4C0BA

Structure of wild-type clp1p-pcf11p (454 -563) complex
Total Genus 131
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
131
sequence length
428
structure length
428
Chain Sequence
TGDNEWHKLVIPKGSDWQIDLKAEGKLIVKVNSGIVEIFGTELAVDDEYTFQNWKFPIYAVEETELLWKCPDLTTNTITVKPNHTMKYIYNLHFMLEKIRMSNFEGPRVVIVGGSQTGKTSLSRTLCSYALKFNAYQPLYINLDPQQPIFTVPGCISATPISDILDAQLPTWGQSLTSGATLLHNKQPMVKNFGLERINENKDLYLECISQLGQVVGQRLHLDPQVRRSGCIVDTPSISQLDENLAELHHIIEKLNVNIMLVLCSETDPLWEKVKKTFGPELGNNNIFFIPKLDGVSAVDDVYKRSLQRTSIREYFYGSLDTALSPYAIGVDYEDLTIWKPSNVFDNEVGRVELFPVTITPSNLQHAIIAITFAERRADQATVIKSPILGFALITEVNEKRRKLRVLLPVPGRLPSKAMILTSYRYLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for ATP loss by Clp1p in a G135R mutant protein.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
molecule keywords MRNA CLEAVAGE AND POLYADENYLATION FACTOR CLP1
total genus 131
structure length 428
sequence length 428
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06807 Clp1 Pre-mRNA cleavage complex II protein Clp1
A PF16573 CLP1_N N-terminal beta-sandwich domain of polyadenylation factor
A PF16575 CLP1_P mRNA cleavage and polyadenylation factor CLP1 P-loop
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.1030 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4c0bA01
3.30.70.2410 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4c0bA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4c0bA02
4XVRA 1AS2A 1BKDR 1DAKA 1F3OA 3AF4A 4DCVA 4JLBA 3I3SR 1ANKA 1E2DA 1XU4A 1LB1B 4DCNA 1YKSA 4X8HA 1OH5A 2VF7A 3L0SA 3B6EA 5KNBA 4OHYA 2GCPA 1GRQA 1E4YA 3B7GA 1YR8A 2G3YA 4Q4LA 4DIEA 4EFNA 1HT1E 2R2AA 1NVXQ 4BGDA 121PA 4DLVA 3CWZA 4HATA 2A3RA 5KU1A 2PEYA 1EFCA 1E2NA 2W0MA 4I99A 3EZFA 5CJPA 4TQAA 4BFUA 4JBXA 4UNRA 4KJZA 3CRMA 1KMQA 1ZD1A 4JVMA 2XB4A 4HAZA 4U5XA 2EFGA 3FGNA 1Z28A 3IO5A 4C2TA 1FZQA 3Q7QA 3QXSA 4KLNA 4JLMA 3LH5A 4HUQA 5L3SB 3DM5A 2P3SA 2ZRIA 1GM5A 5L3SA 4PZLA 5GADl 2A9KA 1JAHA 2WJGA 1S9HA 2R6DA 2FN4A 4C0QC 3PVSA 3DL0A 3LVRE 2OT3B 2WWXA 3IQWA 2WAYA 1E2JA 2ZE7A 1Z06A 3T35A 4ASUA 4DXAA 2ATVA 4I1SA 4IW3B 2ZI9A 4B48A 2PJZA 2OAQ1 3ASZA 1COWA 3X1XA 2O0JA 4EPWA 2VQSA 3IBGA 1XWIA 1I4DD 1H8ED 1G7RA 1OFTA 1R8SA 1FTNA 1G21E 2Q3FA 1L8QA 3ADKA 2I1QA 5CLLA 1N5IA 2P65A 3O8DA 4TLDA 5EJEA 2PX3A 1ZM7A 2KBFA 3PFIA 2FMXA 1KO5A 2J0VA 3THXA 2FZ4A 1SKQA 3FHOA 1FX0A 1T6NA 3HU2A 3UMRA 3VFDA 4NH0A 2J41A 3BD9A 5DI3A 4H9GA 3M0EA 1UKYA 2ZI4A 5FR1A 1OKKA 4M8NE 3UKDA 1QHNA 1W48A 3QIAA 4ZO4A 2JLXA 4YMVA 2NO6A 5FOVA 2OCBA 1GDDA 1G17A 2GNOA 2PLRA 5FPHA 2GEVA 3B1VA 4C0JA 2QG6A 1U0JA 2QQEA 2IX3A 3U3RA 3AKYA 2CDNA 5FUYA 4DDUA 1E2KA 1SZPA 3TRFA 3K0AA 1GOTA 1NSFA 5SZHB 2ZSFA 4XOIA 1TNDA 1GUAA 3K0AB 2PZFA 3OEEA 3UXMA 5JRJA 3DKPA 1W36C 1NKSA 4IOMA 4EKDA 1ODFA 4DLSA 1VMAA 3EC2A 3Q3JB 2D06A 3EXAA 2C78A 3PXGA 2GA8A 4V0NA 5JECA 4CGZA 1ONBA 1BMFA 1T3SA 1UJ2A 2VH5R 3KQNA 2GZDA 4BRWA 2GXAA 4URUR 3MSXA 1VECA 2AK3A 2WSSD 4S35A 3RS4A 1TQ6A 2O8EB 1XD2A 3GJ0A 1IY1A 4DSNA 3FWYA 3IIMA 2XX3A 1GZSA 5CIQA 4B3BA 3AVTA 5FBRB 3ICQB 4Z1MD 3GLIA 5EXSA 1RFLA 2JLVA 2J3EA 2MMCA 4CEIA 4PQYA 1AS3A 3KXIA 1Z22A 4JL8A 1RE0A 1QVRA 1DAFA 2PMKA 1E2EA 4Q21A 4QNRA 1Z08A 5CIWA 2JIZD 3NHAA 3RRYA 4QBHA 4RCZA 3GLGB 4C7OB 2ZAOA 1G5RA 2WWFA 4C7OA 2CJWB 1ZU4A 1ZJ6A 2VHUA 2XTNA 2CJWA 1MH1A 2IK8A 4RD0A 1WMSA 1QG4A 1V5WA 1XXHB 2B8TA 4HAXA 1G9XA 4K8OA 2AD5A 2IA5A 1E0AA 4TL8A 2ZU0C 3SNHA 4P4UA 5KNCA 4BZQA 1JECA 1JR6A 3GLFE 4AG6A 3U3MA 1SVKA 4TT3A 3KL4A 3P32A 5IF9A 3RRZA 2QE7D 4Q9IA 2QI9C 5KSPA 1XZPA 1NN5A 4ZDWA 3TAUA 4PAMA 1W1WA 3W3ZB 1QHHA 2XOKD 1CF4A 3LXXA 4NHOA 1NP6A 1F2UA 3LNCA 1T0HB 2FG5A 4PPGA 1G6HA 3KQUA 2CXXA 3SS8A 2G88A 3DHWC 2AXPA 2RGNA 4WZBE 4M9XA 3N2IA 5FPSA 1Z6TA 1BYUA 2J7KA 3K9NA 3OIUA 4TL9A 3FHCB 2CBZA 3I8SA 2JJ2D 4GP7A 3R9WA 1HY3A 2CHGA 2DBYA 2IWHA 1E2IA 3X1DA 1KO8A 1KY3A 2X19A 4M1MA 4LYJA 4TMWA 4C0SA 2IYXA 4NYMR 1HE8B 1OXSC 3JVVA 4IFBA 2BBTA 2AKYA 2DB3A 1OXUA 4GOKA 2PCJA 3DZ8A 3IPYA 2J1LA 4A2QA 4OK6A 2G77B 3CH5A 1R4AA 1JPNA 1PUIA 5KDDA 4US2R 5B2ZA 3ICEA 1XTQA 4GRAA 2BM1A 2YHSA 4BFSA 5C1BA 1PLLA 2ZEJA 3BFXA 4IOJA 1VYTA 1OFHA 4RZUA 5KSZA 5CYPA 2H1LA 3OE7D 2I4IA 4MITA 5LB2A 5HZHA 2Q9BA 3WRXC 2YKGA 1FFHA 2W6IA 3P4YA 2GJ9A 2HV8A 2ZYUX 1W4BA 1G3QA 1YZTA 2BC9A 2YWGA 3TW4A 4PXAA 3UPUA 2Q6TA 3T1OA 5BYJA 3PR1A 4EJSC 2ZE6A 3NH9A 3P20A 1IY2A 2V7QD 2VHCA 4Z8XA 2P5SA 3FMFA 1YRAA 4HDCA 1R5BA 1JXMA 1XDBA 4NCNA 3OAAA 2VL7A 1CJTC 2AN9A 3KDSE 3VHXA 1HUQA 3UG6A 5FOXA 3SJAA 4HB4A 1FP6A 3SZRA 3B1YA 5HCIA 1AGRA 3BERA 3B82A 4DSOA 5TVKA 4B44A 1JXOA 3L0IB 4GOJA 2NTYC 4JBWA 4A8JA 1GSIA 2W6ID 4EPTA 3RRMA 3EIEA 4FMDF 3BS4A 4HDOB 4NKRA 4QBFA 3RS2A 4C3ZA 2IF2A 2QAJA 1U8AA 1WRBA 3VTKA 3WHKA 2ZI7A 1XEFA 2WVJA 1E9DA 1U9IA 3IIJA 5CDFA 2WJHA 4CEJA 3W5JA 3AQ4A 5DHFA 3MMPA 4V0ME 4XJXA 2QL6A 5TMPA 4Q4JB 1E1RD 1UDWA 2W2TA 3TUIC 2HCBA 2XTMA 3OIWA 2C8VA 4ZDJA 1E2HA 5LB4A 4MKGA 2A2ZA 4TLEA 3DM9B 2FOLA 2P6UA 4B2LA 2GBLA 2IHBA 2ZRDA 4A4DA 2IS2A 3GLHE 4HB3A 3QEOA 1KJYA 4AG5A 1NVVR 1G7SA 2Z83A 4GT1A 3ZVRA 1OE0A 2FEMA 4A1FA 3JZAA 4PC6A 2WIBA 3NDPA 2VHTA 2HDNB 3MWJA 2IT1A 1RJ9A 1IXRC 3G5UA 4BFWA 4QJ5A 4C0KA 2ODEA 4CW7A 2QPOA 1RJ9B 2IF0A 1Z6XA 4OYHA 2Q21A 4BFXA 