4C0BA

Structure of wild-type clp1p-pcf11p (454 -563) complex
Total Genus 131
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
131
sequence length
428
structure length
428
Chain Sequence
b'TGDNEWHKLVIPKGSDWQIDLKAEGKLIVKVNSGIVEIFGTELAVDDEYTFQNWKFPIYAVEETELLWKCPDLTTNTITVKPNHTMKYIYNLHFMLEKIRMSNFEGPRVVIVGGSQTGKTSLSRTLCSYALKFNAYQPLYINLDPQQPIFTVPGCISATPISDILDAQLPTWGQSLTSGATLLHNKQPMVKNFGLERINENKDLYLECISQLGQVVGQRLHLDPQVRRSGCIVDTPSISQLDENLAELHHIIEKLNVNIMLVLCSETDPLWEKVKKTFGPELGNNNIFFIPKLDGVSAVDDVYKRSLQRTSIREYFYGSLDTALSPYAIGVDYEDLTIWKPSNVFDNEVGRVELFPVTITPSNLQHAIIAITFAERRADQATVIKSPILGFALITEVNEKRRKLRVLLPVPGRLPSKAMILTSYRYLE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MRNA CLEAVAGE AND POLYADENYLATION FACTOR CLP1
publication title Structural basis for ATP loss by Clp1p in a G135R mutant protein.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
total genus 131
structure length 428
sequence length 428
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06807 Clp1 Pre-mRNA cleavage complex II protein Clp1
A PF16573 CLP1_N N-terminal beta-sandwich domain of polyadenylation factor
A PF16575 CLP1_P mRNA cleavage and polyadenylation factor CLP1 P-loop
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.1030 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4c0bA01
3.30.70.2410 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4c0bA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4c0bA02
2QSYA 2IT1A 2P3SA 5CLQA 2OUKA 4HB0A 5EE5B 1G5RA 4FWTA 4M21A 1G9XA 1XMIA 1MOZA 4FD2A 5LD2B 3QBVA 5KSZA 4KHZA 4HAYA 2VBCA 3AP2A 3OIUA 4PHGA 3SZRA 4DLYA 3H2YA 3WNCA 4Q9IA 3VR2A 2FNAA 1KMQA 1WQ1R 2GF0A 1MR3F 4AYXA 5BN5A 4OHZA 2Z6VA 4M1WA 3B85A 2CCGA 3U7GA 1ZCAA 1OJLA 5KPDA 1U0LA 5CIWA 1E2HA 3JVVA 4F91B 4LHVA 4B44A 1KGDA 2Q3MA 4ON9A 5FI1B 2FX3A 3TSWA 2QPTA 4BLSA 4DT1A 5FTLA 2MMGA 1TF2A 2A2ZA 3IBYA 3WRYC 2QM8A 4A2QA 1OV4A 3EW9A 4MH0R 4NU0A 2QTVB 2RGCA 1P2TA 4EJSB 2HV8A 2DCUA 4L4UA 2QPAA 1Q22A 1P4SA 1YR6A 4EPWA 1NN1A 5SZHB 2F3TA 3TUZC 4HLUA 2YC4C 4AWXA 3HU1A 2BMJA 4LYJA 1TL7C 5BW8A 1XU4A 3I61A 4IOKA 4F93B 1OB5A 4XJXA 1VKJA 1VTKA 2O0KA 2VHUA 4HB2A 2RCNA 3X1DA 1E2FA 4PR0A 1DBSA 1J7KA 1CJTC 1KI3A 2PJZA 1XPOA 4HAZA 1Q3TA 3MRSA 3QIAA 1JXMA 2FSFA 1GL6A 3BH6A 721PA 1PZNA 1CS4C 4Q03A 2V4ZA 4DDUA 1Z6YA 2ZQ5A 4Q4JB 1JPNA 3LA6A 3KQNA 4G5OA 2F55A 3ZS9A 5BN3A 1OH7A 2HDNB 2FF7A 3LXXA 3ZIAA 2ZJ8A 1OFUX 1XB2A 2QAGB 4IVPA 4GRAA 1MABA 2Y8EA 1E1RD 2W0SA 1ZUHA 5L3RA 2NZ8A 4D82A 2O8BA 1ZP6A 4JJKA 5HE9A 1R8SA 1YU9A 4JYCA 3DDCA 1N0UA 4JMPA 2QRZA 2C5LA 2GXQA 2YV5A 1W44A 5B30A 4PPQA 6Q21A 2O0HA 2VP5A 5G53C 1GRQA 5CK5A 3C16C 1MO4A 1OXSC 2Q9BA 2ZYTX 1NY6A 3GEIA 3NEYA 1R4AA 2XGJA 3RNLA 3LWNA 1IY2A 2VLIA 1MKYA 1KHTA 2FEOA 1W36D 2V55B 3QNUA 1XEXB 4B3BA 4YONB 4PC2A 3PJRA 2JGNA 3SFZA 4EFLA 3F5FA 4O2LA 2IX3A 4TYNA 2R44A 3NHBA 3FE2A 5FPTA 2G1KA 3T1QA 2ZREA 2AD1A 3BRWD 3LQQA 3PUVA 4DSUA 2ZRGA 4LJ4A 3LO5A 5L3SB 1GVNB 4ZV4A 2OCBA 3GJ4A 4P4SB 2DWOA 4QC2A 4DIEA 2QGZA 3QPVA 1C9KA 4TTQA 4NBSA 3SJCA 1YZTA 4JIMA 3TIFA 3GLIB 2W6IA 4AIIA 2C04A 1VPLA 2HEIA 1SXJC 2HT6A 4JLBA 4Q4HB 4AC9A 4B6FA 3ADKA 5TMPA 1NVWQ 3KZ1E 4RD4A 2O8CA 1E0AA 1AK2A 2PEZA 1E3MA 1OH8A 4V0NA 1VG8A 1OIXA 4QJ4A 3RHFA 2ZVPX 4ZI3A 2ZRNA 1JQLB 4QL3A 3CR7A 4M1MA 1Z22A 3RS4A 5FUXA 3KX2A 4Z54A 4LGMA 1T91A 2FSGA 3PCRB 2GBLA 3H0KA 3KJEA 2MSCB 3RVBA 3U7HB 3BERA 1XBTA 3U60B 3UPUA 1XCGB 3AQ4A 1I2MA 1KJWA 3FMPB 1C1YA 1ZMXA 2JAQA 2OG2A 3S1AA 3AUXA 2EU8A 2XJ9A 2IF2A 4YMUA 3TH5A 2C03A 2P5TB 1I2DA 1KI8A 2OXRA 4JLPA 4MGZR 5FPHA 3B78A 4OJQA 3KB2A 5HKKA 5B64A 2PLFA 1Q1QA 1FUUA 3BJIC 2ZU6A 4TL7A 3CX6A 4QBIA 4P4UA 1G3MA 1ZRHA 4NONA 1OXXK 5IDVA 1DAGA 5AUPB 2BM1A 1E2EA 3GJ0A 3I73A 3V4RA 3BORA 2C78A 3TE6A 4A0FA 4Q9HA 4IOJA 1DOAA 4CEHA 4L5BA 4L9SA 1ESMA 2VTKA 5DSZA 4LYHA 2CLCX 4M9SA 3GLGA 3I5XA 4DDVA 4U7DA 3EZ2A 2ZI3A 3QEOA 3VMFA 4DEYA 3VR5A 5J4YA 5DHAA 2OXCA 1F5NA 1P2UA 1XFAA 4MA4A 3ZIAD 1QHHB 3KKNA 3Q72A 2IS2A 4LJ9A 4US2R 5JWHA 3GJ5A 3ZLJA 1XF9A 2GZHA 1NJGA 1W0JA 2J0SA 4BEBA 3QXSA 1UF9A 1Z6GA 5FTMA 4NL4H 2J0QA 1G18A 1JJ7A 3PEWA 3DOFA 1VHTA 3K0FB 3PV0A 1P7CA 2J1LA 1GWNA 4PSKA 4B2IA 3NDBB 2Z5FA 4HB4A 2W6JA 4HZUA 3U44A 4FN5A 2WKQA 2ZE6A 5E95A 2H17A 1VCMA 4JS0A 5DNYB 4H1VA 2IC5A 1DO2A 3GCGA 3LD9A 3DMDA 4HDOB 4DRZA 4EKDA 4QHSA 2H1LA 1U9IC 2UKDA 4ZCLA 4BQSA 3CX7A 3WYAA 2GF9A 4DLSA 3R7WA 3GFTA 2ONJA 2REOA 3OIYA 2OZEA 2B8TA 4RFSB 2A3RA 2EYQA 1Y3AA 3QF4A 3D3QA 1D5CA 2ZVQX 4JL5A 3W8NA 4M9XA 2WZQA 4DCNA 1Q0UA 1IQPA 2IYUA 3HR7A 1WA5A 3NBZC 3AV0B 2F6RA 2XSZA 2PH1A 2YOGA 5H70A 2IF0A 3AUYA 4Q4LA 2W6ID 1RRPA 4JLKA 2ATXA 4KFUA 3M4YA 4NE2A 2CHVA 1E2NA 1W7AA 2OLKA 1E9EA 2J0UB 2ZJ5A 4CVNA 3G5UA 1G7CA 1E2QA 1KZGB 2D62A 2OFWA 4TSFA 3MJHA 1RRCA 3G0HA 1BMFA 3BOSA 2VL7A 2XNDA 3IDQA 1E99A 3RS3A 3CPEA 4Q4AA 2OHFA 3ZZUA 2FGJA 4E03A 2GCOA 4IVQA 4MUAA 4TLDA 2IYQA 1ZM9A 1ESNA 1NRJB 2AN9A 4OI2A 2ZI7A 4M1TA 4MRNA 4QGFA 3FWYA 1A5TA 2G9NA 4ARZB 2ANBA 4POAA 2PZGA 2ZR7A 4E22A 4C0BA 1YRBA 4NYMQ 2QT1A 4N3NA 2JASA 1KDRA 1VYVA 3PUZA 5E3HA 2ZETA 3I4LA 3W6OA 3BK7A 2WM9B 5HKKD 2DFLA 3FFAA 1Z0KA 2ZRJA 4A2WA 1IBRA 4I1UA 2CE7A 1F6BA 3N2IA 4OHYA 1YR7A 5FL3A 2FDCA 5EJEA 1WE2A 2QZ4A 2IXEA 