4C0BA

Structure of wild-type clp1p-pcf11p (454 -563) complex
Total Genus 131
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
131
sequence length
428
structure length
428
Chain Sequence
TGDNEWHKLVIPKGSDWQIDLKAEGKLIVKVNSGIVEIFGTELAVDDEYTFQNWKFPIYAVEETELLWKCPDLTTNTITVKPNHTMKYIYNLHFMLEKIRMSNFEGPRVVIVGGSQTGKTSLSRTLCSYALKFNAYQPLYINLDPQQPIFTVPGCISATPISDILDAQLPTWGQSLTSGATLLHNKQPMVKNFGLERINENKDLYLECISQLGQVVGQRLHLDPQVRRSGCIVDTPSISQLDENLAELHHIIEKLNVNIMLVLCSETDPLWEKVKKTFGPELGNNNIFFIPKLDGVSAVDDVYKRSLQRTSIREYFYGSLDTALSPYAIGVDYEDLTIWKPSNVFDNEVGRVELFPVTITPSNLQHAIIAITFAERRADQATVIKSPILGFALITEVNEKRRKLRVLLPVPGRLPSKAMILTSYRYLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MRNA CLEAVAGE AND POLYADENYLATION FACTOR CLP1
publication title Structural basis for ATP loss by Clp1p in a G135R mutant protein.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
total genus 131
structure length 428
sequence length 428
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06807 Clp1 Pre-mRNA cleavage complex II protein Clp1
A PF16573 CLP1_N N-terminal beta-sandwich domain of polyadenylation factor
A PF16575 CLP1_P mRNA cleavage and polyadenylation factor CLP1 P-loop
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.1030 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4c0bA01
3.30.70.2410 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4c0bA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4c0bA02
1DAIA 3K09A 4A15A 4BASA 1N5IA 2DCUA 2J45A 3NEJA 1ODFA 3P32A 5K8IA 1A5TA 3OFND 3KQNA 5DYIA 3SBEA 5M04A 2JAQA 3O8DA 3TE6A 4BRUA 4BLPA 1MOZA 1Q12A 2ZRGA 4HZUA 3K9GA 1MT0A 2JLSA 4ZPXA 3IKJA 2OM2A 3AKDA 4P3YA 4IEEA 3UANA 1XCPA 2ECKA 3CBQA 1FW6A 4HEJA 3K53A 2XJ9A 2GAAA 5LBIA 4XVQA 2JJ8A 2IEZA 2IWHA 2H17A 2XAUA 1A4RA 4DSTA 2V4ZA 4FWTA 1FTSA 1DAHA 5KSOA 2ZYUX 3BBPA 5GJVC 2BIFA 3GLHB 4TWZA 2O8DB 1ZMXA 3SJCA 5DYGA 1KO7A 1P60A 1AKEA 2BMJA 2QMHA 4KAXA 1M6NA 1NVVR 1NY5A 2A5FA 4JYBA 4XOIA 3R7WA 3SHWA 4EJSB 1C1YA 5JSZA 1SVIA 1OFIA 3C7KA 3TR0A 1Z6YA 4AK9A 4JJZA 2VP9A 5JI3E 1A7JA 2H16A 2EFCB 1G5PA 4N1AA 4HUTA 1NJGA 1JQJC 1TL7C 2EWWA 2JGNA 3FFBA 4BGDA 4S35A 3Q5EA 1SXJB 2KWIA 5JJKA 3QG1A 1ANKA 4G1UC 4Q1CA 5AWFC 3ZVNA 2VO1A 4URVR 2V8OA 1W4AA 2X19A 5DSZA 3W8NA 4O2RA 1HTWA 5EE1A 1OHHA 4EPVA 4YMWA 1XD2A 1W0KD 2RGBA 5AUNB 5L8VA 1W7AA 1S3SA 2ZRCA 4FD2A 4R9UC 4TYNA 4IXMA 4NYMQ 3WNDA 3B1ZA 2FFQA 3I73A 3SJZA 1E0JA 3QPWA 4Q19A 2IYVA 1AK2A 1JXMA 2FPMA 4LY6A 2FU5C 5JCPA 3KUDA 4NH0A 4II7A 1G7CA 4P4TA 4B3DA 1R0YA 2ZRDA 3FFAA 5JWOA 4XWKA 3K0AB 2NIPA 2FX3A 1IY2A 1TNDA 3SJAA 4KVAA 4F4IA 3AVQA 1G3IA 5H70A 1XPUA 2DY1A 2I1VB 1AQUA 2GF9A 2VA8A 5CB8A 2XTNA 4RD3A 1A2BA 1FUUA 2NO1A 4X8MA 3TK1A 2CCGA 2BCGY 1GFIA 4PAOA 2O8CB 1KAGA 4CT4B 1T3HA 1NVUQ 3KXKA 3OIVA 1KDOA 5KDOA 1TPZA 1Z6GA 4NCKA 2OBMA 2EFHB 2HYDA 3BE4A 3S1AA 4YDHB 3QXXA 3QKSA 4US1R 2JIZA 5FPKA 1GOTA 3LAWA 1ZD1A 3KXIA 1JR3E 1KI1A 3A6PC 1UEJA 2AK2A 1VIYA 4IVPA 4RKEA 2QMEA 3FKSA 5JFGA 1BYUA 3IDQA 1DO0A 3FHCB 4HAVA 4TZ6A 3QEOA 5SZHB 3BIFA 1VKJA 5HTKA 2OHFA 2YV5A 1VDZA 1UM8A 1GAJA 2LKDA 4Z1MD 3F0TA 2WOOA 4BWYA 3CO5A 3B7GA 4DSUA 3RWOA 3ZD6A 3AVPA 4YC7A 3QKUA 4BFTA 4D2IA 3DVLA 4QNMA 2P67A 3D3QA 1PJRA 3KQLA 1KOFA 1KAOA 4RJLA 2HF8A 1XCGB 3AH8A 2UZIR 3QEJA 4URWR 3JZAA 2NMVA 4V0LA 1RC8A 4RZXA 2ZTSA 1M7BA 3RLFA 4AURA 4PANA 4B6FA 1EK0A 2EYUA 4TTRA 4A4DA 4LC0A 2QA5A 3UXMA 2WJIA 5IDVA 821PA 3GLFA 4QNRA 2NG1A 4K8OA 3QJYA 5FUVA 1Q3TA 1HE1C 3AP3A 3T12A 3TRFA 4WXRA 1NLFA 1NVVQ 3KL4A 3B13B 1Z3IX 4ASUD 4AD8A 1GZSA 3K70B 4AI6A 3HU2A 1L4YA 4Q4AB 1FPMA 2A9KA 5HCIA 2IWRA 2F43A 1QG2A 3NH9A 4Q1BA 1MO5A 3ADCA 4BRWA 3ZYCA 1O87A 3ONWA 3AB3A 4YXWA 3TBKA 4HYYA 2XSZA 3DPUA 2LWIA 1ZC3A 1BH2A 4JLBA 4AWXA 4EKDA 4LK2A 2HCBA 2ZJZA 3RANA 2J7KA 4E5UA 2WJVA 3VQTA 5C46F 1RIFA 4QGHA 1AKYA 2GEUA 3UK6A 2ZAOA 3I32A 3L8YA 5EE5B 5IK2D 3LY5A 1KK3A 1OKKD 4D0NA 5L3VA 3X1DA 2OLJA 3AKYA 3GLIE 2ODWA 3PEUA 1NI3A 3G5UA 2Q3FA 3LBNA 2OAP1 1AS2A 3NBXX 1Q1BA 4GOKA 2RHDA 4N0EA 2QE7A 3C14C 3AF4A 4C0SA 1OH8A 4HB0A 3R20A 4RZUA 4JLNA 2V1XA 4A2PA 4XSHA 1TTTA 4IDPA 4QL3A 2WJJA 2OE2A 3QBVA 1NBMA 3FMIA 3PQCA 1UDWA 1DVRA 3TVTA 3GJ8A 1E4VA 1S9DA 4UNSA 2YHSA 1K5GA 1VHTA 3AF1A 4M9ZA 1R8QA 4DUGA 1F6BA 1DARA 1P2UA 3PEWA 5TV2A 4TLDA 5AJYA 4QBGB 3FB4A 1IHUA 1ZUHA 3PFIA 1XEFA 1WB9A 1ZM4A 4QOSA 2DHRA 1MKYA 1OE0A 1Q22A 1R0XA 2DFKB 4IRUB 3RAPR 4WZAE 4EPWA 3BXZA 1JECA 4M1OA 3MLEA 2Z0MA 4PHGA 3L2OB 4MUAA 3LW8A 3SS8A 3CWQA 521PA 2WKRA 2ZRKA 1W5TA 1XMIA 3VKWA 4DLUA 1RYFA 2QSZA 1IXZA 3KX2A 1D2EA 3R9IA 2QN6A 4G0NA 4KODA 1X8KA 5L3SA 1Z2CA 5JLJA 4TLCA 1TF5A 3DM9B 3K9NA 4ZV4A 1VMAA 2YOFA 2VP2A 3BD9A 2L0XA 1FUKA 3KJHA 1KK0A 2ZR0A 2O8EA 2WMOB 2GTPA 2C8VA 2H1LA 4IW3B 3EG5A 1B0UA 1OXXK 1U8ZA 1LVGA 3KTAB 4JIMA 2OZEA 4B73A 1Z0FA 4PXAA 4CEJB 2PCJA 2C04A 3IIKA 3V4FA 3KKQA 5H8WA 2AN9A 4QFMA 4QKQA 5B64A 4BUJA 1G21E 1ETUA 1DAKA 3SQXA 2N42A 3K09C 4HAXA 2Z6VA 2ZJYA 1Q20A 2F3RA 3D8BA 4GP7A 1DG1G 1US8A 5EE3A 3HYRA 4FIDA 4HI0E 1HV8A 5B30A 2OO7A 1FZQA 2GBLC 3THWB 2IXEA 4HB4A 2ZJ5A 4I81A 1YZGA 4B44A 2WOJA 1BKDR 2K5UA 5UKDA 1E2HA 3ZQ6A 4C4PA 1PV4A 3TLXA 2ZRNA 3OEHD 4FMDF 3I4LA 1EFRA 2G83A 2ZI9A 1W1WA 1GVNB 2RKOA 4CF7A 1DEKA 1QHHB 