4C0BA

Structure of wild-type clp1p-pcf11p (454 -563) complex
Total Genus 131
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
131
sequence length
428
structure length
428
Chain Sequence
b'TGDNEWHKLVIPKGSDWQIDLKAEGKLIVKVNSGIVEIFGTELAVDDEYTFQNWKFPIYAVEETELLWKCPDLTTNTITVKPNHTMKYIYNLHFMLEKIRMSNFEGPRVVIVGGSQTGKTSLSRTLCSYALKFNAYQPLYINLDPQQPIFTVPGCISATPISDILDAQLPTWGQSLTSGATLLHNKQPMVKNFGLERINENKDLYLECISQLGQVVGQRLHLDPQVRRSGCIVDTPSISQLDENLAELHHIIEKLNVNIMLVLCSETDPLWEKVKKTFGPELGNNNIFFIPKLDGVSAVDDVYKRSLQRTSIREYFYGSLDTALSPYAIGVDYEDLTIWKPSNVFDNEVGRVELFPVTITPSNLQHAIIAITFAERRADQATVIKSPILGFALITEVNEKRRKLRVLLPVPGRLPSKAMILTSYRYLE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MRNA CLEAVAGE AND POLYADENYLATION FACTOR CLP1
molecule tags Transcription
source organism Saccharomyces cerevisiae
publication title Structural basis for ATP loss by Clp1p in a G135R mutant protein.
pubmed doi rcsb
total genus 131
structure length 428
sequence length 428
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06807 Clp1 Pre-mRNA cleavage complex II protein Clp1
A PF16573 CLP1_N N-terminal beta-sandwich domain of polyadenylation factor
A PF16575 CLP1_P mRNA cleavage and polyadenylation factor CLP1 P-loop
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.1030 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4c0bA01
3.30.70.2410 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4c0bA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4c0bA02
1ZM3A 4NE2A 5G3ZA 4D4MA 2YNMA 5CDFE 5CLQA 2OZEA 3I1FA 1YRAA 2XOKD 2ZI3A 4LHXA 4A4DA 1AA9A 1AN0A 4PPQA 2QA5A 5F9HA 1LS6A 4DKXA 2XX3A 2C9YA 1G64A 4C2UA 1KI6A 1KSJA 3NVAA 3FFBA 4R7ZA 2KI5A 5IF9A 3A58B 1HUQA 2RCNA 4QJ4A 3T5DA 4DLYA 2P0EA 4MRPA 2FPMA 2XXAA 4G3XA 4TSFD 2BKEA 2G88A 3K70B 2IBMA 4M9SA 1T4GA 821PA 221PA 1FPMA 2DB3A 4DIDA 3SC3A 3LBIA 3N2EA 3BE4A 1CEEA 2O5VA 3PQCA 4MKGA 2OXRA 2EFHB 1XXHE 2WIBA 4JKYA 1AM4D 4UNNA 4TQ9A 2NPFA 3ZD6A 2REXB 2R8RA 4EDHA 4EFNA 4QKQA 1G4UR 5H70A 2GCOB 4F91B 5IK2A 3C14C 4PQYA 3BIFA 1CR0A 3AUXA 3B1ZA 3P4XA 1JJ7A 1JEEA 1ZNYA 3TSWA 4ZKDA 1LFDB 1HTWA 2ZAMA 5JRJA 4LJ9A 3B5JA 4KLNA 4I81A 3T1VA 4B3CA 4DLZA 2H7VA 1QF9A 3CB4A 3IPXA 1E32A 1YZQA 3B2EA 3AQ4A 2E9SA 4IDPA 2P65A 3AKCA 4JLMA 1P2SA 3F3YA 121PA 5C46F 3AVUA 1KI3A 4DLVA 1W0JD 2ANBA 3V9PA 1C9KA 1QVRA 5DYIA 2VP9A 3BFVA 3OIVA 3ZQJA 1XD9A 3LW7A 1NRJB 1Y63A 1HE8B 4PO8A 4DC9A 2RGNC 1R10A 2B6HA 4LJ8A 3NDPA 3CPHA 4S2EA 5K8TA 1JEDA 2PH1A 4I1OA 1ZUNB 4YMWA 2WTUA 2CK3A 2XB2A 1TUIA 1XEWX 4MYCA 2FGKA 1L4YA 1ELOA 2BIFA 1O87A 2SHKA 4NTZA 1AJEA 2E1RA 2DWPA 1FQJA 2NO1A 1XEXA 4US2R 2C9OA 1N5IA 4PHHA 4NKRA 4ARZA 1Z6AA 421PA 1J7KA 4GNKA 4ON9A 4CEJA 1KO5A 1VDZA 3RYTC 2J7PD 3SE0A 3W5IA 5F3WB 1Q57A 4MGZR 1Z6YA 3HWSA 3RRZA 4BE7B 3TUJC 1FL9A 5KNBA 1W36D 2QL6A 3DL0A 3WRYC 1KYIA 4CF7A 1XJQA 3FMPB 1XTQA 2HJGA 1Q20A 4TLBA 2OLJA 2NIPA 1EX7A 3T5GA 1KMQA 2ZJ8A 2CHQA 5J4KA 2H57A 4BFYA 5KTYA 3CPEA 1KDRA 1S9HA 4LK2A 3P1JA 4I1SA 1UDXA 1KY3A 2O8BA 2OLKA 4AYTA 2I1VB 1E9FA 3GJ3A 3HU2A 5GJCA 5JI2E 1DG3A 1W4CA 4URZR 2ZIAA 3HDTA 3QF4B 3VFDA 1VG8A 5HCNA 2QI9C 4C0LA 4CEIB 2NOAA 2X19A 2JLSA 3QPUA 4FD2A 3DKVA 3VAAA 2ZRAA 1NN0A 4KSBA 2DPXA 3R9XA 1XWIA 4KI0A 4ZDKA 1P9NA 3U4QB 4TTPA 4YMSA 3K0SA 2R65A 2V8OA 3BFKA 1EFCA 5DE3A 3WBJA 4TLAA 3L43A 1TX4B 1TQ2A 5DNYB 1ANKA 1ZCAA 4Q1DA 2ZJZA 3BORA 1OFHA 3PEUA 3RVBA 4G01B 1KI7A 1SXJB 4NYMR 1WB9A 1G41A 1ZP6A 5IK2D 5L3QB 1YHNA 2Z43A 4TMXA 3UKDA 1XD8A 1OFUX 1W47A 1YE8A 2E87A 3FKSD 1ZBDA 1U2RA 3WMEA 3GLFB 3BERA 1KSHA 1KK0A 1UDWA 2XNSA 3ZGXA 2F55A 1U94A 4AURA 2XB4A 1RRPA 1SVMA 2CNWA 4BEBA 5BN4A 2IYRA 3PEWA 3NXSA 1FMLA 1AGRA 4BZPA 2V4ZA 4GP7A 5HCIA 3OAAD 3TGPA 4TLDA 2D2EA 2WWIA 2BBWA 1BOFA 4ZCIA 1UKVY 1RKBA 2FOLA 2H18A 1UKZA 1E2DA 5J5CA 1KOFA 3W6OA 2QROA 1KKMA 3RABA 2OCBA 1E0KA 1G7SA 5FL7D 2HXSA 2XZPA 3QOFA 1LTQA 5EP4A 3ICEA 1F2UB 1EWRA 1W44A 3RRMA 1CXZA 4RZUA 2ZUBA 3IBGA 1N0WA 3F5FA 1U0LA 4DSTA 2WJGA 3UPUA 1QBKC 4UNRA 4OK3A 4DWJA 2HT1A 4TSFA 4NDZA 1AK2A 2BEKA 3AB3A 2ZE5A 1NVXQ 1FP7A 1Z83A 1P60A 3CH4B 3RS7A 2JLYA 5JEDA 3R20A 3LA6A 5JWHA 1AKYA 1OHHD 3ZZ0A 1UKYA 1VIYA 3Q8XB 3MFYA 3TRFA 4Z8YA 3IHLA 4JL6A 1IOZA 1DO2A 3NDBB 1Z6GA 4XOIA 3EZ7A 4G5SA 1NMYA 2FA9A 3VR6A 5L3VA 3QEJA 1Z08A 4QG7A 3D6TB 3K9HA 5KSPA 4BLTA 4U7DA 2OEPA 1KDPA 4L15A 3TW4A 2FV8A 4TL8A 5KNDA 4M1MA 4ZDIA 4PC2A 2OESA 1G3QA 1BMFD 1YZGA 4JMPA 4DLXA 1DARA 1OYWA 2A78A 1KMHA 3K1JA 1CTQA 1KSFX 2QENA 1W0JA 2H1LA 1W5SA 3CRQA 2QBYB 2O8DB 2ZQ5A 3OFNA 5TB5A 5E95A 3WHLA 1KK2A 4D2IA 3QKTA 1GSIA 1O3YA 4KVAA 4HUQA 4AK9A 5M04A 3B78A 5GJBA 3LD9A 3R7WA 4MA4A 3QXCA 3MJHA 3JZAA 2GCOA 1NKSA 4I1UA 4AD8A 4DLSA 1MO4A 1US8A 3GEHA 4US1R 3LFUA 3RAPR 1UBEA 4KHZA 4KVGA 1YZTA 2ZI5A 4U02A 1FQKA 2IYYA 3B1WA 3P32A 4BFZA 1GDDA 1JAHA 4IOKA 4F4IA 5CB8A 2VHUA 4B76A 2OAQ1 4GPTA 3DMNA 4P31A 1Z29A 1G8YA 2B92A 2BEJA 2NO6A 2ZE7A 2Q6TA 3MD0A 3QXJA 1OXSC 2ZI6A 1MR3F 5L3SB 3OEHD 4UKDA 1X6VA 4PPFA 2JA1A 4MQBA 1XCMA 1OKKD 3EA5A 3LX8A 2VH5R 3GJ0A 3KFVA 1BO6A 4W5HA 2JIZA 5TVKA 5UKDA 4M2LA 2G1KA 4LHZA 2QAJA 3DZDA 4CVNA 3CPJB 3ZJYA 3AVWA 3TK1A 3N70A 1RJ9B 4A8JB 1PLKA 3Q7PA 4POAA 2ZRHA 1GILA 3IQWA 5EUQB 1T6NA 1B0UA 5EXSA 2UKDA 2NGRA 4LHYA 