXB 1X8KA 2FG5A 2FNAA 4TT3A 3LQQA 1NVVR 1Z47A 3WMFA 2QPOA 3FB4A 2DYKA 1WMSA 2Y8EA 3NHBA 4Q03A 3DZ8A 2WJHA 1R5OA 1COWA 4BE7B 3IIJA 3IHWA 4QJ4A 1OKKA 3ZZUA 2JCSA 4NTZA 4B2PA 1CRPA 3N70A 2Z4SA 1I4DD 4GMDA 1KKMA 1T3HA 4BECA 2O0JA 4L4UA 1FZQA 3BFVA 3U3RA 1A5TA 1D2NA 2WWHA 3RRMA 4MRSA 1ZYUA 3TAHA 3WYAA 3VFDA 5HKKD 3QQ5A 2RKOA 2RH5A 4B43A 4TL7A 5J4LA 2QM8A 3QXSA 2R62A 3CWQA 1T0JB 3ADKA 4O0MA 2VIIA 1DEKA 2XZPA 5KYKA 3BD9A 3CNLA 3LBIA 2G6BA 3QXCA 2JIZA 4MITA 4N1AA 3ZLJA 2F6RA 3A37A 3GFTA 2WPDD 1H65A 4WOPA 2GETA 4OI4A 2WMNB 1QHYA 3EASA 3I5YA 1XMSA 4JZKA 2O0KA 1G9XA 4PZYA 3TJZA 5HTKA 1JR3A 1YZKA 3WYGA 1AGRA 1XTIA 2GCPA 1EFCA 4OBEA 2D7DA 1BH2A 4ZCLA 4BFYA 4NCJA 6Q21A 4TT3D 2XGJA 1VECA 5AJVB 4RD6A 2OLJA 1B23P 1NJFA 2J41A 1G7RA 1ZNYA 2REXB 1E1RA 2UVQA 3BOSA 4BRUA 8OHMA 3MWYW 4MKFA 1ZD1A 2FX3A 3B1ZA 4MUBA 3V4RA 5KO2A 2FZLA 3NC0C 2QG6A 2ZSBA 4Q7JB 4PAOA 3SE0A 1Z07A 3FKSD 2F1RA 5J40A 2HXYA 2CE2X 1XJCA 1IN6A 2H1LA 1GNPA 5B57C 1OFIA 5JI2E 2ZR9A 2OESA 1XTRA 3ND8A 1XNJA 3KJGA 2C2HA 4CGZA 4X8HA 3W9YA 1OPXA 1GL7A 1A7JA 2IC5A 3QXJA 4HATA 4TLDA 1P61B 1UJ2A 1E2KA 2FF7A 4M4SA 2NTYC 2ZRFA 3PVSA 5BQ5A 3LLMA 4G5QA 4JT2A 2CEAA 3H84A 1MO6A 4AYWA 3VTKA 4RZ2A 1UKZA 2JLUA 1KO7A 1E0SA 1ESMA 1OB2A 1OH5A 1J70A 1JQLB 3U7EB 4CEIB 1QHXA 1II8B 4UNQA 2EYQA 3FYHA 4B73A 3IUYA 4AK9A 3VR3A 2ZJ2A 1GAJA 2QBYA 1AS2A 2J1LA 1E2LA 1WRBA 2G88A 3U6BA 1GUAA 2JLRA 3JVVA 4A6XA 3IEVA 1G8HA 1DAMA 2OFWA 2VLIA 4TZ0A 1OIWA 3LY5A 1P9WA 2WJGA 1KDPA 1YZQA 2ZRHA 3NTUA 4E5UA 2YKGA 4OQMA 1N6KA 3LBNA 4C0AC 2C8VA 3DL0A 2WJIA 4BLOA 2GK6A 3IHLA 4XSHA 3LX5A 4K8OA 5A4JA 2ZREA 221PA 2BJWA 4QBIA 3QEOA 1JXOA 2GBLC 2D2FA 5JZVA 4QM7A 3OZXA 1F2TB 2ZU6A 3KQNA 1I2MA 4KFRA 4NMMA 2OG2A 4M1TA 2VF7A 4C9BA 4EIWA 1WF3A 3U44A 4DC9A 1CIPA 2IWHA 4IJMA 4PZLA 3U3MA 1DS6A 3U6KA 1A4RA 4LSGA 3OEED 4PR0A 3AF4A 1TTTA 4D4KA 4KV9A 3ZIAD 1CXZA 3E1SA 2QPTA 3PITA 4PPQA 5G3YA 3WRXC 2ZSAA 4I1OA 3ICQB 3FKSA 3HU1A 3QPVA 4TMWA 5FPSA 2E87A 4FINA 1KSJA 1SHZA 4LWZA 1VYUA 5KSOA 5JECA 4F4IA 3CRQA 4A0HA 1CJKC 1G4AE 3VQTA 2W83A 3EARA 1N6IA 4FCVA 4M1KA 4PZZA 5EXSA 4QRHA 2IX3A 2J3EA 2N1BA 2AX4A 4XWAA 4LHYA 1PVOA 2QUZA 1RJ9B 1JR3E 1XBTA 4E22A 1EFTA 1SQ5A 1TMKA 4LX0A 1TQ4A 3K8YA 4JLKA 2IUUA 4BGDA 1WCV1 3N2EA 3NWJA 1E79A 1XXHA 4BZPA 1CJMA 1P2TA 4WVFA 3ZD7A 2BCJQ 3GJ7A 4GNKA 3OEHD 5JJIA 3MG9A 4EKDA 1RIFA 4ZKEA 2B8WA 3F3YA 2OFXA 3OIYA 4PC1A 1E69A 3GLGA 3VR6A 1IXSB 3GJ6A 4P4SA 3AF1A 3GLIE 2OEPA 3EWAA 2JA1A 2WKQA 4D4JA 3KTAA 1JJ7A 1AGPA 2W58A 1G7CA 4EJSA 4LYHA 2H92A 4LY6A 3VAAA 2HLDA 3Q85A 4HUQA 4PPGA 5C46F 2WSSD 3O8BA 4PANA 2QNRA 2GAOA 4LJYA 2EFHB 5FL7A 4A6PA 4QJ3A 2AD5A 3IIKA 4HI0E 2W6JA 2FA9A 1GITA 2FEMA 1OXSC 1ODFA 2DWOA 1VKJA 4IEIA 5DYIA 2CL6X 3IEUA 3LO5A 1II9A 1YR7A 2LWIA 4GSYA 4D25A 4FN5A 3V00A 1N6OA 5G53C 3VR1A 1RC8A 4YMSA 2BMJA 4QC2A 3M0EA 2RHDA 4C0LA 1G1MA 2PZGA 2IK8A 2O0HA 3TE6A 3BS4A 2NMVA 1TADA 3RS3A 3WNBA 3E5HA 4Q1FA 1M8PA 1X8JA 4DLUA 3L8ZA 1SKQA 3M4YA 2H8KA 2IYWA 5IHPA 1L2TA 3F0TA 4LJ5A 2QAGC 4JS0A 3I62A 5CYPA 1VCMA 1UKEA 3SZRA 4M22A 1ZNZA 2D74A 3NXSA 1VG8A 3O8RA 4Q4JA 3LQRA 2XTZA 3TMKA 3G5UA 3SN6A 2ZRDA 4PO1A 5L3QA 3PUWA 3LWNA 5EE5B 1DBSA 1HV8A 4UNNA 1EFRA 2Q3FA 4BLSA 4A82A 5CK4A 2W2XA 5FI0B 2GJAA 3Q5DA 5EXTA 4BWYA 3U44B 3G82C 3NBZC 4W7SA 2ZUCA 3CNNA 1OXTA 1HT2E 4U02A 2EFDB 2O8EB 1M34E 1AM4D 2QN6A 4Y0VA 