1M2OB 2YNMA 1VPLA 5ELXA 1MO6A 1E3MA 1KSFX 1UDXA 4F4JA 5HTKA 1KK0A 1MO4A 3ASYA 5AUQA 1KKLA 3KQKA 1OH8A 1E4VA 5DIFA 1WF3A 4JYCA 1CJMA 2QBYA 4FIDA 1TQ2A 2QMOA 3HU1A 1U94A 3Q9LA 1RVDA 1KMHA 4MGYR 1WA5A 4ARZB 2G1JA 4AYXA 2V9PA 1ZUIA 3LLMA 3RC8A 1QHYA 1DEKA 3EPJA 2L0XA 5J4HA 1D9ZA 4JT4A 4A9AA 1Z63A 5BXQC 2FSFA 2Q9CA 2G0NA 2W58A 5KDLA 4Z8YA 1U0HC 2J87A 4Q9KA 4PTLA 4BEJA 1F2TA 2XB2A 1SHZA 1NBMA 2P6NA 2ZE8A 3N2EA 4TZ0A 1JJVA 5G3YA 4TL7A 4DRZA 3CNLA 3RS3A 2UZ3A 4HUTA 4UXIA 2NOAA 3AB3A 2CLSA 3C41J 1NLZA 3VU9A 5EXTA 2XTZA 4B3DA 3V00A 4HAUA 3ZGXA 4DC9A 5C18A 2D3WA 1IN8A 5DHAA 4CIDA 2GK6A 3ZZTA 4OHXA 2QSYA 4EFLA 2ORVA 4M9QA 4KFTA 4ILEA 2B8WA 4RZ2A 1XTIA 4CF7A 3AUYA 4HUQB 5EUQB 5IRCD 4AY2A 1XRJA 2FNAA 2G6BA 2RGGA 3CH4B 3LXRA 3ND8A 4FMBB 4YMSA 4GP6A 3ZQJA 4NYIR 4OQLA 4TYYA 4A0RA 1BYIA 4MGIR 2QGNA 2ZJYA 2RCNA 2CCGA 2VSOA 3WMEA 2VYFA 1ZUNB 2GJKA 4NONA 5FBWB 3E70C 3RWOA 3B9QA 3SHWA 5HPYB 1S8FA 2AXNA 1R0XA 2WWIA 3FFBA 4BFZA 4BASA 3U3OA 1LW7A 1Y3AA 3Q5EA 4HZIA 4DLRA 4EFMA 1E9BA 5JHHB 4Q9LA 4IVPA 3ADDA 4WBSA 4DEYA 4GL2A 2ZJ5A 3I8XA 2RB4A 3QXHA 4KO8A 4LHYA 1XD9A 2NPFA 3LO5A 4H1UA 2FJUA 2A5DA 1E0SA 1T8UA 2E9SA 2ZJZA 2P67A 4L5BA 4C30A 1MRNA 3T34A 2CHQA 1JALA 2ATXA 4LX0A 1Q1EA 4OI1A 3REFA 4LWZA 4GZLA 3NDBB 2R8RA 4QGAA 3REGA 4JL6A 1T5LA 4KXFB 2YVUA 3IQXA 2GZHA 2W6JA 3FVQA 3CX6A 3W5IA 2V6IA 1WBDA 1EX7A 3F0TA 5JWRA 1N2CE 2ZPTX 1XMIA 4Q4AB 1SVMA 4M1KA 3QF4B 4O2LA 1E96A 3QVVA 2OSBA 3I32A 4QBIA 2PJRA 4LJ7A 1SXJB 5JHGB 1ZVQA 4HLDA 1Q12A 4QJ4A 3F8TA 1U8ZA 4MGZR 3GP8A 1XJ0A 2J46A 1NLFA 5BQ5A 4RY2A 2BJWA 1K6MA 4URXR 1RW4A 1IXZA 1FL9A 2FSGA 4AC9A 3D7MA 4WOPA 1FW6A 3VR5A 1KAGA 4BECA 1DARA 3PEVA 2ZVQX 3KTAB 2IL1A 4NDZA 4PC1A 4D82A 4XWOA 1AJEA 1R5OA 1LF0A 1KI7A 2FGJA 4Q02A 2EWWA 2O8EA 1O87A 2PCLA 5B58C 4ZI3A 2Q3MA 5C46F 2PLFA 4I81A 4ACAA 1OHHD 5JS8A 2VTKA 4B74A 2H17A 5CB6A 4V0KA 4QGGA 2AD1A 4BLTA 4F4IA 2O8DB 4RVCA 3GLIB 2QAGB 1P3JA 1S3GA 2XZPA 4GMDA 1HTWA 4BLRA 1E2PA 3LQQA 1E9AA 4OI4A 1OV4A 1Z0DA 2O8CB 5A5GA 4B32A 4NYJR 3CPEA 2BMDA 1X86B 4RFVA 1WQ1R 4TMZA 1N0VC 2NIPA 3O47A 1KI6A 4Q1BA 3AM1A 4DB2A 4UKDA 1KI6B 2IS6A 1L2TA 1FTSA 4QXAA 1NNEA 2ZJ8A 4LK2A 2ZRFA 1SQ5A 4Q1EA 1N6PA 1XXHA 1Q0UA 2GTPA 4U00A 1G4AE 1Z2CA 1KSGA 1US8A 5EXPA 4L8GA 3A36A 5LD2B 4CEHB 3MJRA 4WVFA 3GJ7A 2JLRA 4OHZA 4UXHA 4GDFA 4IVRA 4M1SA 3G0HA 4TMKA 5BN3A 1G5PA 4OBEA 4BZPA 3CONA 1G41A 2WJJA 3OIYA 2QMHA 4Q18A 3TKLA 5DH9A 1ZUHA 3UG7A 1ZRHA 4JLDA 3MWYW 3RHFA 5FBVB 4OI0A 4PSKA 3GMTA 5FFMA 2JJ2A 3JZMA 2XNDA 2C9OA 3K70C 1F2UB 3R8FA 3W6NA 1NG1A 1VG0B 5EP2A 1DAMA 1Q3TA 4RD1A 1E9EA 1R6BX 4EJSA 1YE8A 1T91A 2H5EA 2PT7A 3EASA 4EJSB 4XTCS 4EQ6B 3BB3A 4PO1A 3U3JA 4B6EA 1XEWY 2BCJQ 2J59A 3CX7A 3WY9A 4JJKA 1EFRD 1TUEA 3F3YA 2JDID 5AUPB 1VKJA 4POAA 2BWJA 4DLZA 2DR3A 4LV6A 1H65A 3ZZ0A 1OT3A 3ZS8A 1G6OA 1TADA 1X8LA 4NYMQ 4UJ3A 1PVOA 2BBOA 1MOZA 1GL7A 1P2VA 2DFTA 2IXGA 1YRBA 3KKMA 4A8JC 2DFNA 3TJZA 1D5CA 2FSHA 3C14C 2ZRHA 4O0MA 1G7CA 3T61A 5FBLB 4FCTA 4DLUA 2GAOA 4M22A 3VMFA 1W4AA 2GXUA 3EARA 3SJZA 4URZR 4DDWA 2VHQA 1U9IC 2BMEA 3HPQA 2PBRA 1DO2A 2CL7X 4LC0A 4ZCLA 1V43A 4FWIB 1UEIA 1T3HA 4MYHA 1VCNA 3U6KA 2DCUA 1VHTA 2BMFA 1UKEA 2QTHA 1GRRA 4QM6A 3Q7PA 4A0HA 1SXJC 3B78A 4JLJA 1ZINA 3GLFB 3K70B 1UBEA 4D4KA 4M1WA 1R10A 2QRNA 1TU4A 2YOGA 4WIAA 3U7EB 2F43B 2ZJBA 2ZTSA 3AVOA 3W6OA 3S1AA 4LBVA 3Q5DA 4Z54A 1G8YA 1AK2A 2D7CA 2WOJA 5BYKA 1KO1A 2IC5A 4TQ9A 3AEZA 3WRYC 5SZJA 3AF2A 3GEEA 2GJAA 4KYIB 1P7CA 3PENA 2OCYC 2QA5A 3RNLA 4PFSA 1XCPA 1XX6A 1DG3A 5IDVA 1A4RA 3AVQA 5DGXA 3AVXA 3TVDA 2YJTD 3FOZA 2KB0A 3C8UA 2QT0A 4PQRA 3TQCA 1E9RA 3U44B 1P73A 1JJ7A 4JLNA 1P5ZB 1E0KA 2YC4C 3U3KA 4QOSA 3ZS9A 1HQYE 2Z4SA 3U2QA 4QM7A 1ZBDA 3BRWD 1R8QA 3NKVA 2R44A 3C7KA 4HLUA 2LCFA 4Z1MA 1U90A 1JB1A 1UFQA 3KKPA 5GVSA 1R0WA 1D9XA 2FFQA 3PUWA 1CR0A 4PHTA 3CRRA 3H86A 4F91B 2GCNA 4TZ6A 3KKOA 4M1TA 3AKDA 4PPQA 2R6AA 1XTKA 4KI0A 3BC1A 1G291 4URWR 4US0R 2AK2A 5H68A 5JMTA 1IOZA 1Z29A 3K1JA 5B64A 1C9KA 4URVR 521PA 3FMIA 3MJHA 3EA0A 4XSHA 5FUVA 3SC3A 1I4LD 2HJVA 1CIPA 3I1FA 3BH0A 4BFTA 1HQCA 1Z0JA 2R65A 1SVIA 4YONB 2JJ1D 4D80A 4Q66C 3U7GA 2EQBA 4AK9A 3ZD7A 1M7BA 3T5GA 3RSLA 3GLHA 3IO3A 4F38A 3L0OA 1YR9A 5AK0A 1S3SA 1VIYA 1X1RA 2OCPA 1VDZA 4AYTA 4C0AC 4DCUA 4PSAA 4KFUA 2WWGA 4YQFA 2OFOA 4D81A 4MH0R 3VNVA 1NJGA 1UM8A 1OF1A 1UAAA 2TMKA 3A58B 3TNFA 5D3QA 2AKAB 2QBYB 2J0SA 4GFDA 1M7GA 3PUXA 2OBNA 5AJVB 5DE3A 3QKTA 4KLZA 1TPZA 3L0PA 2IHYA 2HCJB 1E79A 1MO5A 5H1YA 4ZCMA 3A1UA 4D25A 3UK6A 2ZI3A 2WKQA 2XNSA 4I1VA 3DOFA 3Q85A 5FTNA 1GNQA 1NSTA 1KAOA 1Z5ZA 4BLPA 1NMXA 4CYMA 2RHDA 2OO7A 2F1HA 2GESA 4IEIA 5F9HA 4A8JB 2WM9B 3KKQA 2ZI5A 5J47A 1PZNA 2WMOB 2AFIE 2CVFA 2Q3HA 1SXJE 2JLUA 3HP1A 4B33A 3IEUA 1Z8FA 2CK3A 2ZREA 3AF0A 1ZP6A 1Z0IA 5IK2D 1P9RA 1AS0A 2QSZA 1M74A 4M4SA 3B8HA 1KHTA 1WP9A 4ON9A 2JA1A 1QHGA 3QXCA 2GKSA 4CEJB 2ZI6A 3KJGA 2EVWX 1RRGA 2VBCA 2ZIAA 3EZ6A 3GFOA 3FKQA 3N5CA 2G9NA 2ZR7A 2ZUBA 3TQFA 1S2MA 4MRSA 4MRVA 3KQHA 2YYZA 4QBGB 2QPAA 1XJCA 3U5ZB 4N0EA 4TT3D 1KI9A 1GITA 2J7PD 3RABA 4Q7JB 3RLFA 2ZS8A 2ERYA 3BIFA 1X8KA 3RSOA 4Y0VA 2C98A 2Y8EA 2W6JD 4DWJA 3EX7C 2YV5A 2C03A 1FPMA 3K0CA 1IM2A 1QHXA 1W36D 1EFRA 4M2LA 2F55A 3TAHA 2WHXA 2QN6A 3IDQA 2ZRLA 5SZIA 3RANA 