1BIFA 1VCNA 2D74A 1QVAA 1SHKA 2KBFA 1XNJA 3MG9A 3I92A 3K70B 2ZI4A 2IYYA 4XOIA 4ZKEA 1WMSA 3O47A 4CRWB 4FI3C 3RDPA 2A5GA 3PEUA 4TMVA 4F4JA 2O8EB 1DG3A 4UKDA 3AF2A 3KXKA 3ND8A 2OBMA 1Q1BA 1L4YA 1R0WA 4EFNA 3VFDA 4C0JA 1NBME 2DBYA 1NN3A 5G40A 3FMIA 2JATA 3BIFA 4G5QA 4AD8A 2ZRAA 3IHLA 1DADA 1FX0A 1S0UA 3LBHA 1W0JD 2Z43A 2WPDA 1Z08A 4B76A 4ESHA 4D0LB 5KPJA 4KCGA 3TSOA 1YVDA 3QKSB 1B23P 4ZIRA 3ICEA 4UJ3A 4WBSA 4TL6A 4YLGA 3R9WA 1OXUA 1EX6A 4A2PA 1G4UR 2AX4A 2AXNA 2WOJA 1T3SA 3GLHE 3KKOA 1ANKA 2AXPA 2OAP1 2W6JD 4G5GA 3GEHA 1E4YA 2OBNA 2ZU0C 4UQOA 1QG2A 1AGPA 2GK6A 1JPJA 3GJXC 4XSHA 1UBEA 1CF4A 1R2QA 2MSDB 1GDDA 2ONKA 1ZBDA 4OQLA 2RGAA 2WIBA 2HXSA 3CW2A 3F0TA 4NYJR 4U5XA 3TBKA 2YKGA 4E09A 4KI0A 3PXGA 1Z63A 2GZDA 1ZD1A 2VO1A 3AVQA 4GT1A 5KUTA 3LY5A 2VP4A 1X86B 4OHWA 1TTTA 1KI1A 3EC1A 1E2IA 1P61B 5FOXA 4QM7A 2XSZD 4WVFA 1G3UA 1X8LA 3JZMA 2VP9A 3QF7A 1T4GA 1CRPA 4JZKA 3KUCA 2ZJAA 5FOSA 3I32A 1LW7A 4G1UC 2QAJA 3J81k 4NYJQ 1MO6A 1G5TA 2XZOA 5DYIA 3NDPA 3Q9LA 4TSFD 1BMFD 1US8A 2X2FA 2XNDD 3KJGA 4B3XA 2P5SA 2QENA 3JZAA 5FUYA 1CJVC 1UADA 3FKSA 1S9DA 2BBWA 5CLLA 1KO1A 4PHTA 4Q02A 5IF9A 1DELA 2VF8A 1VIAA 4LYFA 1TU4A 1KNQA 3IQXA 3AF1A 4DSNA 1NLFA 3RSOA 3REFA 4XIGS 5SZIA 1KK2A 1NY5A 4C3ZA 1SVWA 4IFEA 1R5OA 4Z8XA 4D4MA 4N0DA 1D6JA 1W48A 2WMOB 3P27A 4B2LA 3OEHA 2G0NA 2WWGA 4R7ZA 4GOXA 3RWOA 1X1SA 1BS1A 4JVSB 4LC1A 4WZAE 2WJVA 2AK2A 4PAQA 2DHRA 4KLZA 2ZS7A 3QG5A 5AK0A 4EPYA 1UJ2A 4TT3A 3T5GA 1VCOA 3GJ8A 5A0FA 4A0GA 4LJ7A 3K8YA 3T5DA 4FMCB 2Q9AA 3EIEA 2ZSAA 2QUZA 2B92A 2B21A 2CDNA 2NO1A 2ZRCA 1OH5A 2KWIA 5FOWA 4MDFA 3BWDD 4HUQA 4QOSA 4KBGA 1KNXA 2WAYA 1NSTA 2RHDA 3AKEA 3SS8A 3IBGA 2MMCA 5EXPA 4JT4A 3K53A 1YE8A 1E9FA 1J90A 4KYUA 3SI7A 1OXTA 4XWKA 4LBYA 3TUIC 4BLOA 1LB1B 4ASUA 2ZE7A 3PFIA 4JBWA 4WW0A 3QY0A 2OE2A 3O8DA 2WPDD 4TMTA 5EQTA 3ZVNA 2Q3FA 4FXPA 4PPNA 4ZPXA 3TR0A 1KDPA 4EPVA 1HEIA 2J0VA 3PUXA 1HT2E 1DPFA 1FOEB 4ZDJA 1YZGA 3EZFA 4BLPA 1ZUIA 4BEJA 3PG5A 2X77A 4ABYA 2KBEA 1Q20A 1ZC4A 1BOFA 1A2KC 4Q18A 2HYIC 3CIOA 1KKLA 2D4HA 4JL6A 2ZJ2A 2YWFA 1EFRA 4EJSA 2BOVA 4PANA 4TLBA 1N6RA 2ATVA 4C0QC 1RYHA 3OZXA 1F3OA 1FL9A 1FNMA 3Q8XB 1SVOA 4Q7JB 3SR0A 2OAQ1 3VHXA 3PR1A 1EFHA 4S35A 4A4DA 4A36A 2RGDA 4CW7A 1J99A 1T0JB 2CJWB 2OM2A 4QKQA 5C4MA 5AJVB 1VECA 4OJKA 1OIWA 1HE8B 4C0KA 2R65A 2YOHA 3TMKA 1LFDB 4Q9LA 3GLGE 3AVTA 4A15A 2IS4A 1BYIA 2BDTA 2WWYA 2J5XA 4LHXA 1TADA 2F1JA 3UIEA 1M1YE 2GEVA 3FKSD 4Q4JA 3C8UA 1E0KA 2OV2A 5J4VA 2OCYC 2ZI6A 3BFKA 4JKYA 1FTSA 2VF7A 3TKLA 1G8GA 1HTWA 3AGPA 3MSXA 1GUAA 1Q44A 2WHXA 1SVLA 1SVSA 1XRJA 2Q6TA 2ZITA 4IXNA 4PAMA 1KAOA 2QAGA 5JBQA 3D8BA 3UK6A 2VA8A 1L7VC 2FEMA 4CEIB 3EZ7A 3L0OA 2ZJOA 1W2GA 1R6BX 1E79A 1JNYA 1GIAA 1RRFA 3OEHD 3BB3A 3VU9B 2EFEB 4QM6A 3OAAA 4JKIA 3L43A 1W46A 5BYKA 2H16A 1RW4A 2ZR0A 4C0LA 5J4KA 4I81A 4TQUS 4TT3D 2EVWX 3UMFA 5FBLB 4AKIA 2IYWA 1GSIA 2XJ4A 2B7CA 4IDNA 1OFHA 2QI9C 2CCJA 3CR8A 3QVVA 3GLFB 4DVGA 5EXSA 2E9SA 2QMHA 5EXTA 3NC0C 3FYHA 1CEEA 3RAPR 1XEXA 4JSYA 4DLRA 1JAHA 2IHYA 4JBXA 4UNQA 3P32A 1S1MA 2P6UA 4LC0A 3DKPA 1U8ZA 4W5JA 3VKGA 3SE0A 2C96A 2J59A 2ZJYA 2ZS9A 1KDOA 2GJAA 2W2TA 4ASUD 4B3FX 2OESA 4OQNA 4A9AA 2AL7A 1IN7A 2JLRA 4P4TA 1JR3A 1HUQA 3NH9A 4P4SA 5CK4A 3L82B 4ZDKA 3ADCA 1AS3A 1B0UA 1G8HA 4R98A 1EX7A 4W5WA 3W90A 3KB1A 4ZDIA 4XTCS 3EIQA 3GLIA 2CMKA 5HCNA 3TW8B 4F92B 4ESVA 3HWSA 4IW3B 4Q4HA 3FKQA 2EW1A 4S2EA 1E6CA 2H18A 5FTNA 3T1OA 5LDDC 1Q1EA 1VMAA 1CJUC 3QXHA 5L8VA 1VG0B 5TARA 1XTRA 1YZQA 2F1HA 2ZRFA 4NCIA 3T15A 2BC9A 3FDIA 1P9RA 1TQDA 2RGGA 1JBKA 3EA0A 5JRJA 3V00A 5AUQA 5KNDA 2C8VA 2C9YA 1KJYA 3LFUA 2KSQA 2BEKA 2I1QA 1ZU4A 3ASYA 5TY0A 3THXB 4LBVA 1EFRD 3CPJB 2A5FA 8OHMA 2PZEA 3W6PA 3X1YA 1E9BA 1EWQA 4MKGA 2HCBA 1NBMA 4JYBA 1ELOA 1QHGA 2XZLA 1M2OB 4DZZA 2QBYB 3R9XA 1WBBA 3DM9B 4IFBA 3LVRE 3RRMA 1V43A 2F7SA 1X8JA 4LRWA 2XEXA 4P32A 3OIWA 1VYTA 3K0CA 1R0XA 4IOLA 5CM9C 2BCJQ 4W7SA 3PEVA 2GA8A 3LXRA 4D4KA 2ODNA 4OHXA 2GDJA 1F2TB 2GVZC 4BLQA 1T3LA 3GLHA 1X3SA 3VR6A 2RGNA 1W49A 3B13B 2VHQA 1U90A 2BJWA 2ZRIA 1T8TA 1R8QA 2ZJBA 3CB4A 4PHFA 2FWRA 1MT0A 2DFTA 3DVLA 1QHHA 3K09C 521PA 4OK3A 3IUYA 3P4XA 3REGA 4RD3A 5CDFA 4OKSA 4OYHA 2WICA 4MRPA 4AG5A 3AKDA 1E79D 4HDQB 1XTSA 1DAHA 3RS0A 3AVOA 5J40A 2O8DB 1ZNZA 4KSCA 1IAQA 1QHYA 3OAAD 1KSHA 3AF4A 3K0FA 2G77B 2ZM5A 2ERXA 4DCUA 2ZE5A 4QBFA 3U4QB 5JLJA 1PUIA 2V6JA 3WY9A 1N6OA 1QHIA 2FMXA 1CTQA 1L8QA 3VAAA 1D9XA 2PLRA 5GADl 4HAVA 2E87A 2QRNA 4DB2A 1N6IA 4FMDB 3SYLA 1R5NA 2ODBA 3E1SA 4V03A 2XX3A 2O8FB 2D2EA 4LHZA 2OSBA 4W5HA 2YOFA 1E2KA 1EESA 3B9QA 4RFSA 1P2SA 1JR3D 1Q3HA 3LDAA 4OL0A 1ZNYA 5AWFC 5GJVC 2RH5A 2GILA 2JLYA 2YWHA 2D2FA 1T6NA 1Q1ZA 4IOMA 5FTKA 2DWPA 2NG1A 4X8OA 3QG1A 4URVR 5KNBA 1RC8A 4GDFA 3TK1A 3EPHA 2BCGY 2OT3B 2QG6A 2VIIA 2J0UA 5DI3B 4YMTA 3DZDA 3AP3A 3CKLA 3MWYW 4Y0VA 1KDTA 4KJZA 1U98A 1U2RA 4QJ3A 1V5WA 2V7QA 1P75A 2AFHE 1Z07A 3FHCB 5AJYA 1VCIA 1ZM4A 2WV9A 3CNLA 4GNKA 4PO9A 5AJWA 1GL9B 3CUEF 3ZVLA 4Q9KA 4CF7A 3LAWA 3Q7QA 5KOYA 1ETUA 1Z6XA 1ZC3A 4Q1CA 4DJTA 1KZ7B 4D25A 2NTYC 1BYUA 4ARZA 1II0A 1MV5A 2Z4RA 3C5HA 4RZUA 1TAGA 3VX3A 3UATA 2X1VA 4LYAA 3OESA 4BFXA 2A9KA 4U00A 4D0GA 1NBMD 1SXJB 4LJAA 2R6GA 4K8OA 3A8TA 4LBWA 1OIVA 2ZRHA 4OQMA 1CR0A 1YJ5A 4HLDA 