4DSOA 4PPNA 4C0SA 5D3MA 5F9FA 4DXAA 1M2OB 4C0JA 3K0SA 1IY0A 3THWA 1H8HA 1XEWX 2RGBA 1ANKA 5DI9A 3LV8A 4KU4A 4A4DA 3GJ8A 4JLMA 2ODBA 2NO6A 5FUWA 1EWQA 2JAQA 2GHIA 1WBBA 2P6RA 5AUOB 1G3UA 3ZQJA 2G0TA 2ZETA 2NO7A 2ZRKA 3LD9A 2REBA 2XNSA 2HXSA 2OCPA 3DHWC 5J4HA 1W2GA 2CNWA 3K1JA 1YZTA 1W47A 2AN9A 3SJCA 5IT5A 1XZQA 4TN1A 4DCSA 2DHRA 4TYWA 5M04A 1ZC4A 2C95A 2N46A 4LDJA 4JKYA 5JMTA 1E1QA 1N5KA 2VHCA 4YLGA 3C15C 4TLBA 5IK2D 721PA 1HQYE 4GP6A 2HYIC 4MYTA 2ZI6A 2OV2A 2CHQA 3VNUA 2PL3A 1JECA 2Z0MA 4UKDA 3R9WA 4M53A 3ZVMA 3A1UA 3CF0A 2GCNA 1ZIOA 4C2UA 1JNYA 1U81A 3VR4A 4QHYA 1DELA 2PJRA 2XZLA 2UKDA 2IYLD 2IL1A 4LV6A 4NYMQ 4M1MA 4XSGA 5JWRA 1W0JA 2Q6TA 4Q4AB 4MYHA 1KI8A 3RSOA 4TSFD 1U9IA 5DSZA 3ASYA 3F8TA 2BBSA 3A1WA 5G40A 2GZDA 2GRJA 2O8CB 4KHZA 2CNWD 1S1CA 4PC3A 4LHZA 1Z83A 2GKSA 3DDCA 4PSAA 3EPKA 1N3BA 1WDTA 2PJZA 5JWHA 3EIQA 5CM8B 5FTLA 1W1WA 3TUZC 2VP5A 4ZI2A 2VF8A 2DCUA 4DWJA 2RGEA 4NU0A 4PFSA 5LDDC 3VR5A 2IWRA 2YHSA 1IN4A 2BMEA 2GF9A 3MJHA 1EXMA 1UBFA 5JSZB 2IUTA 3U4QA 1WBDA 5E4FA 2ZRMA 1OSNA 1TNDA 1ZIPA 3W6OA 4ARZA 3IQXA 3A4LA 3EA0A 4AY2A 2JJ1A 4EPYA 4OK3A 4OI1A 2FN4A 2VTKA 5BXQC 2YWFA 4CW7A 1JQJC 4EDHA 1D5CA 1ETUA 2QA5A 2XITA 4QM6A 3L0OA 4EPVA 2Q3MA 5KHOC 2P5TB 1ZU5A 4FCWA 1DAIA 1L7VC 3PQCA 4RD2A 2F55A 2ZANA 3QNUA 3ZVRA 2JLWA 4JBWA 2D3WA 4KBGA 1IJFA 3CWZA 1N6LA 2GZAA 1K5DA 2EYUA 2HJVA 2OZEA 2YNMA 2YV5A 5SZKB 4R9UC 2O8DB 4E07A 2SHKA 2J0QA 2QPAA 3AUYA 1NBMA 2ONJA 2CLCX 1KI4A 5A5GA 5L3SA 2E9SA 1NN0A 3KQKA 3U61B 5BYKA 3VU9B 4LGMA 2A3RA 3FHCB 2BV3A 1VG1A 3GFPA 3PG5A 4E03A 3W3AA 3TIFA 1NSFA 4F93B 1LW7A 4IDQA 4IXNA 2IA5A 4CRWB 4YMUA 1ZCAA 4TYYA 2OBLA 2Z5FA 4CDGA 3LVQE 4ZCMA 3RRNA 3AUXA 2ZAMA 3N5CA 3W6NA 4JLPA 1T3SA 3HJNA 5KNCA 1F2UA 4NCIA 4IW3B 1SHKA 2BBTA 1S0UA 3B8HA 5AK0A 4B35A 1JI0A 4AURA 5AJWA 1NLYA 1KK2A 3CPJB 2A30A 4ASUA 4HB0A 3LA6A 3TSWA 1GKIA 4NKRA 5IF9A 1KMQA 1X1SA 2XB2A 1ZW6A 4RCZA 1QHHA 4FCTA 4UNSA 2P0EA 3FFAA 3HP1A 4LZZA 3QUSA 3I8XA 1ZM7A 2ZYWX 2C04A 2LCFA 3W5JA 2CJWA 1S1MA 1VTKA 4TQAA 4KVAA 5GJBA 3PEWA 2ZSFA 4RD1A 2R6FA 4PQRA 2VSOA 4EUNA 1IY2A 3A4MA 3P4YA 3SQXA 2J7PD 1FPMA 2OAP1 3QVVA 1QZXA 4OQLA 3TSZA 1E2HA 1YR6A 1XMIA 1SVKA 2IHBA 4BASA 2ODNA 2FFQA 2A9KA 1LF0A 2EQBA 3IO3A 3K0FA 4G5GA 3FMOB 1TEVA 2YC4C 1TAGA 3ZH9B 1MO5A 1G7TA 1OXXK 2IS4A 3CR8A 1W0KA 1G17A 1EFRD 4FI3C 4JBXA 5G3ZA 5EUQB 4I99A 1S96A 3MSXA 4KODA 3K09C 1KI9A 4KI0A 5HE9A 4ILEA 4UXIA 1PLJA 1HY3A 2QSZA 4EPWA 1KMHB 2QP9X 1DPFA 1W7AA 2CHGA 5FPKA 4JVSB 4GZLA 1G41A 3IPYA 2WVJA 3K0AA 1NBME 3EWSA 2ZRAA 2ZS8A 3DKPA 2BBWA 4HDCA 4M1YA 3VX4A 1QG2A 4X8LA 3MFYA 4A2QA 4MUAA 3UIEA 3B9QA 1OYWA 2QQ0A 2QRZA 5DNYB 1LNZA 4TMXA 3W34A 3AKYA 3BORA 1MKYA 2X2FA 3DMNA 4LJ7A 4IFBA 2HCBA 4KFUA 3PV0A 4OL0A 2OAQ1 2F43A 3NIBA 2IYQA 1JXMA 4HDOB 2WWXA 1XD9A 4H1UA 1U9IC 4MYCA 4BLTA 5FBLB 4EFMA 1G5TA 4B3XA 2VP4A 2VYFA 2YOHA 2CK3A 1J90A 1BIFA 1YR9A 4Q4LA 3B9PA 4LC0A 3ZS8A 1QHNA 2CMKA 5KPDA 2O8BB 3CIOA 3CX7A 4HLDA 1OB5A 5CITA 2ORVA 4ZO4A 3OESA 3UXMA 3VMFA 4XJXA 4QL3A 4WZBE 1UPTA 5L3RA 1YRBA 2IS1A 3FFBA 1A82A 1Z8FA 1KDTA 4DEYA 2PEZA 3JZMA 1NN3A 4NDZA 1E4VA 4Q5IA 4D0LB 4RFSA 3L0SA 3QKSA 4PQFA 1SULA 3CPEA 4IRUB 3JZAA 2O8BA 2WAYA 3KJEA 3B2EA 4P32A 2G83A 3UG6A 1CR4A 1AKEA 2ZUDA 2P65A 4B33A 1PV4A 3I8SA 3KKNA 3WNDA 2C78A 2NZJA 2ZE8A 1GRQA 1E9SA 2ZYTX 1NG9A 3W8RA 4V0LA 1QVRA 3SR0A 