2QP4A 2VHTA 5CJPA 4QHTA 4Q4JB 4B3BA 3THWA 4L9WA 3ZLJA 5JZVA 1IXRC 1ZC4A 1R6BX 1W2HA 2FU5C 3FB4A 3AP3A 2ZU6A 1OE0A 1W4RA 4KFRA 2BMJA 2F7SA 3KDSE 3QE0A 2D3WA 3B60A 5EE1A 1EWQA 2HV8A 2WVJA 1WBBA 3TSZA 4BFSA 4AKEA 5FOWA 1G18A 1BKDR 3K0CC 3W90A 3X1WA 3THXB 4A8JC 1MRSA 2P6NA 1J90A 4A2WA 1G4AE 2BCJQ 2C98A 2I1QA 5KSYA 2P6RA 1Q3HA 1CS4C 1KHTA 2N42A 2R6GA 4WW0A 4YDHB 2V55B 1FX0A 2XSZA 4LV8B 4ZCLA 3EW9A 4GDFA 3CO5A 1S1CA 2R9VA 5B30A 4P4TA 5FI1B 1BMFA 3IGFA 3QNUA 2C78A 2GJ9A 2JLQA 5JHGB 1FOEB 2R62A 1XJ0A 2QAGB 4JS0A 4OL0A 5CM9C 2GILA 1Q1ZA 3MUFA 2XAUA 2GF0A 2HYDA 2XEXA 3W5JA 4NYIR 4D25A 4QGHA 4OQFA 3X1DA 4P4SB 4G5QA 3O8RA 4MDEA 1N6RA 5JHHB 1G291 4DEYA 4NYJR 4LYHA 3PR1A 2HF8A 2FSGA 1TAGA 1M6NA 2QAGC 2BOVA 2ZU0C 3FDIA 3Q5DA 4Q7LA 1JXOA 2WAXA 2C77A 2IC5A 3B13B 2VSOA 3PVSA 4RD4A 2V7QA 4IOMA 2CE7A 2R6CA 3B1VA 4RCZA 1L4UA 1CJKC 1A2BA 4UNPA 3F8TA 3T15A 2O0HA 3P26A 2IHBA 4TL7A 4DCTA 3A4MA 3OEEA 1FNMA 3A6PC 5GADl 1UEJA 4LJ7A 4HZUB 2GTPA 4G0NA 4LOAA 2AXPA 2Q9AA 4LUCA 4LBZA 1M34E 3C5HA 2PJRA 3PIRA 3RC3A 4E22A 1E2FA 1Z2CA 2GK6A 3NBXX 2PL3A 5EXPA 3THOA 2JIZD 1QG4A 5FL3A 2FGJA 1II8B 3UMFA 2J3EA 1QHYA 3Q9LA 2IT1A 1KI1A 1VKJA 4GZMA 4NMMA 2EFDB 4K8OA 3WNCA 1IN6A 3H86A 3A4NA 1X3SA 2G6BA 2IYLD 2HXYA 4C4PA 4PPGA 3T06B 4AY2A 4ESHA 2Q21A 1F2UA 5DIFA 1Q12A 1MT0A 2ONJA 1TNDA 3M1IA 1AZSC 2GDJA 4Q9HA 4IEIA 3A1WA 2G3YA 4V0MA 2EFEB 4JZKA 1GWNA 3O8CA 1GM5A 5LD2C 1P9WA 3NKVA 3ADKA 1TL7C 2AXNA 5LD2B 1KTVA 1P75A 4FMCF 1R2QA 4YXWA 1VECA 2AX4A 3RS5A 4L16A 1NSTA 2GRJA 3KL4A 4M1SA 2W58A 1NLYA 1TADA 2IS1A 4A9AA 1SVIA 4B3GA 3RSOA 2A5JA 3GLGA 2JLZA 1S8FA 1AIPA 4YMUA 4FCTA 1I4DD 4Q00A 4D6PA 5G3YA 3TSOA 4DLRA 3AF1A 2JDID 2PJZA 2ZRPA 1IN7A 4JLVA 1JR3D 4KODA 4GP6A 3EZFA 2F43A 2B7BA 1Z6XA 1E1QA 1XMIA 3MJRA 3RRYA 3EAQA 4QNMA 1E9SA 3U3RA 4NYJQ 2J7PA 2FDCA 2NO0A 4AG5A 4KFSA 3REGA 1D2EA 2Z4RA 1E2PA 4XWKA 1ETUA 3SHFA 2QSZA 4ILEA 2O8EB 1W48A 1ZNXA 4DB2A 4C30A 1US8B 4QFMA 2CCGA 3MCAA 1E4YA 4M8NE 1II0A 1S9DA 2CCKA 4ARZB 2W6JA 3CZPA 3D31A 4HLCA 3EXAA 1DS6A 1T0HB 1LY1A 2AFHE 2XNDA 3ZDQA 4FINA 3X1YA 1P2TA 4F4CA 1E2MA 4M9QA 3LV8A 2REOA 1M7HA 2PT7A 5AR1A 4AKGA 3E1SA 1UAAA 3NWJA 1T5LA 2QORA 4WVFA 4GBMA 2ASEA 2VA8A 4P3YA 2ZVQX 2FH5B 4FN5A 2OUKA 2J59A 1R4AA 4LJ5A 1CRPA 5HKKA 4IVQA 4DZZA 1VCNA 2BJWA 3K0FB 1KI9A 1RJ9A 4A8JA 3GP8A 4PSKA 2K5UA 3RANA 2ZEJA 1QHHA 4RZ3A 3A4LA 3W9YA 2HYIC 1KIMA 1XRJA 3L0PA 3J81k 2BBOA 5TDHA 3T1TA 3B1XA 4GZLA 3JVVA 4OQMA 2FSIA 2VSFA 3IEVA 1XZQA 2ZR0A 4Q21A 3KJGA 3GPLA 1OB2A 4TWZA 1LB1B 1UF9A 2J0UA 2EWWA 3NG1A 1KI4A 1W2GA 3PITA 2YYZA 1DVRA 1KK3A 5EP2A 2O8CA 2CJWA 4IRUB 2WHXA 2ZSEA 5EZ5A 4PC6A 1OFTA 1P3JA 2CDNA 2J0VA 3QQ5A 2YWFA 3L0OA 1ZNWA 3ADDA 4HAWA 4Q18A 1VG0B 3VU9A 1Z8FA 1P5ZB 5BN3A 3U61B 4IDNA 3TKLA 2VIIA 4WA7A 4Y0VA 4OJKA 3WRXC 3SI7A 1HQCA 4LV5B 1NG9A 1GKIA 2WPDD 3OHMA 3WYAA 2PLFA 5J40A 3UK6A 3AVOA 2UZIR 1MKYA 4ZO4A 4AYWA 4PTLA 3SHWA 4XWOA 4B6EA 5C1BA 3DEFA 3MLEA 4GT1A 1NSFA 2RGDA 5BQ5A 2IYVA 4KITB 3CX7A 1U8AA 2J45A 2D06A 1NF3A 2DR3A 2RGGA 4JYCA 4LC1A 3R9WA 3QUSA 4LJ4A 2AWNA 2L0XA 3C16C 5A0FA 5J4YA 1VTKA 2HDNB 5H68A 4PHFA 1RRCA 2NO7A 3DO6A 1UFQA 5CYOA 4HSEA 1DG1G 3GJXC 4V0NA 4Q1EA 3EARA 3GCGA 4JJKA 5FTNA 3RS2A 3KKPA 5EJEA 2RGEA 1YJ5A 2O0JA 4LI0A 4QGGA 3SFVA 4BLQA 3QPWA 3U3JA 1FMJA 4RFVA 1YRBA 2AK2A 1VYTA 2O8FA 1Z06A 3E5HA 3UANA 1XCPA 3EPJA 4PPNA 1DOAA 1LNZA 2ZUDA 2BV3A 2KJQA 2QPAA 4LBWA 1E2HA 2D74A 1KJYA 5FBVB 1EGAA 4G1UC 4MUAA 3W3ZB 2PMDA 2ZUCA 5KDDA 2CE2X 4BGDA 3OIUA 3SBDA 1RYFA 1OIVA 3OFND 5CYPA 4WBSA 1Q22A 2AK3A 2VBCA 1WQ1R 1XU4A 1RRFA 1BIFA 1RE0A 2FJUA 4W7SA 3MRSA 3A36A 1NBMD 3LXRA 2OAP1 3SEAA 1CIPA 3I3SR 4B44A 1E0SA 2ORIA 1ZM9A 3AKEA 1GRRA 4ZKEA 1KI6B 4KJZA 1U9IA 4FMCB 1HURA 2DBYA 2GCPA 1KMHB 3DDCA 3M4YA 3B7GA 1G3RA 4N0EA 4TMTA 1E1QD 2UVQA 3C15C 4URWR 2XXAB 4DT1A 4W5JA 2F1IA 3AVQA 1NIJA 3GEEA 2R6AA 2EYQA 1H8EA 2Q3HA 2GK7A 4Z54A 2Z83A 2WICA 4L4UA 2P6UA 3B9PA 3KTAB 4YMTA 4MH0R 2VP5A 5FH9A 4B33A 1NIPA 3GLHB 1XXHA 4MRNA 4R98A 4WIAA 1D6JA 4NZYA 5GJVC 1H8HD 2R6DA 1VCMA 2BWJA 5LB2A 4B48A 3GJ8A 4ESVA 2B8WA 3EG5A 4ZPXA 3S1AA 1OH7A 3AUYA 3B85A 3RWMB 4PQRA 1KJZA 5FUYA 4EJSB 4HAYA 1UPTA 2AHOA 3E70C 4KV9A 4PX9A 1PZNA 1ZVQA 5L3SA 2ZI9A 1SVOA 2XNDD 1D8TA 1MABA 5JI3E 2FEOA 1N5KA 4V0OA 1G6HA 2XTMA 3K8YA 2IS2A 1OT3A 1Q1BA 4PSVA 4BRUA 3CR8A 2A3RA 4DUGD 4BZQA 5F2EA 5JECA 1P2UA 4BZXA 3KTAA 5CJ2A 4NPHA 2IXFA 1L8QA 1E2KA 5FPKA 1D2NA 3DHWC 2QRNA 1KI2A 4MITA 1VCOA 5F98A 1NN3A 3TE6A 3V00A 1G8GA 3E2IA 3M6AA 1UM8A 1DAFA 3S1AB 1A2KC 1R8QA 2C03A 2QMHA 2FEMA 4HATA 3TVDA 3ONWA 3GEIA 1EK0A 3EWSA 4IJMA 2QNRA 3NH6A 6Q21A 4KBGA 3KQKA 2W2VA 1V43A 2KB0A 1JAIA 1TU3A 2YOGA 1UBGA 1VHLA 3EWAA 5FOSA 2WKPA 1N6LA 2ZRIA 3GFTA 2QE7A 4OHZA 2IUSA 1QHXA 2DYKA 1ZM7A 2FNAA 2VTKA 2GAOA 4ASUD 2FFAA 4A6PA 4J0QA 4ZDJA 1ZC3A 1COWA 1IAQA 3EA0A 1TQ6A 4QJ5A 2IF0A 3QY0A 1F3OA 3H84A 4BUJA 4OI4A 1JBKA 2QGNA 2FFHA 3VHXA 1SXJA 2IXGA 2CLDX 5L3QA 4BPBA 3KJHA 4JBYA 1R0WA 4MYHA 3ADCA 1XD2A 3CX8A 1ZD8A 3V4FA 4OBEA 3FYHA 4A82A 4TQUS 1XEWY 3VTKA 3LO5A 4IFBA 1OXUA 1R0ZA 1JECA 2V54A 4GI7A 1CLUA 4LHWA 2O8BB 1CF4A 1SVLA 1IBRA 2IS4A 3CH5A 2VP0A 4UNSA 3U3MA 3QXSA 1XTIA 4GOKA 1JR3A 4QJ3A 5BWMA 2VHQA 3RC8A 4QM6A 1YZLA 5DHFA 1EFHA 1CRQA 1P4SA 