3ZJYA 4DUGA 2CL0X 4B71A 3BJIC 1Q1BA 1DADA 2GWHA 3QI2A 4IXNA 3RS0A 3QSYA 2D74A 721PA 1II9A 3UMFA 4R9UC 1G19A 1ZM4A 1FQJA 4A82A 4LYHA 1VCIA 2ONJA 4Q03A 1XCGB 1FX0B 1ESNA 1SULA 3MFYA 1VHLA 3K8YA 3CPJB 2EYQA 4TN1A 4ZIRA 4MRNA 4ESVA 2D7DA 4OK5A 2O0KA 5KSOA 1Q1QA 1QG2A 4R2HA 1T9HA 2LKDA 1E9FA 1NN1A 1KDOA 1U99A 1N25A 2P2LA 3GJ4A 3A1TA 3QPUA 1P75A 4PPNA 2EW1A 4TMTA 2JLWA 4Z51A 2ZU6A 4JBYA 1DAGA 2CHVA 4PO8A 1JR3A 3BB1A 5E95A 2D4HA 3A4NA 4DCTA 1AKEA 1AKYA 2X2EA 1E1RA 3I62A 2XZOA 4LPSA 2GAAA 4LPKA 1N6LA 2KE5A 3I73A 4HAVA 1KNQA 2R62A 1NF3A 2OBMA 4RD3A 5L3VA 5TB5A 3BFKA 1J7KA 1M1YE 1IAQA 2D2FA 2PZEA 5FPKA 1IY0A 1TUIA 1Z6YA 1ZNYA 2ZRCA 1QDEA 3I72A 4XVUA 1Z47A 2PEZA 2WJIA 2QRZA 1SKYE 3KXKA 4XTRA 4A92A 4Q7MB 4DSTA 2BHRA 2GEUA 3KTAA 5TXGA 2F1JA 3AKEA 2IYSA 2KBEA 2GEDA 5TV2A 1A5TA 5DLQC 2R9VA 4OQMA 1DAIA 1IONA 2A5FA 3CX8A 1LY1A 4DB4A 2Z43A 3GEIA 1G5TA 4G5OA 1WDTA 2JLQA 3CPHA 5FTKA 1RYHA 2IW3A 4V02A 3ADCA 1S4QA 2F1IA 2RGCA 2IYYA 4R71A 1U8YA 1NMYA 5B57C 3LWNA 2NG1A 2BJVA 2V6JA 4NMMA 3U60B 5TY0A 4LHVA 2O5VA 3HPRA 1NJFA 1CTQA 4HB0A 3PUVA 3NH6A 4D0LB 1G18A 3L82B 4XWAA 3QJYA 3KB1A 3V4FA 4D6PA 1UF9A 5HE9A 1KOFA 1ZM9A 2RH5A 3E1SA 2ZE5A 3T5DA 3EW9A 221PA 2F7SA 5CLQA 3AP2A 4N1AA 2ZSBA 4OJKA 3NBFA 4TQUS 2RMKA 4C0BA 3QPWA 3TVTA 2B6HA 3LAWA 2O8CA 1JNYA 1YZGA 1N6IA 4KITB 1KDPA 2N42A 4LV5B 5D3MA 1KZ7B 2XJ4A 4FCVA 4Q4HA 2WPDA 3GLGA 4WA7A 4D4MA 4A36A 4Q4HB 4Q4AA 1JI0A 1BS1A 2ZYTX 1XTSA 1CR4A 2EYUA 1SVLA 1S1MA 3BWDD 2BEKA 1I2MA 1XEXA 1Q1ZA 2LKCA 3TW8B 2QMUA 1SXJA 1TU3A 1W46A 4YLGA 3H0KA 4A6PA 4QHSA 1SVSA 1VCOA 3RVBA 4F7WA 1WE2A 3NTUA 4JLAA 1F60A 4GMXA 4XIGS 3FMPB 2OM2A 1O3YA 3ND9A 4JKIA 4IDNA 5EZ5A 3NBXX 4LJ6A 1NL3A 4Q19A 1TF7A 3PCRB 2CCKA 5IT5A 1R0ZA 4P0TA 4WXPA 4HZUB 2ZSEA 1EWQA 5FUXA 2W00A 3DKVA 2IYQA 4MRPA 3WP0A 5JJIA 1N6RA 4Q7LA 5DYIA 1GAJA 3CR8A 1AQUA 3K09C 2ZANA 4JKYA 5KYKA 3E2IA 1P2TA 1F5NA 5HKKD 3SI7A 3ZVMA 3CLVA 3THYB 1YJ5A 2XSZA 2QM7A 1KI8A 4RFSA 2ONKA 1QF9A 1XD2B 1HT2E 1E2LA 2AR7A 5GJVC 1GP2A 2C9YA 1ESMA 3D8BA 4UQOA 4EQ6A 5EP4A 1KY2A 5GJBA 2ZETA 3QF7A 1MV5A 3KFVA 4P4SA 2IS1A 3EWSA 3RRNA 1CS4C 1SGWA 1W0JD 5DI9A 3OESA 3KJHA 3UWKA 4Y0AA 2REBA 2VP5A 4HLQB 1NBMD 1G8GA 3T06B 3SFVA 4AD8A 1AGPA 4MKFA 5JWOA 1G16A 1X1SA 4TMXA 2XOKA 4D26A 3VR2A 1JQLB 1ZNZA 2ZRPA 2X2FA 3KUDA 1I2DA 3LX8A 2GBLC 2V54A 1DE0A 3FDIA 2GETA 1NLYA 3VR1A 3VR6A 8OHMA 5HCNA 1FMLA 2QENA 1SVWA 1UKVY 2C77A 3QG5A 2V4ZA 3PUYA 4K46A 3V4RA 3ECCA 5TDHA 2F43A 3WXMA 1X8JA 4IKEA 2RAPA 2NGRA 3NBZC 1W7AA 3WNCA 4JLVA 1PV4A 5JLJA 1VG1A 1NIPA 3PUZA 1KK2A 2F3TA 3PEUA 1CR1A 4TLAA 3D31A 5C2JB 2J45A 1KI2A 3ETLA 2MSEB 4CZ2A 2NO1A 1AZSC 1ZCAA 5FBQB 5JEEA 3CZPA 3LW8A 3ZIAD 1BOFA 5L8VA 2DY1A 1OHHA 2WTUA 3TE6A 3AKCA 4UJ5A 5AJWA 1QRAA 2JJ1A 3BAFA 3IBYA 2I3BA 4MA4A 1RPZA 1Q22A 3KQLA 3VR3A 3SQWA 4RZ3A 4KSCA 4D0NA 2FFAA 5E7MA 1XZQA 1OIVA 1ZMXA 3PIRA 1ZNWA 2NQ2C 4UNSA 4DKXA 1T4GA 2ZRMA 4RSGA 2MSDB 1TEXA 3PG5A 2CNWD 2QROA 3QY0A 1XPRA 1GRNA 4TTRA 4Q1CA 4TYNA 2WWHA 4URYR 2Z4RA 1UBCA 4L4UA 1NBME 1MABB 3HYRA 4PC2A 1ZNXA 2P5TB 5JBQA 4CDGA 1W2GA 1RC8A 1VYVA 2IYVA 4DDTA 4B2IA 2H7VA 1R0YA 2N46A 1J99A 4DLTA 1OLOA 1SVOA 2ORIA 2WZQA 3PEYA 3HJNA 4YMUA 2F3RA 5FTJA 5EE1A 1ZCBA 1E98A 1R2QA 2QMEA 3H1TA 2VHJA 1TX4B 3DVLA 3AF3A 2R6CA 2FWRA 2NPIA 4UXJA 1EFTA 1GILA 2GF9A 5KO2A 4FWTA 4QKQA 2OXCA 5KNDA 4Q1FA 4D4JA 1VYUA 5FOSA 2BV3A 4EUNA 1F48A 1DO0A 3LRPA 3ZQ6A 2C99A 1M34E 3QNUA 1YZLA 4LDJA 3K0CC 4L9SA 3LLUA 2QM8A 2C2HA 4BLSA 2Z0MA 4PHFA 1OYWA 1CULC 1W0KA 4A2PA 4PPFA 5E7JA 1EK0A 1G3UA 2HJGA 2DWPA 4C4PA 2OAP1 1G4UR 2RHMA 1KK1A 3H2YA 2XSZD 1Q44A 1T0JB 3EZ7A 2A5YB 1E9SA 4LSGA 1PJRA 3AVYA 3GCGA 1CKEA 3A1VA 1UBFA 1JAIA 1GL9B 3C5HA 4IDQA 2FV8A 3NWJA 4M1OA 3WMFA 3ZH9B 4O25A 5EP1A 4UNQA 1UBGA 4GBMA 4WZAE 5LPNA 5HR5A 4FCWA 1HEIA 2O0HA 1ETUA 5CITA 1E69A 1GKIA 4LHZA 1P61B 3IPXA 2HXYA 5EE3A 3VX4A 5H70A 2AWOA 3TH5A 3O8RA 2GVZC 1E0JA 3K53A 2E87A 4OQXA 1NVVQ 5C4GB 1F2TB 3HYTA 2CLCX 4EAQA 4MGKR 4B3GA 1HE1C 4ZI2A 5AUNB 3FFAA 3HWSA 3MGCA 3J81k 5JSZA 5DN6A 2G0TA 3BFVA 1E79D 1XNJA 2BMJA 4TWZA 4DIDA 4ZDKA 5JSZB 3CF0A 4QJ3A 3A4MA 5JS7A 4V03A 4BPBA 5FPYA 2C95A 1JR3E 4P33A 4B43A 4JYBA 5F9FA 4ASUD 5FL7A 2H16A 4KFSA 4XWKA 5KTYA 2ZROA 2E1RA 3K0SA 2VP9A 4KFRA 4XD7A 1RKBA 2OXRA 2KWIA 5G41A 2A30A 1N6OA 3BGWA 3CKLA 1P4SA 4Q7KA 4O3MA 3VX3A 3DPUA 3IILA 4KBFA 4W7SA 1II8B 4LHWA 4IHQA 1E99A 1E1QD 3GJ6A 1YZKA 1EGAA 3MD0A 3MWKA 4W5JA 2J0UA 3C5CA 5JI3E 4KODA 4NTZA 4TL6A 1S9DA 5L3RA 3NEJA 2QTVB 1CP2A 2ORWA 1PLKA 2JGNA 2ZAMA 3P4XA 3L2OB 3MUFA 2OLJA 4GI7A 5IK2A 1XEWX 3U61B 1JEEA 2REXB 2OCAA 4JT2A 4KU4A 5LBIA 4JSTA 4DDVA 3KFXA 4FMCB 4DVGA 5K8TA 4OJQA 3A6PC 4PAOA 4B35A 3U7FB 3LX5A 1LV7A 4RCYA 4C0LA 4QHTA 4Q1DA 5AR1A 3GJ5A 1NRJB 1WB9A 2OHFA 1D2MA 3EIHA 3LV8A 2DWQA 2UZIR 3EPLA 1G3RA 1Q57A 3EPKA 1GNPA 2JEOA 5FOTA 1GKYA 4GPTA 4TSFA 3I5XA 1W49A 5EP3A 5EUMA 2CE2X 4DUGD 4IOLA 3AVWA 4CRWB 3QPVA 2VP4A 4W5WA 1P2SA 2WKRA 1TAGA 1YR7A 4DBLC 2QTFA 3QF4A 1PLJA 1ZU5A 1ZW6A 1XMVA 3WNDA 4FD2A 4HEJA 2IYUA 3DO6A 3CR7A 4Q47A 3GJXC 2EFHB 2DYKA 4LRWA 4ZDIA 2WV9A 1JPJA 2ZS9A 4G3XA 1LNZA 4EPXA 4G5GA 3WBKA 2BDTA 1UEJA 4ABYA 2O8FA 5AJXA 2O8FB 4IRUB 2JAQA 1CJVC 5K8IA 2Q0HA 2XXAB 2RKOA 4MDEA 1ZD8A 5SZKB 3N70A 