1GG2A 2ZI7A 2GTPA 1NKTA 1M7HA 2F7SA 1Z6XA 4D2IA 1RRFA 2PMKA 2AR7A 4DLTA 4DDVA 2WWFA 4QHTA 1CTQA 3ASZA 3NVAA 4Q9KA 1GZSA 1W4RA 4BZXA 4GL2A 1NJGA 1FFHA 4LJ8A 2VL7A 4JVMA 4Z51A 2JLVA 4Q9IA 1SKYB 3ZIAA 3T1QA 4URXR 3CRW1 4U00A 2CL0X 1WP9A 5JJKA 1BYIA 5FPYA 3W90A 4LCBA 3CM0A 3P32A 2BMDA 2ZROA 3AQ4A 3HYTA 5KDLA 3H86A 1FQJA 4KCGA 1E1QD 1CU1A 4LI0A 1HA3A 4B76A 1HQCA 2D2EA 4HAXA 1BOFA 4O2LA 4FMDB 4HZUA 4DCNA 3FOZA 2JIZD 2D4HA 1J8MF 3PR1A 2J0UA 4AYXA 1T8UA 4A8JA 1BYUA 4IOKA 1ZBDA 1U94A 4R7ZA 4ACBA 2WKPA 4Q1DA 5HR5A 1AA9A 2PLRA 1OFUX 4ZKDA 5IK2A 2BM1A 4D26A 2OM2A 3GJ3A 2G3YA 4GI7A 2WHXA 1XXHB 4R2HA 1NVXQ 4JLOA 5DYGA 3DM5A 1Q1QA 1G19A 1MABA 4D4MA 4BFWA 3RYTC 1DAGA 2CDNA 1FOEB 4EPXA 4US1R 2ZRNA 2JASA 2IYYA 1IQPA 1OKKD 3TK1A 1XEWY 1P3JA 2F9MA 5E3HA 2ZRPA 2ZYVX 2WICA 421PA 2V9PA 4HB3A 3EPJA 3ADCA 2R65A 4NCKA 3PFIA 1IBRA 4OHZA 4EPTA 4AG6A 1IONA 1E0JA 3BXZA 4DHEA 1FMLA 3R7WB 3THYB 5FUXA 1NNEA 5EE9A 3GLHE 5FOSA 2DBYA 2PT7A 1E9CA 2MSEB 2BCGY 1H8HD 2UZIR 3UMFA 4F4CA 4IXMA 2YJTD 1WA5A 3T34A 4RJLA 1XTJA 3QY0A 3KZ1E 2NPIA 1W4BA 3K0EA 4NP6A 1NY6A 1KZ7B 1XPOA 4R98A 1LF5A 4MGIR 1FTSA 2TMKA 1OFTA 2W00A 1E2NA 3KKPA 2NG1A 4DCTA 2EWWA 4DBLC 1E98A 1SKYE 2NIPA 3SHFA 1GRNA 3BBPA 2QSYA 1ZUNB 3QG1A 1GKYA 1QHGA 3D3QA 3C5HA 1R4AA 1OJLA 1S9DA 2V8OA 4TTPA 5LD2B 4ON9A 1KAGA 3T5DA 4XVRA 2KJQA 2X19A 5HZHA 2ZTSA 3OIWA 3TR5A 1TF2A 1NL3A 2ANBA 1T6NA 2P67A 2V1XA 5B64A 3QOFA 1EFUA 4GP7A 3AVPA 1KI6A 3AVYA 2O8FB 4B74A 5JS7A 1UF9A 2O8DA 4U5XA 2ZJBA 3HPQA 4YXWA 4ACAA 3SQWA 2QGNA 3K9NA 1NN5A 5LB2A 3FGNA 2VHTA 4XTCS 4DSUA 2JJ2D 4LV8B 4NYIR 1NF3A 2H57A 1E9DA 2B6HA 3QF4B 3SBDA 1KJYA 2AWNA 1GFIA 1NLZA 1SGWA 1PUJA 4FMBB 4B3FX 4DCUA 1FNMA 2I3BA 4S2EA 4TYQA 3GLHA 1I4LD 2GJ9A 4Q4HA 4YQFA 2C9YA 3M6AA 2R2AA 4NYJQ 3ADDA 5DO9A 1R8SA 1Z08A 4BPBA 5CLQA 1RYHA 2QENA 1RFLA 3NEJA 2BHRA 3HU3A 1E9RA 5FTNA 3CX8A 4MKHA 2X8AA 1CF4A 2PBRA 4MDFA 5JFGA 1X1RA 2B7BA 5DHFA 1SXJD 1YZNA 2QMUA 1Z28A 3LW8A 3OFND 4Q19A 4IKEA 1KI3A 2VP6A 3QPWA 2VBCA 1AKYA 4EQ6A 4B44A 3RWOA 3QE0A 1GSIA 2JDIA 4RD3A 3WMGA 2V7QA 3TUIC 5FTJA 4JMPA 3EZ6A 2Q9BA 5EE3A 1IN5A 3SYLA 4URVR 3NBYC 1VIYA 4LHWA 1ZM2A 2ZRJA 4FWIB 2OT3B 4KYIB 1DE0A 1I4TD 1UFQA 2FJUA 4LHVA 1F60A 1N6NA 2BKUA 3B6EA
chains in the Genus database with same CATH superfamily
4D8TA 1GSLA 3HWWA 2R7SA 1F0NA 2XOXA 1PTJA 3C3CA 2R6JA 5GINE 4PCLA 3M3IA 4KR7A 2VATA 3U7HB 3EPIA 3GEBA 4YV0A 4OOFA 3F1LA 521PA 3LHIA 4HSEA 4QGGA 4I3GA 2YN0A 4ZVQA 4ITSA 1FRXA 1WUTA 3BCHA 4V1PA 4YM1A 3OTDA 1FS5A 2A5GA 5TV2A 1FFGA 3KLOA 5LM3A 2XCIA 1KLNA 1L9KA 2WQ7A 1N1TA 4GSKA 4KPEC 2VSNA 4B34A 1XEAA 1H3EA 2FWMX 1SBEA 3JS9A 5DDPC 4NIGA 1LENA 3HLTA 4RQAA 2NV2B 3IAEA 2H1WA 5E4YA 1RBOB 3A9CA 2IF0A 4KB5A 4TRNA 4X3OA 4ER7A 1LOEA 4NMXA 5L1JA 1WA6X 4UVGA 1WXXA 2Q3DA 5JMOA 2BV4A 2PLNA 1O6XA 2GIQA 1UZZA 5KU1A 4R3NA 4UVIA 1W4CA 2B1QA 1CHNA 5F64A 4YR9A 1F1BB 3FUQA 4IQXA 3TEGA 3U7GA 3I0ZA 4M2LA 4PS1A 3FYDA 2ATFA 3AD7C 2LEAA 3FQKA 3HA5A 3LYHA 5LQUA 5GAEU 4Q4W3 1HGXA 1N5QA 3AP2A 2B5HA 2XWBF 5JOWA 2YNFB 5EJ5A 2PUFA 1J3RA 4RVDA 3OLVA 2ZEJA 2VF3A 5AK5A 4ZHRA 2A5LA 3TZHA 2FPLA 4YCSA 1WLDA 5CURA 1G8YA 1UP7A 3NNMA 2B82A 3QLJA 1N2OA 1EQMA 3MPWA 1U6BA 1KDYA 3VGPA 2B3TA 5BN4A 3W6ZA 5T6BA 3UBMA 3OTOF 1ONBA 3ND5A 3GRPA 2B78A 2XKPA 2PI5A 2G9RA 2J5RA 4HONA 2WNVC 5CFCB 5EJZB 3A28A 2DH9A 3WG4A 5A6ZA 4A15A 