3EPKA 5JCPA 2IW3A 1XMSA 3K9HA 1EFUA 2WSMA 4MYUA 3B9PA 5M04A 5F9HA 1YHNA 3UANA 3IO5A 3P20A 3UMRA 2QSZA 4C0AC 1FPMA 1CU1A 1XCPA 2FN4A 3B2EA 5DIFA 2YINC 2ZUDA 1NN5A 3AF0A 3FVQA 4NZYA 3WNDA 3VKHA 2ZAMA 4P31A 1YKSA 2D7CA 4B2PA 2V3CC 1JJVA 5C1BA 1AA9A 3LLMA 4RD0A 2O8EA 4ZKDA 3QE0A 2JLSA 4BUJA 4YXWA 1G3QA 5JS7A 4W9MC 5FBVB 1E2PA 1P62B 1BO6A 2Z0MA 1QG4A 1E98A 1XWIA 1W36B 2PEYA 1W36C 4Z1MA 4BFYA 1G7RA 2FA9A 3IKJA 3LX8A 4HZIA 3VTKA 4A8JB 2IS1A 1PLJA 4P3YA 3ND9A 1QDEA 1SKYB 4A8JC 4TL9A 1W4CA 4IDHA 1IXSB 2P67A 5AJZA 4Q19A 4PHHA 4L9WA 2PT5A 1GM5A 1P2VA 1ZAKA 3RWMB 4D4JA 3SBEA 3L0IB 4Q1FA 3AVVA 5JFGA 1U0HC 4URZR 2IL1A 5HTKA 1QBKC 2ZUBA 3E5HA 4R9UC 3X1ZA 2Q3HA 4DC9A 3K0AB 1KY3A 4RCYA 1RYFA 5TVKA 1NMZA 5JRZA 3KQLA 4M22A 2IK8A 4GOKA 4Y0AA 1IONA 3B5JA 4LPKA 4PC6A 2KE5A 2V54A 1M7BA 2VEDA 4QBGB 1G1MA 5FOTA 4A6PA 3WMFA 1X8KA 5JWRA 1Z0JA 4BFVA 1MRSA 1ZIPA 5KU1A 2BEJA 1A2BA 4TYQA 2ZAOA 1CR4A 1KK3A 2HLDA 3VR4A 3O8RA 2J46A 4B3DA 2FOLA 4QHYA 1GG2A 2YYZA 5BXQC 4UNSA 1XD8A 4BZXA 4LHYA 1TX4B 4MYCA 2GJKA 5GJBA 3EASA 1GP2A 2ZTSA 3L0SA 5DE3A 4GMXA 2RGNC 5DHFA 2RHMA 2QORA 1A82A 1J2JA 2ZRBA 2BMEA 1OXVA 4URXR 3FFBA 4HLUC 1J70A 5EE9A 1XD2B 2BIFA 2EFGA 3LBNA 2J7PA 3EAQA 4LV5B 3CNNA 3BH0A 1HQCA 2PMKA 1SULA 2CK3A 4HAUA 2W83A 1XTIA 3LV8A 1XXHA 1Z8FA 2OEPA 1NL3A 3C15C 1NVVR 3SN6A 4AYTA 3DPUA 2IS6A 1IOZA 1CIPA 2CEAA 2EFCB 2R9VA 2V7QD 3KKPA 4LUCA 4QBHA 1RKBA 1TF7A 2OO7A 1KO4A 4M2LA 1C4OA 2UZ3A 3SBDA 1E1QD 4BE7B 4BFUA 2PX0A 3GMTA 4HLQB 4I99A 2HF9A 1QHSA 2ANCA 1X1RA 1FUKA 1UEIA 2XB2A 4IHQA 1JECA 1ZUNB 3A58B 3SJAA 1ZJ6A 3EPLA 1NVVQ 3QKRA 4I1SA 4PQRA 1S9HA 3ASZA 1RE0A 3AVXA 3VHLB 1ZM3A 4RD6A 4PC1A 1O3YA 2O8BB 2GXUA 4X8MA 2DR3A 3A1UA 4NYIR 2XTNA 3LW8A 4DLUA 1GRRA 4TZ0A 1COWA 4GP6A 4RJLA 4AKEA 4CT4B 3BAFA 4PO1A 5SZJA 3K70D 5FI0B 4LY6A 3A1WA 2BM0A 3A4NA 4LJYA 4MYHA 2HJVA 5FOVA 1N5KA 1Q21A 1JR3E 1XTKA 2QQEA 4YXWD 2F3RA 1XTQA 4WIAA 3U3MA 3THYB 1E9AA 1J8MF 1GZSA 3EZ6A 2BBTA 3JVUA 3PIRA 1Z0DA 4LPSA 2VP0A 4OI0A 4US0R 4Z1MD 3GLIE 1R7RA 4C7OB 4NYIQ 4TMKA 1TNDA 3P4YA 1GNPA 5FH9A 1RVDA 4ITRC 2BBSA 1N3BA 2QGNA 1FNNA 4PFSA 4JL8A 4CIDA 3ZD7A 3EARA 3U3KA 3SC3A 4TZ6A 2I3BA 2PT7A 4M1OA 4FCTA 1Q57A 2WJJA 4B48A 4KITB 1NNEA 3ZZ0A 2D3WA 3TAUA 1GILA 1WB9A 2REBA 2QP9X 1E2GA 1CP2A 4IEEA 1KSJA 1N6LA 5JWOA 2F1RA 4LDJA 2AD5A 5JS8A 1G5PA 3BFVA 5DLQC 4DUGA 3MUFA 4LWZA 5KTYA 1UAAA 4RCZA 4NCHA 2ORVA 4Q00A 2YJTD 1DARA 3DHWC 1YZLA 1S2MA 2F43B 5FPYA 1NI3A 2YVUA 3OEEA 4HUTA 3A1TA 3I5YA 2O5VA 2WMNB 1TEVA 4ACBA 2QMOA 2HLDD 4TN1A 1OE0A 3FHOA 2NPIA 2GBLC 5ELXA 4TTPA 2MSEB 3IPYA 2XOKA 2XXAB 2CJWA 2XITA 4WZ6A 5HZKA 3L8ZA 4IRUB 2ZSFA 3U6BA 1FFHA 3S1AB 3WHLA 4PSAA 3ZGXA 2NIPA 4BECA 2IXFA 3KXLA 1NIPA 1Z0IA 2BJVA 221PA 1HURA 5JHHB 1KIMA 2J7PD 4Q48A 3Q5DA 5P21A 3UWOA 3WMGA 1KI6B 1KSGA 4B6EA 4WOPA 2CK3D 3OIVA 4YDHB 2K5UA 1KTVA 4PZYA 1QHNA 4JLOA 1N2CE 2QM7A 4QRHA 1KI4A 5CDFE 1MH1A 4KVGA 4B3CA 3VX4A 1CR1A 1GRNA 4ZCMA 5KO2A 4CEJB 4CEHB 2FZLA 3KKMA 2G88A 3D7MA 3DM5A 1CBUA 2AWNA 5H8WA 4TMXA 4FCWA 4JJZA 2JLWA 2IEYA 3B1VA 1HYQA 4CEIA 4NHOA 1PLLA 3FHTA 4NH0A 1DTSA 2BKEA 3RC3A 5LB2A 5DYGA 2AHOA 2OFOA 3VU9A 2EWVA 4QHTA 1ZYUA 4U02A 2QA5A 4BASA 5CB6A 1N6PA 2RB4A 2OFXA 1IN8A 1F2UB 4JLDA 1ZM7A 3AVWA 1COWD 4JVNA 3A6PC 2YHSA 3BC1A 3GLFA 2I4IA 4PQYA 3GFPA 3Q85A 1SVIA 4M1KA 2FPKA 2ZSBA 4FMCF 2ZROA 4TLCA 2ASEA 5IRCD 2OCAA 1GL7A 1CJKC 3AP1A 4GPTA 1WXQA 2DYKA 2VRWA 4LJ8A 1G6OA 1KK0A 1LV7A 1E9CA 4KFTA 3U44B 3GQBA 1Z6AA 4E5UA 5GVRA 3OHMA 4K81B 3WXMA 1XPRA 3HYRA 2VH5R 4NCNA 1D8TA 2L0XA 4DLVA 4DDTA 5C18A 4QNRA 1G3RA 2BBOA 1GAJA 1TMKA 2RGXA 3FGNA 3ZJYA 5FL7A 1JALA 1DAFA 2GEUA 3HU3A 3T34A 1ODFA 5GVSA 2WJIA 2IYVA 4WXRA 2ZSEA 1W5TA 1FTNA 4DLXA 2WKPA 1S4QA 1KJZA 4XSGA 4DUGD 1G41A 5C2JB 1SZPA 2JIZA 2JLZA 4PSVA 1E9RA 3W9YA 1KO8A 4EQ6B 2JJ2A 2A5YB 2VHCA 2DPXA 3OEED 1G64A 3THWB 1UBGA 5EP3A 3THXA 1R0YA 2KJQA 3A1SA 2P6RA 2QY9A 4Q1DA 3TAHA 2G3YA 2RKOA 5AJXA 1DAEA 3CRQA 5EP1A 5J5CA 2A78A 1UFQA 4OBEA 2CL7X 2XOKD 3R9IA 3TR5A 2QBYA 3EG5A 5DO9A 4RD2A 1KY2A 1U0JA 1DAMA 1GFIA 2IWHA 2CL6X 3RS2A 3SYKA 1K5GA 3CRRA 1EFTA 4N1AA 1WBDA 4Q1BA 3U7FB 1N0WA 3QI2A 1E96A 1XEFA 5L3VA 3GJ3A 1F2TA 3SJBA 3NKVA 3AKCA 5KDDA 2WWIA 3NEJA 2J45A 1RFLA 4NTZA 1N5JA 5GJCA 1R0ZA 5EE0A 4BWYA 3RC8A 4URUR 4WA7A 5IHPA 1GKYA 3GJ6A 2IUSA 4NP6A 2ZYWX 1II8B 1IN5A 2EWWA 3DOEA 2GAOA 2OCPA 1UKEA 2NPFA 3H4MA 1VG9B 2GZAA 2ODWA 1NLYA 1KI2A 1E9DA 4MKIA 2C95A 1I4LD 3FOZA 2AKYA 2N1BA 4UJ5A 3TW4A 1AKEA 2O8DA 5K8LA 5C4GB 1HT1E 5FBRB 2BV3A 3CH4B 3GD7A 5KNCA 4KSBA 3N2EA 3VKWA 2J7KA 4RKEA 4LK2A 1K5DA 4UNNA 1XJ0A 4H9GA 1K6MA 3QQ5A 4HSEA 2GKSA 4AKGA 3U4QA 2GETA 2R8RA 3CX8A 1G20E 2WWWA 3WNBA 1OFIA 2ORIA 1OYYA 4C0HA 2QROA 1Z6TA 4WZBE 1NVUQ 4LI0A 1M7GA 4EPRA 3TSZA 4KO8A 2XB4A 5L3QB 1ZINA 5JCZA 2HUPA 2FFHA 1Z2AA 4RKFA 2AWOA 5CJ2A 2LCFA 2IUTA 3MMPA 1NKSA 4Q01A 4XD7D 3B6EA 2AR7A 5BWMA 1WRBA 2O8FA 5EE3A 1HA3A 1G8FA 3U2QA 4GZMA 1G4AE 4AY2A 1XXHE 1CR2A 1YR8A 3MWJA 621PA 3MAAC 2GEDA 5D3MB 1G6HA 1NLZA 2CLSA 3T12A 1PV4A 2XAUA 1W0KA 2BWJA 3D6TB 2IWRA 5FL7D 1JEDA 4EPTA 2BKUA 3CF0A 1RRGA 3HP1A 4DSOA 4PPFA 1H8HA 5DI3A 2SHKA 2WWXA 4M8NE 5E7IA 4EPXA 1T8UA 1SHZA 1AGRA 4CT5A 2VHJA 2ZSDA 4DLWA 5FPKA 1VG1A 2FE4A 1WF3A 2JCSA 3BE4A 