1OYYA 2MSDB 4IXNA 4RZXA 2ZE8A 2JLUA 1TF5A 1N2CE 1NKTA 3LDAA 4P4SA 4QRHA 3KQLA 2RGXA 1R0YA 1DADA 3MAAC 2QZ4A 1U0JA 4GOJA 4RY2A 4GSYA 1OSNA 2DFTA 3IO3A 4BFUA 1II9A 1GL6A 4IW3B 3VR2A 3ZVNA 1KJWA 4RKEA 2V3CC 1YZUA 3HJNA 3U7EB 1IONA 4IDOA 3REFA 4DLWA 1ZMXA 5KDOA 4OHXA 3AF2A 2G1JA 2ZS7A 3AKYA 1IY1A 1GIAA 3GJ5A 1XFAA 4KCGA 1EX6A 1S4QA 2AWOA 3TLXA 1U99A 3LQRA 4AKIA 4UJ5A 1RZ3A 1W4AA 3EPHA 2XTNA 3KKNA 3I62A 5H1YA 1P61B 1E2EA 3HR7A 3BRWD 3AVPA 3ND9A 1G5RA 2XZOA 1R5OA 3ASYA 2FG5A 4DSNA 4Q7KA 4LZZA 3U3KA 4D0NA 3U44A 4ZDWA 4LPKA 3WNBA 3GJ6A 3SYNA 1Z63A 3ASZA 4BFWA 3LLMA 3CF0A 4RD3A 4URYR 3C5CA 1Q3TA 3GLIE 3SJCA 2HCBA 2Y8EA 1NBMA 5HR5A 3ZIAD 4ABYA 1G7RA 4Q4AB 1HA3A 2ZSDA 5FTLA 3QXXA 1PLJA 4QBGB 1GP2A 3I73A 3H4MA 2ZRDA 2W2TA 5CLLA 3W34A 1G9XA 3SYKA 2OSBA 2GHIA 2XTZA 1F60A 1EFUA 3K70C 2YC2C 2YHSA 4M53A 1N0VC 2CNWD 3IDQA 1CR1A 2HCJB 3WYFA 1E98A 3R8FA 1R8SA 5KYKA 4ITRC 5JMTA 3B6EA 1E1RA 5D3MB 4Q7JB 2DY1A 2ONKA 3NH9A 1E2IA 3TW8B 4LGMA 3FMFA 3CONA 1K6MA 1IXZA 4D4LA 2W6IA 2MMGA 2TMKA 4QBHA 5DHAA 4BLOA 1GRQA 4CEJB 2F1HA 3KQNA 2EFCB 2PLRA 1N6HA 4ERNA 3QG5A 3ICQB 4XD7A 3T1QA 2G77B 3QBTA 4JVLA 4QGAA 1N6IA 4B2PA 1XMVA 5KPJA 1DAGA 5L8VA 5E7MA 5BXQC 1OFIA 3SYLA 1YU9A 3FMIA 1S0UA 1MO3A 3CRW1 3IKJA 3K09A 4MKFA 3KX2A 1FP6A 2GJAA 1E9EA 2IX3A 1WP9A 2NQ2C 2QBYA 3K53A 4DUGA 2O8DA 1MOZA 1CBUA 4KFTA 2WWHA 3ECCA 5FUVA 4TYWA 4D80A 2G0NA 4XTRA 4MRRA 3PUZA 3WXMA 4EQ6A 4YMVA 5CIWA 2JGNA 4JLAA 3MWJA 1NNEA 2YWEA 4Q4JA 2AL7A 1E94E 4Q02A 4YDSA 1HQYE 3T61A 621PA 2IUUA 2GXSA 4ZCMA 3PUVA 3SN6A 3DKPA 4MKHA 1UEIA 3B82A 4DCSA 2JLWA 2JJ8A 3C41J 5CB6A 1S3SA 4HDCA 2Q3MA 4HEJA 5FI0B 4NL4H 4URXR 1K5GA 2EW1A 4IFEA 1M2OB 4G5OA 2FFBA 3N2IA 2PCJA 4PFSA 1AS3A 4JJZA 5C2JB 3U5ZB 5KU1A 3THXA 2ERXA 1RPZA 2W83A 3FHCB 4B3FX 4CRWB 3QG1A 3PXGA 1SVSA 4LY6A 2WWGA 4M21A 3WNDA 3KKQA 1GTVA 2XZLA 1E9DA 3QENA 1OV4A 3MWLA 2QP9X 3EASA 2N46A 2QMOA 3RSLA 3SS8A 4C0AC 1HT2E 5K8IA 4PO1A 1YZNA 4O3MA 5AUPB 2CK3D 2GJ8A 2IYZA 3U60B 1X8JA 3LAWA 3FKQA 4KO8A 2QAGA 2QN6A 4O2LA 5E4FA 1GNQA 3DVLA 4CZ2A 3EPKA 1N6OA 3H2YA 1FFHA 3PEVA 4OHWA 1S2MA 3BB4A 1F2TB 1EFTA 1KAOA 3W8RA 4TMWA 3HYRA 2C95A 1XP8A 3A8TA 3AVTA 3VKWA 3DMDA 2CL0X 4RZ2A 2ATVA 2ZYWX 3F0TA 3VU9B 4F38A 4WXPA 2Z5FA 2QTHA 4PR0A 1H65A 1YR8A 2GBLC 4YC7A 4Q5IA 1E1RD 4C9BA 2QEQA 3IUYA 5JSZA 4W9MC 1OLOA 2IWHA 1P9RA 1PUJA 4EPVA 3EZ2A 1H8HA 2ZJBA 4OHVA 5FUWA 1I2DA 1CU1A 1QHSA 4PHGA 2FZ4A 4QNRA 1SZPA 1Z0IA 2J5XA 2QUZA 4R9UC 3KXLA 3SFZA 2X1VA 5B58C 2H8KA 3TH5A 1T9HA 2GF9A 5TY0A 4UJ3A 3AF3A 1T3HA 2DFKB 2RGAA 5DGXA 1FUUA 1G16A 3UATA 3AP1A 4FW9A 1II8A 3U2QA 3I61A 1N6KA 5DH9A 3TR0A 1GRNA 4M1TA 5FR1A 3CLVA 3I4LA 3O47A 2ZM5A 2OFWA 1X86B 3VHLB 4EIWA 1YQTA 1OHHA 2O8FB 4OHYA 3RHFA 5EE9A 2ZSBA 1T5IA 5EE5B 3BOSA 5GJWC 4URVR 1Q0UA 4LYAA 4A1FA 5KHOC 1E9AA 5J4VA 2NZ8A 1JPNA 4GMXA 1EG7A 3X2SA 3GLIB 3IO5A 5DI3B 4LYJA 3BH6A 3KXKA 1JR6A 1EFRD 1OF1A 2NTYC 3ADBA 4RD1A 5K8UA 5FBRB 1TF7A 4M22A 2ZRGA 3WP1B 3ZQ6A 2HT6A 2R6FA 2YINC 4QGFA 1VPLA 3VR5A 3TIFA 4LDJA 2V6JA 1E4VA 4B34A 1W1WA 3ETLA 1KKLA 5BN5A 1W7AA 5JS8A 1N6PA 1E79D 4LCBA 2RAPA 3BC1A 1N3BA 1WF3A 2QMUA 5FFMA 4B73A 4YXWD 1ONBA 4HAXA 4TMVA 1IN8A 5B57C 3OAAA 2WJYA 4LWZA 4UQOA 1GG2A 2QG6A 4F92B 5HTKA 3NHAA 5A4JA 1NI3A 1R5NA 5FOVA 3VX3A 1Z3IX 2IHYA 3M0EA 4JBXA 1W36B 2D4HA 4OQLA 4P33A 3CNOA 4PC1A 3D7MA 2FWRA 5KDLA 2ZPTX 4ZI2A 3BWDD 4Q1BA 4UNQA 3LX5A 1OW3B 1FW6A 4HLQB 1TEVA 5EZ6B 4TL9A 1N6NA 4K46A 2ZSAA 3AGQA 2EFGA 1IQPA 3KZ1E 1I4LD 4JKIA 2WWXA 3ZS8A 1U81A 4NH0A 4B43A 3I5YA 2VRWA 3RLFA 4DCNA 1XTJA 4D26A 4MGIR 1NJFA 1UKEA 2VEDA 3W6NA 4O0MA 2BBSA 4LHVA 4MGKR 1TUEA 1N5JA 1MV5A 1SULA 3OE7D 2H92A 3LNCA 4FWTA 2GZAA 3TR5A 1KZGB 3LH5A 1JB1A 1FUKA 4B35A 4JLKA 2WOOA 2C2HA 4JIMA 5J4LA 1GOTA 2GWHA 1GL7A 2KSQA 4DCUA 1E3MA 1LV7A 2KE5A 4JLBA 2RGBA 3RS4A 3BGWA 3C8UA 1NG1A 4KU4A 4B6FA 4OI2A 3PENA 2AN9A 3OZXA 3RS3A 4ASUA 3CRMA 4C7OA 2A5YB 3WMFA 3UWOA 1GKYA 2ZRKA 4S35A 1DEKA 2RMKA 3UXMA 4EFMA 4FCWA 2WJHA 3CW2A 4HZIA 1QHGA 4DVGA 1JNYA 5JWOA 2EQBA 2A7QA 4G5GA 5HKKD 1NVWQ 2KWIA 4LJ6A 1KAGA 1E96A 2FZLA 4XTCS 2NPIA 3I92A 4P0TA 5TARA 3ZIAA 2V9PA 1RIFA 1Z0DA 3EIHA 4UXHA 5FOTA 4OK6A 2H16A 2WZQA 2GETA 1ZINA 3FMOB 5HZKA 3K70D 4MDFA 1BYUA 1BS1A 2EU8A 2ODEA 2OT3B 3K09C 4GOXA 5IHPA 4E07A 4GFDA 4Q66C 5HE9A 1A1VA 2ZREA 1NY6A 2KBFA 2YC4C 1X8KA 1HT1E 4FMBB 4H1VA 1T8TA 4URUR 4OK5A 4XVUA 2CBZA 1NJGA 3HPRA 2QT1A 1R0XA 4CEHB 2ZYUX 1DAKA 2VQSA 5BYJA 1VMAA 1NVUQ 1Q1EA 4TYYA 3D3QA 2OG2A 3OF5A 2WKQA 4JSYA 1SXJE 1YVDA 1XDBA 3U3OA 3NC1C 2P67A 2WSSA 4Z1MA 1VIAA 2OO7A 4B71A 1QRAA 5FTKA 1BYIA 1F2TA 4KSCA 3BK7A 1KO1A 4X8MA 5FPYA 3C4JA 2ZE6A 4IDQA 3AM1A 5TV2A 2J0UB 2JCSA 2F1RA 1R7RA 4NCIA 1S3GA 3MMPA 2OBLA 3B8HA 2CJWB 2DWOA 3PG5A 4X8HA 1DPFA 3SQWA 1F6BA 2D7CA 3Q72A 2CLSA 4BLSA 1E2GA 2HJVA 5E7IA 1F48A 1J99A 4C0SA 4IHQA 2BVNA 3GLHE 1R5BA 4DLUA 4GL2A 2ZRFA 4IKEA 4TQAA 1ZD9A 4B3DA 3EC2A 4LJYA 1NMZA 1TF2A 2YV5A 3GLGE 2WJVA 3TAUA 1GAJA 3K9GA 4JT2A 5TMPA 4Q47A 3L8ZA 1HY3A 2J7KA 3K0CA 3GQBA 3HPQA 2DHRA 1J2JA 4I1VA 2QRZA 4I4LA 4HB4A 5BW8A 4M1OA 4AYXA 3AGPA 3K9NA 4RVCA 3U44B 3L2OB 2F6RA 3CNNA 2GXQA 2CLCX 5FPSA 4DRZA 1LVGA 1E0JA 2REBA 2W0MA 4OQNA 3NC0C 2OILA 4US0R 5DO9A 2VYFA 4PZLA 1TTTA 2R44A 4N3NA 4RD6A 