2RB4A 4I4TB 2EALA 1J2RA 4FMCF 4D4GA 1PJLA 3A3PA 2DVAA 1M2WA 5JZBA 1MWYA 1C8M2 3AVTA 4L5JA 3A1SA 2P62A 3MCAA 2IYXA 3RAPR 2OHFA 4KJXA 3LWBA 2UZ4A 3NBPB 2YNIB 4II2A 4MVJM 2OHJA 1CG6A 3K70D 2HEGA 1J8QA 5JV5A 4ZI5A 4HYQA 1H2XA 5CVJA 1PRYA 1BJQA 4A44A 4EI2A 4YV7A 3E6CC 3S5UA 2ZHBA 1GG9A 1HTTA 2R3SA 4RH3A 2A9PA 4HAVA 1U90A 1V95A 1XN1A 1LPAB 3GDGA 4R1MA 2C4HA 3BFXA 1YFYA 1LWOA 1QV6A 1Q0PA 3OUHA 3TLBA 1YRLA 1D1PA 2HT6A 3ZNNA 1WHTA 5HM8A 1B8PA 1RSCA 3FOAA 3U5ZB 1TK3A 5CKMA 1ZONA 2PKXA 3HRHA 2Y33A 4NCNA 4CZCA 3T0GA 3TWIA 2YKOA 1WCSA 3B60A 3O83A 3QUQA 3CUEF 4FNHA 1PEAA 1SVOA 3FK4A 2H0AA 4Y2HA 1CZRA 2V5DA 3ZWKA 4XBNA 5DLYA 2VDQB 2I34A 1YQ5A 3M6XA 1C7EA 3WGHA 4IZHA 1ZOLA 4UAGA 2FCRA 3TQRA 4IFEA 2LA6A 2WIDA 1XAGA 1CC7A 1ZJ5A 4FBTA 4HJRA 2O8FA 3KV1A 2WWWA 4XXPA 5K0SA 1T3LA 1V96A 5EHIA 3PPVA 2BZ2A 4S0XA 4UAJA 2IU6A 3MJFA 3IDQA 3NT2A 2DOKA 5ICGA 4FXDA 4HACB 1UPUA 4LZWA 1WMEA 1FYDA 3WG1A 4WEQA 3I64A 1RUJ2 1IUKA 2DWCA 3HWSA 2VBWA 4PZCA 2WWTA 3RYCB 1RUE1 4KLCA 3VNQA 1YE3A 1H2BA 5IVIA 4BNKA 1Y10A 4UUBA 4K4ZA 2QYOA 1QM5A 1CULA 3SC3A 5KT3A 3IKLA 3PEHA 4KQCA 4TVOA 5FZCA 4QNMA 3W4JA 4JENA 5FZDA 2E0IA 1GZ5A 1HPLA 1TM7E 4RGYA 3AXTA 5DN6A 1H8EA 1PM7A 1IXZA 1E2EA 5FH9A 3TLXA 2QLJA 3K6SB 2O1QA 3CBQA 4KLNA 3FUCA 3VYUB 3UM9A 4Y2RA 2ZSUA 3O8NA 5CH3A 2YXDA 1RBMA 4DR4J 3L2OB 4RY0A 2YXNA 1N8NA 3C41J 1UZLA 1BVRA 3WIUA 4F6RB 5BSTA 2NXWA 1QCYA 5BOVA 4CUGA 1WKKA 3KZOA 4QB6A 3BL6A 2AGVA 1R4NB 5HXAA 1WCKA 3EXG2 3BKXA 5LRSA 3GEHA 5D5QA 3OBRA 2W2NP 5LWBA 2GDZA 4NPHA 3KYLA 4J3NA 1FNSA 4YLYA 1J20A 4IV1A 3EZ2A 5KFWA 3SV4A 1XD2A 2DY1A 2QQJA 4Y1UA 2CADA 3NHAA 3S0MA 3FROA 4GWJA 1ZR2A 3U3KA 4HAOA 3M9NB 5L40A 2ZGMA 4AVCA 3GMIA 1IH8A 1QO7A 3H7HB 1E1CB 1P2UA 1OFNA 2JIQA 3A22A 2M1ZA 2KG1A 2ZNYA 4TXHA 4F5YA 3FPKA 3M05A 4TWTA 4A8YA 5AM5A 1G9DA 4MRMB 2F9LA 2VA2A 4LC1A 2BFUS 2AVDA 4PYDA 4TMTA 4BKQA 2UYQA 1L8QA 5ITZA 3TAQA 3CRZA 1IPEA 3IQFA 2QZ4A 4W1QA 3MIFA 3DOHA 4EWLA 5JXSA 1X4BA 4ZPVR 1L6IA 2G80A 4P5YA 1DIBA 3IPCA 5ILGA 4RADA 1ROFA 2EL7A 1Q2UA 1BHO1 3WSOA 4HB2A 3DKDA 5JDIC 4MXWB 5FA5A 3D3BJ 4H17A 3L84A 4IDOA 3FN9A 1VHTA 1KDVA 1T1GA 1C7IA 4MKRA 1SCIA 1C3VA 1KQKA 2FF5A 3W5SA 2PX0A 1CJBA 1Z62A 3DOKA 3KSBC 3NETA 4BMOB 2VPZA 2ES4A 2OAEA 3M5WA 4ZHQB 4JXZA 5JXGA 1XNAA 3ITNA 5DP1A 2Y71A 2JEJA 1Q7GA 5DMYA 1J97A 1G8MA 3R6SA 2HJGA 2ZR7A 1B0UA 5T5QA 5HOQA 1W5EA 1XJQA 3GUCA 1OXVA 5FTKA 2B94A 5FAKA 2FLLA 4M8KA 1ISHA 3GEDA 5HSPA 4LS3A 3RFCA 1O2DA 2ZB7A 4K6FA 3R3TA 1CJVC 3DONA 1F8FA 3N87A 4CT5A 4Y28C 1S99A 1T8RA 1OLUB 2OPHA 3MGBA 2K5UA 5DI3A 3AFHA 3KT8A 3D7SA 4FTBA 2PANA 3JD2A 5BMVB 2DERA 3T2QA 3TXYA 4P22A 1KTVA 4I01A 1WXEA 3AF6A 5KNDH 3D5TA 1CPYA 2X58A 4YCNA 4CP5A 3E8MA 2HNKA 3BGFA 3ZCXA 5LEJA 3DBVO 3R2CJ 3LBHA 1FWKA 4N6GA 4F0KA 3N58A 3WL6A 5JRJA 1N0VC 4RY2A 4L8WB 5HRCA 2IGTA 2YMPA 4NXNF 5CM9C 5LLTA 2QYGA 2VQFJ 1FI4A 3O3NB 5G04L 2HFOA 4Y5TA 2WZPP 5CG8A 3B20A 4HVLA 3MM8B 3G88A 1Q1KA 2NMOA 1EHYA 4QGBA 3L0BA 1WD5A 1HV1A 1YKWA 1FFXA 2HDOA 3DQQA 1G59A 3KG4A 4P7FA 1TK5A 3P27A 3QENA 4A5OA 4L5AA 1Z8NA 2K2PA 4EJSC 1W0CA 3LTEA 1X9PA 4ORFA 5DNUA 2R87A 1COV3 2OPQA 3N8DA 5AWFC 3GRYA 4HTAA 4WASA 1NH8A 1H2AS 1H1LA 3L8EA 4JB8A 1Y0BA 3ZE9A 1I7LA 3LLUA 4O2BF 2BMFA 1YFWA 2PWYA 2PMWA 4JBLA 4MIWA 4OYXA 3OB8A 3A58B 2O54A 1MH9A 2AQKA 4IR9A 1RM5A 2ZDHA 3EJMA 1EK1A 1S5PA 1KPIA 4ED2A 4N8MA 