4LJ5A 2JIZD 3UG6A 3GEEA 3I72A 2BVNA 2NO6A 4TYWA 3OF5A 3EZ9A 2JJ2D 3U3JA 5A5GA 1JI0A 1AQYA 3SNHA 1US8B 4DCSA 5L3SA 4F38A 5CM8B 5JSZB 1P5ZB 1XJQA 1E2LA 1G291 4LV8B 1TUIA 1LNZA 1DEKA 4Q7MB 3Q3JB 1GNRA 2X19A 3A36A 1SXJA 2LWIA 2F1IA 4ZDWA 1YQTA 2EQBA 1KOFA 2R6AA 3UXMA 5J47A 5TV2A 1CLUA 1F48A 1XZPA 4NPHA 1KYIA 3AVYA 3UWKA 1UDWA 4NKRA 4KVAA 5JJIA 3IEUA 4V0MA 3EC2A 4BFWA 1XZQA 2TMKA 4IXMA 4R2HA 4JVLA 2DWQA 3EIHA 5F2EA 5B58C 2JEOA 2ODEA 1N6NA 2FU5C 3NXSA 5F98A 1MO3A 3O8BA 3A1VA 3UG7A 3PVSA 4BRWA 3NHAA 2JLUA 1ZNWA 1E2DA 3SU8A 3U3OA 3HU2A 3E2IA 5JEDA 2QTFA 2XZPA 4BLRA 2ZYUX 1SGWA 1PVOA 3WMEA 4IDQA 2FPLA 4YMSA 5CB8A 1GKIA 1RJ9B 3KKQA 4BFSA 3NBXX 4RD1A 2FZ4A 4TTRA 2CL0X 2VSFA 1G3IA 5JHGB 2DY1A 3C7KA 4XVRA 2ERYA 3KTAB 1SVKA 3HPQA 2WJGA 3L0PA 2JLXA 1XEWX 3QJYA 4Q7KA 2H7VA 4M1YA 2ZPTX 3K0AA 3X1XA 4RZXA 2PCJA 2R2AA 1QF9A 3HJNA 5LD2C 3U61B 5JECA 4R71A 5KDOA 1S3GA 3WRXC 4EUNA 1G17A 2ZYVX 2WOOA 4QJ5A 4Q5IA 3ZZTA 4B47A 2FFQA 2CLDX 3T06B 2WJYA 4D2IA 5FBQB 4RZ2A 3LH5A 4HLCA 4EAQA 5KSYA 1ZD8A 1M34E 1N5IA 2F9LA 3MD0A 1E2JA 3N70A 4KYIB 3MFYA 5FBWB 2DB3A 2WJHA 4FMDF 1KMHB 5LBIA 2WTUA 2VSOA 1UKYA 3ZS8A 1IXZA 4HEJA 4LX0A 2FFBA 1JB1A 4X8LA 4B74A 2G83A 4OHVA 2RAPA 1VHLA 3FTQA 1PUJA 4EJSC 1UPTA 2V1XA 1OFTA 4DB4A 4C30A 1P73A 3AEZA 3B7GA 1W0KD 1XTJA 1XD2A 2B6HA 3CH5A 4ACAA 4AI6A 3B1XA 4UXHA 1AN0A 1XP8A 4PPGA 3K1JA 4A82A 5JZVA 3L8YA 1H8HD 2YC2C 3WP0A 3TUJC 4I1VA 5CITA 2PMDA 1U9IA 3EPJA 1MRNA 3FMFA 1NJFA 3IIMA 2O52A 3U6KA 1M7HA 3MGCA 2FPMA 2N42A 2X2EA 3TVTA 4V0OA 4C2UA 4HDCA 1PJRA 2H8KA 1P9WA 3CO5A 4G5RA 4P0TA 3BH7A 4FCVA 2HF8A 1PLKA 4DXAA 1XJCA 3NBFA 5KSOA 1CRQA 2ZRMA 5FOUA 1S8FA 3RS5A 5AUOB 3GLFE 5EP4A 3IIJA 1SXJD 3TQCA 4DWJA 3N5CA 3CBQA 4LHWA 5KHOC 2O0JA 3BS4A 5JEEA 1I4TD 2J87A 2E1RA 1HV8A 2QAGC 4KXFB 1FQJA 4PZZA 5G3ZA 2YZ2A 2F9MA 4JVMA 4KV9A 2V9PA 4MKFA 4G01B 4HATA 5SZKB 4HI0E 2ECKA 3IEVA 4X8HA 4B71A 4OK5A 3F8TA 1M74A 4UXJA 1E1QA 4A1FA 4AYWA 3WBKA 5EUMA 1W1WA 5EZ6B 3WHKA 3QSYA 4RZ3A 4A0HA 3ETLA 2FGKA 2PBRA 4WAUA 1Z0FA 4F4CA 4MYTA 2GHIA 1NMYA 3THYA 4YQFA 4D4LA 2BHRA 1U81A 4MRSA 3QVUA 1UBCA 1Z3IX 4JLAA 3CZQA 1N6HA 5IK2A 4C7OA 1M6NA 1ONBA 1N5LA 1L4UA 1M8PA 4GSYA 2UZIR 4TMZA 2ZIAA 4B34A 4LOAA 5LB4A 3AVUA 2FFAA 2FSHA 1G19A 2VSXA 3A4LA 1D2EA 2R6DA 3PUWA 3G82C 2JJ1A 2GAAA 3H86A 1TU3A 4DBLC 1OT3A 2P65A 3C4JA 4DKXA 3EWAA 4C4PA 3W8RA 5BN4A 1N6KA 3EXAA 5F9FA 3KJHA 4M1SA 3T1TA 1A1VA 1D2MA 5DN6A 3ZQ6A 1EFCA 3GJ7A 3RSLA 4D80A 2NO9A 1N0VC 2WIAA 1DAKA 3RABA 1EWRA 1ZM2A 4NDZA 2GESA 4TLEA 4BRUA 3LNCA 2F43A 1KO7A 1MO5A 3CWZA 5J4LA 3MCAA 1LY1A 3E70C 4ERNA 1QVRA 1R10A 3M1IA 2ZRPA 1GITA 2BMFA 3CLVA 5FPSA 1J8YF 3U5ZB 4Q47A 5H1YA 1BKDR 3PQCA 1CJMA 1IJEA 2A5DA 3QKSA 4KBFA 2XXAA 3B1YA 3V4FA 5LPNA 2GRJA 4M9ZA 2ZRDA 1QRAA 4V0KA 3SFVA 4KFRA 4RFVA 4Z8YA 1KI6A 3AB3A 1Q12A 3ZVRA 3LLUA 4BFTA 4MGYR 3KFVA 3AH8A 2ZR9A 2NOAA 4II7A 3W34A 3K0CC 4DLZA 1U94A 3LVQE 4A0RA 4F7WA 2XTMA 1XMVA 4JLVA 3RANA 1WDTA 1NIJA 4DT1B 4Z51A 4CEJA 2IA5A 4R2IA 3K0EA 3RLFA 4GFDA 1S1CA 2IEZA 3PENA 1FP6A 3GLHB 1K8RA 5AUNB 4A92A 4DLTA 2D06A 3VNVA 1JEEA 3DKVA 3F3YA 2Q0HA 3B60A 2C2HA 2PCLA 2G6BA 2CHQA 4YC7A 1NG1A 1O87A 3HDTA 4J0QA 2QE7A 3FB4A 1YZKA 2LKCA 3X1WA 4Q1EA 2FG5A 3UMSA 1KI7A 1AS0A 4GMDA 4N0EA 3QKTA 2FSIA 1G7SA 1S96A 2FJUA 2HYDA 2CVHA 1F2UA 1X6VA 4QXAA 4BZQA 4DCTA 2REXB 1EXMA 3WYGA 1CKEA 4KAXA 1CULC 4PQFA 3X2SA 2JJ8A 3IILA 3IQWA 4FWIB 3I8SA 4HAWA 1T9HA 1IY0A 1P9NA 1DS6A 3MJRA 3TVDA 5IT5A 1ZNXA 1IHUA 1XCMA 4RY2A 2HT1A 2IYXA 1Z28A 3KQKA 3TJZA 2C9OA 4AK9A 1XMJA 4ZCIA 1Z06A 4PTLA 5IK2D 2OILA 3K9LA 1JR6A 1NN0A 4CYMA 2ZRLA 5D3QA 4GZLA 4TYPA 1MABB 3WYFA 3T1VA 2NO7A 5K8IA 1E2MA 5DISB 5E4FA 2EFHB 2QQ0A 3IPXA 1FW6A 3QOFA 3ZD6A 1G8PA 3U3RA 4LCBA 2ZI9A 3CZPA 1UKVY 2IHBA 2JJ1D 4AG6A 4IDPA 4L8GA 4A6XA 2IYSA 4O0MA 4MRVA 2GXSA 3K0SA 2FH5B 2N46A 2VP6A 4JLMA 3BD9A 3VR1A 3RS7A 2V6IA 5K8TA 3SQWA 5DN6D 5FFMA 3C14C 3AM1A 4AKHA 1W4BA 3TNFA 3AF3A 4NYMR 2JDIA 3CONA 1SXJE 1YRAA 4PX9A 4IJMA 3I62A 4C9BA 1UM8A 3NVAA 4EQ6A 4PAOA 1F60A 1CXZA 3W3ZB 4MDEA 4OK6A 1DVRA 3CF6R 2QP3A 3THWA 3ADDA 3BB4A 3EX7C 1E0JA 4D26A 4MKHA 2QTHA 4QGGA 3U7EB 1OHHA 3IO3A 4IKEA 5CJPA 1KO5A 1WP9A 4V0ME 2ZJZA 4BFZA 5BQ5A 4RSGA 1ZCBA 3O8CA 1NP6A 3ZH9B 1U99A 3RRZA 1LF5A 5C46F 2VP2A 2IYRA 2P0EA 5EE1A 3VQTA 1RIFA 3HR8A 4MITA 821PA 4IDOA 3BB1A 4TWZA 1I4DD 3BXZA 1SVMA 3DEFA 1KSFX 3D31A 1LTQA 3PITA 1AJEA 3CNOA 1QHXA 2O8CB 1JQJC 1OSNA 2PL3A 5FR1A 3KJIA 1VYUA 1NVXQ 1SKYE 3LX5A 3CRW1 1OH6A 4K46A 3A37A 4V02A 3ECCA 4D0NA 3Q7PA 2WVJA 1UEJA 2Z4SA 3K70C 1OPXA 2YWEA 1FP7A 3ZVMA 1Z5ZA 5FUWA 5EXXA 1II8A 2OBLA 1YZUA 1YZNA 3LBIA 3NG1A 5B2ZA 4PC3A 4KODA 5GJWC 3MWLA 1UKZA 1Z83A 2RGBA 4GL2A 1T3HA 3HPRA 3NH6A 4E07A 4PO8A 4UNPA 2QE7D 5BYJA 4XWOA 4M4SA 1HH4A 4PXAA 1LF0A 5CYOA 1T0HB 1VDZA 3I8XA 2GCPA 4GBMA 5ANRB 3KFXA 1XPUA 4LSGA 1G21E 4EDHA 3ZQJA 1A4RA 2VYFA 1UBFA 2Z83A 5E7MA 3TRFA 5KSPA 1AIPA 1ZU5A 1DG1G 3DZ8A 4TLAA 2CE2X 4TMWA 2UVQA 4UXIA 4O3MA 2R6CA 2H5EA 2D7DA 3CPHA 2VQSA 3R8FA 1VIYA 1ZW6A 4Q66C 3K9NA 3PEYA 5L3QA 2IYTA 3L2OB 3SYNA 1Z47A 421PA 1HQYE 5TXGA 1FMLA 3CM0A 5JI2E 3AVPA 1HY3A 1AQUA 1JXOA 4URYR 3TQFA 3GLGB 4JT2A 3GPLA 3CRMA 4H1UA 3OE7A 1W4AA 2GWHA 3QPWA 1GNQA 5AR1A 4B43A 2GTPA 1U8AA 3BGWA 