4OQFA 4OHXA 1R5BA 3AQ4A 4GI7A 1N6IA 4ACAA 4HLQB 2ZRFA 2WVJA 2ONJA 3SJBA 5HZHA 2VP6A 2IS4A 3TNFA 1ZBDA 5FR2A 1YRBA 3HP1A 2JLXA 3K0EA 4HDOB 1XP8A 1HUQA 1IY1A 4A2WA 1EG7A 1TX4B 3KFVA 2MSCB 2V9PA 3LA6A 2ZU6A 4C0AC 3GLHA 4RD1A 2GVZC 4L16A 4Q03A 5DLQC 3LO5A 1UKYA 4ZDIA 4ABYA 1WP9A 3GMTA 2AK3A 3VR1A 4ZCIA 4EJSA 3K9HA 4MKGA 4A82A 3QSYA 1ZIOA 3OEEA 1TMKA 5FBRB 4A0FA 2BWJA 1XXHB 4M1SA 1YHNA 4E09A 3ICQB 4Q4JB 3CR8A 2AD5A 3MWJA 1JAIA 1ELOA 1OFTA 1KMHA 4E03A 1SXJA 4PFSA 3UATA 2HT6A 4C0QC 5EUQB 3JVUA 3ZIAA 4GZMA 2W58A 1G19A 3WP1B 3U3RA 2PMDA 1GKIA 2QAJA 3RYTC 1XBTA 4DC9A 4EQ6B 4G01B 1H8EA 3R7WB 1CJUC 3A1WA 4H9GA 4JS0A 2NGRA 1TQ6A 2ZI7A 4QHYA 2J5XA 2FSGA 4H1UA 2O8FA 3R8FA 4PHHA 5KDDA 2JCSA 1XTSA 4LDJA 2REOA 2ZS9A 4H1VA 4CZ2A 2Z5FA 3PUVA 2WTUA 4W5JA 4GMDA 1P73A 3K0AA 4G5SA 1G7SA 1XD2B 3TSZA 2QEQA 3GLFE 1N5KA 1E98A 2PT7A 3M1IA 1G64A 4JBWA 2QTHA 4GRAA 2V3CC 4JT2A 3QOFA 4GP6A 3CWZA 4ZIRB 2XXAB 4TMWA 3QNUA 3WNBA 4KJZA 1NSTA 1Z29A 5CITA 1IOZA 4US2R 2AXPA 2C77A 2OCPA 1FFHA 5IF9A 3DDCA 3BH7A 4PAMA 4JVMA 2O8CA 3RC8A 1U90A 2VSFA 4QGGA 1ZVQA 4DWJA 1PUIA 2OFOA 3EARA 3FHOA 4MRPA 2J0QA 4AKHA 3LH5A 1SKQA 2XB4A 4JL8A 3UG6A 5LD2B 5JJLA 2N1BA 2V7QD 3N2EA 5JI2E 1P62B 1ZM2A 2YINC 2GETA 4YMUA 2WIAA 2KB0A 2WAYA 4YONB 5FUXA 1TEVA 3MCAA 2WV9A 4JLAA 5G53C 1CR2A 5GJBA 4DVGA 2ZQ5A 3OIWA 4B2LA 1Y63A 2RGEA 5BW8A 1UKVY 3V00A 3S1AB 2DFTA 5A4JA 1P6XA 4NCIA 1AA9A 3WHKA 5G41A 1YKSA 2XEXA 4LJ9A 4PC7A 4XJXA 1XJ0A 5GJWC 1IAQA 2ZPTX 4Q1FA 1LNZA 2DWOA 3EXAA 2VIIA 3LLUA 2PZFA 2ZJ8A 5KNDA 4MRSA 1RRPA 5FOTA 2UVQA 4UNQA 3RNLA 4PC2A 3EC1A 3NVAA 5FL7A 4Q9IA 3KUCA 1NBME 4B3XA 4B32A 3TVDA 4DDVA 2BDTA 3FE2A 4YMTA 1SVWA 4XD7D 3CF0A 4IFEA 3B9QA 3IUYA 4OI1A 2DFNA 3CRMA 3O8BA 1GNPA 2CXXA 2IYQA 1E94E 4B3BA 2ZR7A 3QXSA 3QQ5A 1E2PA 1GG2A 3W8RA 2WBLC 2CL6X 1OB5A 4PPQA 1QHSA 2J59A 1GITA 3TQFA 1NLYA 1Q1ZA 2QP3A 1Z6XA 2REBA 4Q4AA 1GL7A 1LS1A 1G7RA 4NP6A 2WWXA 3B1WA 1U9IC 1DAFA 2ATVA 2B7BA 2AXNA 4Z54A 1E2QA 2IK8A 3FOZA 3L0IB 4KHZA 2FFBA 3T5DA 5L3QB 1GKUB 1YR9A 4MA4A 1UBFA 2VSOA 1W0JD 1N6PA 1X3SA 1XJCA 4RKFA 2JA1A 5HKKA 1UBGA 3SYNA 2GK7A 3FTQA 2CVHA 2R9VA 5CB6A 2GVDC 1ZM7A 1CP2A 4NPHA 1KK1A 3MD0A 3BH6A 3DL0A 4HLCA 4JKIA 3EZ9A 2QG6A 1OIXA 2ZUDA 4QJ5A 3NDBB 3GJ3A 3M4YA 3GFTA 2ZYTX 4RY2A 1KK2A 2VH5R 421PA 3U5ZB 3ZD7A 2I4IA 2AHOA 1VCMA 3BORA 2QUZA 3QBTA 4P33A 1SULA 1P4SA 2GXSA 3OAAD 4LYHA 4O2LA 5BN3A 3QPUA 1M7HA 2A5YB 2IC5A 2AR7A 4GNKA 5AJWA 4BFUA 4C0HA 2IA5A 1DOAA 3EIQA 4MGIR 4IKEA 3TQCA 1SVKA 4HLDA 3CRW1 2A5JA 4NONA 4TMZA 3B9PA 2BMEA 1R6BX 4IOJA 4R7ZA 4C0LA 1JJ7A 4D4JA 2ZUCA 5B58C 2ZI3A 3LFUA 1WQ1R 4JSTA 1XMSA 3NXSA 3LD9A 2HEIA 2ZJOA 4AG6A 1PVOA 1F60A 5BQ5A 3CZQA 4WIAA 4B33A 4IEIA 2FGJA 1EX7A 1N5LA 1ZC4A 1Z83A 2Y8EA 3A4MA 3AF2A 3MWKA 1B23P 4LYJA 4B74A 2VP4A 4FWIB 3MWYW 1E1RD 3F5FA 2O0JA 2ANCA 1XEWX 3R9XA 4A8JC 4GDFA 3RS2A 2CBZA 3Q3JB 2PX0A 4TLAA 3EX7C 3AVUA 3BAFA 3X1ZA 3WMGA 1D5CA 1G8HA 2VHTA 1E2EA 5KSYA 3AV0B 1G291 3IPYA 4FCVA 1A1VA 1OXVA 1W0KA 4ARZB 1X1RA 3VAAA 5K8LA 1OFUX 2ZU0C 3GLHE 2QQEA 3FHTA 4Q4HB 1Q1QA 3FGNA 4URZR 4EPTA 2ZI6A 4DLTA 4MGYR 3KTAA 2ZJBA 4AY2A 1IN4A 2HDNB 3B6EA 5KHOC 4A92A 3W6OA 4AKGA 3ZS9A 3VU9A 2RMKA 4E07A 4CEJA 3KKNA 4I1VA 2NO0A 4NU0A 1GTVA 4R71A 1BMFD 4BLTA 1ESNA 4M1YA 1SXJE 2BBWA 5FUYA 4XWOA 2WSSD 5C18A 2AWOA 2GEDA 3KDSE 4D81A 4BFZA 2O8EB 4PZLA 3EIEA 3KFXA 2IS1A 3EC2A 1P75A 1OH6A 1OYWA 5EP2A 3P20A 2WAXA 2XZOA 4LHWA 3LQQA 1CU1A 1VCIA 2XTZA 2Z83A 2XOKD 4Q66C 1YJ5A 4DB2A 3QY0A 3A1UA 3THWA 2JLWA 1YZTA 2AWNA 2CE7A 2VSXA 2D7DA 5GADl 2QU8A 3U7FB 2QZ4A 5AUPB 5FBWB 1XPRA 4XSGA 1SVMA 2J3EA 1II9A 4KBGA 4FMBB 1TQ4A 1E9BA 1K6MA 1QHHA 1X8JA 5CM8B 2IS6A 2ZREA 2ZJAA 1KO1A 4JMPA 2PLRA 1YR6A 4Z51A 2NPIA 4DLSA 4F38A 4L9SA 4C7OB 2OCAA 3LNCA 1KY2A 4Z1MA 1ZUNB 3NBFA 4RVCA 1KY3A 1XPOA 1G1MA 2NO9A 3RRYA 1CULC 3E2IA 3NKVA 5EQTA 1FNNA 1G3RA 4M2LA 2JDID 2VRWA 1UFQA 1IY0A 1F48A 3AUXA 5JHGB 1RE0A 1XXHA 2QRZA 2W0MA 1W5SA 2C5LA 3L8ZA 5H1YA 2P5SA 4DDTA 4Q4JA 3IGFA 5DH9A 3O8RA 3EZ7A 3H86A 4IVRA 1AZSC 1HYQA 3SNHA 1U94A 1XB2A 2IYTA 2IYXA 3BB4A 2G6BA 4D25A 1DADA 4CVNA 4ASUA 2YVUA 3ZZ0A 1S96A 4UJ3A 4X8HA 1U99A 2AFIE 3RS0A 2WWGA 4PQRA 1J7KA 1UBEA 4LJ4A 2B8WA 2BBOA 2OLKA 4IHQA 4LV8B 1E2JA 1JJVA 5TXGA 1KMHB 1S0UA 1W46A 3GPLA 4WOPA 5L3RA 2JJ2A 3QVUA 4MQBA 4RCZA 2GXUA 2EW1A 2F1RA 5GJCA 3U3JA 4DCUA 2RHMA 2XNDD 4CDGA 2VTKA 1GWNA 4M4SA 1II0A 3B2EA 3K8YA 2CLCX 1P2SA 1T8TA 1OH7A 2FMXA 1W36D 4ZIRA 2XXAA 1DBSA 2EU8A 2VQSA 1BYIA 2O8FB 5IK2A 3M0EA 2ZIAA 4EFLA 4ZCMA 1OKKA 4B48A 1XEXA 2QI9C 3T35A 4ERNA 2ONKA 3RS5A 2GJ9A 3ASYA 1UKZA 4Q18A 2WPDD 3KKOA 4XH9B 5DNYB 1RPZA 2OXRA 2QT1A 2CMKA 1HT1E 3DMDA 1AQYA 4EPXA 1W2HA 5JWHA 3GJ5A 2D4HA 2OCBA 4ON9A 4Q7JB 1UDXA 3EWAA 3HJNA 4HAYA 1N25A 2QSYA 5JZVA 3ASZA 1E2FA 2NPFA 2GCNA 1UKEA 2BMFA 2ZI5A 2ZUBA 3RABA 1M1YE 4MRNA 3TKLA 2AKAB 221PA 4D26A 2H18A 2YZ2A 4MRVA 4A6PA 2GKSA 3AGQA 5BN5A 1DAGA 1J99A 1KI2A 2F1HA 1Z0IA 3UMSA 4TTQA 1QDEA 1MV5A 3B1YA 1T3LA 4PHTA 1H8HD 1ZUIA 4JLDA 2WJGA 4BZPA 2HXYA 3KB1A 1Q44A 1KDPA 3I5XA 1WBDA 2JASA 3Q85A 2PEZA 3U3KA 3I61A 1NG9A 3SE0A 4BE7B 2ORIA 4DSOA 3ZJYA 2CLSA 2EWVA 3ETLA 1SVOA 4HUQB 4FCTA 3ND9A 3GFOA 4UJ5A 1AS0A 3VHLB 1QHGA 2J9RA 1P3JA 2P0EA 2W6ID 3GJ4A 4MYTA 