2FE4A 3WRWA 1NK4A 5HBAA 1A6CA 2H2AA 2DURA 5M2PA 2KXLA 4JI1F 1JL3A 1YDFA 2MZSA 5JH7A 2CKMA 3M2RB 3SMQA 5C3PA 3HACA 2D74B 4DX6A 2ZGVA 1T2UA 1OZ0A 4BCAA 1DXYA 1SAYA 1ZM3A 1M5UA 1PEKE 4K7JA 2AZ4A 4HDQB 3F6BX 5M0TA 3UMVA 3I9NA 4N9HA 2CKWA 2JFUA 4AFDA 2VPIA 1ABFA 3H1GA 4AUNA 3OAAD 3VKOA 4L2IB 2JCVA 4CEHB 3GEPA 2JJYA 1JHXA 3PDNA 2AHOB 4A46A 4ZJLA 1EDDA 3AT1B 4ZJPA 2HHSA 4Z54A 1RR6A 2G77B 2CVZA 3STYA 4KP7A 5JMPA 2AGOA 1TR0A 3EAGA 1L3VA 5EQUA 2H0RA 4B3TJ 2V8HA 3EGWB 1XMVA 2IXEA 1YRTA 3PUVA 3Q83A 3MMAA 3ZKAA 4Q1PA 1HE4A 1ZU4A 3OH8A 4JLDA 1OC4A 1AXRA 2HAEA 1U2DA 3MLEA 1RCXB 2V6AA 3U4HA 1X4HA 3Q4GA 5C8YF 4DR5B 2ZKLA 1MJ5A 3ONQA 5KCZA 2OB2A 3R5FA 4GX1A 3NDBB 3K58A 2WZQA 5DNAA 1BZWA 2VCEA 1K0UA 4JKKA 3BFKA 1LBIA 1UYZA 4D8VA 2P7HA 3THWB 4YW1A 4QKBA 5F3RA 4KV7A 5BNFA 4GULA 3ZX5A 3THXA 4ARAA 2IP4A 4UM9D 1E5HA 4E70A 2RG4A 4KN6A 4EJMA 1LZLA 3STUA 1SBQA 3O4JA 4C21A 3EXYA 4YB7A 1X7XA 3H2GA 1IAVA 3KVOA 3OX3A 1RP5A 4CQNA 2HADA 3TJ8A 1J7KA 5K4HA 3PJXA 3DXUA 4XGRA 3R7NB 4Y6RA 3PX7A 1KNZA 2WV9A 5FOBB 4QDQA 3JALB 2MSDB 4HUJA 4LF5F 3OE7D 3PMEA 2LNDA 4J94A 3UV9A 1TMMA 4GLFA 3QNMA 3ESXA 3P9KA 3HR9A 1U1GA 2B99A 2QG4A 5TARA 3WXMA 2ACKA 3MZHA 1X7YA 1NA1C 2KM8B 4IJKA 1DB3A 4WXPA 3G82B 3SH3A 1ITPA 3VBFC 2OLKA 1QDEA 3FPFA 4MVWA 4DLSA 5D3GA 2HEIA 2A5DA 2QMEA 3ETNA 5E8RA 1W5SA 4YMLA 4JODA 2OCYC 3FLRA 4E27A 1FTQA 3OUYA 3VBFA 2QEQA 4RA6B 3PWSA 3L0CA 3HA3A 2TUNA 5FLYA 2DNOA 2WHPB 1L5GB 2G7MC 1U8YA 3PR5B 3ICEA 4XFCA 5CCXA 2Y8WA 2DFCA 4C2MA 2G28A 3BBBA 5DXJA 4R8HA 1CP2A 1LDMA 1I3CA 2XJUA 1RDRA 4LQ9A 1DQNA 1M6HA 3TZLA 5EX0A 4WI1A 2ECOA 3ZGXA 3BMOA 4HPWA 2YKAA 4A16A 1C81A 2XSZD 1R4NA 4OJQA 4CDWC 4AI6A 1JWAB 1HXS3 2ZS9A 3AKDA 2IU3A 4AI0A 5H68A 5A9TA 3ZK7A 3LPLA 3OFJA 4TKUB 5I9TA 5EMKA 2QJ3A 1L7AA 1X70A 3C48A 4E2FA 5C37A 3LUGA 5K8NA 2F4VF 2AC7A 1K8QA 3ZHTA 1P8GA 1H66A 4OIMA 4L5YA 4LUBA 1NVWQ 3H2HA 3B9IA 4C7BA 1MBZA 1UXIA 4DX8H 1N9GA 1ARZA 3ZPOA 3EDQA 3I1FA 2WT4A 4MKIA 4XXHA 2AK2A 1E6WA 2JH9A 3DBIA 4IL5A 5A7NA 5KWEA 4ZXFA 2IAJA 2CNNB 5ILQA 3MR3A 4ESVA 5B4TA 2O2IA 3KCQA 4DMLA 2EFQA 4BA6A 4D3DA 1AUVA 4RBTA 4NEGA 5JSYA 3NHBA 1UZUA 5LSAA 2Z98A 2JCSA 3K46A 4NTZA 1VBA1 1ESCA 1W9HA 2H1YA 1JIHA 2JKVA 1OO0B 1ZYUA 5T8KA 1H6AA 4Z6KA 4BIFA 1YIAA 3D4NA 3CWQA 3ADKA 3V4PB 4C5CA 1FX1A 5FXZA 2ZAIA 5FZMA 1YV9A 4OI4A 3EASA 1ENQA 3LGRA 1VSUA 1O3QA 2QRRA 4NMXB 2FETA 3IRXA 4CCJA 2MJLA 2ISCA 3A4VA 3JZIA 1KFEB 1R081 4CT8A 3NC0C 4FXWA 2F1RA 5BSKA 2XUEA 4QWAA 2H1LA 4RMJA 1Z5GA 2IXLA 3AC0A 3LP2A 1GGEA 1T43A 4HT3B 1ISIA 2FF7A 4N5DA 3SC2A 1WZ2A 2D6FA 3D6FA 4AO8A 1O96B 5EWMA 1BWEA 3H7JA 2JLUA 1MNAA 1PVC1 1E0SA 2BR0A 1CRZA 2K7FA 3HMKA 3RZHA 1IEWA 4IMJB 3MA0A 2VICA 4JP8A 2CYBA 5AK4A 3OQMA 3IAFA 4L0CA 3D8SA 4TYBA 5K20B 3JVVA 5IC4B 1ZBQA 2VLIA 4JCOA 2KJWA 3BSAA 5DZ6A 2ZRHA 3JQ9A 1T4CA 4GC9A 4HS4A 5FTLA 2GK6A 2QUBA 4R5PB 1LD3A 2O2CA 4QLAA 2YV2A 1A3KA 1YSCA 1FFSB 1W9SA 1YVUA 2YZ4A 1F2TB 4LTAA 4C9BA 2CXHA 4HDGA 2C88A 2DTEA 3EHKA 1CSJA 1Y42X 2VHYA 4Q5OA 4O7XA 3U6KA 4JLUA 3QK7A 3H0PA 4IUGA 3E05A 2FEKA 4YW7A 2HNBA 1BWSA 1PG2A 2CQGA 2DPGA 3ZN6B 4MHRA 2GZSA 3IEXA 1S8AA 4M1KA 2FUCA 1P1LA 2IX3A 2QD1A 2ZDQA 3CJ0A 3C7FA 1YQCA 2AI3A 5IATA 2JG3A 3ZD7A 3DDHA 4IGQA 2PUBA 1JJ2R 3IR7A 1U09A 3VR6A 2C97A 4H4MA 2OEPA 1KLMB 3EF1A 2AQ4A 3MMCA 4LO5B 3KJQA 5EXOA 2YBPA 4JD5A 5CG2A 4M0UA 1Q11A 4B4WA 1ZAVA 