3TJZA 1E79A 2A2ZA 2WJJA 3EIQA 5E7JA 2J0SA 4N1AA 3ZVMA 1NBME 4JVSB 5EE0A 1RRGA 3SR0A 5B2ZA 4A0RA 1ZRHA 5KPDA 4HDQB 4RKFA 1P2VA 1HH4A 2I4IA 1WBDA 1QVAA 1TEXA 1XMSA 1Z0JA 4DT1B 2VLIA 5FUXA 2AR7A 4BEJA 3O8BA 1T8UA 3JZMA 2IYQA 1KNQA 4R71A 2BJVA 4M0LA 2GA8A 4AWXA 4EJSC 5JBQA 1ZAKA 4TMZA 3QI2A 4Q48A 5EXXA 4U00A 2QTFA 2AKAB 3TQFA 1D9ZA 4PZYA 3QF4A 2QMEA 4AIIA 4JLOA 1RC8A 2QY9A 1EXMA 1JALA 2CEAA 2Q9BA 3H1TA 3IIKA 3CBQA 4IOLA 5AUOB 2OCAA 3THWB 4JT4A 3D8BA 4C0KA 1XTSA 4HAUA 2BC9A 3CM0A 2N1BA 4CW7A 2WKRA 2GCNA 2J46A 4XIGS 2DFLA 1SVKA 2P2LA 2XOKA 3GMTA 2O52A 2ZJ5A 5AJWA 1ZM4A 3BB3A 4NYMQ 1U98A 5J4HA 1CJMA 1VCIA 1SHZA 2YWGA 5JRZA 2QGZA 3I32A 1E9RA 1OPXA 5DLQC 3T34A 1SGWA 1W49A 3QPVA 1G5TA 3B1YA 2FSFA 2YOHA 2ZI7A 5GVRA 3ZD7A 4PAOA 3TAHA 4EQ6B 5J47A 5KO2A 1P72A 4JLPA 2RHMA 3FOZA 2D2FA 3WP0A 1VYVA 2ZETA 4HLUC 3LQQA 4R2IA 3OESA 4D81A 1DBSA 1XXHB 5G53C 2IYXA 2CVHA 1Z5ZA 2BM1A 1M7GA 1UBFA 4P4UA 1DAEA 2PEZA 3PFIA 2CHGA 5SZJA 4GRAA 3AH8A 3BD9A 1W46A 4TYPA 1CKEA 1MH1A 2P5TB 3KJIA 4KLZA 1PLLA 3R8CA 4Q9JA 5K8LA 4CEIA 1HEIA 3HR8A 1XCGB 4DSOA 4EPXA 2PZEA 2ZRNA 1G1MA 3NTUA 5AJZA 5FR2A 2CCJA 4KYUA 5D3QA 4HB0A 4C7OB 2LKDA 5EUMA 1EESA 3PCRB 1YR6A 1XF9A 1A5TA 1IM2A 4QL3A 1UBCA 4QXAA 2G9NA 3BXZA 3PJRA 2PX0A 3DZ8A 2OHFA 2W0SA 2LCFA 4TYQA 3L8YA 4PZZA 1KNXA 4XSGA 3QKRA 1ZU5A 2ZRBA 3AV0B 2J0QA 1TMKA 4ZIRB 1T91A 1CR2A 1DAIA 3AVYA 3BFXA 1RVDA 2IA5A 1OJLA 4XJXA 2ANCA 1DTSA 2PMKA 1FTNA 3GFOA 4BECA 4TMKA 4KAXA 2F1JA 1N25A 4QBIA 2ZROA 1WCV1 3Q5EA 5SZIA 2A30A 4PAMA 1E69A 4U5XA 4DDUA 2VF8A 3VKGA 1ZIPA 3FHOA 1JXMA 1M7BA 2Z6VA 5JSZB 2PZFA 1FZQA 5JS7A 1K5DA 3PEYA 1HE1C 1OKKA 2W2XA 4DXAA 3SJZA 2C04A 2RGNA 1L2TA 4C0JA 3SZRA 4WZAE 2V1UA 2VP4A 3K0EA 2OE2A 4BFVA 4ACBA 4ZIRA 4XVRA 1S96A 4R2HA 2I3BA 4TTQA 5FOUA 3BH0A 4EPRA 2AD5A 5TXGA 4TN1A 2AKYA 1E9CA 4D4JA 1JPJA 4OJQA 1ZM2A 5KSOA 2IXEA 3R7WB 3GD7A 1EFRA 4A15A 3P27A 3FGNA 1G7CA 3W6PA 4V02A 3FPAA 4E09A 4Z51A 4FMDF 1WMSA 2X2EA 1G19A 3T12A 2JLRA 4EPYA 2X8AA 2B21A 2VPPA 4TLEA 2BMDA 1CJTC 2P5SA 4MRVA 3RDPA 4M1KA 4Q4AA 3TUZC 1G21E 5LDDC 4IXMA 4FCVA 2OV2A 5IT5A 4JL8A 4B47A 4BQSA 1X1SA 2WSMA 3K0AB 3KB1A 4TZ0A 4Q9IA 3VR4A 1RYHA 1DELA 2ORVA 1NMXA 4FIDA 1E99A 1OH5A 3AKDA 1X1RA 3QVVA 3LWNA 1NVVQ 4WXRA 1OXXK 3LVQE 4P32A 2YJTD 2WIAA 2AFIE 4Q03A 2ATXA 2ZJAA 3GLHA 1GUAA 4JLJA 5D3MA 1W5TA 2NG1A 1Z2AA 2NO9A 2HLDD 4HAZA 4LV6A 1MO6A 2ZR9A 2FX3A 4XVQA 2ZJ2A 1U8YA 2F9LA 3FKSA 5C18A 4JVNA 4TTRA 4HUQB 1AS2A 1ZUHA 2C96A 4M9ZA 4V0LA 1M74A 1OIWA 3HYTA 3CF2A 3KUDA 3KQHA 4M1YA 3IBYA 4PSAA 2WM9B 3TNFA 3GJ7A 1FTSA 5DYGA 3QJYA 1J8MF 2JJ2D 2GESA 1XEXB 3OIYA 1QDEA 4HI0E 3VKHA 3K0AA 4DJTA 2X77A 4JBWA 2F9MA 3KKOA 1MABB 1QG2A 2GEUA 2MSEB 2JLXA 2W6ID 3IQXA 1MO5A 1N5LA 2MSCB 2RH5A 3C7KA 3OE7A 4HDOB 4WZ6A 1PVOA 4NCNA 1W0KD 1ZU4A 5HPYB 2WWWA 3T1OA 2ZYVX 4ZI3A 4A0FA 5JEEA 5SZKB 1J70A 1Q1QA 2V7QD 1U90A 2IF2A 5FPHA 4B74A 1BH2A 4XWAA 1NN5A 5AJYA 2FFQA 4V0ME 3QF7A 1SVWA 3QKSA 2B7CA 2XJ9A 1FNNA 1Z6TA 1GZSA 1WDTA 3OEED 4HLUA 3EZ6A 2GJKA 1YR7A 2DCUA 2IYTA 2ZTSA 4D0LB 2O8EA 5P21A 4LBYA 4JVMA 3PV0A 2ORWA 3IILA 2BMFA 1GVNB 2NZJA 1Y3AA 2A5GA 4LYFA 4OI0A 3A1UA 2O8CB 1VYUA 2QPOA 3RWOA 1TPZA 1D2MA 4AI6A 1T0JB 2DFNA 2QQEA 2VO1A 5EP3A 5FTMA 5IDVA 4B32A 1ZW6A 1XX6A 1NLZA 2XJ4A 2ZRCA 4PHTA 2ZRMA 1JQJC 3JVUA 1A4RA 2RKOA 1W4BA 3THYB 1V5WA 2RB4A 3AP2A 4JL5A 2IYSA 1KO4A 2V6IA 3QKSB 1HYQA 5LB4A 3WY9A 1XD2B 4Q19A 3ZVRA 5CK5A 4HB2A 3I5XA 3NHBA 2YVUA 2OBMA 3DOFA 3CUEF 3DOEA 4PXAA 1H8ED 3BH7A 1P62B 1QZXA 3FE2A 1COWD 4LC0A 3PUYA 2CXXA 3KJEA 1ZJ6A 3VMFA 3IPYA 2PX3A 4HZUA 1JJVA 3N5CA 4FMDB 3SJAA 1XPRA 1XJCA 2ZJYA 5E3HA 2YKGA 4JLDA 2ZJOA 4QOSA 2WSSD 4Z1MD 2C5LA 5DI9A 3LRPA 4BRWA 4FWIB 3SU8A 4XD7D 5FL7A 3QIAA 3GLFE 4Q7MB 3BS4A 5FTJA 4A92A 4CEHA 1DE0A 3QBVA 4KXFB 2BBTA 2XGJA 1LW7A 1LF0A 4B3XA 4TYNA 2FE4A 4HYYA 3LLUA 1Z0KA 4PO9A 4JSTA 3OEHA 3AVXA 2V1XA 3TUIC 1E2NA 1N0UA 1NY5A 1Z28A 4Q1FA 5HE8A 2C8VA 2GXUA 4KFUA 4AKHA 5C4MA 2GXAA 2OFOA 3VR3A 2F3RA 2VF7A 4X8LA 1T3SA 2BHRA 1YZKA 1Q21A 4LBVA 4NCJA 2X2FA 3I72A 5AK0A 2ZAOA 4FXPA 2C9CA 4RD2A 3AVVA 5JJLA 8OHMA 1GFIA 3P20A 4CT4B 2GZHA 3NBYC 3ND8A 2WMOB 1YKSA 5L3RA 3UG6A 1SKQA 5BYKA 2QSYA 1U9IC 3QXHA 4EPWA 1AS0A 4LRWA 3MWKA 3VNVA 2WMNB 5EQTA 4UXJA 1S1MA 3MG9A 3WBKA 4ZV4A 3IHWA 2QE7D 4A0HA 5A5GA 1E9BA 2GVZC 2OBNA 2QM7A 1E2JA 1E6CA 4EAQA 1E0AA 5DISB 5KSZA 2WWFA 2RGCA 3H0KA 4DHEA 1WRBA 3NBZC 2FPLA 5DN6A 2PT5A 3RRNA 3IIMA 1GNRA 1LF5A 4M1WA 5LBIA 4IOJA 1TQ4A 2HEIA 1TQDA 4V0KA 1A7JA 4TL6A 5JCPA 1TU4A 4IVRA 2WAYA 1G3UA 3CX6A 1CR4A 2VP2A 4N0DA 5G40A 2WOJA 3LBHA 1JQLB 4EJSA 2ZYTX 4L5BA 4BASA 3CNLA 1ZYUA 2ZRJA 1AQYA 2ZITA 4QC2A 1ZD1A 3CWZA 4YLGA 1IN4A 3FFAA 3IIJA 4NHOA 2H5EA 1K8RA 1D9XA 1KSGA 4DEXA 2JLVA 3SNHA 4RFSA 2WPDA 4MUBA 3U7HB 1YR9A 1P7CA 521PA 5JFGA 1M8PA 4Q4HB 2ODNA 2D62A 1X8LA 5CK4A 2GAAA 2IWRA 4JLNA 4PC7A 3ZZUA 1ESMA 2JJ1A 1WA5A 3KUCA 4L9SA 1QHHB 1J8YF 3MWYW 2CHVA 2HUPA 1FX0B 1KDOA 2ECKA 1Z47A 4Z8XA 3TVTA 4B75A 4DIEA 1T3LA 5JCZA 3U6BA 1HV8A 2F3TA 2OFXA 1NLFA 3SBEA 1L7VC 5AWFC 2O0KA 1G17A 3BBPA 4YONB 2A9KA 3QVUA 4LSGA 1D5CA 4Q1AA 3HU3A 3L82B 4NP6A 4EKDA 4NCHA 5FBQB 3AEZA 1SXJC 1IJFA 3A37A 4FI3C 1XTRA 4QHYA 4CGZA 5CDFA 1QHIA 1AGPA 2QQ0A 2ZS8A 1UADA 4WZBE 4RFSB 3SDZA 