1E9DA 2JLRA 4HATA 4RZ3A 3EPKA 3EZ2A 3X2SA 4DCVA 1NL3A 2ZRAA 1E9EA 4G3XA 3REFA 2KJQA 3CNOA 3P27A 1FNMA 1G3MA 4MKHA 3WMFA 4WXPA 1E2LA 5FFMA 1UJ2A 4CEHB 4AIIA 3AKEA 3I72A 4LJ5A 2FNAA 1C4OA 2F6RA 3TH5A 4D0LB 4ESHA 3KKPA 4PC6A 1XF9A 4WBSA 4URYR 4JBYA 3SEAA 4PC1A 1G5TA 2F9LA 4QC2A 2R2AA 4KO8A 1EFTA 3I62A 4NCHA 1AZTA 3LXXA 2QNRA 5E4FA 5CDFE 4G5GA 3EA0A 3SDZA 2HF9A 2IL1A 4TL9A 2ZSDA 3UIEA 1PLJA 3BS4A 5L3QA 3QKTA 2CL7X 4XVUA 1V5WA 1LF5A 1FMJA 3P1JA 2XB2A 5AUQA 4I1OA 4UNRA 2ERYA 2W83A 1Z5ZA 1S2MA 4KI0A 4C0BA 1E0AA 1E2KA 1KDTA 1KI3A 1J2JA 4DHEA 4M9SA 2HUPA 3C8UA 3KXLA 4IFBA 4ILEA 5SZIA 4BLQA 3OZXA 4DLRA 1MRSA 1S1CA 4LHZA 5FOXA 1E2NA 5E7JA 5FPSA 3CNLA 3RS3A 1YZLA 3I5YA 3F3YA 1A2KC 4M9XA 3W5IA 4MGZR 2JJ2D 5KPJA 3WXMA 1LS6A 5AJZA 3B1VA 1NG1A 2BEJA 2JLQA 4W7SA 6Q21A 1F2UB 1P7CA 2DYKA 2PX3A 4CGZA 1BO6A 2HV8A 3C5CA 3OEHA 2CVFA 5G3ZA 4V0NA 3U3OA 4BFWA 1CS4C 2YWGA 4D82A 1CJKC 1W44A 4CW7A 4Q48A 4LJAA 4DJTA 3NHBA 4US0R 3SYLA 1VPLA 4C0KA 4DDWA 3CW2A 5CIQA 4L4UA 4OJKA 3DOFA 3QENA 4Q02A 3TR5A 1PLLA 1OV4A 5CJ2A 2QP4A 4GT1A 5HE8A 4W5HA 4Q7LA 3HU3A 1R0WA 1RRCA 4LRWA 4UQOA 1MRNA 1E1QD 5JECA 1IN8A 1HA3A 2P5TB 1UEIA 1N0VC 3HYTA 4KBFA 2FSHA 4A2QA 3QG5A 4HLUA 4MITA 1U0HC 1JXOA 3T1OA 4RCYA 1VTKA 1NVXQ 4PPFA 4NYIR 1GKYA 1VHLA 2GCPA 4C30A 2NOAA 2ZRJA 5FH9A 2OESA 2UZ3A 5IHPA 3N2IA 2DWPA 4NBSA 1MO4A 1TUEA 2NO6A 1KYIA 2FH5B 1Y3AA 1ZW6A 2C98A 5JEEA 4OK6A 3SI7A 4FMCF 5F2EA 4OQXA 4LBYA 1ZCBA 2ZRIA 4KSBA 4YMVA 4JJKA 4ARZA 1Z2AA 1RFLA 4P4UA 3UMRA 2VYFA 2FSFA 1G17A 4Q4HA 4R98A 4XWAA 1R4AA 2PJRA 2ZR9A 4M1KA 4OQMA 5B2ZA 3C41J 2GNOA 5GVSA 1SHKA 5HZKA 4NZYA 3THYB 1TU3A 4JKYA 3MMPA 2B7CA 4U00A 3V9PA 5EP3A 3G0HA 1XXHE 3AM1A 3SFVA 1G9XA 2ODBA 4NYJR 4M1WA 4TQAA 3HDTA 4LHVA 2XZLA 2RGAA 5FTMA 4ITRC 3A4NA 4GL2A 2A5GA 3A4LA 1OF1A 1W36B 3TAHA 2FFHA 1GRRA 4ACBA 1J8MF 1ZRHA 1XTIA 1FP6A 5F3WB 4XVRA 3VU9B 4RFSB 5J4HA 4AG5A 3G82C 2BKEA 4LBZA 5JEDA 2C2HA 3FYHA 3BK7A 2HJVA 2WKPA 3BB3A 5FOSA 1G8GA 4MYHA 5JS7A 2CCJA 2QAGA 1RW4A 4TT3D 2EQBA 2A2ZA 2V7QA 3AF0A 1EWQA 3SZRA 3F8TA 1E9CA 4DT1B 5AJXA 2REXB 4QXAA 3ZGXA 1U2RA 1EX6A 1CJMA 2VLIA 1Z0KA 3ZLJA 1N0WA 2FZ4A 3LVRE 3VR5A 3LRPA 1N0UA 3D31A 4C7OA 3J81k 2QORA 2X2FA 3ZZTA 3KZ1E 2QP9X 4LSGA 3SN6A 3WRYC 3H1TA 4BFVA 2A78A 4A6XA 2GCOA 2XZPA 3BFXA 1GSIA 3FPAA 3A1SA 4BEBA 2OT3B 1E2MA 1EXMA 1VYVA 3Q7PA 2IHYA 3T06B 4Q1AA 3GQBA 4ZO4A 3IEUA 1JR6A 2UKDA 2HXSA 4RD6A 3GJ0A 4FXPA 4LCBA 2GF0A 4XD7A 1OW3B 3AVTA 2MMGA 3VNVA 3U44A 4URUR 1VG9B 3ECCA 2QENA 3GJ7A 3OESA 2HYIC 4URXR 4QBFA 1P2TA 3AF3A 4JLPA 4ESVA 2GA8A 3CH4B 3W3AA 1KI8A 1NMXA 2ZJ2A 1CBUA 2GZHA 4OI4A 1UAAA 4MYCA 4NYIQ 1KSHA 4A0GA 2YYZA 3OF5A 5KU1A 4GPTA 2IF0A 3VFDA 3O8CA 2WWHA 2WICA 2QPOA 3KKMA 1XMVA 2Q6TA 2IYYA 3OE7D 2RGNA 1DTSA 2HT1A 3DZDA 3T5GA 4ZDKA 2OCYC 4RD2A 4KYUA 3CH5A 2QTFA 4A0RA 1W0JA 4IVQA 4DBLC 3MJRA 2CHGA 2WSMA 4TL6A 3MAAC 5KNCA 1IQPA 2J7PD 4Y0AA 1M74A 2A3RA 1II8B 3W6NA 1KZ7B 2ODNA 4QBIA 1Q57A 1VG1A 5C4GB 1P61B 4NYJQ 2N46A 5DE3A 5CLLA 4WZBE 2ZE8A 5LD2C 4HB2A 4TYWA 4RFVA 4JLKA 4I1UA 3PENA 2I3BA 1I4DD 4JT4A 3OAAA 1KO8A 5FI1B 2BBSA 2WHXA 1TQDA 1QHXA 1Z0JA 3U3MA 3B60A 5CYPA 4TTPA 2QROA 3B78A 4M22A 1DAMA 2OV2A 4L9WA 4OBEA 1XTKA 4KITB 1XEXB 5G3YA 4F93B 4D4KA 2X2EA 1COWD 4QBHA 2XX3A 3LX8A 4LPKA 2DPXA 2GZDA 121PA 4GOJA 2IUUA 2PEYA 3W5JA 4BEJA 4A36A 5DI3B 2NO7A 5G40A 2GXAA 2C78A 2B6HA 4AKIA 3NC0C 1E1RA 3B85A 5EXPA 1N6OA 1TQ2A 4KSCA 1IN5A 2X1VA 4HUQA 4IOKA 4DEXA 1R10A 8OHMA 2IYRA 2O8BB 5TMPA 4PC3A 3CONA 4TLEA 3MGCA 5IRCD 5F9HA 3ZQJA 3T15A 3ZH9B 3X1WA 3DOEA 2QBYB 3U7EB 5JRZA 3CX7A 5E95A 4GMXA 4POAA 5KUTA 5E7MA 2ZITA 4LHYA 1ZCAA 1Q21A 4CEHA 3P4XA 4MGKR 1R7RA 1CTQA 3QUSA 1XRJA 4C9BA 2GZAA 3FWYA 4OK5A 5BYJA 1P9WA 3RS7A 2IXGA 4GFDA 3W9YA 3VR3A 1P5ZB 3U6BA 1QHNA 3RWMB 4ZI3A 2DR3A 1JAHA 3Q9LA 3HR7A 5TB5A 2D2FA 5EE0A 5DI9A 4BLSA 4M53A 2P3SA 2BCJQ 4EPRA 1F5NA 1BMFA 1XTRA 5J5CA 4MKIA 1OJLA 2WSSA 4LJ8A 3I3SR 2YOGA 2D3WA 2IXFA 4EAQA 1YQTA 2FPLA 4RSGA 4C3ZA 3THOA 1SVSA 2P6NA 1YZKA 4L5BA 1EFCA 4KV9A 2XOKA 3A1TA 3A36A 2R6AA 3NEYA 1IXRC 4KFTA 3RRNA 3SC3A 4LC1A 1EFUA 4Z8XA 3GLGB 2GDJA 4EFNA 2R65A 4KYIB 2VHJA 3EA5A 5EXXA 4ZDWA 1F2UA 1K8RA 2CEAA 2GHIA 5GVRA 5LDDC 4FN5A 3L0OA 4LWZA 4PSAA 5HCNA 4NDZA 3SQWA 3T1TA 1HEIA 5E7IA 1ONBA 1Q0UA 3NH6A 3QXJA 4PSKA 4DIDA 4BLOA 1G20E 1NJFA 4IJMA 1W48A 3VMFA 3UWKA 4LX0A 3K0CA 3T1VA 5FBQB 1EGAA 2OG2A 1ZIPA 2CJWA 1ZNWA 4PPGA 3WYFA 1Z06A 3IO5A 2B92A 4HZIA 3TGPA 2Q9AA 2IEYA 3CKLA 2BMDA 5CJPA 2WWYA 2PH1A 1WA5A 2EFGA 1OXTA 1WMSA 2R44A 4LV6A 4CT5A 2BC9A 3E1SA 4TMVA 4XTCS 3WHLA 4Q00A 3MJHA 2Q0HA 2JDIA 2D7CA 3BH0A 3L0SA 3SR0A 4MDFA 1RVDA 4ZDJA 2ZEJA 2O0KA 1VCNA 2QQ0A 1NKSA 2OFWA 1S8FA 2BOVA 4QRHA 4FW9A 3QIAA 3EASA 1NN0A 1ZNZA 2PT5A 1D2MA 1TF7A 4DRZA 1NKTA 1KKMA 2YWEA 2G3YA 3SBDA 3K0FB 1UADA 5B57C 1E0SA 1U81A 4EPYA 5FTLA 1G3QA 5FTJA 5CDFA 4TLBA 4JLVA 2YC4C 4U5XA 1SGWA 2IYUA 4CIDA 3THYA 2QGNA 2ZYVX 4DXAA 4Q9HA 2F9MA 3UWOA 3A1VA 3WNCA 4P4SB 1G41A 1BOFA 1GDDA 5E3HA 3M6AA 1HY3A 1SQ5A 1ZM9A 2O52A 4LI0A 5AR1A 2ZS8A 1PLKA 2Z4SA 3U4QB 2LKCA 1UF9A 4DIEA 5CK4A 2R6GA 3CPEA 2XNDA 3TSOA 3VKHA 1NSFA 4OI2A 3HR8A 3VR6A 1HQYE 2ZRMA 3BWDD 3FMOB 4X8OA 1PZNA 1RRFA 2E9SA 5TARA 3IO3A 3A37A 2PZGA 3FDIA 3DEFA 4DKXA 5HE9A 