3LUYA 5C46F 1T94A 2D1RA 1XBFA 3THPA 2H3EA 1BEEA 1D09A 3T30A 3DYBA 2Q5EA 4RW4A 5F3GA 4Y3OA 3CJXA 1UWCA 1DGWA 2HDWA 3TQHA 3UXHA 3V8MA 3VR1A 4BUCA 1RC8A 4X6RB 3AKPA 3W05A 2I2WA 2Y1EA 1GMWD 4GALA 1TADA 1DUVG 3G5TA 1OTXA 5JPDA 2JJ6A 3TMKA 3RAJA 3U4DA 1QY4A 3K31A 3N2ZB 5JXIA 2JX2A 3LWNA 2O23A 3GQVA 2Q3FA 1FRQA 1PO21 2K8GA 3IGVA 3DOMB 2PQQA 4J1QA 1Y5IB 3ZHBA 3DMHA 3STXA 1H8TC 4Y0VA 5KG5A 3KJVA 1Z6QA 3GSDA 2WUVA 2EC5A 2D40A 3KKEA 3N86A 3ABZA 4ZZ3A 2VHVA 4NFHA 2GTHA 3H8YA 4GIBA 2ODBA 4R1PA 1WBBA 5HNKA 1FP4B 1I0ZA 3N07A 4JC5A 3ZC3A 5FZBA 3LX6A 3V7NA 4KSEB 4XBQA 1MW9X 2V5HG 3IOCA 1A8QA 2IV2X 2QRPA 4WDQA 5GONB 1YQDA 3CXRA 1EK2A 1ADYA 4TLBA 2A1UA 5AM0A 1E0DA 4MYTA 2CHQA 4UKDA 2A70A 1LFAA 3IRUA 1TQ5A 1RAGB 2Y34A 2V8PA 2RQ4A 5J9FA 4AWDA 4LV6A 4MOWA 5J1PA 1T5BA 2ABYA 5HUHA 4ZKTB 3WO1A 1S3FA 2P5YA 5AVUA 1JILA 4ZVMA 5A6SB 4EE2A 4E5YA 3WF0A 2PSHA 2BEUB 2O5EA 4AY4A 3G59A 2AJTA 2OCXA 3QVSA 4MWDA 1H4SA 1EQ0A 4U7FA 1XAIA 2WYIA 3ICVA 4AF7A 4JU8A 2BE9A 1ZEJA 3TEFA 4CMBA 2VKZG 2RH9B 5ARCA 2HHHF 2JJ1A 3NGLA 1H4QA 2E4WA 1MGOA 3AX4A 1PS9A 2CMFA 3S6JA 5IH7A 1QGAA 2FP4B 5I45A 3LL7A 4B9MA 1EIWA 2YY7A 4I2OA 1EUYA 5EHNA 1WSBA 2V7WA 3AFIA 5I3ZA 1O6UA 1DAIA 4M5DA 2JEFA 2C42A 1CY1A 4JYAB 1EDEA 3I76A 4M8IA 3HXKA 3O03A 5AICA 2YYSA 3RYFA 3WR5A 1OLSA 2YNMA 4WE3A 2SHKA 1OLRA 1DWQA 5L3SA 5CB0A 2VDLB 3U61B 5EWFA 3ER9A 1QM9A 4QMAA 2A3RA 5LK7B 3BMNA 1FRZA 3GFPA 3PG5A 2VDWB 4C5BA 2IA5A 2PL9A 3GRFA 3JYPA 4DJ5X 1K63A 3ZCTA 1S2GA 3IA7A 3TLYA 1MR5A 1YJWS 1YWKA 4UOJA 3EIOA 2H0BA 1FLVA 2X0JA 4LZNA 1HL7A 2EEYA 1J2EA 1OC2A 1ZH2A 1RZRD 4NVPA 1J06A 3N6RA 3CNEA 1FXUA 2GM3A 3AWIA 4TQAA 1AZWA 1AF7A 2K7KA 1UBUS 5EIEA 1V1RA 2BDUA 2VJPA 4XJAA 3Q8QB 2NREA 3OLYA 4E32A 3V5RA 2J7PD 3L7DA 2GT1A 2IHBA 3ORQA 1GV0A 1GYKA 1VFJA 4K2XA 4O08A 3UQSA 1DBQA 2BE2B 5KFEA 1AR91 3R0RA 3I8TA 2MZTA 2RG1A 1G2IA 4CBVA 5A7PA 1OXCA 4DB5A 4QDZA 1PFGA 1G41A 3K0AA 1IB6A 4BHQA 4FEAA 1NBME 4OXNA 2OLWA 1XE3A 3NCRA 1B8OA 4M1YA 3GJTB 1R6TA 3LY8A 2C2RA 2WSFC 4GQAA 4WJLA 4GKKJ 2YMZA 1TKTA 2XKAA 4OL0A 4EJFA 1IM8A 3AZVA 4F2PA 3PVXA 3M5PA 2C2KA 2OBXA 5HKBA 4J0JA 4RNDB 3VYSB 4UFNA 3LUDA 5E1MA 5BN4B 3UXMA 3OESA 2IPXA 4D45A 5MDHA 1UPTA 2G1HA 3TKAA 4B3NA 2OEJA 3T7CA 3ACHA 2YG0A 3SSNA 3FWKA 1X7GA 3ISTA 1QH0A 3UB2A 2O8BA 9LDTA 2R25B 4YJDA 1WORA 2BRUA 1TL7B 2Z9CA 4AJPA 1TZMA 4OX9Y 3J8F3 2SXLA 3F90A 3OQIB 2Q7XA 1FOD3 5AI8A 1SK8A 4ZVRB 3M83A 2NSCA 4RHV2 4R9SA 2FZKA 4JVMA 1NOIA 3PUIA 4FPRA 4TN5A 4ER3A 2K7JA 4PZEA 1EUTA 1KDMA 4U00A 2REQA 1GU1A 4PONA 1T3ZA 2XHCA 2D2EA 2QJTA 1UEKA 1RHMA 4J7UA 5HJEA 5AOAA 3PC4A 5F4ZA 3QH7A 1QFYA 3GILA 2BR5A 2HU5A 1BQ4A 1AXEA 3R5AA 4FK8A 3MM8A 3PMSA 4EA8A 5FUQA 2XQCA 2VMEA 1FDNA 4LMRA 3M8RA 3VR4D 4BMSA 2FSVC 5DGAA 3ZWYA 5KQSA 4RMHA 2V9PA 3M2VA 4HB3A 5AK6A 1Y8RA 5HA5A 3THYB 2LRHA 4E5KA 5EE9A 3Q22A 2RR13 1I6WA 4XE9A 4HKWA 2PT7A 2VF5X 4NLOA 1DKMA 2BCGY 2GEBA 1EB8A 1XTJA 2NUTB 4XTTA 3TYXA 4ZV9A 3TNJA 4OV6B 4MW9A 1JE0A 4LXHA 1I4OA 4FFPA 3Q8VA 4AN1A 4FYWB 1NZDA 4L8QA 2HNDA 3BE8A 3KXDA 3PWZA 4Y20B 1RWOA 1LI7A 2WY2D 4XVRA 2QN7A 5F8NA 3TTXA 2HDHA 5IC6B 4K86A 3J81j 1F4VA 3AVPA 3B6IA 2BNMA 4ZCRA 1FYVA 2VRNA 4OYYA 3WNOA 3SVTA 4ACAA 4MKAA 4FUQA 1NN5A 1M1KT 4AZVA 4YAOA 3T3FA 1DO8A 4TY8A 3GFSA 1N2CB 1AGYA 1PUJA 2X2PA 1EM8A 2WO2A 1RHI2 4ANEA 1CR6A 4NYJQ 4OSPA 4RQPA 2AOUB 3NEJA 1N34F 5D01A 1CF4A 