2Z0MA 4RCYA 4RJLA 1OH6A 3WYGA 4TT3A 1AKEA 2CMKA 2PBRA 1GKUB 3B9QA 5KNCA 4NONA 1QHNA 1DAHA 1G5PA 2DWQA 1CP2A 4ACAA 4HAVA 4C3ZA 1JI0A 3BJIC 3PUWA 5SZHB 3K9LA 2XSZD 4A6XA 3R9IA 1ZNZA 1DAMA 2HF9A 3OIWA 1G8HA 1GITA 4DBLC 3PUXA 3GJ4A 5CIQA 1ODFA 1WE2A 1PV4A 1G8FA 2WJIA 4BLPA 5FPTA 4DB4A 2JAQA 1G3IA 4Q4LA 2CL7X 1AZTA 3U7GA 4DCVA 4DDVA 4DDWA 5DN6D 2VL7A 5G41A 4CDGA 3CZQA 3DM5A 1Q44A 4CYMA 3RNLA 3THYA 5EE3A 3RS0A 2QU8A 4HB3A 4MYTA 3X1ZA 1NL3A 3KXIA 5DSZA 1C1YA 5EXTA 4B2LA 4QBFA 3MSXA 1IHUA 2JDIA 4IEEA 2C99A 4OKSA 1ZIOA 3WHKA 1XNJA 3T35A 2IL1A 3DM9B 1G6OA 4XH9B 4PC3A 4EUNA 3Q3JB 3U6KA 3CWQA 3W8NA 1VG1A 2PCLA 1A82A 1KZ7B 2IEZA 2GKSA 2ZVPX 3NBFA 3QKRB 3AF0A 4CIDA 5JJKA 5AJXA 3VQTA 1IN5A 1XPOA 1VHTA 2OM2A 1SKYE 1G3MA 2GJSA 2JJ2A 3G5UA 4KBFA 2ODBA 4OQXA 4D4KA 1KO8A 2WBLC 3QKUA 1RFLA 2CVFA 1Z07A 4M4SA 3VX4A 1XBTA 1W36C 4DLTA 5JLJA 5AUQA 1G8PA 5B64A 3X1XA 3EZ9A 3UWKA 4C2TA 4E5UA 4Q1CA 1W0KA 3A1TA 3GLGB 4B2IA 1G7TA 3ZZTA 1IXSB 2ZANA 2W6JD 3LBNA 1SQ5A 4Q9KA 1NVVR 3TMKA 3G82C 4GMDA 2YWHA 3IEUA 3AF4A 4MYUA 4Y0AA 4WAUA 3GFPA 5HZHA 4NCKA 2GEDA 2OCYC 3KFXA 1LS1A 3EX7C 3L0SA 4JYBA 2F43B 2VHCA 3A1VA 5KUTA 1UJ2A 2WWYA 1OH8A 2BMEA 4RD0A 4MGYR 5ANRB 3SQXA 3Q85A 4MRSA 2H17A 2J9RA 4A0GA 4EFLA 2IEYA 4F7WA 2ZSFA 1P6XA 3CF6R 4NBSA 4PQFA 4LJAA 1CJUC 1GNPA 4EPTA 2JATA 4PAQA 5AUNB 3SOPA 5F9FA 1M1YE 3MGCA 3TQCA 2ZS9A 4TT3D 1CULC 4E03A 5CM8B 1U8ZA 2W00A 3NIBA 2XITA 4IDHA 3UMSA 3I8SA 2PZGA 4BLRA 1E2LA 3CKLA 4LPSA 1SKYB 2FF7A 3NEJA 4OI1A 4BFXA 4RSGA 4C0BA 2HLDA 1KI8A 2FMXA 4LX0A 4II7A 3KKMA 1OIXA 2GVDC 5LPNA 3CIOA 2VP6A 2VSXA 5EP1A 3O8DA 3WMGA 2YZ2A 3LY5A 1AQUA 1XEFA 2OXCA 5C4GB 1DO0A 3LW8A 3KB2A 5AJVB 1ZCBA 4HLDA 3UIEA 2GBLA 2LKCA 1MRNA 1SXJD 4AC9A 2UZ3A 5JJIA 1XMJA 3CRRA 3GLIA 4KYIB 2Q0HA 4DDTA 5DI3A 1CJVC 4DSUA 2GZDA 4YQFA 5IRCD 3K0FA 2YOFA 4Q01A 1G20E 1KY2A 4AG6A 5CITA 2CL6X 3L0IB 1OXTA 1VG9B 1C4OA 1IY0A 1Z0AA 2LWIA 3BB1A 2ERYA 2J41A 2JJ1D 2FPKA 1XTKA 1Z0FA 2JEOA 3HP1A 4C0QC 1IY2A 2QPTA 4F93B 1KDTA 1KK1A 2GNOA 3NEYA 4UXIA 1PJRA 4BFTA 3QEOA 1I4TD 3SJBA 4QM7A 4Q9LA 2BKUA 3VNUA 2R2AA 5H8WA 3Q7QA 1IJEA 5FBWB 3CRVA 2G83A 3FVQA 1P73A 5GVSA 3EIEA 3U4QA 3P4YA 1KGDA 2IW3A 5ELXA 2WV9A 4Q4HA 2QP3A 1KO7A 2J87A 1PUIA 2BM0A 3DPUA 4IVPA 4V03A 2IYUA 2JASA 4A2QA 3FTQA 1XPUA 1SHKA 2AD1A 2QM8A 5JWRA 1RW4A 4H9GA 5FBLB 1ZUIA 4M9XA 721PA 1B23P 2IUTA 1NP6A 4MKIA 4L8GA 2A5FA 2D7DA 2VHJA 2ODWA 5KOYA 3HU1A 1JR3E 3TBKA 2KBEA 4CT5A 4H1UA 4NU0A 3GLFA 3EC1A 1NN1A 3U7FB 3FWYA 2BDTA 2EWVA 3UMRA 1WXQA 4O2RA 4D0GA 1XB2A 3KQUA 3ZH9B 3A1SA 3LVRE 3V4RA 2MMCA 4C0HA 2P3SA 4D82A 2EYUA 4HUTA 3QSYA 1I2MA 2Z4SA 1F5NA 2IYWA 2ZR7A 1OB5A 4A36A 2NMVA 2G0TA 2EVWX 2PEYA 2QT0A 3VR1A 2FSHA 4F4JA 4TZ6A 1OXVA 3ZVLA 2OCPA 4O25A 4QHSA 4A2PA 2ZI4A 3BAFA 3W3AA 2FN4A 5FOXA 4G5RA 3ZYCA 4WOPA 3CR7A 2RHDA 1GL9B 2IS6A 2B8TA 4NYIQ 2A5DA 4XSHA 2GEVA 3LXXA 3ZS9A 2QTVB 4W5WA 2Q3FA 3I8XA 2ZXUA 2ZRLA 2BCGY 4X8OA 4I99A 4OYHA 1Z22A 2J1LA 3UG7A 1E2QA 1XZPA 4K81B 2Q9CA 2IK8A 4PANA 4TLCA 4BWYA 3EPLA 3G0HA 3FHTA 1ESNA 1U0HC
chains in the Genus database with same CATH superfamily
5G05L 5G3ZA 4NE2A 4EMTA 3NFRA 1D8AA 3DF0A 3AKQA 1E5XA 2KXNB 1WMFA 4YW7A 1YV9A 4ZTZB 3IAXA 2II6A 2VQEB 2P2SA 1OLUB 2WSEC 1LLDA 3WG4A 3QW4B 4HL0A 4BDPA 4KQXA 4DLYA 3U7RA 5K4AA 1R8BA 2XQVA 1CUFA 4R2WA 4H2DA 1QTQA 4X6YA 1DJQA 3BE4A 1FFWA 5DHTA 1NM2A 4FE7A 1GQEA 1U9CA 4A8OA 5FT9A 2FPPB 4DM3A 4CDWC 4X64F 4CH0S 3G8QA 3UOWA 1NQAO 1FE0A 3F0NA 2B4AA 4D7YA 3N05A 3P4XA 4PYAA 3R8YA 4B3CA 1RM5A 2HDOA 2JDUA 3AVUA 5AOVA 2HRQA 2VTVA 1QVRA 1D6SA 4WX2B 3TO5A 3OUTA 4K9LA 1GFSA 2Y0BB 2Y6JA 3FOWA 2EQ5A 3AM4A 4YMWA 4I1OA 3VYRB 1TUIA 2G5TA 2VT7A 2SHKA 4DR7F 1H9CA 3GILA 4XFCA 2Z56B 1N2CB 4NAUA 1C1LA 1UZUA 1J7KA 2XW6A 3PICA 3SE0A 4UFLA 4FNHA 3TUPA 1V1JA 1K47A 3LOPA 1VRH2 3FMPB 1Q20A 3TLCA 1NAHA 2NIPA 1QGLA 4IXWA 2DXFA 4BFYA 1X36A 1A8PA 1CIJA 4BX0A 1HBUB 4B4QA 3TTVA 4P7FA 4ENPA 2AIRB 2SICE 3VH4A 1E9FA 2IXDA 4OHRA 1DG3A 1YB6A 4MS3B 1M9NA 4HQNA 4H08A 2QI9C 3M8LA 4Y1YA 3Q2SC 3HEIA 1DKLA 1EEXB 3D2BA 3ZR4B 1DYKA 1S2BA 2A9OA 3R3HA 5K09A 3IWZA 1N75A 4P5PA 2BABA 5C8WA 5DNYB 1ANKA 1KI7A 3WDVA 1G41A 4BNHA 1JAXA 5K03A 3RFFA 4TMXA 5M3BA 3HT0A 3MMAB 5DN2A 1MTOA 5DEOA 4JITA 1ZBE2 5JT1A 1LA2A 5A3VA 4FP3A 2UYCA 3BSAA 3WW1A 3C3WA 4A8TA 3OAAD 3K51A 4QPIB 3TGPA 4TLDA 3FJOA 5F8IA 5FFNA 5G1OA 4CCJA 1K08A 5GV7A 5I93A 3W6OA 1IZ3A 4RS5A 2JI9A 4X2BA 1LBHA 3I6ZA 4CM8A 3FE5A 2F4FA 5AHOA 4UMFA 5CBKA 4DSTA 4HK8A 3DKRA 4E8CA 3AOEA 5A6XA 2VYVD 3AB3A 1GP6A 1P60A 1GQQA 4AX4A 5KR7A 1P31A 1KVRA 1W5AA 3LLCA 1H6YA 2FA9A 3U40A 3WAGA 2OEPA 2C5SA 1QFXA 1SPXA 4LF6B 1YZGA 3ZPOA 5KOJA 3T3GA 1U0HA 1V7CA 3ZWAA 4C3KA 1FYWA 5EKTA 4D2IA 3QWPA 1CJKB 4QXHA 2PLAA 1ZGGA 1MS0A 2J8AA 2AHRA 2J0QD 1UVLA 4CZSA 1DTTB 3JAMA 2FTRA 3MJHA 2GCOA 3E1F1 2JC0A 2CZVC 1MO4A 2WS93 3GEHA 1QOOA 3GIMA 4P5DA 1N8RT 3C45A 2CYFA 1FQKA 3SX0A 1FUEA 1JG4A 1JQEA 1JIJA 4QWDA 3HNBM 3KG0A 3OR2B 3I97A 2EG5A 4UKDA 4EYHB 4EZHA 3DCQA 1RUSA 4LIRA 1MEEA 5LU9A 2K7FA 1CQZA 2CXEA 4M2LA 4QWCA 1XZEA 2QAJA 2DVMA 2PA7A 3NVMB 3WYNA 4C1NA 2Q3JA 1KOLA 2O7SA 2H2WA 4AI9A 2QDNA 2FHKA 1H3NA 3H1MA 2K0GA 3PLQA 1R6BX 3N75A 2ZU6A 4BMNA 4PICA 2BDRA 1DNPA 4E31A 1G6Q1 4AKEA 2EJWA 5K14A 1ORHA 4KR3A 