3MLEA 2CNWA 3AGQA 5FTJA 5KYKA 4DSTA 4F4IA 3NTUA 1YR9A 3FMOB 3CF2A 5D3MA 2GCNA 2P6NA 4CGZA 5EP2A 1D2NA 1W5SA 1E9SA 2YWGA 2GJ9A 3CRVA 1UDXA 1W4RA 2CCKA 3OFNA 2IYLD 2OLJA 4GOJA 3AKYA 4G5SA 1DO0A 2WWHA 3M6AA 3P1JA 4HZUB 1Z29A 3NWJA 1HE1C 1OYWA 4OQXA 4XD7A 4B75A 1OB2A 1TQ2A 2JDID 3ICQB 2NMVA 2HJGA 1XXHB 3QEJA 1OKKA 2WBLC 2C99A 3C5CA 2IXGA 3LRPA 3B82A 4JBYA 1LS1A 4M53A 2X8AA 3QXCA 4MGKR 5JSZA 4OI1A 4OQFA 4FW9A 4ZO4A 4V0LA 2ZE8A 4P33A 2KB0A 3R7WB 1OHHD 5JMTA 1G8YA 3IGFA 3R20A 1TPZA 1NKTA 1TQ6A 4LZZA 4DCVA 4US1R 3RRYA 3QF4B 1LVGA 1ZIOA 5K8UA 1U8YA 4FMBB 2C77A 2VPPA 1RZ3A 2WSSA 4NMMA 4O25A 2GJ8A 4GI7A 3SHFA 2V8OA 2A7QA 2GVDC 2RMKA 4YDSA 1AS2A 4MGIR 1IJFA 5E7JA 1AZSC 4DHEA 2PJRA 3QKRB 4BPBA 121PA 3DMNA 3MWKA 4XVQA 2EFDB 3IHWA 4G0NA 2P2LA 4OI4A 1FMJA 1NF3A 3I3SR 3T61A 1AKYA 3SEAA 2WKRA 4HAXA 4B35A 5H68A 4RVCA 2BMDA 2A30A 2ZUCA 4DIDA 3SHWA 3QENA 4Q4AB 3LQRA 5KDLA 4ILEA 2GCOB 1FZQA 2EYUA 2ORWA 4C0SA 3QBTA 3B8HA 4G3XA 1XDBA 1DE0A 2R62A 3A4MA 3DO6A 2ZXUA 4D81A 3NC1C 3TLXA 4BLTA 1RJ9A 3KQUA 2LKDA 3Q5EA 4M9QA 5DH9A 5TB5A 1S3SA 5EZ5A 4UNRA 1E4VA 1R5BA 1QZXA 2PZFA 4DDWA 3GP8A 4TQAA 5FR2A 4QG7A 1D9ZA 1Z0AA 1P60A 4TQ9A 3KTAA 3RYTC 3THOA 5JJLA 4D6PA 2QL6A 4Q21A 4XTRA 2QP4A 3VNUA 1AZTA 3QXJA 1ZD9A 2GJSA 3DL0A 4KU4A 4LJ6A 1KK1A 5FUVA 1ZVQA 1IY1A 1RPZA 2YNMA 3ZYCA 1E0SA 1OF1A 1P72A 3PUYA 3K09A 5JI3E 1A7JA 1N25A 4PC7A 2QT0A 1H65A 4MRRA 4XWAA 4B3GA 2WWFA 1G16A 3P26A 4TL8A 1H8EA 3OE7D 1KMHA 2I1VB 1JAIA 2G1JA 4L15A 2GXAA 2B8WA 3KQHA 2IUUA 2CNWD 2FV8A 4HYYA 1OLOA 2J9RA 1FX0B 4LBZA 2W58A 2H92A 3KUDA 3QKUA 1P3JA 2QN6A 2QU8A 4FIDA 5TDHA 2QEQA 1OW3B 3H1TA 4ZI2A 2C9CA 4I1OA 4IEIA 2H57A 3B1WA 3NIBA 4KLNA 3TGPA 1NSFA 2CHGA 2G0TA 1Y63A 2AKAB 2CXXA 4YMWA 4ZIRB 1WCV1 5F3WB 5DGXA 2HXYA 3OFND 1E32A 4JLJA 5B57C 1FQKA 1GTVA 2NZJA 5UKDA 3M0EA 1KI9A 1EK0A 4URWR 1KAGA 4B32A 1T5IA 1KKMA 4M0LA 4YMVA 5A4JA 4Q7LA 4TYYA 1XX6A 5J4HA 3KDSE 3CWQA 3NBYC 4KFSA 4L16A 5G41A 4B33A 1TQ4A 1OKKD 1IXRC 1LS6A 1L2TA 1SQ5A 3KL4A 2V1UA 1GKUB 2CVFA 4CDGA 4NCKA 3ADBA 4QGAA 1II9A 5JJKA 5EUQB 4CZ2A 3GFOA 4PZLA 2QMUA 4EFMA 1AM4D 2W2XA 1TEXA 3ZDQA 3LW7A 1SKQA 2GK7A 3I1FA 2NGRA 4JLNA 5CYPA 2IBMA 1EG7A 2Q9CA 2QPOA 2WSSD 4QGHA 2W2VA 4NCJA 4B73A 5DI9A 2IYZA 2HCJB 2KI5A 3WP1B 3FPAA 1NG9A 2JA1A 2QMEA 1XEWY 3W5JA 2AK3A 3BBPA 3K9GA 4WXPA 1GOTA 1TF5A 4JSTA 4XH9B 4QNMA 4AURA 2JLQA 2QNRA 5CIQA 3R8CA 4XVUA 5G3YA 2R6FA 4LV6A 4BZPA 3SQXA 3KXIA 1W47A 2JLVA 1XD9A 4O2RA 1W2HA 2W00A 3SJZA 5HR5A 4Q1AA 3EWSA 1P6XA 2B7BA 4C2TA 5HCIA 2ZEJA 2J41A 3V9PA 1E94E 1IN4A 2XNSA 4DEXA 2C98A 3RRNA 1E1RA 1Z2CA 1DAIA 2W0MA 2CBZA 3VR3A 2A5JA 3UKDA 4BGDA 5HE8A 2VHTA 3T35A 3C41J 2ZANA 2ZRKA 2XTZA 4GP7A 3QPUA 4HB3A 2AFIE 3ONWA 2DFKB 2J3EA 1NMXA 3SDZA 3W3AA 2GNOA 4IVRA 2WAXA 2ZS8A 5HPYB 3B1ZA 3IIKA 1G7TA 3WBJA 1IM2A 1E69A 3EA5A 4EIWA 4QFMA 3BFXA 3QUSA 4HUQB 1EGAA 3W5IA 3QXXA 3W6NA 3SOPA 2RGEA 3HYTA 1TUEA 1T5LA 4A8JA 2NO0A 4Q9JA 2DFNA 2PX3A 1H8ED 4FINA 1BH2A 2NQ2C 3H84A 4MQBA 5HZHA 4MUBA 4I4LA 1IN6A 2ZI5A 2Q21A
chains in the Genus database with same CATH superfamily
1VRBA 2B45X 2O57A 1TL3B 5EE5B 1UA0A 2W91A 5H9RA 4FWTA 1MQ9A 4OX9F 3QW2A 2RR12 3GWGA 4ZZ0A 1OI7A 2JG3A 1YE5A 3UJNA 4V1CB 5CU7A 5FZ1A 1ZCAA 3RHTA 5GADU 5F8PA 5ISLA 2E48A 2HMSA 5JAIA 4F4YA 1TF2A 2WYVA 1HWLA 3LQYA 3WF2A 1WU7A 1XZAA 3RZLA 1NN1A 2X3FA 3FMVA 2B9VA 4KFBB 3ILSA 1RUOA 3AM2A 3QUBA 2D7SA 1H8TB 3HXMA 3HT0A 3OLXA 1OYDA 2JNWA 2BE2B 2J0WA 2JE9A 1E2FA 4GU5A 3VU0A 3ENZA 1HDZA 2GU9A 4X3CA 2LDIA 1KXJA 3Q8QB 1Q0PA 2V4ZA 5LP6A 3CDEA 4GS5A 3KQNA 2PUJA 4ZRNA 2H7CA 1JH5A 1XB2A 4K87A 1F5CA 1QGYA 3T9ZA 5L3RA 2YR0A 1TI7A 3K8OE 3H5NA 5IASA 4KJIA 5DU2A 2BWAA 5DQ0A 3KLBA 4ZYVA 2VP5A 2PWBA 5G53C 1GRQA 5HVHA 4D0RA 1F2GA 1R4AA 4DG1A 1L7PA 3PHIA 1YTLA 2JFDA 5TMBA 4YONB 4D7YA 1I2CA 2VNSA 2R44A 5FPTA 2MYTA 3DO8A 2XYGB 2D0OB 1N8RT 2J32A 3IOEA 4JI8B 4IV1C 2W4MA 3OZGA 3WHTA 3I5MA 5JZ9A 3ISVA 2YV4A 4ZQHA 2QSJA 3KO8A 4BQ3A 1J8QA 2IVFA 1VPLA 2QX0A 1Q74A 4Q4HB 5GM1A 1AKWA 4X6XA 4BLIA 1HOXA 3T1MA 2PN6A 3RTEA 1Z22A 5FUXA 2A5LA 4CEWC 3H7HB 2J7UA 4XHXA 4QLBA 2GBLA 1QCYA 2MSCB 3U7HB 3D7KA 2NTVA 5F8LA 5H80A 2EU8A 2A1UA 4UUMA 4U2BA 4JLPA 1I2DA 1JJHA 3F46A 3B78A 1NMEA 4XABA 2B2CA 2OBYA 2ZU6A 4YJHB 2Z56B 4QDKA 1SA0A 1E5VA 3CLSC 1Q83A 1OBCA 3L7MA 4Q26A 4IOJA 4RVNA 4L5BA 3F5DA 3ZZ1A 1QJFA 3GR6A 4IV5A 1ZXXA 3P2YA 3T3NA 2PGOA 3NLLA 5K2OA 3Q8VA 3OQOA 2ZI3A 1PCXA 4NENB 3OBAA 2O5CA 2QO3A 3T7IA 3EWNA 1D09B 1OAOA 1Z6GA 3C3YA 4PR6A 3WW4A 4B81A 2XIJA 1VMKA 2J1LA 1WCDJ 4ZWNA 3A6DA 3I54A 1X13A 3BDVA 3PNAA 2UWCA 1JLSA 4GHWA 5DNYB 4IICA 3W1WA 2DF7A 5GQSA 2P34A 4HDOB 2BFAA 3KMSA 2G17A 4ZCLA 2H1LA 4K0KB 5C1OA 2LUWA 3FZBA 1S76D 4DLSA 4JAAA 2CFTA 2ZW9A 2BGTA 4LF7J 2VODA 1TFYA 4ALNA 5FBZA 3WLIA 5F2NA 3DB1A 3L4BC 4Z9BA 2XZTA 3UV7A 4UBJA 4RDXA 2EXIA 5BURA 5LQUA 2WJPA 3C3JA 4U3JB 2D62A 2E5LB 1RLJA 2FPGA 1DTQA 2FPRA 4YZ1A 4U96A 1SUDA 4EBEA 2GHTA 2O19A 3FWYA 1Z4KA 3H4IA 4LY0A 3TP2A 2WM9B 3ZWYA 3ZHZA 4DV5B 2GIFA 3S6JA 3L7UA 2V73A 4KWCA 1ZKDA 2ZYSA 3RBVA 2QD1A 5GOTA 3RIMA 2XG8A 2EKYA 4IKAA 4XUGB 5HZMA 4PIVA 2C57A 5JJ5A 1LCLA 1HG1A 3VL9A 4ADSG 2DUWA 1DADA 3FYUB 3HBLA 4F4KA 3DRSB 4ZVPB 5BSEA 4P86A 2HJ9A 5ILGA 2YZMA 3HFSA 3L9JT 4TVKA 2OBFA 