3WBJA 2FWRA 2FA9A 5FPYA 1WF3A 3IBGA 1TU4A 1AM4D 2KBFA 3FVQA 4RFSA 1KMQA 3CRRA 2AL7A 3CX8A 5DISB 1LY1A 2F55A 2Z4RA 4B34A 2WPDA 3KJEA 4XIGS 2RGDA 1FQJA 4PR0A 1VYUA 2P6UA 5FOVA 1JI0A 3AP1A 1DS6A 2RGGA 2BBTA 3C5HA 1CIPA 2QPAA 4NE2A 2CDNA 2PL3A 3HWSA 4DT1A 1GNQA 4JZKA 3K1JA 3MUFA 4QHTA 4Q9KA 4BQSA 1Z8FA 4CEIB 1KI4A 4LBVA 2OAQ1 1E79A 4KFRA 2VHUA 5FBLB 2MSDB 5P21A 1CF4A 3RSOA 4B43A 1E9SA 4A8JB 2ORWA 4DLVA 2LCFA 3IILA 4TSFD 2JATA 2H5EA 2QAGB 2W00A 1H8HA 4EFMA 4QG7A 1DAEA 4FMDB 5JBQA 3NTUA 3TUZC 2ORVA 3SYKA 3CPHA 3CF6R 2CNWA 2IYZA 1D9ZA 3EWSA 5ELXA 4Q9JA 2HJGA 3BC1A 3GEIA 1YU9A 2X8AA 5TDHA 2W6IA 1HQCA 1KNQA 2YOHA 3GJXC 3IBYA 4I99A 4LGMA 2FDCA 4EUNA 1IXSB 2IS2A 2C95A 5CIWA 4O25A 2EYQA 4V0MA 2B8TA 3RHFA 1ZP6A 3EAQA 2GCOB 2CK3A 3UG7A 4EJSC 4JL5A 2W6JD 2WJYA 1I2MA 3DKPA 3Q5DA 3QI2A 2D06A 1IBRA 1JQLB 4IDQA 3B1XA 4NMMA 4M1MA 2IHBA 5BN4A 1IM2A 3C15C 1SXJC 1XZPA 2R6CA 4KCGA 1XDBA 3KQHA 5KO2A 4HAUA 1RJ9B 2QTVB 3OHMA 3U44B 1JR3D 3I92A 4TYQA 2GBLA 1QHYA 4KXFB 2BJWA 3OIYA 4BFXA 1VG8A 5J47A 2WM9B 2YKGA 2OUKA 3R9WA 2PMKA 5KPDA 2QMUA 1J90A 2HCJB 3PVSA 4GZLA 4UXJA 3ZVMA 3I1FA 1NNEA 1IN7A 1XWIA 3K9LA 3PIRA 1E2IA 4Y0VA 3TAUA 4B3CA 2IX3A 1YZUA 4Z8YA 4KU4A 1DG3A 2C9YA 2ZAMA 1N6NA 3TW4A 1II8A 2G0TA 3T61A 4OHZA 4QHSA 2ZXUA 4Q01A 2QMOA 3B82A 3ND8A 5EJEA 2C96A 3U6KA 2YWFA 3IIMA 4WA7A 3LV8A 3WRXC 3AVOA 4V02A 5EZ6B 4DLYA 5FR1A 621PA 4D4MA 3GP8A 1T5LA 1P72A 2JJ1D 4TL8A 3KQUA 1KI7A 2QL6A 4OQNA 4HDCA 1CR0A 2WWIA 2WWWA 3KJIA 3U61B 3GFPA 5EXSA 4R2IA 3CF2A 4PPNA 3JZMA 3PG5A 1DELA 4HB3A 5DHAA 3EPHA 2RCNA 1NN5A 3DKVA 1MABB 2GJ8A 2ZS7A 4MDEA 5DN6D 4UXHA 1G5RA 1T6NA 1Z22A 1ZU4A 1E1QA 1KJYA 1YRAA 5DI3A 3AGPA 1YR8A 3PJRA 2FFAA 1XZQA 3RSLA 1CR4A 3NHAA 1WCV1 2FG5A 5JS8A 2AFHE 1WXQA 2O8BA 5D3QA 1KSGA 4F4CA 3HPQA 1T4GA 3B5JA 4A1FA 1E79D 3GEHA 3CUEF 4EDHA 3E5HA 1DE0A 1OXSC 4UXIA 1L8QA 2QBYA 1FMLA 2Q9CA 2ZROA 4BZXA 4DCSA 5EXTA 4D6PA 1AS3A 4TMKA 1XU4A 5LB4A 3PITA 1OB2A 1I4TD 4M8NE 1EESA 2BJVA 1L4UA 2WMNB 4IDHA 1OH5A 1V43A 2W0SA 2CNWD 2ZRLA 3CRVA 3GCGA 1N6KA 4JYCA 4Q1EA 4B47A 3CPJB 3CX6A 1G8FA 3KJGA 2J0VA 4TN1A 3NG1A 4CYMA 1S3GA 2QM8A 5FBVB 4LZZA 3THXA 2NQ2C 4F91B 1W2GA 1NVWQ 1NMZA 3DZ8A 1Q1EA 2J41A 3U2QA 1M2OB 1TEXA 3CNNA 2CK3D 3W3ZB 3K70C 4FI3C 3NWJA 4LBWA 3REGA 1N6RA 1AGPA 1U98A 1Z6AA 3WP0A 1TUIA 4Q4LA 4GSYA 3IQWA 1J70A 2IYLD 5C1BA 1BS1A 4UKDA 1DO2A 3ZVRA 1E99A 2VBCA 1DPFA 3W34A 5BWMA 1G16A 4I4LA 2FE4A 1QVAA 2IW3A 3I8XA 5J4YA 5A0FA 2X77A 3GLGA 2WKQA 5J40A 2GILA 3VR4A 3VKGA 2O0HA 1N2CE 1OSNA 1S9HA 2CHVA 4TT3A 4NCJA 3BOSA 2Q9BA 1T8UA 2D62A 4XTRA 3AKCA 4NL4H 3K0CC 5KSZA 1D8TA 2F1JA 2GXQA 3IHLA 4LOAA 2ZRHA 1K5DA 4OHYA 3L43A 1RKBA 4JVNA 4FINA 3SFZA 4I1SA 1H65A 3PUXA 1AGRA 1OLOA 2FZLA 2RB4A 2RGXA 4UNPA 1Z63A 1O3YA 2G77B 4JL6A 2XTMA 1IJEA 1KNXA 2OBLA 5DHFA 3D6TB 3VR2A 1ZNXA 3P4YA 4DDUA 1NN1A 4F4JA 1QG4A 1LV7A 1NRJB 4MYUA 1QBKC 3LX5A 4YDSA 2BHRA 4LHXA 5J4LA 1LB1B 1E3MA 2IT1A 2CJWB 5KDLA 4E22A 1OPXA 5JJIA 4IOMA 1Z08A 2ZE5A 3QKRB 3TUIC 3N5CA 1U9IA 1OHHD 1OIVA 2ZSAA 3TW8B 2RGCA 3DM5A 3QVVA 4KLZA 5KYKA 1XCMA 3D7MA 5BXQC 3U7GA 4AC9A 2MMCA 1NMYA 3WMEA 5C4MA 1R5NA 3K0FA 1VG0B 1T91A 3PEVA 3AVXA 3KB2A 1GL6A 2NZJA 1L2TA 1X6VA 2GJKA 1G8PA 2JLVA 3PEYA 3OE7A 1T3SA 4OYHA 1NIJA 2ZE7A 3BERA 4P4SA 4N0DA 4ZI2A 4KVGA 2J87A 1CJVC 3MWLA 5K8TA 2KSQA 2OSBA 4HSEA 1W36C 2W2TA 2ZANA 4V0ME 2J0UA 2ANBA 3FMPB 4S2EA 4YLGA 5AJVB 3W6PA 3U4QA 4JLMA 3LDAA 2JLUA 3L0PA 4O3MA 1G4UR 2D2EA 2B21A 4MUBA 1GM5A 4P32A 2GJSA 2R6DA 2J7PA 3CIOA 2HLDA 3CZPA 4MRRA 4PQYA 4QM6A 1XTQA 4MKFA 1T0HB 4N3NA 2PJZA 1NF3A 2ASEA 2WWFA 3BFKA 2GAOA 1FX0A 1TADA 1Z07A 2IUSA 2MSEB 3H2YA 4G5RA 1BIFA 2JIZD 4J0QA 1I4LD 2O5VA 1CEEA 3PV0A 5SZKB 3MG9A 2I1QA 4V0KA 1IJFA 2P65A 2CLDX 5FTKA 4C0JA 5KNBA 4R2HA 3MFYA 4BLRA 1LF0A 2VPPA 3FKSD 4B3FX 4JSYA 3DHWC 5FL3A 3T1QA 4L15A 2BEKA 1XD9A 3AEZA 1G4AE 1M8PA 1KIMA 1ZYUA 2A5DA 4TZ0A 1GNRA 4K46A 1HE8B 5D3MB 1XD8A 1CXZA 1XTJA 5A5GA 1GL9B 4CEIA 1COWA 3VNUA 3TIFA 1E4YA 1SVLA 1D6JA 3H84A 3RRZA 4OL0A 4A8JA 1A82A 3ZZUA 4B71A 2YNMA 4TL7A 3A8TA 4ZKDA 1GIAA 1KO4A 1W4BA 4Q9LA 5DIFA 2PZEA 4RD0A 4CRWB 1ZM3A 1XX6A 2F1IA 3CR7A 3QF4A 4JVLA 1KI6B 4B75A 4TMTA 1VCOA 2DB3A 4B35A 2FOLA 5EP1A 1W47A 1FQKA 1FOEB 4MH0R 5EZ5A 1XJQA 1MO6A 4LPSA 5DGXA 4OI0A 1QVRA 1QHIA 3AUYA 5ANRB 2EVWX 3RDPA 2YJTD 1M34E 4DLWA 4ZCLA 4RD4A 3OIUA 2C9OA 1KGDA 4D0GA 3Q72A 2ZVQX 3RC3A 2ZRBA 1SZPA 3GLIB 4BECA 4JLJA 4EQ6A 1F2TB 1OFHA 1UPTA 2CCKA 3SHFA 5AK0A 3C4JA 1JPNA 2CHQA 3EIHA 1JEEA 1U0LA 3L82B 4K81B 4LV5B 4YXWD 2XSZD 4LJYA 2TMKA 1J8YF 4M9QA 4TYPA 1KI9A 4GBMA 1E69A 1RJ9A 1E2GA 4NHOA 2VEDA 3V4RA 1ZAKA 1ZJ6A 1E32A 3UKDA 1CLUA 1HURA 1W4CA 1MH1A 2KI5A 4LJ6A 1NP6A 2FSIA 2NZ8A 4IDNA 1ZD9A 2EFDB 3LLMA 3QF7A 3GEEA 3Q8XB 1ZINA 5JWRA 3WYGA 1EWRA 1UBCA 1SKYE 2FV8A 1VECA 1NLZA 4G5QA 4PZYA 3UMFA 4JLOA 1E9AA 1XFAA 4OKSA 2G1KA 3Q7QA 3BB1A 2VHCA 3IQXA 2ZETA 4HZUB 1D9XA 2RAPA 2H92A 4EIWA 1JNYA 2QE7D 1I2DA 2EFEB 4IXNA 2DWQA 2F7SA 2W2XA 3R8CA 4LYFA 4U02A 4Q21A 2O8DA 2FGKA 2C99A 3TMKA 2YWHA 3U60B 3W90A 1Z0DA 2FN4A 4Q47A 1KSFX 1NBMD 1R8SA 1Z28A 3CLVA 1S4QA 3GJ6A 2JLZA 3ZVLA 4BPBA 4X8LA 2HLDD 3LQRA 5LB2A 4W9MC 1Q3HA 3VTKA 3LWNA 2DBYA 1G8YA 3ADDA 2G88A 1KSJA 2PBRA 4DUGD 1Z0AA 3JVVA 