4N47A 2VMIA 3G87A 2VUTA 5FJJA 2I1QA 3MTBA 1JV2B 2VDNB 4WF9Q 1E4EA 3CEJA 4TV8A 1LNSA 2Y9HA 1FX0A 5CHYA 1RYRA 1S1CA 4PCUA 3UV3A 3A2KA 5C34B 3JQFA 2R62A 1TM5E 2BE7A 2P9GA 1B7FA 1RBYA 2JLGA 2D5IA 4QFDA 1F17A 4MDEA 3HOBA 1N34J 1M6NA 2GH2A 3PKMA 1DZQA 4FFRA 4DUPA 2QDKA 2VFUA 3PR2B 1L4UA 4UNPA 2XLCA 3EGDB 1ZRSA 4ES2A 3P26A 1QU3A 3R0VA 2PC6A 4TRNA 5B08A 3LDRA 4OL8A 4BE4A 1WVGA 1S6QB 3G7UA 3Q9LA 2UUTA 1VKJA 4B83A 3UUWA 1QOSA 3BGOP 3A4NA 4LRBA 1X3SA 2FLOA 2A67A 1QDUB 5DIFA 3K20A 1W2WB 2EXKA 1JFLA 1LQTA 3FH0A 1UK7A 3NKVA 4O44A 1S2EA 4Y6IA 2GBPA 3UA3A 3INAA 3VAIA 4NEGA 2DCLA 3BF4A 2NUPA 2UU9B 1S57A 2WZR1 4JLVA 4LZPA 5F32A 2NM1A 2ZYHA 4LF9J 3MJRA 4B9LA 3QT5A 2J7PA 1ECCA 3NBKA 4XW2A 2DRBA 3J7MA 3P7MA 3M6VA 1E2PA 2WI8A 4CNQA 1L1FA 1JUDA 1EUDB 5CX1A 1FJ7A 2WZ8A 2ZTMA 4G4SP 1A97A 1YI1A 2MQ8A 1II0A 2CCKA 1QR6A 1DBPA 2ZACA 2G28A 4FQ7A 2QVBA 5FO8B 2WIKA 3ZYZA 1YK0A 4KO2S 3FTEA 4CEWC 4GPAA 5C25B 2VVTA 2F8SA 1DV2A 2FDGA 1UNBA 1N57A 4KBBA 4L95C 3I9FA 3PYXA 4PSKA 4RAOA 4BQ2A 3RG0A 2RIPA 3J81k 3SMHA 4Q21A 1X82A 1XNRJ 1XELA 4U2KA 4LITA 3LOIA 3LFMA 1SUAA 5ULLA 5FZ8A 3I5BA 1XDUA 4LV5B 1K5PA 2W43A 4GE0A 3LZZA 3IQFA 3G6VA 3I58A 4G8BA 2Y4NA 1L8LA 2OXIA 4BLVA 4FPJA 4C4ZA 3CX7A 1IQZA 3L93A 3ROMA 2QD4A 4IIEA 1S2KA 1ZOIA 2RJNA 3O2IA 1VBYA 1Z34A 1NYRA 4DM7A 3ZC3A 3QVMA 2H8GA 4BNVA 3ZBPA 3T9EA 1YL5A 1H9AA 3F5SA 2FOXA 5C2GA 3AXKA 3SSSA 5L51A 2BV3A 1S12A 4FPFA 3H8VA 2W0XA 1MORA 2B4VA 4BGDA 4KPCA 4LKRA 4DNQA 4MAFA 4WNAB 2W47A 5A8WA 3M2TA 2VZQA 2AT1B 5A32B 3A36A 3EGZA 4J1SA 4ZXEA 1GLGA 4BNWA 4MIEA 1PJBA 1KMHB 4LECA 1RT4B 3VBHC 1H38A 3UDEA 2W9BB 2Z83A 4BNKA 1L5MA 4MH0R 1WMBA 3OFJA 4YHHF 5J5VA 1D6JA 5GJVC 5JSUA 1VCMA 3IEMA 4OYIA 3CUKA 4ZPXA 4P3KA 1OH7A 3RR8A 3L3CA 3MEEA 2XQXA 4ZRDA 4V38A 1FYXA 1SVOA 2FUEA 2C4MA 5H9PA 4IDEA 2EIDA 3RSJA 2ETVA 2KT2A 2JLBA 4BZQA 1OX4A 5F2EA 4F0JA 5BN1A 1D0SA 1QQP2 4AXXA 1E2KA 3IP5A 3JSXA 4AJLA 2FEAA 2O2CA 3TGWA 1JSCA 5JO9A 1VCOA 4P6VF 4AEDA 1Y3DE 1G8GA 3W5NA 13PKA 3RARA 1ZRRA 3CLTD 5KT5A 1F5JA 4KBGA 4ZMSA 3PNLA 4RTKA 3LOQA 5E7OB 2E7TA 4AUMA 2YOGA 2A58A 5MLCV 1AGXA 5AKIA 4JA2A 3WNXA 1SZDA 4J1QA 4NA3A 1ZAXA 1VLZA 4YW6A 1KJ9A 4IKAA 4MB0A 4LF8J 4LT6A 1C8NA 4JV5J 1N56A 2ZCVA 3VTKA 4IFBA 2EKDA 2QUOA 2GHWA 2NV0A 2JGAA 5K3FA 2NV2B 5C24B 2Y1EA 1AXRA 1QS0A 1P7PA 1CWPA 2PEBA 4OFXA 5C3UA 5IAGA 4L4SA 3CQ9A 1NSQA 3ZVXA 4N5MA 9MHTA 3AF2A 4UFKA 2H59A 3Q40A 2NVBA 3DN7A 3ED5A 1IULA 1E2EA 2OMOA 1G5RA 2FG5A 2J9FA 4EB6B 3O8OB 4MYSA 3CMGA 1UIMA 1R1DA 3WNBA 4HGYA 1XWWA 1KRIA 1NQ5A 4BFWA 3EMBA 3GONA 3JARB 1FFEA 3EVDA 4QDOA 3KD4A 2MCFA 1D9AA 3ZXFA 2GPWA 1S4MA 3PUJA 3IQZA 3QY9A 2FLPA 2DFDA 2VSYA 5ALZA 1ZRMA 3NMAA 4PS1A 4PG7A 4E4DX 3L0ZA 3ICOA 4RPHA 3MS4A 1E98A 3TYJA 2FWAA 3T41A 4LGMA 2HF7A 3RTAA 3MR2A 1AMNA 4CIAA 4OMDA 3GWCA 3DLJA 3H16A 3T1QA 4QGAA 1L5NA 4AT1B 1GLNA 3TKYA 3FZ3A 3EAGA 5FY7A 4KK4A 3AJ2A 2KRBA 3E0QA 5M0TA 3N3BC 3MM9A 1CVJA 5CXQA 2XY5A 3TAMB 1TLLA 1GEEA 5E9WA 1XC7A 2I6QA 5ETSA 5E38A 4IQ4A 2MINB 2N7YA 4M1QA 1KOHA 2GSDA 1AKUA 1A8HA 1UXIA 3T2QA 2FPWA 4BNDA 2LDBA 2PHFA 1E3DA 4CF6A 1DLCA 3MOGA 3AJYA 5BSHA 3MV01 1JKHA 4H16A 4JJZA 3HL0A 3C8YA 5EJFA 4MZXA 4CGYA 1QONA 3OOJA 3MINA 3FIJA 4ZYLA 3B6JA 2GAHC 3F73A 1VQKS 5DHSA 2CC2A 1GUFA 2QMOA 5FP0A 3JQKA 4MS4B 1HT2E 5AM1A 4C3OB 5E1OA 4MA0A 3K1YA 1XJWA 5A70A 2P3OA 4B0PA 2QSUA 3N3HA 1IPHA 4PLOA 2BE9B 3EHKA 1ECLA 1Y5RA 1HQUA 4EHFA 5B6IA 4XVHA 1OLUA 1GTMA 4W7IA 3C16A 5EKXA 4JB0A 1VBA1 1L7RA 3DI6B 5CCMA 2IXKA 3FDFA 2FKNA 1POV0 4H6XA 1YRWA 4MAKA 4AMGA 3EUFA 1Z0IA 3KZKA 5J48A 2BGWA 2W6OA 1W6MA 3JD71 5F41A 1DCSA 3KEFA 4BGIA 4FW9A 1II8A 2WZR3 4FC7A 4DMFA 3ZDAA 1LPBB 1PKUA 3U3ZA 3MBWA 1KXZA 1B8NA 2OFWA 2TUNA 2G71A 2KZMA 4WKCA 5EE5B 3OF2A 4G0UA 5BMVB 3DQPA 5HV0A 1UWVA 3MAGA 3IO5A 2HSGA 3KXKA 5FBRB 3QZ8A 5I8YA 2XPJA 1OXKB 4Y2PA 3OEBA 3KZCA 3M8RA 3M5WA 4BQQA 2MQLA 1TD1A 3VR4D 3GH1A 1QMGA 4G24A 3GIKA 1MC5A 2DNMA 3OPXA 1BVUA 3RV4A 5DS7A 5JPMB 1IM8A 3HA2A 4QFBA 1SCSA 4RUBA 1YRYE 2ONCA 1Y34E 5EZ6B 2Z5WA 2LVBA 3WWCA 4X4NA 4K9SA 4Q4Y1 2EWMA 3CNEA 4AW9A 1C3HA 1SBCA 1H98A 1Z62A 1NLRA 2VDJA 1HK7A 3EHDA 3I52A 3CNBA 1QDCA 1KRHA 4GVBB 3JWIA 3X29B 4ZPBA 2P1DA 1J84A 1GTRA 4JIMA 3U48A 3U17A 2JVJA 5A8KB 3VGTA 3EE3A 1UOPA 1FMCA 4JJ8A 4QVIA 4OVKA 3R5DA 3O90A 1QRTA 2PUFA 2A5YB 1LBTA 2YV1A 4DLAA 2IOYA 4HFRA 2P3IA 3HQUA 3EPRA 5HKKD 4CJXA 3N8NA 2D6FA 2VKQA 2V9PA 2F17A 1M5KC 1N36F 4UXHA 3S44A 1TAQA 2HNDA 1AYEA 2HQRA 2QL7A 5DLFA 4MDFA 3K09C 1HZZC 2JHCA 4HLNA 4MW0A 1XPUA 4H1VA 4CWAA 2FHSA 4KN6A 2HLHA 4OLHA 1RWNA 4C7KA 3NVKI 1KGSA 4IHAA 1YHFA 6AT1A 3ORFA 4WZBA 3L95X 3EYWA 4G0ZA 2VVEA 1ZZ7A 5BR4A 2I29A 2OO7A 2E66A 1SN7A 4KSCA 3LE8A 5IKEA 3TYXA 1GCIA 4BY9E 1XLTA 4C6TB 1UTAA 3FMGA 2BVNA 2MZSA 4J6GA 3OF1A 3CVWA 4V19X 3V7NA 2WQ6A 1HNXJ 3M6UA 1I2AA 3SYZA 4PI2A 2HHJA 2CJ9A 2I3ZA 1S01A 4NBUA 4UF0A 2E5LJ 4PF5A 2BBVA 4DRZA 3TJ8A 2SCUB 4MKYA 4DV2J 3UBMA 2MNGA 3PDQA 4IRKA 4U6SA 1ZYBA 1MQTB 5DK6A 1RQXA 3QIVA 1SLAA 2VW2A 1VC5A 3N9LA 4RXTA 1XMSA 3SIRA 4Q39A 3O3CA 3WXBA 2Q8PA 1VQ7S 3JATB 4R71A 2OV8A 3SBMA 4XJ9A 4M0LA 1PS0A 5CLFA 5FORA 2QQVA 4U00A 2GUGA 2QTFA 3QKIA 2AKAB 2M88A 2EQAA 4LF4F 1J21A 2R072 3GJTB 1NUPA 1VIXA 4G0XA 2P9EA 5A5EA 3K5PA 3UEOA 5AQEA 5T5LA 3KQPA 1VCIA 