2ZITA 3FB4A 4IDHA 2AX4A 1ZM3A 1IN7A 5M04A 2QP3A 3LBHA 1DS6A 1KKMA 1YQTA 1Z0AA 2OBLA 3B13B 4YDSA 1KGDA 1MO3A 3WYAA 3F5FA 3SE0A 5FL3A 1XP8A 1HURA 1W5SA 4V0MA 3TK1A 4EDHA 4ERNA 1IN4A 4P32A 4BZXA 4LJ4A 4A15A 3TUZC 3NC0C 3K09A 3ZZUA 3PITA 3I5YA 5CK4A 3AGPA 2B21A 4TYPA 4X8OA 1WXQA 1TEVA 3CB4A 3U6BA 2EU8A 1J8MF 1W4RA 2OV2A 1J90A 1KJWA 1IJFA 3CUEF 2V3CC 5DNYB 1UPTA 1HYQA 1C4OA 4NCKA 1JQJC 1FNMA 1US8B 1XXHE 5JRZA 4YC7A 5DISB 3LVQE 5CYOA 4CEHA 2WKPA 2UVQA 1EESA 1BIFA 1QBKC 3GLIE 4M9ZA 4LGMA 2H8KA 1OXXK 2QPTA 2GCOB 3FKSA 1F6BA 2IYZA 1L4UA 1XEXB 2RGEA 3GQBA 2CVHA 3BB4A 2GCOA 1LS1A 2H18A 3R9IA 5CM8B 621PA 4LJ5A 4NCIA 4D4LA 4KAXA 2IYLD 4M53A 1P9WA 4P3YA 5HKKA 3THXB 2CE7A 5LDDC 3SJBA 4JLOA 4IOKA 4E5UA 3NBYC 3R7WB 4JLKA 3B1ZA 3MRSA 2V55B 3QENA 2WIAA 2HXSA 3CRW1 3X2SA 4LC1A 1BO6A 1BH2A 5EXXA 5GJWC 4KYUA 3KUCA 5J4LA 2C5LA 2DFLA 1KO7A 1Z2AA 1QVAA 2GJSA 3QKRA 2A5GA 2A5JA 3SBEA 3AP3A 4M9SA 3SHFA 4HAYA 2KSQA 3R20A 1PUJA 2XJ9A 1X3SA 4HI0E 3OF5A 3AVUA 2ANCA 1IQPA 1IBRA 3HDTA 3WNBA 2ZR0A 3KJIA 4BLQA 3CBQA 4HZUA 5A0FA 2WPDD 2ZJOA 3DOEA 4P4SB 4E07A 5IHPA 4K81B 3GFPA 3RC3A 2WSMA 4RKEA 4MDFA 2XNDD 3SBDA 3NEYA 2VLIA 3P26A 4EIWA 1MKYA 4TYQA 3EAQA 3EG5A 2B92A 3QVUA 3OZXA 3ZYCA 3NC1C 2WJYA 1NIJA 3UATA 2F6RA 4I1UA 5F2EA 4LJAA 5UKDA 1P62B 2WWYA 1ZC3A 821PA 2VRWA 4UNPA 1YZNA 1FNNA 1ZM2A 3LBNA 4KCGA 1YU9A 2W2VA 2V7QA 2QE7A 2JCSA 3C15C 5EE9A 4F4CA 3I92A 3A1SA 4H1VA 1E9CA 5JZVA 3OAAD 5JJLA 1YZUA 3THOA 3CZQA 2YWFA 4F93B 2LWIA 3A1WA 3EPHA 3TR0A 4XD7D 1MT0A 3IGFA 4LHXA 5FTLA 5KOYA 1NI3A 2FH5B 2BBSA 1OFIA 3IUYA 1W2HA 1I4TD 1XFAA 2AHOA 3EC1A 3ZLJA 2YWHA 4M21A 1J70A 3CRQA 2W0SA 1XB2A 4PO9A 1RRPA 3FPAA 3RYTC 3VNUA 4WW0A 4E03A 4WXRA 2BBWA 4CVNA 3H4MA 6Q21A 1E1QA 5CK5A 3LFUA 3LDAA 1AN0A 5FOWA 4JVSB 2O52A 2QAGC 3B9PA 5KUTA 2QQ0A 5G40A 1E2QA 4G5QA 3B60A 3LD9A 2FA9A 3EZ9A 4W9MC 1RRCA 2J5XA 4PHGA 1T8TA 4HLCA 4WZ6A 5BWMA 4TTPA 3VAAA 1N5LA 2G83A 3I4LA 1N3BA 1U2RA 3IKJA 5HE8A 1H8EA 2JJ8A 4AURA 2BOVA 4LJ9A 1AQYA 3BBPA 4QFMA 4IVQA 1EFHA 2F9LA 5E7IA 3SOPA 3SDZA 4JL5A 4XSGA 1E2FA 4DLYA 4N3NA 1U0LA 3UWOA 4EPYA 3SR0A 1LVGA 2GJ8A 2PT5A 2P0EA 2WOOA 4NL4H 1Z3IX 2Z5FA 2OUKA 2HLDA 2VF8A 2ZJ2A 5L3QA 4G5RA 4OHWA 2QY9A 4NYJQ 1XPOA 1B23P 1ELOA 1OIXA 2IWRA 4D2IA 5CDFE 1Z6GA 3FKSD 4MYCA 2OLKA 4F92B 2I1VB 2FPKA 3BE4A 3K0FA 3NVAA 3D6TB 3FMOB 2EFCB 4P31A 5C4MA 1SHKA 2WJVA 2REOA 4KHZA 1KIMA 3WBJA 4PQFA 1OXVA 2IUTA 4LUCA 1MABA 5KDOA 4DZZA 4C0HA 4OQNA 3OEHD 2P6RA 4YDHB 1FUKA 3WP1B 3OHMA 5KSYA 4ZV4A 4FN5A 4MUAA 1VG8A 1SXJD 3TR5A 3GLHB 2ECKA 2ODWA 3CWQA 3S1AB 4B75A 5J4YA 4JZKA 1E2GA 4P4TA 2FF7A 4V0OA 4LBZA 4G5SA 4GOXA 2ZRKA 4KBGA 1MRSA 2GXQA 3NXSA 1HA3A 2V8OA 4IJMA 4YMTA 3G82C 1TQDA 2RGBA 4QGHA 2O8BA 4FW9A 1GVNB 4L16A 1G64A 3EZ2A 3KZ1E 3L43A 3LQRA 3QKSA 1Q3HA 1A7JA 4RKFA 4HAWA 5DYGA 3B2EA 3W90A 2V1XA 1GG2A 1XCMA 3L8YA 1B0UA 3Q8XB 2OG2A 1CJKC 2QP4A 3B1WA 2WMNB 4MKHA 2IUUA 3DMNA 4NU0A 1RYFA 2V1UA 5DO9A 4LY6A 1N5KA 1N0UA 3ZD6A 2VSXA 3SU8A 4BEBA 4IFEA 1G1MA 2ZR9A 4JVLA 3SJCA 2ZUDA 5EE0A 2NZJA 3D3QA 4DHEA 4GSYA 4R7ZA 2QT1A 4ACBA 5FTMA 4AI6A 1D6JA 4DLXA 4AKEA 1XTRA 1DOAA 3HU3A 4GNKA 3TMKA 1Q20A 1GNRA 3TUJC 2ZSAA 2ZS7A 3GEHA 3IHLA 3HR8A 2WWWA 1DAEA 4QHYA 1A2KC 2YOFA 3DZDA 4JMPA 5FUWA 3GPLA 4JVNA 4WAUA 1CRQA 3QEJA 3VU9B 1XBTA 1ZIOA 1T3LA 4YXWA 2ZUCA 1R5NA 1EWRA 5JCZA 3W34A 4LI0A 5J4KA 3ZVLA 3SYNA 3T15A 4A0FA 2GK7A 4A2WA 4JIMA 5FR2A 1LTQA 1QHIA 3AUXA 3B1XA 3C16C 4E09A 1EXMA 3QXXA 5JWHA 1QZXA 2IYRA 5G3ZA 5KHOC 3U4QB 2YOHA 2BEJA 3U4QA 1VTKA 4AKHA 4IDPA 1NY5A 3GJ8A 4C9BA 2JLSA 4HSEA 5DSZA 421PA 4OI2A 3K9LA 1IJEA 2CK3D 2ZJAA 4KV9A 3FTQA 3PQCA 1GIAA 2JDIA 1GTVA 4J0QA 3UMSA 1D2NA 1K5GA 3NG1A 1KMHB 3AVPA 2R6FA 4PZYA 3RWMB 5AUOB 2J9RA 2J0QA 4XVQA 1TL7C 4W5HA 2PX0A 3MG9A 3ZIAA 1KI4A 1OYYA 4MKIA 3OFNA 4RD4A 1CR2A 5E4FA 1OH7A 2GZAA 4QNMA 1EG7A 3ONWA 5BN4A 2FFBA 4TTQA 4BUJA 1TF5A 4G1UC 2QU8A 1CXZA 2GVDC 4Q48A 1KDTA 2D62A 2VP0A 1YHNA 3AV0B 3M1IA 2NO0A 1E94E 4RJLA 4PANA 2QZ4A 4GZMA 3PV0A 5F3WB 2SHKA 4OKSA 1ZD9A 1M8PA 2ZYVX 4I1OA 1X6VA 4II7A 1QHSA 2PMDA 2BVNA 2D2EA 3ZVNA 4Q9HA 2C9CA 1DG1G 1XTJA 5FPTA 2ZSDA 1HH4A 5ANRB 3KX2A 1L7VC 3WHLA 1OXTA 1COWD 3VR4A 2ASEA 2N1BA 1WCV1 4QRHA 2DHRA 3CW2A 2IS4A 4NBSA 5LD2C 1GKUB 4PAQA 4QC2A 1S96A 2RGDA 2YWEA 2IEZA 3KKNA 4QG7A 2PZGA 4I4LA 1OSNA 4QL3A 4ZPXA 1KSJA 3OEHA 4O2RA 4BLOA 4L9WA 2AFHE 2FZLA 3QBVA 1AZTA 3WYGA 2C96A 1JEDA 1NY6A 2CEAA 2CCJA 3U7HB 2ZVPX 4B34A 4EPVA 4M0LA 1TTTA 4TSFD 4AIIA 2XEXA 2NMVA 5KPJA 4FI3C 4PHHA 4PZZA 4JS0A 5EE5B 4FMDB 4U7DA 1KTVA 4US1R 3TSWA 3PJRA 4MUBA 2PL3A 1KSHA 2B7CA 1H8HD 1XJQA 1W0KD 1EFUA 2XZLA 2MSCB 4CEIB 1GL6A 4V0LA 5BN5A 1KI3A 3MLEA 3HR7A 2HF9A 5DI3B 3THWA 4NPHA 1KDRA 4CT5A 2VIIA 4KSBA 5J4VA 2CNWA 2HEIA 5D3MB 3QQ5A 1RRFA 4UNNA 2FPMA 1G7TA 3OEED 4ITRC 2HYIC 2W83A 5EQTA 2PH1A 2GRJA 4RD2A 1TF2A 4B6FA 2WAXA 3AH8A 4PC3A 1OW3B 2OFXA 1W47A 1A2BA 1HV8A 3BORA 4LV8B 1XD8A 1NVUQ 3VKGA 4G0NA 1E2MA 1R7RA 4DSUA 5J5CA 2GDJA 4FXPA 1XMJA 1Z0FA 2DWOA 5EZ6B 4E22A 1YR6A 3VHLB 3L8ZA 1ZC4A 5AWFC 4ZCIA 2XITA 2ZM5A 2HUPA 4JJZA 5K8UA 2YC2C 2KI5A 2VEDA 4JSYA 1CJUC 3R8CA 4BE7B 1YZQA 2JATA 2GHIA 4NP6A 1P6XA 1KK3A 1S0UA 5J40A 1NMZA 4IDOA 3T1VA 2DPXA 2J7PA 2CLDX 3R7WA 3UANA 3H84A 4LYAA 3THYA 