2G1AA 5JFGA 1DIOB 4IINA 2G1DA 1KQ3A 1WW6A 2PDAA 1O95A 3PVNA 3OFND 2F4PA 3GLKA 4XUOA 4HGYA 3N9MA 4D7AA 4KPUB 2QW0X 2GD6A 4JMPA 5EE3A 5K0FA 4ANDA 1GAEO 3JTMA 3FYUA 3ET4A 1YZ3A 5JPCA 2WJ3A 1UFQA 2J6TA 5KEIA 3MOSA 4F11A 2BKUA 4FPGA 5EXPA 4YJFA 3OEAA 1E20A 1SEFA 1D2RA 3NEKA 1HQUA 5ABJC 5HMXA 1NW6A 1C3XA 2R9VA 3DMPA 4TN2A 4L5IA 2A3JA 5D5HA 3B1KA 3RC8A 5LXTB 4DV1J 1MEC2 4US0R 3TVYA 1PGSA 4R9BA 3HN6A 2DPXA 5EPAA 2CXTA 1XYVA 4FOVA 1FFDA 1XOIA 1URXA 4DT1A 3H13A 1VAKA 3DZKA 3ESDA 2PSJA 3NI2A 4LNAA 5H4GA 1KC1A 4MULA 3EEYA 3D6VA 3H4VA 4JX9A 5J2QB 2K0GA 2ZGLA 3HYLA 1SIBE 2ZBRA 3T7KA 1PFQA 2HMAA 4YVWC 1UMBB 1BQNB 2DB3A 3PFGA 4ZQCB 4MADA 1HNWB 1H4GA 2PA3A 5B1EA 4MUYA 1BHQ1 1FK9B 4P9LA 1LV7A 2VA8A 2ZUSA 1O87A 3PRKE 4XGQA 4KWJA 1EWRA 4H18A 3W2VA 2UXDB 3BGOP 3LGNA 3W64A 2AXPA 2BKVA 3QPUA 5IBQA 3EVTA 2R7WA 4JJ4A 4UTNA 2E5LB 2V7EA 5EYPB 1ULHA 4K5RA 4PIVA 1OZFA 1ZCFA 3NVDA 2VSXA 3QVUA 4ZI7B 5F9HA 5KFNA 1HARA 5E1RA 4N9WA 2XXAB 2E66A 4WAUA 3NWGA 2VG7A 4QQ2A 4PZVA 2EWVA 1K0VA 2VPYB 4NLVA 2I9SA 2VNSA 2Y93A 1DIAA 1Q1AA 1SU7A 4XK8C 2HTFA 2Y6GA 2DITA 1H05A 3CW2C 1U1MA 5C1BA 3CCWA 4DV2J 5CB4F 1AT1B 2ZDPA 4LBOA 1TQ6A 1OBNA 2RB5A 5C4MA 4GB33 2ZR0A 4RPFA 4PAQA 4ES3A 2BMWA 2CGNA 2JG8A 1T8EA 1U5ZA 4QLOA 4GE0A 2Z4TA 1GP2A 4LVOP 4A36A 3RFXA 2CDPA 2ZFUA 3ZUGA 1Q1ZA 1USKA 1TA9A 4C0QC 4OGKA 2XNDD 3DOIA 1ZJWA 3HI6A 3PYFA 1F6BA 1DAOA 2P6UA 3M7AA 1XA3A 4CTEA 4F26A 3KDSE 5F37A 1ZUWA 4I30A 4Q45A 4QULA 1VC6A 3IAS6 4BNUA 4E1AA 1S2IA 3RWKX 3DNCA 1VIAA 3LTOA 4Y7DA 5LNK6 3V4MA 1H2LA 5GZ1A 3C3VA 4JXXA 2Y6FA 1E9AA 1FL9A 2B2CA 1V9U2 5GLUA 4HG6B 2PTMA 2M4MA 1M6VB 2OYZA 5FPQA 2WU3A 5EINA 3EXHA 2JFBA 1PL0A 4PLOA 2H2DA 4BEWA 3IBCA 3LGXA 2ZGPA 4LFCB 4YVSB 5IDYA 1XK6A 3KUCA 4MRNA 1QGOA 1F7UA 1VYAA 3FBTA 2KVIA 4MRRA 1F2UB 2F40A 4GD3Q 4RZQA 4PFQA 1YR3A 5TPWB 4AY3A 4BNYA 1UZVA 1P74A 3NJRA 2GHQA 1NVUQ 4JVNA 2X1HA 3WNNA 4G5XA 2KI2A 1BWQA 1VQ8S 2X8KA 1LB1B 2Z2SB 5I8TA 3CINA 5DZFA 3BXXA 3ZFGA 1JLGA 4XWYA 4K9NA 1UJMA 3MPUB 1E5XA 2W94A 1S6YA 2GYUA 3JQJA 1HZZC 1JLGB 2YYZA 4YJ3F 4XCXA 3BRWD 4GT1A 5ADZA 3RANA 3GQCA 3DA8A 2V09A 4CLKA 2YC2A 2R072 4JKOA 4NU6A 1WG5A 1ICEB 4PPDA 1HW8A 2JA2A 3JB9k 1R16A 3IRXB 3NIGB 4HQKA 4BDVB 3LZ6A 2D5CA 3KSZO 3NOQA 3RS7A 3COPA 2QP4A 3MUMP 4X6YA 1WCIA 1ZA1A 4E4DX 5A70A 2RCNA 5E7QA 3GD5A 2XHZA 4YJGA 2WP0A 5JRDS 3PICA 3IRWP 1UPCA 3CEPB 1KP9A 2BA9A 3V6DA 5LJ5Y 4YBRA 4GWKA 3S68A 4I8DA 4MNTA 4M83A 3UJ6A 3T61A 3FW1A 1ZIDA 2A75A 1N2IA 2J6IA 2RHSB 5FPUA 2XJ9A 1A78A 2XNHA 1HYQA 1TP7A 1SZBA 821PA 4K6MA 4LIRA 3OQIA 2V3CC 3V1MA 2BHSA 3DO5A 4LBWA 2R4UA 2LDIA 3QVKA 1WW7A 5JD4A 3DGPB 1TYZA 2GVZA 1LWEA 1HWKA 4WCVA 4US2R 2HLNA 3J7AN 3GLGE 3TX8A 3LCRA 4YP6A 1D1TA 4IDGA 2XLAA 2ILVA 3PGA1 2F8MA 1FUUA 1WZIA 3J9SA 4LJ6A 1YQUA 4M37A 5AC92 1OASA 5KFTA 3EVWA 4MIOA 4HEA1 5IKPA 2PGXA 3M8WA 3MM7B 2FY8A 2PJUA 2VHJA 3ICPA 4JWTA 2IUFA 3DFZA 3OFKA 4MMZB 4HUTA 5C80A 4AXJA 3OZVA 4J7CA 2QV7A 3O8OB 4AQ7A 4MA5A 5JROA 2ZEZA 3NJXA 2PX6A 3MINA 2CY6A 2E21A 3VU1A 5CDTA 2DFTA 4V2VA 2FDJA 1N5OX 4C8YA 2VJAA 3LWDA 2CD9A 2C5SA 1GZWB 1VBYA 3VC2A 3MJEA 2QL6A 1UOBA 4KT0C 3FXAA 4DN9A 4JKLA 3LCVB 5LLDA 4XF9A 1YI8A 5JYDA 2XG3A 4TQUS 2MQOA 2WM9B 3UKJA 3MCZA 4ICLB 1IPJA 3WHIA 1DC5A 1Y1SA 2KVQE 2VG6A 1A6LA 1VP9A 3DVLA 2HHLA 2GBPA 1E3WA 3UCFA 3FBEA 5F7OA 4AJHA 1GRRA 4Q48A 1ZBE3 4XUCA 1L3CA 4EFLA 