4WZ6A 5FUWA 4QJ3A 4UNNA 4B2PA 1MABA 1VIAA 4A0HA 2H8KA 2DFLA 3EW9A 5K8UA 4AYTA 4B3GA 3NDPA 5JSZB 3GLGE 2BM0A 2WIBA 3UPUA 2E87A 3C16C 1JBKA 1RZ3A 2QRNA 1S1MA 3AVWA 2V1UA 1T0JB 3CRQA 2GK6A 2VHQA 4AYWA 1U8AA 5HPYB 4C2UA 4D4LA 3K0SA 4D80A 2BM1A 3VHXA 1WDTA 5BYKA 3I8SA 4QGAA 3HU1A 2VF7A 4QGFA 5FOUA 1IN6A 3A58B 3RVBA 5FTNA 2IF2A 1XEWY 3TJZA 3ZDQA 4AYXA 1X1SA 1GUAA 1VYTA 2GWHA 1PUJA 3NIBA 1E96A 5HR5A 3BJIC 1ZU5A 2FJUA 2Q21A 1XMJA 3MRSA 2AX4A 2QPTA 2QT0A 4F7WA 2KE5A 1JB1A 2CL0X 1E9FA 2GRJA 1CKEA 1TF2A 1W4RA 1KDRA 5FOWA 4DZZA 4C2TA 4HAWA 4OHWA 2Q3HA 2JEOA 2WZQA 1N5JA 1NN3A 1P9NA 1Z6TA 3EZ6A 3QXCA 5FPHA 2XGJA 3AVVA 1FL9A 2IUTA 1SKYB 2ERXA 4HDQB 2C9CA 2P6RA 2VL7A 1R5OA 2G9NA 3AP2A 3IIJA 1CJTC 3THXB 5JRJA 2P2LA 5JHHB 4Q7MB 3QPVA 1NIPA 5JMTA 3QKSB 3U7HB 1LW7A 4QJ4A 4NKRA 1OT3A 1KO5A 1C9KA 3T34A 1EFRD 1T9HA 4M0LA 4NTZA 4HAZA 1D2NA 1N6LA 4W5WA 1QRAA 4PHFA 3N70A 2H7VA 5LPNA 3EPJA 1U8YA 1AIPA 1IONA 1E2DA 5H68A 4DSNA 2OXCA 1X8LA 2KBEA 1FP7A 2OILA 4PTLA 5TVKA 4M21A 2H57A 4LJ7A 4V0OA 4O0MA 4PO9A 1EFHA 2ZI4A 3BGWA 4TSFA 4YMSA 1R2QA 3LXRA 2FPKA 4PSVA 1FTNA 1KTVA 2E1RA 2G0NA 2VF8A 4IOLA 3OEED 4AKEA 1TAGA 5FPTA 3QXHA 5EE9A 4RZ2A 3E70C 5DO9A 1KJZA 4L8GA 1G18A 1OYYA 2IYWA 1N6HA 2QY9A 3GLFB 3X1YA 4IDOA 5JCZA 1SXJD 2V54A 3ADKA 2RH5A 4PO8A 3GD7A 3ZIAD 1N3BA 2Z43A 4DLZA 4F92B 3QKRA 5IT5A 3PXGA 4A9AA 4HLUC 1H8ED 2F3TA 2A7QA 2IBMA 1E6CA 4NCNA 4B6EA 2A30A 2IYSA 2GJAA 2XNSA 2ZSBA 2W6JA 2F43B 4KFUA 5EP4A 3SU8A 3KQKA 2AKYA 4TYYA 2CE2X 2V55B 3FKQA 3FMFA 4OJQA 1CRPA 1NY6A 3CB4A 1X86B 3IPXA 2ZM5A 5F98A 1YVDA 2V6IA 5FI0B 1M7GA 1OXUA 1T5IA 2ODEA 2ZSFA 3OFNA 4WW0A 1AJEA 4DEYA 1SHZA 5EUMA 1JR3A 1G3UA 3IEVA 1P9RA 4V03A 3B8HA 5C2JB 1R0ZA 4PX9A 2ATXA 4FMCB 2V6JA 4OHVA 2D74A 5J4VA 2Q3MA 2C03A 1JPJA 1WE2A 1YZNA 3BFVA 2VP5A 3LBHA 3NC1C 2PLFA 4Q5IA 4BZQA 1HT2E 1Z47A 2FF7A 2NTYC 1YE8A 2BV3A 1KHTA 3WBKA 5J4KA 1G7TA 3NBYC 3PUZA 3BRWD 4WVFA 4U7DA 5CM9C 4Q7KA 1CRQA 4BFSA 2QM7A 2FEOA 3LBIA 2J0UB 4JVSB 5KTYA 3NBZC 5KOYA 3QE0A 3ICEA 1AN0A 1E9RA 4BFYA 2J1LA 3TUJC 1RYHA 3O47A 2JJ1A 2YC2C 2BVNA 1G6OA 2VP0A 4KFSA 4M1TA 5KSPA 3VX4A 1LFDB 5D3MA 4OQLA 1FX0B 4G5OA 4LUCA 1WRBA 1ZD8A 1QZXA 4DCNA 2ZVPX 2J0SA 4PZZA 1MO3A 2QAGC 5CK5A 1KZGB 3DO6A 3IHWA 4ZKEA 3MSXA 1JEDA 2J46A 5DN6A 3HPRA 1KJWA 4PO1A 4TQ9A 5AUOB 2ZYWX 1U0JA 1MR3F 3LW7A 721PA 2OEPA 3PUYA 2OBNA 1JALA 1L7VC 3H4MA 3DMNA 1XNJA 2W2VA 4Q1DA 5FL7D 4TMXA 4GOXA 3P26A 1GILA 4PAQA 4NYMR 2ZSEA 3WYAA 1KI6A 3ZS8A 4KLNA 3X1XA 3WY9A 4DLXA 5L3SB 1ZNYA 2WJHA 4DB4A 4FCWA 3AVYA 1HH4A 2GEVA 2OFXA 2GESA 2ZE6A 5CYOA 3ADBA 4TQUS 1ESMA 3RS4A 2AD1A 4YQFA 3K70D 3LVQE 4OK3A 1CR1A 5TY0A 3QF4B 1KKLA 3EPLA 3EZFA 3GLIA 1WBBA 3PR1A 5CLQA 1F2TA 2XJ4A 3RRMA 4P0TA 4WAUA 2PCLA 4JBXA 1OIWA 1GRNA 4PQFA 4B2IA 4LYAA 2R62A 1GP2A 1RRGA 1YZQA 1F3OA 1P2VA 1QF9A 4P31A 2QGZA 5SZJA 4DCTA 5F9FA 2JLYA 1GRQA 3PUWA 3H0KA 5HKKD 2XITA 3PCRB 3TSWA 2R8RA 4QM7A 2BKUA 1G6HA 2G1JA 1W49A 2FEMA 1E0KA 2ZRPA 3CM0A 1LTQA 3SOPA 2R6FA 1US8B 2RGNC 1YR7A 4B76A 2SHKA 3VX3A
chains in the Genus database with same CATH superfamily
4QPGC 2OXEA 1NA1B 5M04A 2Z5WA 4B45A 3ESXA 2VMCA 1PG2A 3DBRB 2IYFA 2J7UA 2ZRGA 4OOFA 4WZAA 4OHRA 5I48A 4Q3EA 4P3YA 4RTMA 1EAYC 1C57A 2HSEA 2WRMA 4UW2A 4C4WA 1A4RA 2ZSJA 1US3A 1G9CA 1YBMA 2MOKA 1QQ6A 1AKEA 2CYCA 3X29B 2ZUGA 5JSZA 3IT1A 5BNFA 1C1YA 1E6MA 3RW6A 4NHEA 3AL0C 3QRQA 3V8PA 1A7JA 3FFWA 2HBUA 4HEA9 3FFBA 4RH3A 2KWIA 4TVSA 5AWFC 2ZT7A 1NUSA 1T9XA 3QFWA 1W0KD 2Z5GA 3EG9B 4FD2A 3VD9A 1P1BA 2ZH6A 5A6WA 3HB1A 3O1RA 1PV1A 1DTWA 1GXLA 1IM8A 3UUFA 1AHHA 4LF2A 2CMHA 4C8LA 1QYCA 1SD5A 4HADA 1KAGA 3IFEA 1TPZA 1H73A 3EGEA 5BY2A 3BE4A 1HV1A 3QXXA 1CC1S 3QM1A 3GZJA 3A6PC 2QRKA 3DWGA 2NV0A 3I6MA 4H17A 3FFTA 4EJRA 4HPWA 5SZHB 5C81A 4OL9A 3EDOA 3V80A 5DBEX 1X42A 4F67A 3NFRA 2ZE2A 2NUAA 1HMYA 3QV2A 2XYGB 3KQLA 1RUG3 1XCGB 1DQ4A 2UZIR 2VAPA 1PIV3 1V6NA 1HDZA 3GFYA 4TN7A 4CXYA 3HXQA 3AKTA 1TQLA 3PDNA 5FPQA 5FUVA 3JSAA 1T0PA 3PFOA 3BILA 1ZMTA 1OUXA 3LUBA 3QPAA 1IY9A 4RHXA 3HU2A 3FLTA 1JIXA 3ZYZA 4TVAB 3U37A 2BUKA 5HQLA 4J43A 2UXDJ 1RS0A 3CD6S 5BYBA 1O5JA 2O2ZA 5D4PA 2BOAA 1OI2A 1BH2A 5G1PA 4JLBA 3ZN4A 2DUWA 5GZ3A 2HAIA 1KP9A 1T2NA 3DXFA 3UV6A 3TSYA 3Q87B 2PX5A 3IP5A 4FEYA 1RUE1 2GEUA 1JJ4A 3S99A 3D5MA 5G0UA 2VUJA 4P5HA 4DA6A 1F5AA 5AW7A 5DGAA 2R7SA 1CEYA 2JGMA 1D9AA 2B8QA 1ZN2A 3C14C 4DB5A 2BMVA 1CDEA 5CXTA 2VA3A 3RAJA 4O59O 1UDWA 4EBFA 1SUIA 1RUF3 2OV3A 4LOHA 1VB4A 3AYDA 3GAMA 1F6BA 3LA8A 5FUMA 1EK6A 5AJYA 3R5KA 3E3MA 1OE0A 4LDNA 5EI5A 3T3HA 1ZH2A 5IYZF 3PNKA 5FI5A 4ZVUA 5IT9Y 4DLUA 3PNLA 2FY8A 1RSCA 5DUVA 1Z2CA 4DU8A 1EE9A 2QA4G 2GSDA 5A6VA 3BD9A 2X5OA 5IJ0A 4KDEA 1RB0A 4UFPA 4PXAA 5IM0A 2F4VB 3NWGA 5C2CA 3ORQA 5CPBA 2VCBA 1LDBA 1PSDA 1A50B 3Q2KA 4QULA 2EAKA 1MOPA 2N42A 2DETA 3A9RA 2PSZA 1L3JA 2ADEA 2VJCA 1ISRA 1NKVA 1N88A 3L4SO 4DBLE 4C90A 4V0RA 4LKEA 1ORTA 2C1EA 4X20B 4EI7A 1EFRA 4KAAA 2M9MA 3HV0A 2RKOA 2LM3A 4CIXA 3WQRA 2ZTLA 3JATB 3QEMB 4W4TA 1V5GA 5ETPA 5AO9A 1UXHA 1Z37A 5FR2A 3K0EA 4RXTA 4MICA 2HURA 4PJYA 2GHWA 3SYZA 2F9DA 1G4CA 5EJ7A 2JSXA 4HRVA 5HVFA 1UZ0A 1QOQB 5FNVA 2NSBA 4I55B 1U1DA 3QFCA 4BKOA 3S40A 1KMCA 5JVGQ 3MWJA 4FKBA 1ZGCA 3LFIA 4HMOA 1LPSA 3JVUA 4QXKA 4X4VA 3BA6A 2W58A 