4PR0A 1OKKD 1Z0KA 4RFSB 3W6PA 3GLGE 2NO9A 2OESA 1KI1A 3CNNA 1Q21A 4D0GA 2KJQA 1XMSA 2XXAA 1K8RA 2EFDB 2JIZA 2O8DA 5H8WA 2QAGA 3SQXA 1DVRA 4M1YA 4AKIA 3VKHA 1KO4A 2FDCA 3DDCA 3CO5A 3QUSA 2C04A 3KB2A 1KNXA 4TLCA 1OH6A 1KJZA 3SYLA 1ZIPA 2IXFA 4G01B 4U02A 1N0WA 2CMKA 3OIVA 1OB2A 2F9MA 3EA5A 2X8AA 1G20E 3TBKA 4PX9A 2VA8A 4DLWA 2IEYA 3TIFA 4LCBA 5JFGA 3QG1A 3W3AA 2ZQ5A 4A6XA 1OJLA 2QGZA 2VP6A 4BFVA 1BMFD 4JLPA 4R2IA 5FH9A 4AKGA 1DTSA 5JEDA 4B47A 2GXSA 4EPRA 2H57A 4NE2A 5AJZA 5P21A 4Q00A 2NO7A 1CEEA 4NCJA 5HZKA 3BH7A 1OB5A 2FSIA 5BW8A 4LBYA 3C4JA 3LBIA 3CF6R 2HYDA 2YINC 4LYFA 2ODBA 3A37A 5JI2E 1IXSB 1CLUA 2BKUA 4Q9JA 3A4LA 1Z07A 4HYYA 4ZKDA 2ZRAA 3GJ3A 1M6NA 3MAAC 3VQTA 2NZ8A 3W8RA 5K8LA 1W0JA 1W36B 4BQSA 3SEAA 2FU5C 5FOUA 1MR3F 3IIKA 2K5UA 3QKUA 1UADA 2ZRJA 3RAPR 1A1VA 4HDQB 3CIOA 3UIEA 1DPFA 1AIPA 3V9PA 1G8HA 3NHBA 2W2XA 3TSZA 2JASA 2HLDD 1DBSA 1VIAA 1NKTA 3AVVA 3SYKA 4B73A 3W9YA 4A0GA 4ZKEA 2OZEA 1G8PA 5GVRA 3QKRB 1FMJA 1S1CA 4B76A 1T5IA 2GILA 2HT1A 3BK7A 1QHHB 3OE7A 4LZZA 1OFUX 1D8TA 1WBBA 2FX3A 3T1QA 5E3HA 2OEPA 4LBWA 4LOAA 3IHWA 3GFTA 1N6HA 2XAUA 4DEXA 1CRPA 1KYIA 2ZRGA 1VG9B 4KVGA 4YMWA 4L15A 2BM0A 3T1TA 1LFDB 1ZYUA 5L3QB 3K70D 1P2UA 2IYTA 2ZRBA 2H92A 4OQFA 1AM4D 1D2EA 3BOSA 2AWNA 1DAHA 2X1VA 1JR3D 1N6NA 1VCMA 5JCPA 4PC7A 4X8LA 1EX6A 3KXLA 3O8CA 1FP7A 2VP2A 4AYWA 1E32A 1P60A 3P27A 4DJTA 3GLFA 3SFZA 2ZXUA 4N0DA 3K9GA 1U98A 3X1ZA 3CM0A 2FE4A 2QP9X 2UKDA 1FQKA 2ERXA 2IUSA 4PSVA 2F1RA 3QXJA 1YVDA 1P9NA 3P1JA 2CL6X 2OFWA 3SN6A 1ZAKA 3CNOA 2HF8A 4RD6A 3LW7A 1NN3A 2FPLA 1NVWQ 2DFKB 2R6GA 1W4CA 1Z6AA 2BKEA 3W8NA 1OIWA 3BH6A 1GFIA 2WBLC 3B85A 3AP1A 2WICA 1W5TA 3THWB 1K5DA 1TMKA 3EWAA 1JBKA 3M4YA 4R98A 4B3CA 4YXWD 5CB8A 1NG9A 4OK3A 4QGFA 4NYIQ 3T12A 2RGNC 1L4YA 3WYFA 1H8HA 4TMVA 1Z83A 2VO1A 4CT4B 4KVAA 5CJ2A 4OHVA 5CM9C 5FI1B 4IEEA 1C1YA 3NIBA 2RGAA 2IBMA 2FFHA 2WSSA 4B3FX 2QORA 3ADBA 1W44A 1GWNA 3MWLA 3QE0A 4MYUA 4Q5IA 4DT1B 5TARA 2O8BB 1J2JA 4DT1A 4NZYA 1II0A 2Z6VA 1J8YF 1SKYB 3QOFA 4MYTA 4IXMA 4AWXA 3U44A 3RS7A 2FGKA 1RZ3A 2OE2A 3LY5A 3AF1A 3QBTA 3TSOA 3WMGA 2BCGY 2AL7A 1XF9A 1Y63A 3JVUA 2A78A 3K9HA 5F98A 4NCHA 4B2PA 4BFYA 3FYHA 5FI0B 3EIQA 4TYWA 2Q9AA 3IEVA 1FOEB 3FE2A 3E5HA 2QEQA 3B5JA 1IHUA 5JJKA 3O8BA 4DCSA 4Q01A 4BWYA 3RS5A 1AA9A 1II8A 2VPPA 4S2EA 4Q4JA 3VKWA 2MMGA 5B30A 2J0UB 4OL0A 2YZ2A 1G8FA 1RIFA 2BIFA 2IYWA 4XH9B 1FUUA 3K0FB 5A4JA 3OFND 1IN6A 2JLYA 1P72A 2ODNA 5KPDA 1G3MA 2A7QA 3I61A 1A82A 4C2UA 4B3XA 3CRVA 2VSFA 4LJ8A 4TLBA 3M6AA 5G53C 4ARZA 1KZGB 3TGPA 2EWVA 2IXEA 3PEWA 1M7HA 3MCAA 4FMCF 3FHTA 1TQ4A 3BXZA 3A8TA 3K0EA 5DN6D 5FL7D 4MQBA 3AGQA 3ZDQA 4MRRA 1LF5A 2ZYWX 1CU1A 1NN0A 5GJCA 2ANBA 1N6KA 2X77A 2HT6A 2OILA 3LA6A 5AJYA 4BRUA 1IN5A 3GD7A 1OPXA 3DMDA 3QKSB 4FINA 4ZIRB 1LS6A 3DEFA 2FEOA 4RZXA 2XGJA 3Q72A 2G1KA 4LJYA 3RDPA 1UKZA 4HB2A 2QUZA 1DELA 2GF0A 2ZRNA 2EFEB 3CF2A 4Q1AA 2B7BA 3TLXA 4X8MA 1E6CA 1CBUA 2RGXA 1N5JA 1G3IA 4HLUC 3X1YA 1XPUA 2JLZA 2QNRA 1U81A 3X1WA 4ESHA 3KJEA 3R9XA
chains in the Genus database with same CATH superfamily
2O5RA 1NRIA 2WJAA 5ALPA 2DU1A 4LGCA 5E7OB 4DR2B 3T4VA 3TZBA 3GBGA 1LDBA 3HHLD 1JIXA 1GRQA 3S6PA 2OTCA 1YR8A 4Q4LA 3V3TA 2I87A 1ZA2A 1CQIA 2O7VA 1PRYA 2A3RA 4YJHB 3RS8A 2FEPA 2WDZA 2PPLA 4BFUA 1SG6A 3KWFA 2FR0A 4M0KA 3G2QA 1AHSA 3DJYA 4D4GA 2P3SA 1ACLA 1R1ZA 1S9HA 3EIOA 1JG2A 3RTGA 4IG3B 4BISA 1UFVA 2EV9A 3T35A 2Z58B 1D7OA 4DXAA 4AG4A 2Z9DA 2ILYA 1QAOA 4L0DA 1NP7A 1URXA 4RYDA 1G21E 3LWLA 3CULA 5KOIA 4ARXA 5M2UA 1SKQA 3HMQA 3NIWA 1S8OA 3I9KA 1F8VA 3UKDA 1UYZA 3PGXA 2DPHA 3NYWA 4N8SA 4UTVA 4EB3A 2VIHA 2DY0A 3QTLA 2IX3A 3D9QX 1NJYA 1TGYA 1ISRA 3WLHA 4K5QA 4ABTA 2XBMA 1QJ4A 4E0DA 4DLSA 4HY3A 2GA8A 2FJ0A 3C6ZA 3RIYA 2WSEC 5EWLA 4URUR 1JKHA 3MM4A 2WSSD 3L1UA 1RI3A 3H11B 5E2IA 3AB0A 4WDQA 1UFLA 4TZTA 2Q5JA 2CXOA 3S2YA 2JK1A 3SEEA 3COYA 2YQZA 5JOZA 1KC8T 2O0MA 5BRJA 1E92A 3TRKA 1WBFA 3LXMA 4DR6J 4ISRA 4JL8A 1K2WA 4Q21A 4DYDA 4DUYJ 2HQIA 2WSLA 2BTOA 3MPOA 2P34A 2IK8A 5EHGA 2Y2VA 1S1VA 1WV1A 1JR6A 4KQIA 4XQEA 3C6KA 3GJZA 3U3MA 3DLKA 2EIDA 1X9IA 1CY6A 3PA6A 2VJNA 3VKFC 1MWQA 4C8DA 3LXXA 3LNCA 3QFHA 1RISA 1A2QA 3AU8A 2ILMA 4DMFA 3VZDA 2RGNA 1B16A 2X8LA 5F8HA 1NA1C 3O6QA 1RT5B 2R1VB 3OMLA 2RMU1 5IYZF 3SMQA 3BCHA 2BBTA 3UQZA 3OKPA 4QARA 4A2QA 5EJ5A 1FUIA 5F5NA 2CQPA 1H2VZ 3HV0A 3WV4A 1RHI2 1Z16A 3SC2A 1T11A 3W9HA 1FFHA 3IUMA 4AB1A 2LTNA 1S8NA 4ZLLA 3NH9A 3FUTA 4Q3NA 1WTCA 3PY8A 2V7QD 2IX9A 2QJRA 4QOFA 4M83A 1JXMA 2JLBA 2BI8A 2B4AA 1VPWA 4HVZA 1E1YA 3RD5A 1XJ5A 2G71A 4KLRA 5HUHA 3B82A 2ILZA 3UUEA 4F4AA 5JISA 1FA0A 4NDNE 3ZXJA 4ID9A 3UGKA 4RU2A 4RW6A 4K0KJ 4DX6A 3RVQA 4UUBA 1GT6A 2R87A 5HPOA 4CEJA 4J75A 4V0ME 3H5OA 10MHA 2Q6IA 2W2TA 2HCBA 4UFNA 2R751 2WAMA 2HBZB 4I5IA 1QP7A 4A4DA 3QJGA 1UPXA 3AWDA 2QD4A 2Z83A 1P7VA 5EJ9A 1Q84A 2BONA 3DHEA 3E3MA 3IMNA 2FPXA 1A9QA 2IT1A 2ODEA 1RJ9B 4ILLA 3DRXA 2NZYA 2EICA 2ZGQA 4YSFA 3OPWA 4F5WA 2FUG9 3NAPA 1CAUB 5H59A 1HMYA 3C3BA 5DXFA 1YIAA 2D1CA 2JDAA 2V9PA 4IJKA 4LDPA 3HKCA 5JH7F 3PE6A 3S30A 2FSFA 5JCTA 3K5OA 4R0JA 1AR82 1F2TA 3N0XA 1OA3A 5K2OA 2QZ3A 1FS4A 5G3YA 4Z0NA 2R6R1 4CQMA 3IO1A 1MLDA 5HKAA 3C41J 3F5MA 3BPDA 4FDUA 4ALNA 3QAEA 3UAOA 3Q8SB 4R1QA 2QNBA 1WX1A 