1REGX 2XNCA 1HNZF 1SC3B 3WQ1A 1Y5IA 4N5SA 1OOPC 4NYMR 3G5LA 1A0OB 3BU7A 4WA7A 2ZQ5A 2P9EA 3FMPB 4M1SA 3KLIB 5HBGA 3RRZA 2PV0A 1RRKA 4C05A 2IOQA 2IPMA 4N9QA 3UT0A 3ILOA 4A41A 4WZCA 4IW3A 4DMFA 4I66A 1BEZA 1NK6A 2FDKA 3V7UA 2HBQA 4R01A 4YM2A 5B2EA 4NCGA 4DQRA 3B78A 3KLGB 4LZLA 3RJMB 2NU8B 1Z5OA 1G8GA 2IXFA 5DGDA 5CVCA 4IG0B 3UETA 3CDBA 1L4UA 3PRDA 2IC1A 4WP3A 5FUBA 2B92A 2R8PA 3RFVA 2GA8A 5B2ZA 1ZA4A 2NP6A 1QFJA 4PICA 1KAQA 4EO7A 3RNSA 2A5FA 3M8QB 3PQ3A 3J7A1 2BKEA 3NNSA 3AEZA 3K1YA 5K8TA 1VMBA 2W9XA 1W48A 4AL4A 2R7KA 4OFZA 2QN2A 1GR3A 3OOWA 1OREA 2CDOA 7YASA 3Q8BA 4HN1A 3S8MA 2VZUA 4TQ9A 3M6LA 1ZA7A 1DTWB 3L9ZA 2K4MA 2X3GA 1XXHE 1RT1A 4Q3AA 3LXUX 4MCIA 5DIFA 4ZPBA 4CUAA 3WRYA 3KUKA 4GRDA 1BFDA 4KKOA 2RIPA 1NQJA 5GZ6A 4P4TA 1TZJA 5FDLA 1NDLA 4PNZA 4U67Q 1R64A 3O4IA 2ZEXA 1PJ4A 3UY4A 1WDWB 1O4ZA 1XTZA 3PEVA 2VZOA 3AEQA 1F2GA 3GRUA 1O6BA 3HKBB 3MFHA 4PWDA 1PTKA 5C5EA 1YR2A 1KI2A 3MO4A 1UA0A 3NBFA 4UHDA 4Z8XA 4EWDA 4AVVA 4AHZA 5NULA 4YBZA 1VQOS 4GOLD 2HLPA 2RR11 3HR4A 5KDDA 5LWHA 3N2IA 5CA5A 2G9ZA 3MECB 4Y2TA 1TMF3 5DG8A 4PFJA 3NBQA 2Q4RA 1I2CA 4BO4A 5K0JA 1RKUA 2ZGNA 1RZMA 2J3LA 4ZQEA 2YBSA 2VXBA 1VDZA 1WG4A 4QFBA 5GJVC 3RHFA 1IZ0A 2JDYA 4PCQA 4X66J 1YUDA 1HQWA 1X8EA 3LUHA 3G9XA 2FDCA 5LJIA 2ZUBA 4MZDA 3WW2A 2ZD1A 2GCEA 3WGZA 1IBLB 5ALFA 2SLIA 3PHLA 1W1UA 2VDWA 3UGHA 4J0FA 4BQQA 4EQVA 4AEMA 1RJFA 2OXCA 2ROQA 4FD2A 3RZGA 3AESB 3PPYA 3DE3X 4PO9A 5J2UA 2GQ2A 2ONZA 4USIA 1ENRA 5G0RA 5DDJ3 4GR9A 4K87A 2EIDA 4X90A 4MIAA 4MJLA 1SOVA 1L8AA 1D2EA 4KUEA 1T5OA 2EP7A 1VJ2A 3OL6A 2VIHA 3GIRA 2YNFA 2WQZC 3N1UA 3CWCA 5CJ2A 2TMYA 2WU0A 1MUUA 1SBZA 1YVEI 1QR6A 2VL4A 2W71A 2D3ZA 1VE5A 4Y26A 4AFMA 4WGGA 2X7XA 2GHWA 1E5TA 2CPYA 2ZJAA 1A5ZA 1PO6A 5ULLA 4UF0A 1HE8B 3VKFA 5ED4A 1GT8A 1XNBA 5B30A 4LF9F 3LDAA 1RAHA 4XF4A 3IO1A 3L05A 2O4UX 4ECZA 1CC8A 2HK2A 1AZSA 4YGXB 3T1LA 4BVLA 1N2GA 5ESXA 3OPKA 2NUUG 1CESA 4D7TA 4Y2PA 4YPVA 4K4TA 4KGXB 1S3IA 5JPMB 1AGXA 1GP5A 3ROUA 4TSRA 3E27A 1SXJC 3PEUA 2V54A 5A3QA 3E6BA 4BV3A 1NSQA 3FJYA 3E5RA 1J2YA 1MEEA 4IUFA 1X7ZB 3PNOA 4MV8A 2P9ZA 4JI1B 1A8IA 4LVUA 1JH5A 2NYHA 4M9UA 4TU8A 2R8KA 5LQAA 4OKIA 4HDRA 1FD2A 1X7WB 4BQSA 2EBFX 3IR6B 1CEQA 3OP4A 4LR7A 2GZHA 5HUJA 4P0QB 2D3UA 1R8PA 1UM9A 1H2RS 4GKJJ 1ONOA 4JI4J 1U6ZA 1TYAE 5AI4A 1SCUA 2R68A 1II0A 2YY5A 5E7MA 2OQIA 1DQ8A 4WM7B 3AJ1A 1UT5A 2WKSA 1IR2A 1W90A 4DUYJ 2QLFA 3UQZA 2ZSDA 2XJRA 2NVUA 2VMFA 2W6IA 1FVFA 5CEEA 4CU9A 5FXWA 3QLUC 2FJVA 2DGXA 4ES2A 1PD1A 4XUEA 1WEKA 2OSQA 5DPNA 4BDPA 2MYUA 4HVZA 3E61A 4FF4A 3PTRB 3W2GA 2HRTA 3S1TA 4RF5A 2FUEA 2C99A 5KFRA 1HMPA 4LIPD 1OQ1A 1B64A 2F4FA 4B3RJ 2EAKA 1WSVA 1PLLA 3F78A 3U3XA 2BW8A 5IV4A 1Z2CA 1RJ9A 4K1XA 4A8XA 2CTVA 1SC4A 3PA8A 4JEUA 3S2FA 2C2MA 3OM9A 1ZDMA 2NP0A 1XJAA 4F56A 1TI7A 2GUGA 4I1UA 3F6EX 4JL5A 1FFGB 2YV8A 2G72A 4QEDA 2RIJA 3K3OA 5LSRA 2DNNA 3TRSB 3T0BA 2ZS6B 3TRFA 3BH7A 4EZ4A 5IT9U 4JUZA 1C0PA 5CNMA 1LECA 3M1VB 5IFMA 4BVHA 1TU0B 3HCCA 4ZCSA 3WICA 2C9KA 4XIJA 3NS7A 2QQOA 5HOEA 2RRBA 1F2TA 3IAAA 4DEXA 5TC4A 3A36A 4ZQGA 2ENWA 2Y64A 1PK8A 4GX0A 4RBVA 2XTMA 1TZCA 1TU0A 4MJ7A 1WG1A 4ZLLA 5KDOA 1GX5A 2WMOB 1QIKA 2O7RA 2VEDA 5FULA 3K57A 4IDNA 2D5IA 3SKXA 2QROA 2H4HA 5FT9A 2GHRA 4K3UA 1Q7TA 3RR2A 3ISVA 4DPMA 4ZVVA 4YRPA 4YFUA 3KXIA 2I1WA 1ESEA 1H2HA 4IVRA 3SSQA 3PHBE 5IC4A 2VTXA 3RSLA 2D1CA 1XEXB