3ZIAA 3JQAB 5FY9A 2JAXA 5JT1A 2HN9A 1TT5B 4LDQA 2JANA 1JNZB 2K1RA 3F47A 2DGDA 5KDDA 1HKAA 1YGYA 3VBOC 4X7PA 1X7GA 3RU2A 1F1BA 4W5JA 2G7MC 1B64A 1IY8A 1XMPA 3PMEA 3E1GA 2PMCA 2XXAB 3C24A 2Q0XA 2AXPA 2C77A 3H7HB 4DZGA 1JZQA 1G7CB 1SC1B 1V8ZA 1J7JA 3HHNB 2VNHA 3OLBA 4WYLA 1J2YA 4HWOA 5TEWA 4ESEA 3EXYA 4QU8A 1S10A 1VC5A 4ISBA 1NT4A 3WWPA 1ND5A 2RGEA 1S7HA 4CP1A 5BN5B 2FVSA 4NCIA 1C4KA 4CM0A 1RR6A 2WKSA 3FCAA 4KR7A 3IM9A 2AFIA 2CWSA 2ZYIA 5KYUB 2Q0SA 4WVWA 4M9UA 4ZV9A 5LLDA 4AJIA 1LULA 2B20A 3TVDA 1FRVA 4F71A 4DDVA 1RRKA 4YMTA 5KTOA 4PWUA 3B9QA 1G66A 1ZJZA 1GNPA 4NDNE 4JHLA 4N53A 1UU5A 2CL6X 4LSMA 5B2GB 1IKXA 3ZBTA 2OMOA 1XN4A 3VC1A 2X5KO 4DYHA 1QTRA 2UXCF 2DPYA 2JFQA 2ATVA 2XCRB 4YMIA 3RI3A 4IIHA 4XIJA 3IXMA 1T6YA 5KFRA 2JLGA 5J1PA 1UBFA 3SAJA 3SYNA 3L8CA 1M6WA 2A0FB 3F9IA 4OXKA 3P9ZA 2AN1A 5AH0A 2HSWA 2YCBA 2OGWA 4PZUA 3NNJA 2AHOA 4P33A 3T1HF 5ARBA 3D0GE 5RUBA 3C3BA 4F9FA 3I5MA 2A1BA 4IKEA 4QXHA 3DHXA 2BOPA 4PCUA 1HLPA 1WQ1R 3LFUA 4WM7C 5LA6A 4R4XA 1V3ZA 1Q0HA 3DGPB 2Y8EA 1O6FA 1J58A 5H02A 5B7PA 2QWXA 4DF4A 1CZOA 1KY4A 3QZUA 1RFGE 1WDWB 4GWIA 5DXDA 4OIMA 4X66B 3O5TB 3BAFA 4EMTA 1VDHA 4G0ZA 5KSYA 2POCA 1G291 2O2XA 3WLQA 3A2MA 1OXVA 1JKJB 5J2UB 1XEZA 1WXWA 5I7SA 4CCNA 1XR5A 3C6XA 3CCLS 1FNZA 1UXKA 2ZOFA 2HDNB 4A4JA 5GAEU 5CH3A 2Y6LA 5F1PA 3ZS9A 3D3JA 1K6EA 1OPZA 2X3YA 2RHSB 2AWOA 1NYQA 4D81A 1JSRA 2D00A 3TL3A 3O1LA 4J9OA 2HZAA 2ZEYA 1TMF2 3VAYA 1JFRA 1FZTA 4ANEA 3D0IE 4Q4V1 4KR3A 4WOCA 3ZZZA 2DRAA 4QG3A 2FWAA 1UMJA 3FRIA 4TRJA 2RBKA 1S7GA 2JFKA 1XWFA 3RAXA 3SSQA 3FNIA 1QIEA 2O6LA 4CHGA 3SYTA 1HRI2 1EP1B 1PMHX 2VJNA 3H98A 1H9WA 1RNLA 4CMHA 2NO9A 4BU1A 4P7VA 2ZB3A 1G3RA 1JTVA 1UFQA 1YNSA 2QRZA 1X1BA 3ZDVA 1BE0A 3BG5A 3NT4A 1PM4A 5BYRA 3T0BA 8AT1B 1U99A 1LJLA 1X70A 3M30B 3EQ7A 1LFPA 2HS3A 1ND3B 3L9ZA 5K4AA 1N77A 1VXOA 5AXNA 3GPLA 3INTA 4MQBA 2H4HA 1RKJA 4RMGA 2RHMA 5JS2A 4TS9A 2VTKA 2X23A 3ZWMA 3SSRA 3K8YA 1T8TA 4UTRA 4AUNA 1O96A 3KYJB 4ZIRA 4RIIA 5FDFA 4MA5A 4ER7A 2D5HA 3CVXA 4YHBA 3OPXA 4Y3UA 5F2KA 3AM4A 3LW5C 4ZVEA 1L9XA 3IAAA 2P4UA 4KNWA 4PG7A 3MEKA 3EEFA 2BFMA 2ZJ4A 5ALGA 3STVA 1SFNA 4CMJA 4LQLA 221PA 3CC8A 3NLLA 4R0NA 3FRZA 4TTQA 3SE7A 1WCWA 3PHLA 3KB1A 1FBTA 1VB5A 4CT9A 1XRRA 4YVFA 1SVOA 4IOCQ 2H3EA 4MEBA 4DV3B 4XFCA 1EAH1 4UVIA 3AR2A 1EUCA 3U13A 1XRMA 3VKMA 4R31A 1L7AA 2WFMA 1V5EA 3W8PA 4E4RA 5AKKA 3WMFA 3GK3A 1MVEA 1A69A 4AXJA 4F12A 5CCMA 3TQEA 2V5DA 4DV2J 4PC1A 1F3VA 3FB1A 1SBQA 3TBDA 1Q7BA 1UYPA 4QYIB 5IJXA 1OC1A 2WUVA 5A3RA 4C3LA 2ZSDA 4E51A 1IBLJ 5A8RA 1OLME 5HSPA 4ID9A 2HRCA 4ZWNA 4AVYA 1MNQA 1MJ5A 4GWLA 3NPMA 5TJ9A 3USES 4DQDA 1WIWA 1SD1A 2H1OA 1QSLA 3GWCA 5D86A 4ZAWA 4NAMA 3JYTB 1DF0A 3DEYX 4CW7A 4Q48A 3KZKA 1SCJA 3EMBA 1TA0A 3M2MA 4D45A 2VBZA 2EF1A 4YY3J 3DVSX 5CFPA 4DPMA 5TT0A 2SXLA 1VP6A 3VHPA 4USMA 2KJVA 5BPFA 3HXKA 1TJ5A 3KQWA 4RCYA 4YT2A 5IHPA 2RHGB 1Y5MA 5FO0A 5L9XA 2DWPA 4NBSA 3IA0A 3K5OA 1P8AA 2N3ZA 1YQUA 4P4UA 4PQEA 1RJDA 2FSFA 3WV4A 3RJRA 5HF5A 2CQ0A 4BLUA 3C41J 5GVSA 2HWKA 2F2TA 2IM0A 1NVGA 3MMPA 4KPUB 4U00A 4EEXA 2BFFA 3FPBA 4M1WA 3I3DA 1HB3A 4BCUA 5CD9A 2FFHA 1JT9A 4RTSA 1PEKE 4QOFA 1L5NA 5FO8B 4BJHB 3NW4A 3LX4A 4P81A 4LQ9A 1IZ7A 3RJMB 4LVOP 2Z3WA 1IDN1 4KRFA 1YCFA 5FY1A 3UFBA 1MZ5A 1VS3A 2RE8A 1JJFA 2X14A 2FZ4A 4ZPIA 1PQPA 1EDEA 4C7OA 4FOTA 1NVFA 4L22A 5J59A 4DY6A 3OIGA 4ZI7B 3BFXA 2MKHA 1H4QA 5E1BA 1V39A 3EGNA 1LBTA 1AY0A 2VG5B 1B0AA 1JZ5A 1DX6A 3GFXA 2NXWA 5IT9A 3HF5A 1Y1QA 5I4CA 4M5LA 3A2NA 5EIHA 5LBCA 1KHHA 4ES1A 3EYPA 2C58A 5BYNA 3RSZA 4RKQA 5KU1A 4K8RA 1RTIB 2ZHBA 3M1LA 2WWHA 2WICA 1DTSA 3C6ZA 2BTVC 2OCYC 4JRLA 2QSFA 3GRKA 2WVDA 1QJU3 4DCOB 1B8PA 5IC4A 3JQ7B 4Y0AA 1M74A 1KZ7B 2WYIA 5T64A 4LMAA 5JVHQ 1HB2A 1IU9A 4HH4A 1VR6A 3GLUA 4DBQA 5FUIA 3BWYA 3C6KA 2K2SA 1K1SA 1Z0JA 5ALSA 4RF4A 5CYPA 1T1JA 3ECAA 4L9WA 2YHAA 1DY3A 5TSDA 3KT6A 4H3VA 5IG2A 4Y28C 3UPFA 3VL9A 2B6HA 2XHCA 4DQAA 1GFWA 4PCRA 4KSCA 5FY8A 4LBPA 5LP6C 3DZIA 4PC3A 3O26A 5JRZA 1MZEA 5LRRA 4YR3A 4D8YA 1H3NA 4POAA 2RK6A 2YUIA 1TVRA 1KVUA 5ES4B 2H00A 2F00A 3HFJA 4J0EA 2NNWB 3W9YA 4QODA 4WLFA 2PNJA 3EE3A 1TP7A 1QHNA 3SEFA 3MIIA 1W6NB 4M5DA 2NAFA 3VSEA 2W8KA 1XTRA 4MT1A 4Q4Y2 4HWRA 2F9FA 1K75A 2DYCA 3QEAZ 4II2A 5K20A 4HL0A 3AWIA 4PWDA 5AVJA 3OJLA 4F36A 1WLCA 2L69A 2WNIA 1EFCA 3MAGA 2CQHA 3FWKA 2ORXA 1YQCA 5KOXA 2VHJA 3R5XA 2CEAA 1HPZA 1IR0A 3EF3A 3F46A 4E2XA 4FOVA 1G20E 3VMFA 2UVDA 2QLXA 3L49A 1RJ8A 4JGGA 3KLEA 4CZCA 4HZIA 3TGPA 2WDPA 4AMVA 2BMDA 2RBEA 1QCCA 4H18A 4ZVSB 1OXTA 3RZZA 2R44A 1Q5OA 1Q0NA 4CF4A 5A2QU 2D7CA 2ATLA 1I4EB 4DL0C 2G40A 4G9EA 5IDWA 4IEXA 4IDCA 3HC7A 4M0MA 2DH7A 3S68A 1J2RA 3ZI7A 1D2MA 2NYUA 4DRZA 3DV2A 1UADA 1J8DA 4QYMA 4YJKA 2QGFA 5DUUA 3ANLA 4U2GA 2QRJA 5FTLA 4OZXA 5FJIA 4JLVA 3BN4A 1FMD3 2EL7A 3B6JA 5ABJB 3F41A 4F3KA 4YQZA 1FATA 2I34A 2V68A 3HU5A 3HDQA 3ZYHA 5IATA 2EX4A 2QJRA 5EZWA 1OLXA 4WLNA 3EE6A 3SP1A 4MGEA 4CNZA 4OLLA 1NZCA 3DYPA 3C5HA 3ETOA 1GWKA 3ABZA 1SDDB 4CCCA 3D8SA 4IBOA 2WHEA 1QAXA 2AI1A 5P21A 3E4CA 3RYIB 2RGUA 3IILA 5KTKA 2PC6A 3SKYA 4AEDB 1YUMA 4C4OA 2CXPA 1NCRB 4YP0A 2IYZA 4EY4A 2HWC2 3M6MD 2O2IA 1C7RA 2IS2A 4S0XA 5HG0A 2AR6A 1E5LA 4M49A 4RF3A 2VAMA 3U11A 4UUAA 4ES8A 4ZIVA 2IHTA 1N32F 4B4WA 1XE0A 1Y4SA 4QICA 