3R9WA 2EKDA 3PHCA 3E23A 3L01A 2NM1A 1ANKA 4N9WA 2E4UA 4BV9A 4FDVA 4PBOA 4INPA 1X0VA 2VMIA 3ZTYA 3DRRB 1G38A 1NZ8A 3HBJA 5CYGA 2GNTA 4CG0A 4ZXPA 1K12A 4P6VF 1RQ2A 1G20B 5HIJA 1CG2A 3CS3A 3LGAA 4NULA 2ZB4A 4E09A 4W5RA 1DAXA 2FQWA 1Z5UA 3K5WA 1G6Q1 1CRPA 4ZVUB 3BQ1A 2RG1A 1MO6A 1OD3A 2VNRA 4AWBA 3PLNA 4WJKB 5HRUA 4LHNA 2XWSA 2X8WA 2HVDA 3H9AA 4X85A 4RWXA 5F2OA 5CCLA 4JK3A 3E15A 4RMIA 3HFZB 1SKRA 4MK7A 1UMCB 2XUFA 4HKOA 1SVWA 1D6JA 1GFZA 1KYQA 1KRPA 4DG5A 4F72A 2ID9A 4R7ZA 4WXYB 3KAQA 2GCFA 4IIJB 1BS1A 4AEMA 3KHUA 1H0KA 3TXYA 3BCSA 4TT3A 5JZMA 3RT1A 1A71A 3CEJA 4OFGA 5HYVA 1KZ4A 2VUGA 3FOCA 5CT5A 1C0UB 3DYMA 1BVVA 1OBHA 4JT4A 3K53A 2ARXA 4OV1A 1JF8A 4KYUA 2CLEB 4PVCA 3JATA 4GC6A 4L7QA 1FERA 1ZN8A 3TQIA 4XOUA 2AB0A 3I39X 2C92A 1DRZA 1JHPA 2Q3FA 4LOKA 5AKGA 5FPLA 3KVRA 1C57A 1V6NA 2RDJA 2DXDA 4ECEA 2OSRA 5JUWA 1Q20A 2JKBA 3BGFA 4FDFA 2ASLA 3C24A 3PNPA 1UU6A 3CIOA 4ATFA 2D3TA 1EFKA 2XTAA 3TTUA 4P7VA 2HBTA 4S35A 1J99A 1DBWA 4PFJA 5DDQC 4DS3A 4A15A 4XFDA 2SICE 3K6JA 2J1UA 1PQWA 4U67Q 3PGLA 3ZFEB 1XERA 6AT1B 4E3WA 3T0FA 2G9VA 4XJUA 3TNYA 3G8CA 3W7BA 1W26A 5J2TF 1ZI8A 2ZITA 3VDQA 1KAOA 3I6PA 2VJKA 4H4OA 4Y65A 3EZ7A 4Q4DA 4XUPA 4QM6A 3N8NA 1RW4A 4Q82A 5L45A 1YI2S 3KYIB 3VAHA 1KQNA 4HNQA 4KWUA 3SC2A 3FYHA 3LZ6A 4BQ4A 2ZX2A 2VG9A 4ZTBA 4W6XA 3OX2A 4Y2TA 3DC7A 4EI8A 1W5BA 2VSNA 2QDKA 1EWKA 4ND1A 3PACA 4B3FX 1OVPA 2FMUA 2HDOA 3NH9A 3ADCA 2JVKA 1WTFA 3KB1A 2HWF1 3QLEA 5A3WA 2COEA 1EHWA 3T1OA 3LK6A 3QLQA 3FR8A 5EKDA 3SYTA 3QXHA 4G9BA 4OQPA 4UFIA 4MFBB 3D3JA 2C0ZA 3OUHA 5KBFA 3FCAA 1I3MA 4XE9A 2I1QA 1YJ9S 1TJ4A 4M8KA 4HNSA 4CTKA 4PU0A 4B3MF 1SURA 1P5JA 4W7SA 5EWSA 2R8BA 7FD1A 3S8YA 3DF0A 2RILA 1I94B 2HADA 1AFIA 2VHQA 1USWA 3EDQA 1T8TA 2D6OX 2KVQE 1JT9A 2XKOA 3SCIE 3ZZYA 2XQVA 5B12A 3BSSA 1ZUD1 3B4DA 1DAHA 5LA6B 2ZR8A 2HI0A 4FBUA 1NJYA 3S6EA 5LU9A 2BTQA 1VRTB 3T7AA 3TZ6A 2FSVA 2OXBA 4WVLA 2ZE5A 3LO8A 3C1OA 1CR6A 2BE7A 2O2JA 5C35A 4OB7A 2NU8A 2IXLA 2OV8A 3N7UA 5KT2A 1MB2A 2PIAA 2F7VA 3E1SA 3NKGA 1GV1A 1E2KA 4FZRA 2Q4SA 5AWFC 5FAKA 1REEA 3CU5A 4NDAA 4FP3A 4H0FA 2ZGUA 5ALYA 4GDFA 2DX7A 3ZDAA 4EI2A 2A8YA 1NHUA 3IYLW 4FT4A 4ZHRB 1N7IA 4B3MJ 3QELA 5SV5A 4AL7A 2RS52 3NV7A 1VCIA 2EQAA 4FNOA 1RI7A 5CW2A 1H2ZA 5JSQA 1FOD2 2QCSB 1ZH0A 3C5HA 2SNIE 5KAPA 1ZTWA 2X53S 1CAUB 4RMJA 3W2VB 3UW1A 1F1BB 5E8AA 2RVJA 3J7Z5 2Q6OA 2HEKA 1FYVA 4C0AC 1Q8OA 3MINB 3B2EA 4WCFA 3TRGA 4CKWB 3HOBA 5B6JA 4ZN6A 3AJ9A 1PP4A 2R00A 1G3QA 5JS7A 4RW8A 2BLLA 2QX7A 2ZE2B 3WLNA 2HPUA 3PGXA 4HZIA 1MU2B 3M3PA 1GUZA 2QNIA 3UH1A 5AJZA 3EFOB 2QJ3A 4L9WA 3OVAA 3I34X 3L0IB 4URZR 4R9UC 3ET4A 3AQOA 3LQVA 3RODA 1KY3A 2HRZA 1RYFA 3GEPA 5JRZA 1L4GA 1SOMA 3Q3HA 4AVAA 3NGLA 2JECA 1NK8A 2C1EB 2WF6A 3BU0A 3WOHA 4QOTA 4UU0A 3R76A 1XD8A 5IAJA 5CB4B 1Y8QA 3NWKA 5A80A 3T4XA 4CKCA 2QORA 3L40A 1CJKA 5IWAF 4FFFA 5CVVA 4XYEA 3G8YA 4P9WA 2H6BA 2J6TA 2CK3A 1ZYBA 3IDBB 4LO4B 2R9VA 1X7NA 4DOUA 1VI7A 2HZBA 1JKJB 3BEOA 3V4SA 4DMZA 3L4EA 1JYWA 2PK3A 1HQWA 2NNLD 5DNUA 2C7VA 5KHGA 3PNVA 5IFLA 5DDIP 3HS3A 1VB3A 4ETMA 3ESBA 2IQIA 2QVYX 5DMXA 4EHDA 1JJBA 4KNVA 4GH5A 4JI1F 3KHLA 2ROEA 1TOAA 2DR3A 2QR2A 4B9AA 4BPZA 3DBLB 4RMGA 1DEHA 3AIOA 5AC91 4C8ZA 3A4NA 2V7GA 2QHXA 4FI3F 3KJNA 4IEVA 2UYGA 1EYBA 3AERB 4YFWA 5L1KA 1R0BG 4Q0MA 2Q4RA 2W2QA 1XBFA 4L22A 3KL2A 3C39A 3L4JA 4M7PA 5ADVA 1T36A 4P5YA 1Z2DA 2FVPA 4YMIA 2JLAA 3ETDA 2RMU2 3A0RB 3H3UA 3KGLA 1MP0A 5IWAJ 2VPYA 2MEV1 2B61A 2BGIA 4WTOA 4EB3A 4QAJA 4GOMD 1ZONA 2QIPA 4MI6A 3G6WA 2BFDB 2C2MB 4Z4FA 2O5VA 4HVOA 2B1GA 4AJEA 1B0AA 1I5EA 4N8OA 4BBZA 5FNVF 3H05A 2J67A 3B5EA 2WOMA 5E6UB 5D8HB 3KTQA 4FDUA 2FI1A 1G86A 1FNSA 1ZN9A 2IXFA 4Q48A 1KSGA 4JI1J 4RVUA 1SH2A 1JW9B 1SU6A 1CP3A 1KQFB 4W99A 4TMFA 5FBKA 3V0AB 4PIMA 4JI4J 5KO2A 2EQ5A 2E7ZA 5G0TA 2UVDA 4X20B 1UJCA 5KFAA 5TE9A 3UKJA 1LBTA 3O8OA 5EXEA 1N2EA 1XAJA 2A67A 1LWEB 4MV1A 1U0BB 2OV4A 1YA4A 5GALA 3ILHA 4YG6A 3ESQA 2FWIA 5A7PA 4G5HA 1QIKA 4P0QB 2Y1OA 4O9EA 2ENWA 1THTA 2IAJA 5JVGQ 5DLGA 5HCFA 3WKCA 3P9PA 3WB9A 4YNBA 4CT9A 3J81j 3FBCA 2W2PA 1Z9BA 1EX8A 2F9DA 1BD4A 4HS9A 1CS0B 1Y6RA 1N36B 3D6NB 2HWF3 4LRDA 1DAFA 3EMDA 2WZR1 2QQOA 1C0TB 4CMJA 4O4RA 4OLAA 1R8AA 1Y3KA 2KDOA 2Z3VA 5KFYA 5ITHA 1PBAA 5AMXA 4Q1DA 3OJCA 2YJZA 1DAEA 3AMMA 4EGFA 1I2BA 2DMRA 2PX4A 2YNFA 2AYHA 2X9LA 3BDIA 4BU0A 2HG4A 4EROA 5CCEA 1P2FA 3U7FB 5FZOA 3WRYA 1GPYA 4H7LA 4GQIA 4H7IA 1HO3A 3CC8A 2VASA 4ZVGA 3DI6A 3W63A 3PGMA 3HHKA 2ZSIA 1WO8A 3UK2A 4AROA 3H4MA 1S0FA 2F8TA 2D6NA 3F1LA 4ZT3A 1K2VN 1X2BA 2X0RA 4BNYA 4OZNA 2NV6A 2XB6A 1KEUA 3NHRA 1TZJA 1LPSA 5U47A 4HBNA 3D0OA 1WSBA 2AUYA 1CB0A 1IHPA 4CTMA 1KOHA 3CD6S 5L3QB 4AB1A 1M83A 3HBMA 5JPCA 5CJ2A 5CTAA 4LIVA 5IP5A 2PUTA 5TF4A 5EL0A 5ITVA 2M6KA 4BKUA 3VU1A 5TJ9A 1LAJA 2KI2A 4QIEA 4ZCPA 3LQKA 3C16A 4XFKA 1W0KA 4S1VA 4MIOA 3DGFC 1OZGA 2EG5A 2FTKE 3FZ2A 1S79A 3QX8A 2R2GA 4RDIA 3PLAE 2P9BA 1QIJA 1XCJA 2WWXA 4M8NE 4F3YA 1PSZA 4DV2F 2BA9A 1S3IA 5JSRA 3EUNA 1N5VA 3SYMA 4RVSA 3QVKA 3OD4A 3SNHA 5JSZB 1P5ZB 2B69A 4XQ9A 2HRCA 4ZAYA 1QY4A 5A8WB 2YNGA 1EGMB 1KOFA 1TKZB 2BM9A 1GT6A 1IJFB 2PMFA 3RRXA 3POEA 5A7SA 3M05A 3SF8B 1Q78A 1N32F 3WXBA 2XECA 3O8BA 2QRLA 4LO8A 2PO4A 1EIYB 4I50B 1ZH2A 3AFNA 3VMMA 3MPPG 1S12A 1SMVA 1QFZA 1W8NA 2GZ2A 