3GRUA 4XCAA 1NSKL 1YSCA 4LOSA 4CTAA 2IITA 2JIMA 3R7AA 2VYCA 2H3EB 5D00A 1MS4A 5LDGA 1IVZA 1FS5A 1MIOA 3NG8A 1VYVA 2VYVA 1R9NA 3LRTA 5D3GA 4I2QB 2IYXA 2VJPA 3E6AA 2VNVA 4JGIA 4LEIA 4YJFB 2ZEXA 1FERA 5K7SA 3W63A 2D5CA 3UW3A 5JAUA 4Q9JA 1X1QA 3HR8A 1ZJJA 4GKVA 4BNIA 1OGYA 2WFMA 4QM9A 4FGWA 2DUPA 5A0YB 4AFMA 1YR6A 4U8VA 1Q8SA 4M86A 4ARAA 4EW1A 5EKUA 1QJEA 2W70A 1J9ZA 4TYQA 3CW8X 4FP2A 2FOIA 2IZWA 2WCXA 1DTSA 5FX2A 1REVB 3G0DA 2WNUB 2F1JA 4QGSA 3C6XA 2ZAAA 3D6MB 4PAMA 4M3CE 2W08A 5T3UA 1LPSA 1M7BA 3H50A 2NMNA 1HMVB 2PZFA 1LWCA 4IEYA 2DUUA 5AKGA 3U1LA 5KFYA 5A5VA 3DAOA 2FPUA 1Z8DA 4JQRA 4LMBA 4KXUA 1T8PA 1JXVA 4XK8C 4TTQA 5IVHA 2XCRB 4NBNA 3M5DA 2LUWA 3HKEB 2FZKB 2C83A 4IQMA 1XZAA 4B4OA 4FMDF 2VPPA 1T36A 5AVQA 4DR2J 3P0JA 3TI7A 5KYYB 2YKNA 3GFSA 3ITEA 4Y2IA 1OXBB 4Q9IA 1NXQA 2ORVA 1PGNA 3AKDA 3MSCA 2W2NA 4BO0A 5AW1A 3D8NA 3G7NA 1QIHA 1XLUA 1YB5A 3AJ9A 3OBRA 3VZMA 2RHWA 3T9BA 4ZYVA 4WPGA 5D3MA 3R41A 1JJIA 2INGX 2ZR9A 1U8YA 4BDVB 5CVRA 3V65A 4FYMA 3C6UA 3DWFA 1JN2P 2IODA 3EULA 4OB6A 4CO2A 4K8RB 1YXWA 1J8MF 2HK9A 2XRZA 1WACA 4BP8A 1RUC1 3GGPA 4QODA 4AT1A 5KG2A 3QVWA 5ABJC 2J6HA 3HNRA 2FVSA 1H22A 1E66A 5AW5A 4BEWA 1Y4ZA 4ZI3A 4A0FA 2CWDA 4X1IA 2JEFA 4BUZA 3BQ9A 3L06A 4MKXA 4AXBA 3C5EA 2DJ5A 3L01A 3PTLA 4TTAA 4LK7A 1IY9A 1FNNA 2GZ3A 3M1VB 4PZDA 4C3LA 2VG8A 2ORWA 4HD8A 2YX7A 4JH0A 3RU2A 4CKBA 4R31A 1P39A 5EP9A 4J2HA 1QEXA 2ZKNA 1TPZA 5KNLA 1KQFA 1AA1B 3C6ZA 5EP3A 1O59A 1AX2A 3AHGA 1ZBA1 1J2TA 4O1IA 3TF5A 2FVRA 3JVUA 5DRTA 3DE3X 1FDBA 1V5WA 5EHGA 2VNJA 3AMVA 1BFDA 2FN7A 4J25A 1ZK4A 2ZX3A 2ID4A 4K6GA 4MS4A 1WTCA 5LP6A 1CLFA 4LFCF 5F9LA 2DY0A 4BS2A 3ND6A 3X43A 5A6ZA 3BQ2A 4BO8A 4HANA 4H6VA 4JLDA 3UGKA 4DSKA 3N58A 3L7PA 4OV1A 3KXDA 3O94A 4UOGA 2DKOA 4NRUA 1DE0A 1VBC3 1DQSA 4DR6J 1ULBA 1R6UA 4C1WA 1EHIA 2CLMB 5ISMA 3LLUA 1VB3A 3GXUA 1T1RA 3D6JA 4LQCA 5HROB 3J7HA 2VJYA 4IQ0A 4HHUA 4ZOBA 3SHRA 4BTLA 2UUAF 2V9ZA 1QSSA 4LBVA 5AK0A 3AVVA 2QZPA 2OUIA 4AUKA 4UE6A 3SLKA 1SKQA 1BXRB 3FHAA 1AS0A 2R8ZA 2WMNB 1LFPA 2Q1SA 3MW2A 2AFIA 4NARA 1N4AA 4RWEA 3NPAA 1FBTA 3RSCA 3FF1A 2MSLA 4BEVA 2R1VA 2MU1A 4J90A 1FKPB 2PGXA 5KSZA 1K4YA 4OU5A 2PT5A 1WD4A 2HWB3 4NLDA 4IOJA 5TLSA 2PHDA 1H2FA 1OLSB 4DC0A 2XVZA 3D2AA 3UWMA 1TU4A 2IDJA 1JH9A 4IZHA 2MSTA 4J7AA 3DLTA 1G3UA 1AKMA 4CHTA 1QYXA 4CI9A 1ODJA 1JFFB 5EA2A 3UN1A 4EARA 3E5RA 2HFKA 2VHVA 4R81A 2PA0A 4IQ8A 1Y43B 4AN0A 2FJXA 5ITSA 4DUZB 2AEYA 2ETXA 4Q4HB 2I8EA 3UWPA 4J16C 3ZZUA 1GAQA 5IKXA 2CFRA 2BVVA 3C14B 2ZWMA 4QPJC 2R00C 3B8EA 2ADEA 3IUJA 3TW8A 2A9KA 4Q1AA 3EOZA 4OJ3A 5CX4A 1GCGA 5KNBH 2CMKA 3UMJA 3WQHA 2VNGA 4PWZA 5CDSA 1O6GA 1T4BA 2G6TA 3PUXA 1S0FA 1ARZA 4FO9A 5LA6B 4L5YA 3MMAA 4ORFA 2JAQA 5E88A 2C6SA 2AJ4A 1YI0A 5IT9U 3MCVA 2OBFA 4C21A 3A7DA 3V1NA 1TK3A 3IUEA 4LOHA 1ND2C 3KPJA 2JGLA 5LMUF 4OV6B 1LW2A 3WHKA 4LOJA 2VF4X 4NN0A 3VC7A 1Q16A 2GEKA 4UBIA 2OELA 4OXKA 4HNAB 4J7UA 4IIVA 4MVJA 4P7VA 1RFLA 5BVHA 1G8WA 4P7JA 1KERA 1RJEA 1OLXA 1XI2A 1W0KA 3B53X 4IG4A 4IG3B 1DXHA 4TWAA 1AQJA 4K9QA 3IP8A 4WBNA 1X8MA 4RSHA 2BZSA 3TIIA 4C7JA 5T4BA 5F8LA 2CPFA 3H3LA 3AUSA 1ZETA 3ICLA 1T2XA 2JVKA 4XUDA 2IEYA 1V6NA 1P6XA 1F0YA 1SEPA 3PC8A 1GNPA 5L4NA 4QTXA 2MZRA 4LF6F 2XKAA 1GSHA 4TT3D 3UETA 3MOJB 3CRZA 3A3PB 3HY6A 1KEEA 2WR8A 3ZMOA 3QTBA 3MAAB 4BO3A 4N3BA 4PGMA 1K98A 3KVBA 2Q9UA 2ZK7A 2HQDA 4JHTA 3HI9A 5E33A 1QUVA 2CYBA 5KHIA 2M5YA 2HAIA 1DPGA 3CPSA 2BR4A 2P11A 5I9NA 2RT3A 4K3UA 4RW6A 4KYIB 1RAAA 2W2IA 4YQFA 4W1SA 4GM0A 1J24A 1Z0AA 3UV9A 4XRGA 3O5AA 3UT5A 2KI2A 4NV3A 2MHCA 1JKIA 1S49A 4WJBA 1N5SA 1Z7GA 1N7JA 1WY5A 4F25A 2R2AA 3G79A 4LBLA 5DDJ1 2FPIA 4Q4X2 2XG8A 1YOVA 2WV9A 4DEVA 3LEKA 3MDFA 3JB8A 4DSJA 3TEWA 1VQLS 4JI0B 3AFGA 2ZGOA 2QM8A 1EP3B 4H9GA 4FZ3A 721PA 2CJKA 1B23P 4DZGA 1IUPA 1KL7A 2XUKA 2ODWA 1W2TA 2XWSA 1UY3A 4PGAA 1NN1A 3ZGLA 4TXJA 5IULC 4OI3A 3V4RA 2XT9A 1NX6A 2QT0A 3AKPA 2KHDA 3HYSA 1M2JA 4A2PA 4EHNA 5CYMA 3IOEA 5JSQA 3QFTA 4AJPA 2B8TA 2JH8A 1Y6JA 4ZJZA 1C2PA 2H0BA 4W5WA 2Q6IA 2VJAA 1A2OA 4KAAA 1Z22A 4JY7A 5LMUB 1PO23 5FY1A 1ZM3A 4D4MA 4O65A 3VR2D 4A4DA 2XOKD 4U9UA 3PDUA 1AN0A 2YS7A 1VYAA 3R1HA 5U47A 3PJWA 4HPKA 2O57A 2PU5A 4HRXA 4ESEA 3BKTA 3MEKA 3W1YC 3GJAA 2Q8EA 4CR8A 4P4GA 5IP5A 4QGMA 4ZU5A 2ZZNA 5JY6A 2DB3A 4I0WB 1Z7S3 1OQ3A 2DXDA 5KJFA 1VQPS 2J9GA 3N2EA 2D5LA 3H3XA 3RTBA 3CLUD 4UW3A 2Y77A 3JAWB 2ACWA 3JAKA 1SQ0A 5FKJA 4UNNA 4FXDA 3ZCPA 2R8RA 2AG8A 4PQYA 2BP7A 3GD5A 4EB3A 1EIZA 4YDQA 4EF4A 4MLOA 4KLNA 1NRWA 4R8LA 3B2EA 4YP7A 4IDPA 2H29A 3SFUA 1NCRB 1JLLB 4CUCA 3OVAA 5DNUA 1FTWA 2W4DA 1TTQB 4DC9A 4DUWA 1QIQA 3JZIA 2WTUA 2OVUA 3AY6A 3CW9A 1ELOA 1FRZA 1ZH0A 2H5LA 3WWOA 3FGOA 1U0SA 3IAM1 3UAGA 5A7PA 1Y3JA 2ZIUB 4L9AA 1GKBA 3U26A 2BKVA 1FYUA 2WAMA 4EGLA 1HLCA 5D8AB 1GMVA 3LZDA 3TEHB 4BE7B 3OTCA 3ZR5A 2EP8A 3A21A 2OLJA 2AQ4A 4XQCA 4I3PA 1AUPA 4DJ5X 2CHQA 3UENA 1XR5A 4ZOCA 3CPEA 1Y9OA 4IGIA 1RUF1 5G4KB 1T29A 3DLCA 4N5IX 1RL3A 4URZR 2OAEA 4KSYA 5KWJA 2JEYA 2OMKA 3DXXA 5E9AA 1TECE 4CUAA 3O92A 3PUSA 3ZU5A 3TB4A 3WJAA 3G17A 4TLAA 3OZ7A 5HFJA 1K5MC 3ZFFB 1LDEA 3FBGA 1W6NA 1JNRB 1LRJA 4KDFA 1ULUA 5FJHA 2Z43A 4DL0C 3W59A 3NGUA 4JOBA 5KX5F 3LC2O 4HDMA 2XBUA 5KBFA 1LU1A 1VL2A 4KXYA 1SVMA 1KEKA 3RKUA 4XVCA 4KXQA 4IDBA 1DURA 4UDOA 3LL4A 