5DDQC 4XHBA 1YHQS 1O8BA 4RMJA 3WK9A 3IBSA 4TYQA 3Q8VA 3GHHA 3HM9A 3HI4A 3MPVA 1GVHA 2QB5A 5A9RA 5KPDA 1DKNA 3WX0A 5A7GA 4OLPA 1VRBA 2GYUA 3VKNA 4IJVA 1GO2A 4Y0VA 3KOOA 4Z8YA 3N9LA 1TKCA 2SCUB 1N7IA 5EHGA 2QMOA 5EJEA 2QMYA 1QIJA 4G1IA 2AGPA 2XTAA 3J7TA 3ZGYA 1KWKA 5JOYA 2X0DA 1I32A 2WNHA 3G7UA 4PWYA 2W71A 2XJUA 5KFEA 2WWWA 2VAWA 3U61B 2ADCA 4YW5A 3AETB 1FX4A 4HB3A 3BBCA 3ANMA 2H2GA 3LGSA 1GU1A 1S0DA 4MKZA 1UA1A 3EVDA 1YRAA 4FD3A 3PJRA 4XYBA 1Y89A 1Z35A 3V46A 3FWPA 1JZTA 3R3SA 1O5LA 1Q8KA 1WXQA 2OK8A 1P0CA 3RYFB 4BO5A 4F4CA 3K30A 1U31A 3TMYA 2O0OA 2ZIVB 3L9JT 2QBYA 3D7NA 3K8VA 1JZ8A 1FX2A 1QMJA 3RSSA 2HWB3 5KTPA 2ISCA 4TS4A 1BHQ1 3PNSA 4D98A 3CZ5A 5EMKA 2JVRA 1G8FA 5B4XA 4C48A 2L19A 5LXTF 3V4OA 1QR2A 4NO4A 1Q5YA 1SG9A 1HM5A 3KFLA 3K70C 4LBWA 4EL0A 3TA0A 2FLLA 2O57A 3AY0A 4X2BA 7FDRA 1DO2A 2VBCA 2UXCB 3AOEA 5IUJC 1PZMA 2G8LA 1QGLA 2GILA 4M0FA 3VR4A 4G8DA 1Y7PA 1HBOB 3P7MA 5HVNA 3UF0A 4QIVA 1RPNA 1X7NA 3FLBA 4I1SA 2HWF1 3UQYS 5JNRA 1WCUA 1FF2A 3T1HB 2R7TA 2WTEA 3I0NA 3U26A 3U7QA 3T4PA 4XUQA 4FPYA 4BS9A 4W7HA 5IK7A 3WG2A 4F2SA 1NZAA 1W19A 2C6SA 2LNDA 2IT1A 2R073 1TGYA 5JJIA 1X1AA 4AJ4A 1OHHD 5BSMA 1ILWA 4CMKA 2MZQA 3DAFA 3I1JA 3U7GA 5ETJA 2D43A 1NMYA 2VH9A 1M5RA 4FB4A 4KB7A 1AKWA 1NUEA 2DJIA 3H0OA 4G1PA 2R48A 1LWEA 3H2VE 3I4CA 4UQGA 2XS2A 1O8SA 2UUAF 5CLFA 3BTZA 3CJIB 1P27B 1W8ZA 2Z6AA 2ZP1A 2J7PA 2HLDA 4CNYA 2WWFA 3UV3A 1WAMA 3HG7A 4J0QA 3LI2A 2CLDX 3GRCA 1I36A 5HOEA 3ND5A 2V96A 3W2IA 4BQ2A 3T3DA 4G4IA 2CFTA 1G4AE 3KSBC 4Y18A 4RS4A 4RW0A 2Z2IA 1D6JA 3OYWA 2QX4A 4JC1A 3HHLD 4MI6A 2VFAA 5FZ4A 1FNSA 2YNMA 1JT2A 2VR4A 1TO6A 3ZIDA 3U1LA 1B42A 1LRHA 4X3OA 2OFFA 3MI8A 2PZEA 3RC9A 5L6LB 1C1BB 4REQB 3OC6A 4KMSA 4Z9FA 4RAOA 1ZZFA 2FMKA 3RDPA 1NZIA 1ADBA 4XAQA 4BBAA 4RD4A 2ZVQX 1BDJA 3ETHA 1UPTA 8ADHA 5E0OA 4PYQA 3GVCA 3L09A 1Y80A 3G4SS 5LCWL 1WC5A 3PPYA 4TYPA 2VC2B 3ELNA 4FKMA 7FD1A 4CLZA 1GYPA 1N9GA 3UKDA 3IP0A 1RJEA 4IS3A 1SXIA 1X33A 4LJ6A 5DK4A 3GZEA 3R3VA 3ORSA 2YC0A 4ZVTA 4PLTA 1YIPA 4MWCA 1WTCA 4O1IA 2DVAA 2WB1D 2IDZA 4QPZA 1SN7A 4G6ZA 4QU1A 3ZLBA 4HVAA 4TZTA 2FZ1A 2UYAA 4CM2A 4LOKA 4H35A 3C70A 4X8LA 3V9AA 4I01A 4TXMA 1MAUA 1CVRA 1NJ1A 2A1XA 5FWXB 4MNTA 1Z0AA 1T5SA 3LL7A 2D3OR 4QOJA 2BGKA 1T95A 3HN2A 3SGLA 1J5OA 4DUWA 1TUGA 4UTZA 4XF1A 2QKDA 2D0OB 3BMOA 3BREA 3KUEA 2CGPA 4NOKA 1V6KA 3QHPA 1HDCA 3LPDA 1I9CA 2IFWA 3W65A 3ZCVA 2BDUA 4B4QA 2CXNA 5ALTA 3TEWA 3GN2A 3GFHA 1E3QA 5U9CA 1DLOB 3BHIA 3JSXA 3UBTA 2KW5A 2X6TA 4C97A 3DXUA 2WVAA 2XMDA 3FKJA 2PS0A 3GHMA 4JI8B 3K6SA 2X5NA 1QTNB 3KG2A 1KWMA 2Y34A 5FAXA 4F60A 1U2CA 1R5OA 1KC3A 4N5NA 2Q2VA 3THXB 2HHPA 4QX5A 1JLLA 3UNXA 2IXJA 4NXNB 3JBG1 1T13A 2ZIZA 5EYXA 3M6UA 2BTOA 3NVDA 1UJMA 3B51X 3PS9A 3UK7A 1TMYA 4FKYA 5LPNA 2R5FA 3IUNA 4IEQA 2BHLA 1DTQB 1KBOA 3VA7A 3DTVB 5E1RA 2BGWA 1YRTA 1FP7A 5TVKA 4YW3A 4O0MA 5KHKA 4YQEA 3IEMA 4PSVA 3OJXA 4DOMA 4B46A 3C7TA 3HADA 3ZHRA 1TEIA 4GO1A 5SY9A 5CQGA 2HPUA 3MTJA 4K4ZA 4L8GA 2UVPB 4CDNA 1I5OB 3CDUA 1GG8A 1C3EA 2ZYGA 2Z2MA 1N3BA 5DPMA 3TXYA 2CD7A 3E53A 1H8ED 3UMVA 3KXDA 3GH3A 2A30A 2GNKA 5IK4A 2YWCA 2AKYA 3VVCA 1G6BA 2A0XA 1NY6A 2RUGA 2W2MA 2P35A 3QMQA 5T6MA 1YJLA 1OROA 1M6HA 4PRYA 3SCJE 5KHLB 3D1HA 3K15A 3MCSA 2WB2A 1GV0A 3P2KA 5DULA 4U7PB 2V6JA 3ECSA 2Q9UA 2C5GA 2VP5A 1UQXA 5L36A 2XDWA 2OS2A 5EDWA 4MCAA 4Q7KA 3M3HA 2QM7A 5MLCV 3T5TA 2P17A 3QLVC 2QNBA 4NNOA 4MS3A 3KLPX 3NRCA 2HLNA 4OV1A 4KFSA 3VX4A 4NEGA 3TF5A 2A92A 2J0SA 3MEEA 4EO4A 1X92A 2IV2X 4TVBA 5A32B 1MR3F 3LW7A 4MQFA 2HA3A 2G04A 1XXLA 4Y1RA 1BROA 4P9WA 4G4SP 5IABA 4WU3A 3ZR6A 1L5RA 2WSLA 3WY9A 2GDFA 1KDYA 3ET4A 3WYEA 5TPZD 4IGQA 2OP1A 5A1AA 2QIFA 2A6VA 2GESA 1ESMA 4GKBA 5CBLA 5AW1A 3KKFA 3JQPA 3HB0A 2RGYA 3WCRA 3EZFA 4A8XA 2PCLA 2XWSA 4DDHA 1YZQA 2LCWA 2QGZA 3GNQA 2JLYA 1DQRA 4ZJUA 1Q16A 3M2RA 2R8IA 2AB0A 3TFOA 4HDMB 4LS3A 1XMQJ 2XB9A 2A59A 3ATGA 1AF9A 4F4UA 3BEOA 4INJA 2EARA 4M5KA 3KLGA 2D40A 1Q12A 4RZIA 4NULA 1ATZA 4AI9A 3H99A 1UP1A 1FW6A 1RTDB 1GTL1 1EYBA 4LHKA 3N86A 4TLMB 2J8SA 3H8YA 3ZH2A 3W1VA 2MZJA 3HJVA 4KRWA 3TW6A 3D0SA 5K3EA 2O59A 1HOXA 1Y3KA 4KAXA 5EJZB 3IQHX 2EIEA 1OFIA 3MGGA 3QOWA 3FYDA 2VP9A 2WSCC 1RWOA 4HUTA 4A3ZA 1FDAA 2IZ1A 1ZBE1 4DZ6A 2GGSA 3D1VA 3W8NA 1KFKB 1FPN2 4X93A 2IUWA 3ZHOA 3ZXUB 2A58A 3WGQA 3JTMA 2BR0A 5KZMB 5KHIA 3M3QA 2FU5C 1VBMA 3VHXB 1KQFA 2C9KA 5IASA 3V6DB 4DBVO 3R1LA 4NPLA 4AKTA 1XPUA 3T3NA 1AQUA 1VLHA 4RD3A 2MQMA 1A2BA 1VC2A 4CKEA 2IE0A 4JUZA 1UZAA 3MT0A 4CT4B 3KEGA 2XUAA 2FDIA 3U9SA 1O3SA 5EKDA 2L2QA 1YO6A 1URXA 2IKSA 1SLCA 3G8CA 2GHVC 1MLAA 2Z8ZA 4IJKA 1AURA 2M6KA 4QAJA 2OHFA 2PL1A 1I7QB 3ICVA 1AR62 4YT5A 3T41A 2WLSA 1R6UA 4YNBA 4CUAA 1X8EA 3JZAA 2B4PA 3KHBA 3RLFA 1C3HA 4BO8A 3S1SA 2W4QA 4LOLA 2YBSA 1RP7A 3AP3A 1MXFA 3AUJB 3KL4A 2VZPA 2WFF1 4AI6A 4GD3Q 2YH2A 4OXNA 3JAWB 5HIKA 4QPIC 1OU0A 4YMHA 4PDWA 2RRAA 2WWJA 5FPXA 3TQTA 5F5QA 4FFHA 3A6KA 2FN3A 5JPDA 4QD2A 3ZTPA 4E5UA 5K9ZA 1P45A 4C2MA 2ZAOA 1N1GA 1KK3A 1MN9A 1GD1O 1BVHA 1CUJA 4OHKA 3DU5A 2QQMA 4HVTA 2ID8A 2ZHOA 3NBXX 4R81A 1HJGA 2QE7A 3WYBA 5KTQA 2IVJA 1GFSA 5FZGA 3ZFVA 2HIAA 2WT4A 3FMIA 2OFHX 1S7IA 1AYN3 2DWUA 1SUDA 1V8FA 1IMJA 2JGDA 3T3FA 2X9NA 4UAVA 3PEWA 3RK1A 2ZOEB 4KWJA 1ESEA 3CUTA 4EPWA 5HQJA 1XG5A 