1EIWA 9ATCA 1C8BA 5C0OE 3AEKB 1RE1A 2R4FA 1CDOA 2H7VA 4YJ3B 4UEKA 5DMHA 4ZPDA 3IR6A 2ARAA 4IV8A 4C4YA 1Q4RA 4GX0A 2QLFB 3IRXB 3STYA 1G21A 2W8BA 4D3XA 5CXUA 3E6AA 3QJGA 1RTHA 3MLBA 3OG9A 5CR9A 3GHNA 4BQFA 2EVXA 3C3LA 3KKZA 4ZGWA 3S2ZA 1T8SA 2HSEB 3WADA 3SSQA 1QPBA 4CDXA 5F0UA 2ZH3A 3CCVS 1DDIA 3K89A 4PPGA 5JZVA 4EWAA 4QU7A 2OPPB 3IB3A 1U1OA 3JQWA 2P5VA 3W5BA 1UC8A 3MGCA 4ENQA 1VE0A 1W87A 3V4IB 4NLOA 2R4UA 1N32J 1VLYA 1T9VA 1W99A 3AFGA 4Z2YA 1S8FA 5AUOB 3SH5A 2XMRA 1XQWA 3ZPOA 3RG8A 1I4TD 1MQTC 1RUE1 1PFUA 3UAOA 2DY0A 1TA9A 3ZEIA 3VZLA 3IS9B 2HWE2 3RI8A 1TME1 4BJ0A 3PRHA 4ER3A 4AYWA 5AC93 3OT9A 4KQZA 1I5PA 5KFJA 3M32A 1XMOF 3S01A 1Q7LB 4C6SA 1RPAA 1N5DA 4A8HA 1L4UA 1XQNA 4YVWC 1M5VC 1FDRA 1XU9A 3O73A 9GPBA 3DUFA 1DYPA 2IFTA 3IERA 3NNAA 4GQAA 2E7XA 3K73O 5BN4A 1QTNA 4LHSA 1A1VA 5DLYA 5E41A 1PSWA 3MJVA 4CF3A 3B01A 4Q7AA 2MEV3 4D80A 3WKDA 2FHMA 5KTPA 3VVMA 3I6IA 2A6PA 3I9JA 3EIFA 2IJNA 5LA2A 1RWKB 1LY1A 1JB0C 3RIXA 4BQPA 2XCLA 4AHYA 4I55F 3BAZA 3W9UA 1U5ZA 4G3IA 3TNVA 2CXEA 5EIBC 2VVFA 4UFLA 1K2WA 1TVKA 3DOLB 3TUPA 1YVFA 1SQ0A 4MGYR 1WQ4A 4Y3UA 3C5WP 4R2IA 3MECB 1N1TA 1ZZEA 2PRIA 3VNVA 3DKVA 5EPUA 2CHQA 1XMOJ 1JMVA 2QE7A 2YWXA 4C06A 1AGYA 3QVLA 2Q3DA 3C87A 3IQWA 1CPYA 4UBMA 5CFDB 2E53A 1L7BA 2G4VA 4HAWA 5A06A 2ID4A 3GAFA 1CVNA 1PEDA 2PKCA 5BNNB 5F1PA 3K9LA 4CU7A 3L41A 2ZGVA 1NJIT 5DN9A 1CDZA 1X31C 3ABQB 2EFHB 1SJ9A 3U3RA 2D3O1 4ZT5A 1GPWB 2VZ1A 2WZR3 2WMDA 1TVMA 3WQ7A 4CKYA 3B7WA 4YUXA 1R3NA 4IDFA 4JYAJ 3B6ZA 2WUVA 1F60A 1QWSA 3U7EB 1HLFA 4V0ME 3MM5B 4JGYB 2ZH2A 2R60A 1CC7A 5EE1A 1EP2B 4KQGA 4IDOA 4RQPA 3BXZA 3D31A 4I9NA 4KDEA 1K1QA 5A4AA 1OSNA 1JA9A 5FR1A 1H1IA 3ZZPA 3H5VA 2WB2A 1YU6A 3LUJA 5BWBA 3J80Y 2W3JA 2C9BA 4PRLA 3PJEA 2NZ9A 4U9RA 2DVIA 1ZBQA 5EXXA 5FKJA 5E88A 3DBHA 4IGKA 5EHXA 3UQZA 4KODA 4Z0TA 2HWB2 3TNQA 1NXPA 4H6WA 1WZ2A 5HQ3B 2ZHKA 1PR5A 3LF0A 4EEKA 2QXTA 2CDRA 4LOHA 1UMBB 1HQDA 1ULUA 2JC3A 4UXIA 4QSMA 2Y4NA 1OI3A 1HQYE 2H3EB 3WSVA 1HB1A 1XPWA 1RXUA 4RWWA 3FOWA 3IV6A 3I8TA 2ZHBA 4F26A 3ESZA 3HCRA 2W2QP 4ID9A 1HBUB 1I7DA 3AUFA 1GDTA 3PL5A 3ZCRA 3S1SA 2L9WA 1RZUA 4DZ6A 2R7SA 3KNGA 1PX3A 4F5ZA 2YWGA 1K7SN 3OUTA 2Z6QA 1Z29A 2JCVA 3NWJA 1YFKA 1OYWA 1TQ2A 2ZZJA 3P9YA 2HQFA 2DXIA 3F2IA 5JPMB 3B82A 2OUGA 5K4LA 4C6TA 2X8AA 3MBOA 3BIXA 1G8YA 3O8QB 5BPXA 1T3NA 1D0EA 1XWWA 3AKSA 5HBMA 4OYAA 5K8UA 1IK6A 1EFVA 3A0KA 3PL1A 2RMKA 3M9MB 1ZEMA 2Q2VA 4CA9A 3O8LA 1Y1RA 3GX1A 2C2OA 4UQLA 1V8PA 3FSEA 1UMZA 5F6KA 2YGMA 2OD4A 4FZVA 2BMDA 4DIDA 4ILEA 3DBVO 1M2NA 3N9NA 2EFVA 5EKTA 4NSNA 2ZXUA 3I30X 3Q3CA 2YHUA 1QOPB 1D2RA 2R8ZA 3OEWA 3KQUA 1R5BA 4WLOA 2YXNA 1A8PA 1DZ5A 4D6PA 1WKKA 2P6TA 4R0MA 4AVBA 4U5QA 3QTBA 5DFAA 4RIHA 2G5GX 5REQA 1ZVQA 1RPZA 1N8NA 5KG0A 4HMQA 4C04A 1XGKA 1DTWA 1PZMA 1K8ZB 3JAKA 2FD8A 3NCPA 1YO6A 5E6SA 3V6DA 2W2PP 2GDFA 2JLCA 3F2ZA 4TSRA 3CNQS 3GRCA 1NRXA 1YULA 3GA0A 2QU8A 3IULA 4BQEA 1G9BA 3MELA 3KV6A 2AKAB 1WY5A 3K1AB 4FOOA 1V2GA 4JLJA 3M0EA 4FKMA 3S99A 1XX6A 4E70A 4NHEA 4PLCA 2MCFA 5IM5A 2VMGA 1LPAB 1KFEB 3LYHA 4QBUA 4C05A 2W2XA 4XX0B 5IZHA 1YMQA 5FLKA 1SKQA 2IBMA 1RUE3 4PQAA 5LOVB 1Z56C 4LISA 5FO1A 1B0ZA 4XJ9A 1HLCA 2VJNA 3ROMA 1RZMA 3K9GA 1TME3 1TEZA 2A0YA 2R6FA 4F3JA 1D7AA 1X7WA 1SOUA 2JLVA 1IMJA 1UH5A 4TPKA 1XLVA 1RT2A 3IBCB 1GPH1 5MAOA 2BBAA 3ADAC 2QW8A 5I0DA 1E1RA 3NJVA 2QQGA 4I1RA 4PX5A 4ECWA 3TZYA 4RR3C 3QHAA 3C1TA 3VV3A 1INLA 4CT8A 2AFIE 3B7MA 3OPWA 3W2WB 4H27A 4PICA 3U13A 5A0YA 3S8MA 4CI0B 1AX9A 2RB5A 4RHEA 4X4TA 4MXWA 2CKDA 3RG0A 1BWPA 1FFXA 1L5LA 3OZAA 4DY3A 3F9IA 1GOHA 1XNHA 5DX1A 4Q0UA 4Z7CA 2Y0OA 1GNTA 1TKAA 1DDLA 3U0BA 4UUXA 4D79A 2I4MA 3FIUA 4RA9B 4FHEA 1H42A 4IERA 4XUOA 3Q9UA 4DLYA 1GZHB 1KMQA 1IZ3A 2GF0A 3ILYA 4M1WA 3RMYA 3C3BA 3LKDA 3CU7A 3D3BJ 4KSEB 5EWEA 3ENKA 4ZVOB 4H55A 5FTLA 1WUHS 4U8YA 3OUJA 3AZOA 1OV4A 3GV5B 1ULSA 1ZPVA 2CNAA 5CLIA 4XUDA 1C1CA 2PEHA 3TX0A 2AJQA 4HLUA 1EAH2 1XDSA 1VTKA 1RVF1 4IUYA 4A8WA 1XTTA 2RCNA 2BEUB 5A3MA 2ZT8A 2OPRA 2ALZA 2GYWA 3ORFA 4UHJA 3H9CA 5T3NA 4DSEA 1AXEA 2ECQA 4H7HA 1JXMA 5GVQA 1IWBB 4NMXB 2XMUA 1GYRA 2EIXA 1W75A 3L4BA 2DGTA 2W0SA 2ZSJA 3KVYA 4MX8A 2P3YA 3PF8A 3EXHB 5AW4A 1N0UA 3SC6A 5A3SA 2C5LA 2JFBA 5BORA 3HO1A 2FXIA 1Y80A 4RELA 2I7CA 1CUAA 3GDGA 4JDOA 1WLYA 3EIWA 3HL4A 4MDEA 2ET7A 4ALLA 5EJFA 4P58A 2JGNA 4KO4S 3KT4A 4EFLA 1PJ2A 4TYNA 3RHSA 3WJ7A 4CTNA 2HBYA 3AILA 4RY9A 3ZXIA 4DSUA 3A6FA 2DWOA 5FLIA 4GW3A 2F40A 3JTPA 1FVFA 1DLIA 2YG0A 4AC9A 5FX2A 3JX9A 1E0AA 1NX6A 2CXQA 1OH8A 4RZIA 4ICIA 1CVRA 3WMWA 1LBEA 1SXGA 1S6PB 3W9AA 1FP4B 3U60B 1N1VA 1PK7A 2FYTA 3NBKA 4FBTA 2NR0A 3T1HF 3FMPB 1ZMXA 5DZ7A 2YJ6A 4YMUA 1C3HA 1WHWA 2G0JA 1IQTA 3WQRA 4YAIA 4WINA 4MVJF 1ZRHA 4W1RA 5JXIA 2ZH8A 1QANA 5HBAA 4UZFA 4BWGA 3D82A 1QSLA 1DG9A 4R51A 1CR7A 4QW9A 4LYHA 3SC7X 3J7LA 3I5XA 1RI1A 2XJVA 3KWVA 2DVAA 5DHAA 1DJOA 1GUIA 4MS1B 2Q8NA 4MICA 3R74A 2W9BB 3PFWO 2AT1B 5EOVA 1SNYA 1W0JA 2AN5A 2J3DA 1HRV2 5FTMA 3H1MA 1WF2A 2PE8A 3A13A 2WVDA 4UZEA 5LZ6A 1OLRA 4YW7A 1GWNA 1CHNA 4AK3A 2QD3A 3CNAA 2VTVA 3L05A 1SOWA 3C74A 3PZBA 2WM2A 3BIWA 1ROFA 1B8PA 3DEHA 4RA6A 2BT4A 1VIOA 3IXMA 3L7LA 3SQNA 4BO0A 3RW9A 1ATIA 3HR9A 5FYTA 2OENG 2GZSA 2UUPA 3D3QA 3KYDB 5DHQA 4X8PA 3H4DA 3LKJA 4MKVA 3ND5A 5D3ZA 