3KE9A 3KPVA 5BSMA 1QQ6A 2YMLA 1FP2A 1H0KA 1NBEA 3PCOB 4HUQB 3MIEA 4FMPA 1VAMA 4OYLA 1PGW1 1R4ZA 4DCPB 2NU6A 3L2HA 1W9TA 2P9YA 3KLOA 4DANA 2VKRA 4BFZA 3HCOA 5H16A 5AXCA 4IJQA 1FPQA 5L9AA 1XA3A 4H1UA 3K89A 1EVIA 4UVHA 4WZFA 1T8UA 2E9SA 1JMKC 3OVSA 4AZVA 2MYUA 4C1BA 1K8ZB 3BRWA 1URRA 3EMVA 2RGUA 4R83A 4ZEVA 2V50A 2ZPTX 3PDCA 2H65A 5J2PA 4UD2A 1E8NA 3HSJA 4ZOLA 5KAMA 2XVZA 1U6ZA 3T0DA 4HLDA 4L1KA 2VFTA 1XJ0A 3WG3A 3PC7A 4YFUA 4HPKA 4G5XA 4UBGA 2HS0A 3I6PA 5JBIA 3ELYA 4BX9A 1AE1A 4BBYA 4L5JA 3JQJA 2JFHA 3QXGA 5DNAA 1LWCA 1HEUA 1O5JA 3KG2A 1NT2A 3FLMA 4ENPA 1AG9A 2WU4A 1KGSA 2OCKA 4Q29A 4XVHA 1KQ3A 1XLTA 5K6TA 1ZTTA 4F4IA 3POFA 3IMMA 4Y33A 4K1YA 1SI9A 2YKNB 3H3UA 3WADA 2HHPA 4NYJR 2NIPA 4OLBA 2WZR1 2IS6A 4F9GA 2WHPA 4JKMA 4KWIA 1WHTB 1QCYA 1KSGA 3K05A 5KFJA 4WWSA 3A1YG 3BTAA 4DUXA 5FIXA 4OHZA 2ZWMA 1FRKA 4DHVA 1V5EA 2P4QA 3UG7A 1LESA 1WEXA 3ZYRA 1K0TA 1VAVA 3W6NA 4A8KA 1PT5A 4MVJM 2XQIA 2YBKA 4JC1A 2VZPA 3CCJS 4Z9XA 3NOOA 2DFNA 3ZXGA 1OD3A 4L51A 2UU9B 3RJ2X 3C14C 5DAXA 2CGOA 3H5AA 5GADU 3WRWA 1D1PA 4U0KA 4A6OA 3PU3A 2I2FA 3SQNA 4UTNA 5B4UA 4FGUA 3TNQA 2DJWA 1Z34A 3CVVA 2Y60A 1C3JA 4H14A 4RQPA 1ACMA 2DCUA 3P2KA 2BMFA 1R9NA 4PABA 4PLHA 2JZ5A 3GLFB 1E1LA 1YS4A 4OZ5A 1R10A 6PFKA 2HK8A 2WM3A 4LBVA 1R27A 1AK2A 5I3UA 1YDMA 3EWIA 1VLNA 3LK6A 3AF2A 5KWJA 5KHJA 2ZC4A 1W75A 5HBAA 1X92A 1VL5A 4Z4CA 2KPOA 3TM5A 2CQIA 9ABPA 4TY9A 3TVDA 4P5DA 1YVRA 5DQHA 1E9RA 3HRIA 3L1IA 4UASA 1HE4A 1WZEA 1XF1A 1T34A 2R44A 1JKFA 2D7JA 3SIPB 1TM1E 3A2LA 4TLGA 4M1TA 4PIYA 2F8HA 1RJWA 3EODA 1PM4A 1C8LA 2EAAA 4CP5A 3TP2A 3MJHA 4XSHA 1POV1 1NYTA 4TPKA 3BH0A 2B9WA 3IOYA 2WR8A 1UMDA 5KNCD 5AE1A 3HDVA 2A6XA 2FHRA 4HXYA 3IERA 5F5CA 5DW0A 4DCUA 4CNYA 3S5UA 4MH0R 2ZYAA 4SBVA 1UWBA 4XFDA 4O4HF 3AW8A 4ED5A 1UWAA 2VMGA 2HWKA 4J0KA 5AK3A 1BS2A 4MPJA 4I1VA 2W2NP 3C70A 1YQCA 4ZC8A 2W8LA 1A5SB 4BCCA 2AFIE 4KG0A 3M8RA 4GAEA 3HP1A 3MM5B 1HQKA 4XZPA 2FWPA 2PN6A 2ZREA 1ZP6A 4UUOA 1JWAB 4G0XA 1OAAA 1P18A 3EZYA 1HKAA 1VL0A 3OLWA 3MGUA 3QXCA 1GADO 3D3WB 4HDKB 2HA7A 3IP8A 1IR2A 4DFSA 3U1XA 5C5TA 2EXHA 4DI6A 1OWOA 3RABA 2OV3A 2HNDA 3RAQA 2ERYA 3BSYA 3UD5A 1NQOA 5K0CA 4ECEA 2YV5A 4HR7A 3P9RA 3U4IA 2E4YA 1Y5MA 1IGOA 3BE8A 2XT6A 4QEDA 3ROKA 2ZRLA 5SZIA 4J76A 1N9KA 4B71A 1Q1BA 2B4PA 4PEOA 4IG0B 5F51A 5K0BA 1VE6A 4JTOA 4OX9J 1BQPA 2J5AA 3C2PA 4R0NA 2ONJA 1UAGA 3PQ4A 3K8YA 4QYMA 2EYQA 4IWYA 4WLVA 3IMKA 5JMCA 4MRNA 1GZHB 4MR8A 1YHFA 1NZ8A 2ZWPA 1X1QA 4PBPA 1RMTA 5E95A 1BVHA 4HQFA 3I62A 3VGJA 3JXOA 1M34B 3M89A 4KQHA 1EK5A 1Y1KE 4O4HB 4IS3A 4XVUA 2WB1D 3E9DA 2F1JA 2KBEA 3DE5X 4G63A 1SCDA 1L7DA 2UVRA 2A5FA 4C11B 4XPIA 4MYEA 2YFHA 1UX6A 5K3CA 2DR2A 2RGCA 5EWMA 4R71A 4K8RA 1S2GA 5A4MS 4WYWA 5BSUA 3U75A 2MHEA 1N36J 3U60B 5EIAA 4CKBA 4CLOA 2O5VA 2ZH2A 3ZFGB 4HB0A 1FK8A 4HK9A 4EZHA 3OSZA 4DZGA 4ER6A 1LJ7A 2XGSA 3EZXA 3GDWA 2ZSBA 9LDBA 2YXSA 2G1AA 3TVTA 3QVKA 4YVWC 2V67A 4G4JA 3PFCA 1AR73 1V3QE 1Z0HA 4MI6A 3KIPA 1YJAA 1FTWA 3HU5A 5DGBA 1JLHA 4MV1A 3I82A 3LT2A 2PNJA 2FRVA 1TU3A 1ECFA 4LFCF 1OI4A 4DTIA 4Z9BA 1IN0A 1M8KA 4S1WA 1XR3A 2C22A 2VRNA 1VQ1A 3WZ0A 4XCQA 4J7CA 5H3HA 2YYYA 1AKRA 1EFDN 2QZ9A 3I9FA 3VYWA 3TJRA 3MCTA 4WU3A 1GAJA 1ZK2A 4B9AA 1SMVA 1NHGA 4BNJA 4FGSA 4NYOA 1YJ5A 1QUFA 2P8SA 3MOIA 2HHWA 3G0IA 1H69A 5KNBH 4L97A 2Q6OA 2HK9A 1FW8A 1T9XA 3HIFA 3LP8A 1CS4C 5B2GB 2BGPA 1C7RA 4Q9DA 1N4AA 4CQLA 2HWB2 3T06B 1BXNA 1L5HA 2FPPA 4D26A 3MF4A 3E5RA 4LBHA 1HNWF 1H0HA 1SVWA 4IYRA 1GZVA 4C76A 2CMDA 1TRHA 4RORA 1GPWB 1VKNA 1SZBA 4RNNA 3EXCX 1NLMA 3PWKA 2L19A 1BGXT 3PW4A 1L8OA 2HMYB 3EJKA 1B0VA 1NK4A 1PT6A 2Q3DA 1T26A 3FZ2A 3L7IA 3TW6A 4DUPA 5TT1A 4AY6A 3MT7A 1RPZA 1D2QA 3KQLA 3SQWA 2ZM6B 5B4NA 2KS6A 2DVMA 3FF1A 4N76A 3SX0A 1ZNWA 4XTMA 1DKUA 1H05A 3UK9A 3HT0A 4NFLA 4U67Q 2QROA 2R7TA 3ND5A 3ILNA 4LIUA 1EJ0A 4MCHA 4Q1CA 4H7FA 3C3YA 3RZJA 3WYCA 4UVIA 5JAXA 1OA1A 1WHYA 2QJFA 3CE6A 4NVPA 3I4IA 4B2IA 4AY3A 4YO7A 1KFSA 2WG0A 3OOEA 2XSFA 3H1TA 4G3YC 4WNCA 1ZY2A 4HOYA 2GGPA 5C34B 5FMDA 4IZIA 3DLHA 4EUNA 3OICA 3LRPA 5L9BA 1QGDA 4WKBA 4AXOA 2YKMA 3EH2A 3R0ZA 2YKMB 1N34B 4Y9DA 3V34A 1M6VB 4RDXA 4N48A 4OAOA 4A2PA 2LU2A 1BG6A 5FJIA 1TQHA 1LDNA 4YPFA 4YEDA 3AVYA 1RFGE 4MGTA 1P6TA 4COWA 3VTIA 1N3IA 3WX5A 1EB8A 3NHJA 5B4VA 5EFUA 2IZ5A 3NO8A 1KR2A 1YQ2A 2AR0A 3CZAA 3I76A 1E6WA 2HHLA 3LCVB 2C88A 1JZ7A 4KO2S 1XXLA 1LLQA 4XWKA 2ZROA 3QI7A 1FAYA 2VP9A 4GUAA 1UMIA 3DH0A 3DCQA 2AYGA 4DF4A 3IILA 4PYKA 1MW7A 5IBRA 3VJMA 2DIVA 3QH4A 3NFYA 5BV7A 1M2WA 4KODA 4NTZA 4CNZA 5I42A 1LUAA 2DEJA 3TPZA 1IEQA 4RGQA 4DDVA 4U9IS 2NZVG 1DIBA 2VRBA 4EO4A 2W1UA 1N57A 3F98A 2DFPA 1NRJB 2OHFA 3EIHA 3G5TA 3LV8A 3SZGA 2IYFA 4UEQA 2G1UA 4YGYA 3I5XA 3K1TA 1UX7A 3LECA 5EUMA 4DUGD 3Q2IA 3NRUA 3CZUA 4W5WA 3CDEA 1NXD1 1YR7A 4BIMA 2IU0A 3PRHA 2OWEA 5TMDA 4O4GA 4RLHA 3BKUA 1NJ8A 4LRWA 3DI6B 4GPD1 1AZDA 3I58A 4FCAA 4P8RA 2WVEA 2IRUA 1SEVA 4WASA 1CJVC 4ZJZA 2HKIA 1K9MT 3MM8A 3FB4A 1BZYA 2HMIA 2IC3B 1Z2ZA 5KS2A 3KLVA 4DX5A 3JD2A 2X86A 1C0IA 2ISCA 4PZAA 4BM8A 2G9OA 3GCWP 1IN4A 4P32A 3TUZC 4TKUB 1KFXL 3PITA 4S1PA 1O5LA 2XCUA 2B1RA 4LFAB 2AIRA 2R86A 2EU8A 1E3EA 3EVOA 1DF0A 4TTIA 4CMEC 3MCNA 3OTOF 2IYGA 3HN6A 4YC7A 4AECA 2ZYDA 3VV3A 5GAHI 4GF5A 1L5FA 3TZQA 4HDRA 2ARCA 3GLIE 