3TEGA 4P73A 1K08A 4XLZA 2J6BA 4Q4W2 1SC3B 1HZZC 3LHFA 4RW7A 2ZBUA 2FRXA 2MZRA 4NNJA 1VI7A 4TM7A 4Y6SA 2VJLA 1BE4A 3CLTC 4DSAA 2ZR0A 1JDPA 1I2BA 3NIWA 5FP7A 1WDMA 1C1FA 2AF6A 1RAIA 4JI4J 5KOJB 1PJ4A 3H1PA 1FWLA 4C4XA 4RHEA 2AMYA 2Q8DA 3UK0A 1Y9DA 4BUCA 1XK7A 1SQSA 1Z4QA 3MJTA 2VTVA 3D8BA 4X4QA 1B0PA 1HV8A 3DEAA 3OBIA 3SKJE 3JZFA 3BXFA 5KFMA 3HCBA 4XJVA 2CVPA 2OCXA 1RABB 4BJ3A 2V50A 1XCLA 3MINB 4OVKA 5DG8A 4CF7A 4OHXA 2ZRFA 3UGKA 2B36A 3I01M 2OOSA 1T24A 3ZWWA 1TX4B 4Q9DA 3NT5A 1CBKA 3OLAA 2PZMA 5B12A 4GKJF 2VJAA 1C0UA 4Q03A 4QX7A 2XB6A 3UICA 3LSYA 3ANXA 1VC0A 4QYRA 3VR1A 2IQIA 2YFYA 4QEDA 3GOHA 2JOQA 3KZXA 4FBLA 5DBOA 3U62A 2YZKA 2DQSA 2G1AA 3U3RA 3O9VA 2J5BA 4IV1A 3A10A 1AZSA 2JFZA 1TQ6A 2ZI7A 2FSGA 3KOXA 2VTFA 4B29A 3WA6A 1LOGA 4PI2A 3D4KA 7REQB 3Q0IA 1V1RB 3I39X 2VUTA 3M1IA 4UUPA 3VPAA 3D6VA 4Y22A 1KJRA 1JLRA 1U3VA 3QNMA 3S6EA 4QUDA 3KWFA 4OJGA 1H2XA 2H3HA 5FK7A 5A0VA 2HBYB 5FP0A 1A96A 2V7QD 1GCOA 2OPSA 4DBZA 3H50A 4P9NA 2PAFA 1N3LA 2WFAA 1CR2A 4N8DA 4I1RA 2RHQB 1LC3A 1O95D 3W5AA 3E7DA 1Z62A 1YKSA 2OAUA 3ID6C 3BPDA 1JQKA 1XT6A 5GJWC 5ELLA 1LNZA 3EH1A 1UPUA 3N0TA 4UCXA 4UNQA 4FP3A 1U6KA 3FE2A 5HROB 4UM8B 1FTCA 5A33A 1KN6A 4I64A 3FFQA 4BCBA 4EB8A 1Z4JA 2DVFA 3L6EA 4PPQA 3ERCA 1MO2A 2J59A 4Y2UA 3IIIA 5B7QA 4PHZA 1BHJA 5KXEA 1KFUL 3TG2A 1Z7GA 5K4GA 2B7BA 4YRTA 4MXWA 4KHZA 2V7XA 1Z6PA 5IWCA 3GP5A 1J0BA 4ZEMA 5BNPA 3GILA 5DSTA 4KQWA 4E2FB 4YRDA 3AF5A 3JUUA 4EMSA 3E9ZA 3DL0A 1TKTB 3M4YA 1PFWA 2QRMA 4CM8B 4ZZ3A 2ZYTX 1H93A 5FWYB 2VH5R 4NMLA 1YB4A 3B4MA 3KKZA 1ADCA 3I37X 4RIHA 5I7HA 1QV7A 1RHKB 2ZJ7A 3WMXA 4D4IA 2FJXA 4C0HA 3HUEA 3HFKA 4ZN1A 3NS7B 2L9WA 2A5JA 1NI4B 2UUAB 1AL22 1CS4A 1Q11A 3AG5A 3SC2B 2TYSB 3FIJA 3JYNA 3KBBA 3LG2A 4WIAA 3TZHA 5IC6A 4EHAA 5C34B 1B23P 3HCNA 3KV4A 4MULA 3AWDA 3B01A 4IUBS 4WK6A 3A9WA 4PNPA 2ZIXB 4YB8A 4IH9A 1PNTA 1Y10A 3IPYA 4FCVA 2YVQA 4IWXA 4AZ3B 3TQOA 1TL5A 2V4JA 2X0FA 1AT1A 4QQHA 2DCKA 1UWWA 5EQFA 1LZKA 2B7CB 2RMKA 4CEJA 4UEWA 2E6KA 3I3OA 4TN5A 2QW0X 5J1SB 4HWTA 2HU5A 3TNLA 4X7MA 1RXVA 2RJZA 1OH6A 4R52A 5EP2A 4A8YA 1BBT2 4DMKA 2A67A 1QOPB 4BDPA 1PWZA 1N34B 2CDQA 5A71A 3RB3A 2RGRA 2P2NA 2BWAA 3H5VA 3U17A 1GG9A 4JOCA 4UVDA 3TPFA 3R7LA 4AEKA 1KLMA 1Y48E 3M2VB 2ZJAA 3WLUA 1KORA 1W28A 2FMHA 2NT3A 3R7SA 1Y3FE 2BEWA 1HDOA 2F8TA 2OCAA 4XLTA 3C74A 3NBFA 3PVEA 1GYRA 2XCPA 3MMCA 3RRYA 1CULC 2NW6A 2CWWA 3LO8A 4P75A 3ZWPA 2WS92 2Y9PB 3EBOA 5CNMA 5D0GA 1U2GC 1SJFA 1GA4A 3HJAA 4MRMB 3ZFGA 5TIIA 2ZB7A 1X7WA 1AZSC 4LISA 4ASUA 2GAIA 4CKYA 1KZ9A 3NPAA 1KC1A 4FS2A 3AHPA 3OKPA 1TME1 2UZAA 3S0MA 4RXMA 3EGDA 3PQEA 3PB3A 1II0A 1UIJA 1IQTA 3GNTA 5IK2A 2ZPUA 2W2NA 2VAUA 1OXCA 4BOWA 2HFOA 3KJVA 3KKOA 2Y1FA 4KVZA 2QT1A 2YY6A 4D97A 5K7SA 3ABQB 4WM8B 4EPXA 4HXEB 2CZ4A 4GJZA 2I66A 4IIUA 3F7MA 5E5NA 1AK9A 1F5SA 3ASZA 5EXEA 4TRRA 1YFXA 4XQ4A 1MORA 4JGYB 3I31A 3WW1A 2PKQO 3QLQA 1WVMA 3POEA 5JAHA 2QA2A 1H8HD 1ZUIA 4JLDA 2XSJB 5HWSA 4UEJA 2XBLA 1QZTA 4WNYA 4FYXB 3I61A 4BE7B 4MR9A 4BTLA 2ONZA 1LEDA 3ND7A 2J9RA 1YS2X 3O1SA 3CLSD 3T3MB 4DCVA 1LRLA 3KVOA 3IE2A 3REFA 2RIRA 2A1UA 1VIVA 5CCLA 4BQYA 2CJQA 2JVIA 2YTCA 4D7YA 4AE2A 2QS9A 3B48A 2UZ1A 2PUVA 4E6EA 4DXSA 1USIA 3AM2A 2VNIA 3I83A 2F9LA 4QC2A 5HO4A 4JJEA 4KQZA 1EFTA 4WZBA 5TSWA 4W5QA 4BV2A 2W5FA 5DXJA 5L3QA 3UD4P 5AI8A 3Q8AA 4EGCB 3ICLA 3KOZA 1RLJA 4C6AA 3C8UA 3OZXA 1S1CA 3E61A 3WX8A 4P4LA 3WXMA 1NG1A 1ZI9A 1F2UB 3ORRA 3OQPA 3U3OA 4FR2A 1PGQA 1CS4C 2Y6JA 4RIEA 1B7FA 5ALFA 2QRUA 5JIBA 1O5OA 2EFYA 1ZX5A 4TXJA 4LR7A 1FMCA 5JCJA 2P6CA 1PO11 3HU3A 4MV6A 5C8YA 2H4JA 1TQHA 1UY1A 3T54A 3BYPA 2AH5A 1OT5A 3DYAA 1Z7S1 4PPFA 2K7ZA 3MYYA 2NOAA 1PGW1 2A88A 2P9YA 2DXEA 4ZQFA 4KPFC 1ESCA 1RQGA 4JJKA 2OL4A 2LKZA 1G17A 1RKIA 3PY8A 5TS2A 4HTIA 5EP3A 2D8MA 2REQB 1WU8A 3VBUA 3MCUA 4AL9A 4TQAA 1OBHA 2OIIA 4R1PA 1S2LA 2AC7A 1CJVB 1TYEB 3VBCA 4J0IA 4Y1ZA 5BR8J 2G13A 3R41A 2FWMX 4XVRA 2XSFA 1HXHA 1PVC3 4URTA 3H5IA 2ZTVA 4I7EA 1BA2A 1G8GA 4WFJA 4ICLA 4YJFB 1SXQA 2RQCA 2D93A 1UOBA 2NUUG 1PX4A 5C42B 3D6UA 2CJAA 4BIFA 3U4AA 1Z0KA 4IR9A 2FPSA 1JEYB 3QD6A 1HQ2A 4DMMA 4D42A 4DV0J 4LTMA 4KGXB 1E2MA 4PYOA 3ZFGC 2XMAA 1I1HA 3RARA 1T9DA 5DRTA 1QAJA 4W98A 3JSMA 4Z86A 2G28A 1TI7A 4LRXA 2VNKA 4JI3F 4JI6F 2GF0A 1OW3B 2FQYA 2ZYHA 1MPXA 1Q8LA 3ND6A 3H2SA 3NSTA 1ZRMA 3W3AA 1QONA 1ESZA 3FPHA 1U7TA 3BTAA 4B09A 4SBVA 1YCIA 4RSRA 3ZU5A 1FA0A 2CPHA 3DE6X 2OHJA 4CU5A 4QPGA 4YAWA 2E7AA 3KVNA 2HIGA 3WDKA 4AF6A 3HLUA 2ZH5A 1HYEA 2ZBDA 1IZYA 3D59A 1EAYA 1ZOOA 1GP6A 3MM7A 4KTVE 4YWJA 5JLVA 1KEEA 4JLKA 2VQFF 4AMZA 2Z5LA 9MHTA 2QDNA 5KMGA 2VSQA 5SYMA 3B60A 3J80A 3RM3A 4B2YA 1PHPA 4F93B 1A7KA 1Y5IA 5G2OA 5E9WA 4YYOA 3LX8A 1K1EA 4LMPA 4U6PA 3MLBA 1NRXA 4A36A 2GXAA 2DH5A 1XNQJ 4L9BA 1O0CA 3PDWA 2OEKA 3ZQUA 5F9HA 2VPWB 5JNSA 4UYBA 5D1IA 3DOKA 4Y1XA 4IIBA 1U8FO 3I96A 2GP5A 2XNQA 1VBKA 3J9SA 1E3WA 2JZ5A 3T7EA 1ICEB 1M83A 3R6SA 4FGJA 3LA3A 5C9AA 1LODA 5B0CA 3CKKA 4LNAA 3ET6A 2HHQA 5IVJA 4DXRA 4X62F 1HHTP 2GN6A 3HT3A 3MELA 5HRUA 3HHEA 1Q79A 5J5CA 1ROFA 3W8FA 4G8CA 4N0PA 4GXNA 1B26A 3WKDA 2Q3CA 3P4UB 1W05A 1T1RA 2EZTA 4EAQA 3UGGA 4FNHA 4M5JA 2BUBA 2GH1A 5A8WA 1EFUA 2PGOA 3WFIA 2WQ6A 2Q49A 1T4CB 2IC3B 3US5A 2AOTB 4R3WA 2NO5A 1EGAA 3L8FA 3WYFA 1PYOB 1B6TA