4QU5A 4U7HA 2IP4A 4Q4LA 2OSVA 1RRPA 3Q83A 1O3SA 1SC1A 2I9PA 2J0UB 1RXEA 1E2QA 1R0CB 1D1SA 4X71A 2F8SA 1YKFA 2IU6A 1X8XA 3GPCA 1M2GA 1UWBA 2C88A 1BXRA 2OHFA 3RC9A 1W05A 2WVAA 3GN1A 5BV2P 3AX6A 4E5VA 2HC9A 3AF5A 3EF3A 4C0BA 3HH8A 2DPYA 1KWGA 3BK7A 3J81U 5IYZF 2H5IB 1EJ2A 3N2IA 1WSDA 1KE2A 4G0QA 3V56A 3LA2A 4ER0A 4D3DA 4E11A 3ZR5A 3EWIA 4OYOA 1V3VA 2JAHA 4FE3A 4FI3C 2Y0EA 3LP8A 3K9FC 1VPHA 4L08A 1Z5VA 4EFNA 4EUVA 5J98B 5G40A 3EGDB 2CJKA 1MLAA 3JALB 2XVXA 4K1ZA 3TF5A 3S28A 2JRLA 3VU8A 2ZZNA 4ZLPA 3Q7EA 4CU5A 5FTTC 1U0NA 3DHXA 1OXUA 3UNPA 1PAUB 3E5XA 4MW2A 1H9BA 3THCA 3DLKA 2HMAA 3THSA 2GK6A 1R8YA 3WK8A 1QFSA 3WDKA 1CGPA 1SC3A 5GIPE 5A5FA 1DMRA 2JDZA 2FZ2A 4NFSA 3F0TA 4NYJR 4QASA 3T7SA 3A3YA 5FZEA 1FWKA 3Q4GA 4CZSA 2JL1A 1E2IA 5FOXA 1SHJA 3AA8A 1F4LA 2HAEA 4KTVE 5ENVA 4Y2XA 4U2GA 2VBIA 4KQFA 4BNHA 3B8EA 2YWDA 1BHO1 4C11B 4QODA 5JDCC 1IBSA 1JLGB 1PYDA 2X2FA 1SRQA 4PHTA 4BVJA 3TVKA 4AFMA 2VF8A 3OX1A 4LECA 2O0LA 5J1XA 5JIBA 4CR6A 1UXHA 4BKQA 3RSOA 3REFA 3ZKYA 2VT6A 4N0DA 3SM9A 1NFQA 3RWOA 2ZUTA 4F8EA 4LC1A 2YYSA 3TWZA 4R6XA 2AK2A 2ZS7A 1O3QA 2G1PA 4LJ7A 4LSNB 3EIEA 5KYUA 1JQDA 1UX7A 2HMIB 4NWWA 2KWIA 1WW7A 1J97A 1WP4A 4Y0FA 4QJVA 4WK1A 3SI7A 4CCLA 3IOYA 2RUGA 1F9KA 2RDNA 3SIPA 3PFHA 2AR6A 2RSQA 1XA3A 4ETIA 2IUWA 4KGVB 4FT2A 2OMOA 1NMSA 1RHQA 2NZ2A 3F44A 3N9LA 1J0DA 1U49A 5JYCA 1OBVA 2IHKA 3LPEA 1ULAA 4MKZA 3EZFA 5HS4A 2KBEA 3TFWA 1R00A 2WE7A 5A7FA 5JAHA 3L6UA 5GZ3A 1PW7A 5I0TA 1PU2A 2H07A 3WNPA 3HHNB 4R8VA 2OAQ1 3FFZA 3EUWA 3LCRA 1RVF3 4C0KA 4G97A 1YK9A 2VTBB 1BYIA 2ZIUB 1JX4A 4M7WA 1UK7A 2Q8PA 3M70A 2I0FA 3LFHA 2VG5A 4LBHA 4K9RA 1VLVA 4JKYA 2CNNA 2WHXA 2Q6TA 4UVIA 2DFCA 3I8OA 1YJTA 4Q1VA 3HQUA 2RJ2A 5DYYA 2IYWA 1GWMA 4D6RA 3I4CA 1KJJA 5EXSA 4GJZA 3ZWAA 1EHIA 2XKJE 3OPYB 2GX6A 4P73A 1S1MA 2I54A 3OX3A 3DKPA 1Z12A 1F0PA 1TIBA 2ZS9A 4KE8A 2GJAA 2YS7A 1JR3A 1HUQA 3TNDA 2Q8OA 1W73A 1L1RA 3F4BA 5J3JA 3I96A 2JVOA 4QVIA 3GLIA 1HRI1 4GJYA 4BL5A 5BT8A 1OUSA 3OIDA 1HYBA 4F97A 3UXHA 3SLGA 1OA3A 2HV9A 3NONA 3HI4A 3O1UA 2BKLA 1UAGA 4HYQA 3NJRA 1UIRA 3MPDA 4MKGA 4TKTA 3VALA 1ELOA 1QHGA 5KFIA 4W8GA 1M2OB 4CLRA 4XQ0A 3EPIA 2F7SA 3KGZA 3PRVA 3BWYA 4GYJA 4LXGA 2FUNB 4U1RA 4A7PA 2IDKA 2E33A 4WZZA 4YCJA 3LP1A 3QT8A 1T13A 4ZYLA 2JIQA 2ASDA 4JITA 3LUCA 3KU4A 2VF4X 4FD3A 5H82A 4REOA 1BCRA 2PXHA 3AU9A 1FKOB 3KLVA 4TVOA 3OAAD 1IBCB 4HWSA 1QIQA 1A9SA 2QT9A 2ERXA 5JLJA 1PUIA 4BNKA 1WZNA 4M99A 4EYEA 1EDBA 3WICA 1EVQA 4EZ6A 4YIKA 3T8YA 1EH5A 4DR2B 1RB0A 4CTAA 4WFXA 4Q0PA 4TKUB 1P1KA 5IBRA 4HVQA 2I1WA 3I55S 5DETA 5ICSA 1YOVA 3N2NA 4G9EA 3C6XA 2HWXA 3OJBA 2RH5A 3SY8A 1UVIA 4IOMA 3O92A 4F11A 2P9QA 2RT3A 1FSSA 4Y8VA 1WZEA 3BBLA 2PKRA 1KDTA 1V5WA 3FHCB 2RIRA 1PGZA 2I03A 1HHQA 5F5QA 4GNKA 1SH0A 5A32A 1RQ7A 2BBEA 2PT0A 3WEZA 2IRWA 2OXFA 4CQNA 4MJKA 1ETUA 3IMNA 3HADA 3EOAI 4HWOA 3MCOA 2ZBGA 1L5MA 4BFXA 5LXTA 2ZBRA 4BCDA 4LJAA 3A8TA 2PUHA 4OQMA 2QA2A 1V26A 5ALXA 5K4AA 1OWLA 1YHNA 3Q9SA 1IRIA 3IO5A 3W9SA 1KR2A 1SG6A 4K03A 3KOWA 1F7VA 2V3CC 3CVKA 3PWSA 4UHHA 3GRVA 3NMAA 1AFJA 4AJJA 3FZYA 4KACA 4IOBA 4O3QA 1G7RA 4NX2A 5HMXA 2MKIA 1H73A 4ND6A 4WGGA 1O6GA 5FIIA 5JFGA 4NX9A 4DMFA 2IA0A 3Q2TC 1UM9A 1JLEA 3ND6A 2CL2A 3SDEA 4CTJA 1DBIA 1T5HX 4LPKA 1CJPA 2CJFA 5CEHA 4GALA 1TW2A 3EULA 1ZBA2 3CUWA 4A6PA 4FOPA 3C5EA 2VPZA 5CTJA 3O8RA 4PKDB 2WF5A 4UNSA 4PWYA 5GAGU 5JW6A 1WG8A 4E46A 1OF3A 5DHFA 2IZ1A 3SCKE 1OXVA 1C8M1 3NO8A 2EFGA 2VFUA 4DQLA 1DHMA 1ASJ1 2W83A 3SN6A 5C53B 3AB8A 2QRJA 2VA3A 4HLQB 3HVJA 3GO4A 3TL6A 3AETB 3IESA 3QLHA 3HCNA 1X1RA 2H4XA 4A8KA 3R0QA 2JD0A 3I9V1 2W2OA 4UPEA 1XEZA 3VHLB 4RD6A 5A6SA 4BXOA 4UOHA 4QKFA 1LODA 4X8MA 2P7HA 1UC4B 4YHBA 1KZ1A 2V6FA 3U3ZA 5C8WA 4DFJA 1ML3A 1QYWA 3QVSA 4WD3A 1T8YA 3DXSX 1I1OA 1D1QA 4MYHA 2GMLA 3MM8A 2F3RA 5AM0A 4ZRMA 4BLJA 3U3MA 4FAHA 2DNZA 2EJUA 2J9GA 4UAVA 4US0R 3L4SO 5KBYA 3DS8A 5ECWA 3TO5A 3U10A 3DTVB 1RBQA 1ZQ9A 3MLLA 4WZFA 1DJMA 2O59A 1QTQA 3FEYB 3WGLA 4N3AA 5B6IA 3ZZ0A 4DARA 4I8DA 1FVOA 3DGPA 4WLUA 1KYZA 1N6LA 4OQDA 3I4PA 3JQKA 4GEKA 2XDQA 3G6XA 2X8JA 1I6XA 5ALZA 2HF2A 1N4LA 5DDJ1 2DTYA 4WPGA 2PHWA 5I8PA 5C42A 2J3HA 5E1BA 3R5TA 1IJEB 4UF4A 3HT3A 1AG9A 3WHLA 2WNOA 4WUVA 3ZCUA 4V1CI 3KXLA 2E66A 1R27B 2CSUA 2VG7A 1HURA 2RDSA 3UWOA 3KD2A 3TSYA 4NHKA 3L0ZA 1NAIA 4U2CA 3VYTB 2PJUA 3VX4A 4BYYA 5FBJA 1TAQA 3U9TA 3B1VA 4X1IB 2DNGA 1BHSA 1DQ8A 1P45A 1LSJA 5DUXA 4H31A 2ZYAA 5CNKA 1CJVB 4BP8A 2JIDA 3KUEA 1Q81T 5CHEA 3AP4A 2GMHA 1EZ4A 2GM4A 2GMWA 4FS8A 2DHCA 1OX5A 1SG3A 3RFFA 3G9CA 5GP1A 5ALOA 1H3DA 4EAAA 2BBOA 5DF1A 4D9BA 4QX3A 2QTAA 3Q40A 1RAFB 1HRI3 4IW3A 3GU3A 4QPZA 4MS3B 1GYQA 2WJIA 4RTLA 2IYVA 4HBGA 4DLXA 1S4QA 3A1CA 3LL4A 2BJ1A 1CQJA 3W04A 5A05A 2AYBA 3WNMA 2JJ2A 3CH6A 2KJQA 3AOGA 5FY5A 5AJXA 2GF2A 2PXXA 5I7VA 3CT4A 2BJHA 4IJUA 2CGOA 3KK2A 1XU7A 2PGIA 2ZTNA 3ZCVA 3E58A 2APOA 2OG1A 3KHBA 1M1NA 1E96A 2F3QA 5C7YA 3HVAA 1DKRA 1N5JA 5EE0A 5IHPA 4ZAWA 4E98A 3KE9A 1VR3A 1II8B 1VQNS 3Q8EA 1BFDA 2VOJA 1PJ7A 3HVHA 3HZEA 4F5EA 4UJ5A 5F1RA 2GPSA 2WONA 3DN9A 3VKWA 2WAOA 5KX5B 4UNNA 2LA6A 4H7KA 4BMSA 1NLQA 1U3VA 1LZKA 1A69A 4G5YA 4JHZA 5A7QA 3DYAB 1ZHHA 4C8YA 4M0CA 3A6JA 3EAGA 5BNWA 4ZALA 1OXCA 5EQUA 1ORTA 1SPPB 4HPXB 3KYLA 1E3IA 3BZBA 3FGVA 3B6EA 4L76A