2EQ5A 1SL1A 4FVVA 1D5WA 5J2UF 2R0FA 1GZ5A 2FUCA 2V9CA 4AFMA 2BDEA 3LT0A 3CJ3A 2R8JA 3PLAE 2VZ0A 4GLFA 2L2QA 4KAXA 4AD6A 3FROA 2NZ4A 2HMAA 3NBYC 1FDAA 1F4HA 2WIFA 2CJYB 1QXPA 3B00A 1P1BA 2WNVC 3RVDA 1WW6A 4EX7A 5KFTA 1U1CA 1QVAA 1NSAA 3DWIA 5EGSA 4TXLA 4L2IA 3AP3A 4K4UA 4ORFA 2UU9F 2J0XA 1ZBA3 2OXFA 3DAHA 1PUJA 2XJ9A 3K5WA 2GM4A 1IBRA 1TLTA 3ICCA 4MIEA 1R081 1E6VA 3DOHA 2FTRA 3WFJA 4LO4B 4LXHA 4LNVA 2BW0A 1BC6A 4C78A 1EHYA 3GEMA 2F6RA 2YHAA 3T3HA 4CLRA 2DUWA 3C15C 3PQ2A 5FKCA 3V1TC 2OCLA 3HSSA 4IIBA 2GLUA 2LWIA 1SU7A 1NBWB 5FULA 1BEV3 1YBVA 3IUYA 2RVJA 4YECA 4AJ9A 4MRMA 3W8DA 4GGPA 1G86A 2W0SA 2NV0A 4PRZA 4ZU1X 1ZESA 2J76E 2RQ4A 3AUJB 1KQRA 1U2GC 1INLA 5FO9B 2PWPA 3WF2A 3UYKA 3T4HB 5CKQA 5K5EA 2BEWB 4YAFA 1PWZA 1DJQA 3SC7X 5BN1A 2GEJA 4HVAA 1GXSA 3JQ8A 2R1UA 3SDZA 1XSEA 1M83A 1W35A 3PYFA 1JLLA 4M5MA 3TDKA 4LVNP 1YI2S 4II2A 1Z3IX 1HDOA 3BMXA 3TOZA 1G42A 2QL5B 1M9NA 3SXUA 2CVZA 5BV8A 4C1WA 5D5HA 4ZI5A 2IYNA 4G6VB 1VBB2 4L11A 1JHZA 4CETA 2C5BA 1YXWA 3H59A 1NCQB 4QFBA 4A10A 2UUBJ 5IABA 1M5KC 1CUIA 3MWEB 1GZWB 4QAJA 5DDOC 2XG3A 4LKFA 1G9CA 3TAYA 4G0OA 2BABA 4QM9A 2H4YB 3IS9A 4NRPA 2FF7A 3F71A 4G5SA 4U5QA 4X6QB 1ZMTA 4HVTA 4X65J 4QT4A 3ZMOA 4JB8A 2PVSA 1TLFA 4WM7B 1AHIA 4G85A 2OG2A 3KSBC 3DMNA 1XTVA 2V1UA 5BV0A 4PYMA 1HI8A 2HMVA 3REOA 2H1VA 3TARA 1QIKA 3JZVA 3K77A 3HJFA 2AJLI 4AKEA 3H5VA 1AR83 3JALA 4FFLA 1H85A 4CLKA 4QHYA 2YOFA 5ED4A 3H4DA 2ACVA 4JVNA 1Y10A 5C5JA 2V8GA 1ZHFA 1M1UA 5EJMA 1DP0A 2XWBB 4M5DA 1T0PA 1V2HE 4OBXA 1OQ3A 3MBWA 1G2OA 5C3RA 2I74A 2FLVA 1U5ZA 2W39A 4ZP6A 1EUDB 3L1JA 5EESA 3PVNA 3U4QB 4ND3A 2Y0SD 1CUCA 2WU0A 2BZ1A 1FXSA 3FX2A 4Q8KA 6YASA 2B94A 2ECQA 2IP1A 2BISA 2R2GA 1U7ZA 3PPXA 4JDPA 5TQJA 2G04A 4NHYA 1EQ2A 1I2AA 1K5GA 5LWQA 2IHUA 1GGMA 4AXBA 4LNAA 2HFUA 3BU7A 4HDGA 3FSGD 1J1LA 2W22A 3AJ8A 1M0TA 4P9WA 5EV7A 2FMHA 4RJLA 1XBWA 1R1DA 3J8F3 1B8UA 3RRDA 4X64F 1OOEA 4OKSA 4Q9AA 8ATCA 1CQXA 3DLTA 1IBKJ 1OU4A 4QUHA 1OXTA 1O95D 3H2IA 2C97A 1S77D 3MPYA 3P3DA 1XNQF 1EFAA 2HWE2 1WD6A 3DYVA 1OSNA 1NTRA 2D54A 4MQUA 1K27A 5DP1A 3NPMA 2WILA 4RUKA 3I5MA 4KACA 4TSFD 1JE1A 1BMV1 1JN0A 4S1VA 4WA8A 4V0SA 2BFDA 1DAOA 1L7MA 3RZGA 3Q5GA 3BSSA 2BE2A 4NI2A 4V0LA 5BN5A 2GLTA 3L0YA 5TC4A 3BMNB 3UMGA 1ZVFA 2FPMA 4DC0A 3DTVA 3F0NA 4N7TA 3OGSA 1QJY3 3Q7EA 1V0AA 1TCVA 1X38A 2HA3A 3M8QA 5CU7A 3L7JA 5JZGA 2GDJA 1VALA 5ESXA 5EZ6B 2X29A 4ND5A 5C25B 1VJ2A 2P2NA 4WECA 3F6CA 3I9OA 2WZCA 4JUAA 2YC2C 4Q05A 1HYBA 3C7DB 4N0QA 4P6VF 1S0UA 5J40A 1QYXA 3CVWA 3MQFA 3UANA 5IP5A 5CP8A 1K8XB 1GEGA 1WG1A 1J2YA 3BKTA 2HREA 4MWBA 3CNNA 1Q21A 3B53X 4L08A 1MHTA 2MEV2 2EFDB 2O8DA 2FKNA 5FYSA 3QPCA 1SQ0A 5FY1A 1KNXA 1SLIA 2VEOA 2OK8A 2MCFA 1EIYB 4HQKA 3AR8A 4LCBA 1EWTA 3ZCTA 1YZYA 4FQ8A 3DMRA 2Y1OA 2NO7A 4WZCA 2XH8A 1SUAA 4QXRA 1GPMA 1FJ2A 1QQP3 1UT6A 4N3BA 1UVJA 3LBIA 3LO8A 2GD1O 4HV4A 4FOSA 1Q50A 2BFUS 4HYYA 3R5BA 2MKSA 3UJQA 3BDEA 3W2GA 5JMWA 1HL6A 1W36B 4HTFB 2I1LA 2OEMA 4UTOA 2I2XB 1DPFA 3OJFA 5JR2A 2JASA 1VB5A 1V3RA 2CLFB 1UKUA 4ZK2A 1C3HA 4MCAA 1ADCA 1Z6ZA 3DVAA 2PAKA 2H0RA 4B80A 4LITA 1QB8A 2R96A 3M2VA 4CKYA 4EGQA 1PKXA 1PK6B 1SIWB 1NFQA 5L3QB 1LPOA 2BKOA 1RQXA 2FJAB 2H07A 2GDFA 3KLSA 5J7MA 2OSRA 3JQFC 4R8UA 4KGMA 1O91A 3LEIA 3OOYA 4W50A 2DGVA 2G9UA 4GRDA 3CM0A 3NGSA 2JD4A 3L7YA 2ADCA 2AMCB 2RJLA 4I9NA 3UV9A 2FCTA 3NNSA 1XVLA 5DNCA 2HF8A 1XU9A 5MLCV 3VDDC 2DFKB 3LFTA 2GJFA 3TX0A 1H5QA 1XVTA 1S10A 2WBLC 1P6UA 2WICA 3MO4A 3VOSA 2H4ZA 3RASA 1QGZA 1P4RA 4G1FA 1QDLB 4YT5A 1TU0B 3X1MA 2A2CA 1AJOA 4MYUA 3UCUP 5ECGC 1NJZA 2FFRA 3CLRC 3VSDA 4XLZA 3LY5A 3SQDA 3WMGA 3UN5A 3T1YF 2A6ZA 4P2GA 3HXMA 5FI0B 2AREA 3H05A 1FOEB 1YOBA 3IIIA 1ZISA 4DTCA 4N53C 4S2EA 5F8PA 3CL1A 1TMYA 4PX2A 2UV8G 2QRLA 1XE8A 2XZWA 3K0FB 4R9AA 2J9EA 1R8CA 1DQ0A 3H9JA 2JLYA 3GB9A 2B43A 1VGRA 3SLKA 3K5PA 1ASJ2 2XE7A 4R9RA 2YNFA 5KFOA 1CJPA 2AC1A 4NHLA 1KLMA 2HAEA 3RHSA 3AP7A 1M2OA 5IAVA 3JAMY 4CU9A 2OHVA 5IYZB 1AB6A 3C39A 1L1EA 3J7TA 3DMYA 3AGQA 2BBVA 2GSDA 2Y1KA 2K2PA 3CLHA 2X77A 1TCAA 4RNHA 2KXFA 3DMDA 3DEFA 3CO0P 3CF2A 5KNDD 4AJLA 5KWVA 2BVVA 4DRXA 2OO3A 1KE1A 2DPYA 1YX2A 2I8CA 2QIFA 3AF4A 2CQGA 2X51A 4IE0A 1EARA 4ZQIA 3TZHA 1DC4A 1CNFA 3O4JA 1I0LA 4DPLA 5IYYA 5ALDA 4IHJB 2R2AA 3UJPA 2PEYA 3VDNB 1RP5A 1SCUB 1WZCA 1CJUA 3ZTRA 5CT6A 2VZUA 1NI4B 2VBDA 3JXSA 2ZRIA 4RZQA 1I3NA 2WJGA 1TL1A 1Y6GA 1YQEA 2BMVA 2OT3B 4UMVA 4Z1OA 3RZHA 4YUWA 3MI7X 5B6PA 2HLEA 2PJZA 1K73T 1RT7B 4ZN6A 5ICEA 2E9ZA 4CM8A 4Q0BA 2HMUA 4W9NA 2O3JA 1L8QA 3F7OA 4TLDA 4KV8A 4RTKA 1RLIA 3D7NA 4KR0A 3PW7A 1RQPA 4OQEA 4AI3A 3KHGA 3I8TA 4UBLA 3P9IA 1YVFA 3JTEA 1TD1A 5A7WB 1Z2OX 2QQOA 3JW8A 1V16A 2EDCA 3GYGA 4E15A 4QOEA 3AEQB 3LPMA 3DKPA 3EOAI 1YJNS 4BKRA 1E64A 5FZMA 1GP4A 1H6XA 2N4DA 3PC6A 1EK2A 4X8NA 1HW9A 3NGDA 3AMNA 4TQGA 2XKJE 4NS4A 5LSOA 3EXHA 3EQ6A 4B3BA 5TX7A 2RS52 2MMCA 4NIGA 3LTEA 5AW0A 2HTFA 1Z22A 2I2DA 1MZ6A 2QQUA 4JI7J 2HCTA 4TWJA 1SPBS 1UIKA 3BF7A 5HTOA 2CJWB 2A6OA 3B9BA 1M1YA 1LV5A 2AYZA 4LN1A 5AVQA 2CJWA 1TZ0A 2EATA 2IEDA 3PDQA 1PEKE 1YKFA 2E29A 3GGSA 1C4CA 3HCRA 4TOIA 4UBKA 2L9LA 1GZ4A 4E32A 4DAEA 2TUNA 2LIVA 5LQAA 4PAMA 5ALOA 5IV3A 2B98A 1QMPA 3I6IA 2J6BA 3FGPA 1ULBA 1RABA 4UPDA 5EJ1B 2PQ6A 1PFVA 2PXJA 4H77A 4EO6A 1O5OA 