2VAUA 3AERA 4NMWA 1XAIA 4LF8B 4JV5B 4KU8A 5CPFA 3ZXGA 2FPGB 2B5JA 2ABYA 2WC2A 2ZUFA 5J5CA 3L7IA 1VRH1 3KSUA 2AUTA 2OCBA 1E0KA 2XZPA 1F2UB 1ND2B 4FYHA 4TKMA 2VA3A 2FLNA 4K4TA 3SPXA 2GNDA 1LTHR 2HT1A 3EGOA 5A3PA 4NLRA 3HXOA 1U28C 3NQ41 5I3PA 4S12A 3EF1A 1RAIB 1V3VA 4ITSA 4UFOA 4YT2A 4KTTE 4KI7A 3TRFA 4U2CA 1Z6GA 4ILKA 4OSPA 3CJXA 1YB2A 4I7FB 3QKWA 4TL8A 2O20A 2GFQA 2YNFA 1JKXA 2PD1A 4OZ0A 2V8BA 1L1EA 4LXXA 5F5NA 3KUXA 1VBB2 2P62A 4DFPA 1KMHA 4A5SA 1W5SA 3CRQA 3AI3A 3PUHA 3E6CC 1IXKA 3FZBA 2ZT8A 3O93A 2WS92 1L1QA 5FTTC 5JQWA 3PXGa 3R6LA 5A1JA 4DBQA 1BHQ1 4U02A 1H7XA 4ZJYA 5EYYA 3OF3A 4BFZA 4UPEA 5APAA 3QXJA 2Q5FA 4ENUA 3RRBA 1MR3F 3OEHD 1X6VA 4PPFA 2ATCA 1GUZA 2QFIA 4YV0A 2HW3A 3ROZA 1X14A 5CHEA 4J1WA 1YCHA 3QVGA 5D0EA 2CF5A 2C42A 4GVLA 4G8DA 2GNPA 1AT1A 2XXBA 1K9MT 4HT5A 1I6MA 3DEAA 1T6NA 3NP5A 4DTCA 3LTNC 3WBFA 4BXFA 2YY1A 1C1CA 1IXRC 4X24A 2VQUA 3AP3A 2OMLA 3A6FA 3PPVA 2I7DA 3QE0A 1M1GA 3QHAA 5IAXA 2XGXA 3IR5A 3DDIA 3W90A 1E3LA 3C7DB 4GGOA 4Z37A 4M0EA 4CUKA 3IWNC 4G1BA 2ESRA 4ZCLA 1BQ4A 5FI1B 3EN0A 1Y1QA 4U4AA 1U7LA 1XJ0A 2QN6B 5LA9A 4OIMA 3QPIA 5H1SV 2P9BA 1JHXA 3PR1A 3NYQA 3LBFA 2FSGA 2QAGC 3Q5DA 4Q7LA 4F8AA 4FYPA 4DNPA 1G42A 1ID8A 1WO8A 2GN7A 1N7GA 4TL7A 5B3AA 2HEVF 3F1LA 4X93A 5DZEA 1SC1A 2J9FB 2YS6A 1VBB3 1QG4A 4R68A 1KC1A 1IN6A 1UOFA 2G06A 4GL4A 4LSZB 1QP7A 3HV2A 2XVYA 1HNZJ 3DZIA 2H2AA 1TNDA 1YU6A 4XDDA 4JZKA 3F6SA 1GWNA 1FXDA 3JW8A 4KGZA 1C8M1 4UOCA 1R2QA 3NWEA 2AX4A 5ICSA 5HMXA 3DLKA 1UIJA 4AY6A 2GGPB 3TX2A 5C3RA 1S8FA 4YRRA 1KMCA 1FP4B 3JPWA 1LUAA 2CL5A 1SEVA 1E6WA 3DDSA 1SCKA 4I55B 1DQAA 4IE5A 3S81A 3GL9A 3PXBA 4N82A 2F43A 4Q6BA 2ISQA 1T9WA 2YVAA 3PFEA 1PR5A 3J7YI 4PNHA 3BQ0A 3AQIA 3OCJA 2JNJA 5FBJA 4WZAA 1Z4JA 4JI6B 4YRBA 4F06A 3ONQA 1IQAA 1MB9A 1JXNA 5DN9A 3ZDQA 3GR6A 3IEKA 2WINB 4FINA 4E2FA 4IZIA 3E1GA 5JU6A 1XNKA 2ZBCA 3WEZA 1RT7B 4D98A 2NXNA 2ZVQX 2GIRA 5LA0A 2R751 1EQ0A 3L7LA 1CJTB 1UDBA 1H30A 3MERA 4CIOA 5HKOA 2ZEJA 2QGFA 3KT0A 3W9YA 1RGVA 2YFYA 1DDLA 3T1TA 3PR3A 1M2FA 2FSIA 1KVQA 1AX9A 1Q81T 2EWWA 4OZLA 5I0TA 1NVKA 4BQEA 4CI0B 3OE4A 1GZCA 3FOCA 4Z0TA 2YWFA 4G41A 4IGPA 2GN6A 2HCRA 3AFNA 3S29A 1DJ0A 2CWMA 1BQMB 2R97A 2RMU3 3OBBA 1G2QA 4P93A 1Y98A 2YRXA 4ZO4A 5IVJA 2KXFA 4JV0A 4LS3A 1CAWA 4B6EA 2C7OA 2WVBA 5F7UA 5C1BA 4PCLA 5LSAA 2XECA 1YTYA 1NF3A 2RGGA 4MZDA 4Z0HO 1ZI9A 1EDEA 2W6CX 4AHZA 2CXHA 4D9MA 1Z2NX 1U4BA 1O58A 5KWIA 2RGEA 2O0JA 1TKZA 4ENTA 5E3PA 3JRXA 2B5OA 2HYKA 4F3OA 2WNOA 2P27A 1CUDA 3TLZA 3TSAA 4RK7A 3DGPA 1E2HA 4B6PA 4Q4Y2 3M8QA 3TR6A 1I01A 2QL9A 1O3QA 1UP4A 4DJDC 3GZTB 3ZHTA 1TA4A 4R84A 4DBVO 1PS9A 1RRFA 3I87A 3MRSA 3K16A 2HHCA 4DO0A 1E6EA 3I0SB 3W9JA 1ZM9A 2GPBA 3DE1X 4ZKEA 1J0XO 2W94A 2YKMA 4YP6A 1TMF1 3PRJA 3KB8A 1SIZA 2FK8A 4IXLA 2XY4A 4DT1A 1L9KA 2HZCA 3TLAA 4D9CA 1WB6A 2CXRA 2FGOA 3D6FA 3KTAB 5KTPA 2V68A 4HV4A 1E7RA 4CDXA 4ZU4A 3LUBA 3VDBA 4HTFA 5LB2A 4ESVA 4ZVMA 3H8OA 1J8DA 1I3HA 3PMEA 4S24A 5A71A 3QEMB 5I9SA 3TD6A 3CCLS 2XNDD 3AUTA 2XONA 1M5PC 5BSMA 3OPWA 1XALA 3BIWA 3MJCA 4UM5A 4X65F 1THMA 2IXFA 5CDUA 5FPKA 5F98A 2GUWA 1ONNA 3V1MA 5CCXA 4C7QA 4XQWA 1A2KC 3S1AB 2VF5X 3E2EA 2W2LD 2GO1A 4ALIA 3D9QX 1BVVA 3SLRA 5JPDA 4L2NA 1ABEA 3ZVKA 2PH7A 1MPXA 5HCAA 3CVYA 3B9IA 1QHXA 2OYSA 3G2XA 4N7IA 1COWA 1JLRA 2IXGA 4ECYA 1R0WA 3S99A 2G40A 4TQUS 3OUYA 3WG1A 3GALA 5JANA 4F7ZA 2VXOA 4FFBB 4BO5A 1FSFA 3ZJVA 4KGXB 5EV7A 9LDBA 1DQ4A 1UOQA 3K92A 3CNQS 4CYDA 4FE4A 1CUAA 2AG0A 2CMFA 4OJMX 4BFUA 1GZ5A 4IW3B 3N01A 1WNTA 2NQ8A 5KDOA 2ZS7A 3LQRA 4AKIA 2C4NA 4P3NA 3I62A 1O5TA 3C8ZA 3R0JA 1A7KA 1Z8NA 1VKRA 2GC1A 3CLPA 1RBOB 3ASYA 3SXWA 4ED6A 2VPZB 3O1JC 1DFHA 2FW9A 4I55F 4HXCA 4WZZA 3T3YA 1GPMA 1ZL0A 3MAAA 2QSJA 3UJ9A 3QGIA 3ZNNA 1B0TA 3IT1A 4FDLA 1PLJA 5FXWA 5LMNB 2DDUA 5K0UC 4YHHB 2PKEA 4N43A 2YVKA 1W6PB 4OQ9A 2XLKA 4D4GA 3QITA 1BNCA 1Z75A 3DTVA 4LBQD 1UZDA 3CJIC 3HHLA 1JRLA 3MT9A 1C7RA 1Y9QA 4ZAGA 5LK5A 2DITA 2JHPA 2IYOA 2HWKA 4NLLA 2X5OA 2G5CA 5EJ4A 3G2HA 3HXPA 2MLZA 3CT9A 3GJTA 5A7WB 4JVLA 3SCGA 3WWEA 4FTBA 4GKBA 3K2EA 1EXWA 1YU9A 4JD5A 1NHGA 1GSLA 2YQ5A 1K6XA 4I9NA 5D8DA 1ZRIA 4F4YA 3PD7A 2XDWA 1NT0A 2GHPA 2BH2A 3NHLA 3HG7A 5L38A 2OBYA 4F26A 4OP2A 4DCSA 4H35A 2OWDA 2Q7XA 1P27B 2JJ8A 3C41J 2UYYA 2P2CB 2R6ZA 1N1TA 2FR8C 4RORA 2BEOA 3MICA 3N7AA 1M90T 3HWWA 4G9GA 5HUQA 5AM5A 5DZ6A 2HK6A 1R0BG 1RHUA 4B6QA 1OC2A 3NTLA 5DWDA 3M8WA 2JBAB 3VTFA 2QN6A 4MYDA 3WP3A 2NUBA 3JSMB 3GN2A 3A8TA 1SUWA 3GBVA 3M5CA 1S1UB 3V46A 1KS4A 4JI5J 3CF6E 2QEQA 3Q2IA 4HDGA 5A05A 5JUWA 2W4CA 1ZMOA 3EEBA 1TJNA 2CQBA 1J2UA 4IR7A 2DT9A 1A9RA 1N5DA 3OOYA 5EJ3A 4NZMA 1JLMA 1O0BA 3CO9A 1DQZA 4UUXA 3UR3C 1USGA 2FMYA 1T3HA 2VJUA 3E7XA 2YWJA 3AY7A 1ZL2A 3M7IA 3D3WA 3NT4A 1IKQA 4P9WA 1YQTA 4A8KA 5ICCA 5E1DA 1Y6GA 5IVFA 4GYKA 2H4FA 1HDGO 1RZVA 1MXHA 3BOSA 2VBIA 1T5IA 3G59A 2YR0A 3OXLA 4KQZA 1J5XA 3GG2A 2R68A 3X2SA 1RKQA 5DI3B 2WJ3A 2IGBA 4P8RA 1XTTA 1SIOA 1MX3A 2YINC 1H2MA 1K8XB 2ZJ3A 3DTVD 5C5UA 4J2TA 1NJ2A 5DP2A 1N6PA 3BC1A 1R9JA 3RRJA 4I3GA 1IKYB 1GO2A 2VK2A 3AKSA 2QG6A 1X4CA 1CJUA 4Y1UA 3QUAA 1Y9AA 3EMDA 2AEFA 3VBFC 3C8DA 1EVEA 3DOCA 1FP1D 1S2LA 2J1EA 4MW7A 3UVJA 1Q1KA 2QZSA 3DOLA 3KBOA 2F8TA 1NJFA 4O0MA 6ADHA 1GMWD 4LVUA 1SULA 3OE7D 1IZ8A 3PL1A 2NSHA