1KH1A 5FPXA 3JYNA 4WBNF 4M9UA 3OIUA 5LOVF 1QVVA 3UNYA 3JU3A 3CYFA 4O4LB 3ZGLA 1Q8VA 5F37A 4J2TA 3N87A 2X19A 4X1YB 4QATA 4A8FA 4JODA 3B36A 1HX7A 2DVDA 3A3OB 3I3BA 2V8HA 1T9TA 2ZFHA 4TKZA 2VAVA 2YHSA 4P2MA 3H7HB 4DFPA 2DXFA 1XCBA 2KXLA 2VXOA 4ZK6A 1Z0ZA 1N92A 1YEWA 2GLXA 4B3JA 1Y9GA 3MR3A 3OUJA 4PFJA 5AM3A 4HDCA 1O4VA 1DU3D 5CXXA 1V6JA 3L7PA 1JDBB 5KKAA 5D87A 2F00A 4U7HA 3H98A 4ZVQB 5F7ZA 5D8HB 1XYNA 4EMDA 4FDMA 3BVCA 2ILVA 1HBUA 3OTOJ 3DRPB 4HPXB 1J1ZA 1ISIA 4UAJA 3OZEA 2VQAA 5DHFA 4ZANA 3MMPA 1R8AA 2MZ1A 3UN3A 1Y0BA 4JC0A 3H1PA 1R4MA 4Y1EA 3LDBA 1Y8AA 4YY3J 2Y1CA 5BOSB 4ARSA 1EQUA 1KJYA 4E9KA 1TD9A 3NUQA 1WF1A 3NIFB 2SBTA 3E27A 1SBDA 2WHRA 4XB2A 4B6SA 1LLUA 5JI7A 3ONFA 2AZ5A 1Q8OA 4GM0A 2ZEYA 5ELXA 1W28A 2YN2A 3BCSA 2NVOA 2VZRA 1U1KA 1VBZA 2JG9C 4G8CA 1NCRA 1QH0A 2QVLA 3B5EA 5CHEA 1PAUA 1WMDA 4MGYR 1WA5A 5F1KA 5LJ5Y 5DASA 1IB6A 4B6OA 4X64B 3QM1A 1ZGAA 2G0NA 3PLNA 1RYEA 2RHOA 4P92A 4GJYA 3IGVA 2NZCA 3QPAA 2YVSA 3ZHXA 1FRIA 2GJ2A 4WKNA 2HWHA 3LDGA 4YW7A 4HN4B 2HVZA 1W88A 4AN4A 4RK5A 3OEWA 3ZGXA 5D6GA 5CYMA 1EFVA 2Z2IA 1A9SA 1F1BB 4HPWA 1CUGA 2YHIA 2FJXA 4WEQA 1P9OA 4A8YA 4L22A 2CCGA 3ST7A 1UH5A 2HAFA 4EKGA 4QZVB 1WXDA 2PAEA 2FW7A 4W1SA 1E4EB 1DJOA 2WWIA 3LPLA 3OD4A 5A32A 2CVIA 3BSNA 3QXHA 4S2GA 3ISZA 4LHYA 3SJ7A 5IJRA 1E0SA 3PTYA 3RJMB 1ADGA 1UL1X 4J1WA 4KRGA 1X4DA 3EXYA 4PLVA 1T5LA 3IVMA 3NBAA 3CXRA 1ES9A 1EX7A 3GJBA 2H65B 1PC5A 2IEAA 1C0UA 3U7QB 1MZPA 1XNKA 2FJBB 3TW8A 4URQU 1ZVQA 5COAA 1ZCFA 4QYXA 1UEUA 5IEJA 5IVDA 4QJBA 2ECPA 1FI2A 4AC9A 1OY9A 3JARA 4K6GA 3D7MA 3I4PA 3OOWA 1Q43A 2HIYA 3RRFA 4BECA 1UZUA 2IL1A 4LA2A 1S6YA 4AZ3A 2FGJA 2PFGA 2EWWA 3O5SA 2QX7A 3PXXA 4UOHA 1VI5A 2ON6A 3GLIB 5CVCA 1DTQB 2GP5A 5I91A 2QSFA 1P3JA 2I4RA 4WT7A 3T0FA 5LQKA 1HTWA 4IOBA 3LQQA 3N3AC 2XNHA 4TMZA 4YAGA 3NOQA 5JQGB 3JATB 2ZRFA 5H9SA 3QLVA 2CN1A 3OJWA 4N6GA 3FSYA 4DR1J 5HQJA 3GJ7A 3GBVA 4RENA 2ZOMA 2RU9A 2GBIA 1OOPB 5JNTA 3M1VA 3ZPXA 1G5PA 1BMTA 2AHOB 3R9LA 3ELBA 2IPXA 5K4AA 2XS2A 4JDNA 1AVBA 4DIBA 1IZ0A 3R23A 3EB9A 1FATA 4FI9A 3BGRB 5JOQA 4UU8A 2PT7A 1IIBA 2I07B 3KKKA 1Q7LB 4FQ4A 3EPGA 5ESRA 3OPQA 1DIGA 3FRYA 2VMEA 4W6YA 4MQFA 3WLKX 2X8KA 1HNXJ 2CNKB 1QHFA 3WZMA 3C7AA 4BU1A 1LBQA 1EHWA 2CWXA 3BPSA 3BWBA 3MW8A 1W39A 4URZR 2BMEA 2PBRA 3R7DA 5K0UA 4ZCLA 2PEBA 3B9RA 3KOZA 4E5KA 1S1WA 3C3AA 1YHQS 1ZR4A 3VZBA 1VAKA 1VLLA 3DR3A 3QY9A 3R75A 4IIUA 3QH6A 1OURA 1ZINA 3VPSA 2XAAA 1ZSVA 1EHIA 2WKWA 1TU4A 3PF8A 1H4VB 4OA5A 1BMDA 1JK9B 3IR5B 2EHJA 1DEOA 2ZIXB 3OXGA 4JI6B 1RAFB 3WICA 5SZJA 1QOPB 4NEHB 1CDDA 2HBQB 1KNZA 3FJOA 1QLNA 5EYYA 3SIXA 1WCQA 3RB3A 3HBNA 4RTRA 1HBMA 4BNGA 1NUQA 1THGA 4CDQA 5HV4A 2OD7A 5EFOA 3C8YA 5KG4A 4MKBA 4F04B 4P7FA 1AQNA 3TAXA 1LK7A 3CRRA 4GO1A 2VOPA 3UCEA 5J09A 3ESRA 2WNUA 4TZ6A 5CNJA 3OPNA 4Y1VA 2JVOA 4US0R 1S59A 1HNXF 1Q1AA 1EAH3 5FUVA 5FO8B 4DR6B 5DUUA 2VT2A 1LCIA 2M3DA 1SVIA 1J24A 1OKQA 2GCIA 4LX8A 1S01A 4MX8A 1OPRA 3PDWA 5AK0A 1XZDA 2PI5A 2X53S 2AMJA 3O26A 4FF2A 3FETA 3Q3CA 3EPIA 3OWOA 3AMQA 3NHFA 3MUTP 1W0PA 4RV9A 4ZT2A 2OBNA 2EJCA 3WGYA 3VZMA 1YBAA 1WXHA 4J3JA 2WN3A 5T50A 5E1DA 5D8AB 6ABPA 1OH3A 1KOGA 2ZT6A 5TEVA 2EP8A 5C3MA 4X4UA 2VYQA 4J9VA 5HLFB 2X7HA 4QU2A 1CB7A 4Z7CA 1XRNA 3JWJA 5AOCA 3VH4A 3T3FA 4DUWA 2JRSA 3KLHA 1P9RA 4Q39A 3GBSA 2PLV2 3CJ8A 5K0FA 5ILQA 5C24B 1L4NA 4FKYA 4JB3A 3PHLA 1XJCA 3AY7A 1GITA 3RLFA 2D5LA 1EJ2A 3PNQA 4FPXA 2OL4A 3AKQA 3RSOA 1XDUA 2LEBA 2CYBA 4NI5A 4KXWA 5JAPA 3G6YA 2CKDA 2DFBA 3IC5A 1YQQA 2FD8A 3MIDA 3GROA 3RVOA 3K46A 4LF7F 3COPA 4FQ7A 3R5AA 2VG5A 4G56A 3BTUA 1V6CA 4CIAA 4GI1A 4QJIA 2WYOA 3HVUA 3WKBA 2HQSA 4H0NA 2NZXA 2BWAA 2Q1ZB 4CTNA 4D8WA 4GH5A 2R7XA 5L39A 3A1TA 2D0PB 1NC3A 1P75A 2ZDOA 4RPFA 3ZTPA 2D4AA 1JR3A 2MJUA 1AKYA 4MEAA 5ALUA 4GXLA 1KYXA 1NZFA 1W30A 4QPGB 1YIJS 4FR5A 3BUCA 2A35A 4M98A 4FJ0A 2HWWA 2G4LA 2W8BA 3KTAA 4HT1T 4E4DX 3W2WA 3FVRA 3IODA 3IAQA 5BNPA 3K17A 2VPZB 2JLQA 3U7IA 2XCSB 4RQUA 4YM2A 5JAUA 2QN7A 3I0RA 4MLPA 4HSJA 3RWBA 4WCVA 5HJYA 1CTQA 3UFXB 4E13A 1TT5A 1SELA 1HZJA 3V4FA 4LY0A 1FYDA 2HBUA 3A21A 4N1AA 2YKNA 3IBCA 3NBFA 2ZUGA 4D98A 2JIBA 2DZDA 5IBCA 4NLPA 1PMIA 2HJHA 1MB4A 3WRXA 3VV2B 2VJXA 1CJCA 4HJRA 2LKCA 1SXJA 1MQ9A 1W46A 1Z26A 2PTHA 4XGKA 2JFBA 3DOLA 2IKQA 1FDVA 4JI0B 3FLBA 3ZDSA 3VSCA 3QUAA 3VL9A 2W00A 4NU6A 3W5NA 4IYJA 3GMSA 3ZTOA 1C4WA 5JSYA 3THYB 5ALRA 4HDNA 3MR6A 3P4UB 2Y8KA 1Z5VA 3D8BA 4UQOA 5AK6A 2PG3A 5EP4A 1WB5A 2PRIA 3QF7A 1DV2A 3KFVA 2IM0A 5LSLA 1SIWA 1PIWA 2CXNA 3EWSA 4PF5A 2KR2A 3VVTA 5DI9A 3MXTA 1BE8A 2YCBA 2Z4TA 1N3OA 1G16A 3R3YA 3CF4G 5J63A 2UVPA 1D1QA 5FQ0A 2D5BA 5I4CA 2XGXA 2WAAA 4CR6A 4XGQA 1QNYA 3CLUC 4OM7A 3K8WA 1XJAA 1SR8A 3OC6A 1NIPA 1KJIA 3UC5A 4TKVB 2WV7A 5C2JB 5HK9A 3TM4A 2MSEB 2O1PA 1SCRA 2PIDA 2NO1A 1HC7A 5B08A 1G2EA 2QLJB 1Q5VA 2RILA 4XZUG 1FOD1 1PK9A 5L4SA 4JJ8A 2I1RA 4I4TA 4E12A 2JFWA 1F3VA 1RWPB 4WFIA 4OB6A 2CNWD 1Z36A 3CUTA 3OPVA 3HYRA 4PC2A 1JLCA 1W2GA 3LC1O 4K5RA 4FB4A 2WZQA 4YMUA 4MHRA 1KIFA 3DV8A 1WBJB 4PYIA 2VHJA 4ZPAA 2FWRA 2MU1A 4GWLA 2E1MC 4K86A 4B1MA 3IE2A 1J0XO 3JRNA 4YMIA 2P9FA 1N1YA 1NTOA 2GAJA 1ZA4A 5F12A 3D28A 1PDVA 1OUSA 4GM4A 2SCUB 4OYRA 4FZ3A 4ZVOA 5DG7A 1SO8A 4XO0A 2QM8A 4JI2J 3ISVA 2Z0MA 1Y89A 2VFAA 1EK0A 4BMCA