4C0BA

Structure of wild-type clp1p-pcf11p (454 -563) complex
Total Genus 131
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
131
sequence length
428
structure length
428
Chain Sequence
TGDNEWHKLVIPKGSDWQIDLKAEGKLIVKVNSGIVEIFGTELAVDDEYTFQNWKFPIYAVEETELLWKCPDLTTNTITVKPNHTMKYIYNLHFMLEKIRMSNFEGPRVVIVGGSQTGKTSLSRTLCSYALKFNAYQPLYINLDPQQPIFTVPGCISATPISDILDAQLPTWGQSLTSGATLLHNKQPMVKNFGLERINENKDLYLECISQLGQVVGQRLHLDPQVRRSGCIVDTPSISQLDENLAELHHIIEKLNVNIMLVLCSETDPLWEKVKKTFGPELGNNNIFFIPKLDGVSAVDDVYKRSLQRTSIREYFYGSLDTALSPYAIGVDYEDLTIWKPSNVFDNEVGRVELFPVTITPSNLQHAIIAITFAERRADQATVIKSPILGFALITEVNEKRRKLRVLLPVPGRLPSKAMILTSYRYLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for ATP loss by Clp1p in a G135R mutant protein.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
molecule keywords MRNA CLEAVAGE AND POLYADENYLATION FACTOR CLP1
total genus 131
structure length 428
sequence length 428
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06807 Clp1 Pre-mRNA cleavage complex II protein Clp1
A PF16573 CLP1_N N-terminal beta-sandwich domain of polyadenylation factor
A PF16575 CLP1_P mRNA cleavage and polyadenylation factor CLP1 P-loop
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.1030 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4c0bA01
3.30.70.2410 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4c0bA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4c0bA02
5ELXA 1NVVR 3MFYA 1FNNA 3OZXA 2J0QA 5KUTA 4HLDA 2NG1A 3EIHA 2Q9AA 2F9MA 4HB4A 2WWGA 1YE8A 1LNZA 2VSXA 3ETLA 4Y0VA 2WM9B 1O3YA 4LC0A 3B1WA 1J7KA 3I3SR 4ZCIA 1G3QA 3KXIA 5F3WB 2EFDB 4DLZA 1G7TA 4EJSA 3HR8A 3IIKA 5FOXA 2ANBA 5DHFA 5IT5A 4AIIA 2QT1A 4BEJA 3U7HB 1OF1A 2MSEB 3OIVA 1DOAA 1W0JD 2P2LA 2LKDA 3EIEA 2WJGA 3VMFA 4E07A 1YR6A 1D2MA 2QENA 1IN4A 3R7WA 5CB8A 1MO3A 5KPJA 5CJPA 4AD8A 3MJRA 3L2OB 4LYAA 3RWOA 1JR3D 2VEDA 3O8RA 2X8AA 4IXNA 3SI7A 4XIGS 1RYFA 5FTNA 4MDEA 3C15C 1M2OB 3DMNA 1XX6A 3CO5A 1I2DA 4TL9A 3IO5A 3I5XA 4Q9IA 1QHIA 2W6ID 2P6NA 4QGAA 2JLVA 1OYYA 1S1MA 4QG7A 3GFTA 1DPFA 3IQWA 3IUYA 5KNCA 2V4ZA 3AF3A 3QKSA 4TLDA 5H1YA 3QEOA 1TEVA 4OK3A 5CJ2A 4DKXA 2JJ8A 1GRNA 3KQUA 4D26A 4B47A 5JECA 3WBJA 4C2TA 5JZVA 4TZ0A 4TZ6A 4RFVA 3E2IA 2G88A 4I4LA 1XEWX 2NZ8A 2XOKA 1OH6A 2C78A 5JWHA 2KE5A 1YHNA 3A1WA 2FF7A 4U5XA 1XCGB 4LSGA 3FVQA 2F7SA 1O87A 4PC1A 1CF4A 2V8OA 4CT4B 4FWTA 1UPTA 2BEKA 4Q4HA 3IHWA 4KFSA 4MGKR 3X1ZA 2C03A 5AJXA 5DE3A 3HR7A 4KBFA 521PA 3UWOA 2YC2C 4AI6A 2WKQA 4Q4JB 5DI9A 1J99A 1NMXA 1J90A 2P6UA 3FMFA 4XTRA 1U99A 4XJXA 1CKEA 1PUJA 5AUQA 2V55B 4M1OA 2GCOB 1P72A 2JGNA 2VO1A 1MOZA 5FI0B 5FOUA 3U4QB 4JIMA 1Q1ZA 2OHFA 3AF1A 3SR0A 4KI0A 2FSFA 1TMKA 2QGZA 4PO9A 3W3AA 4BFZA 3LV8A 3KQKA 1MO5A 3K1JA 4PHFA 2G0TA 2HUPA 2WWFA 2HT6A 5L3SA 5BW8A 4JLPA 5TV2A 5CK5A 1KSHA 1U0LA 3EIQA 1YZLA 4OK5A 5TMPA 4C0JA 2PJRA 1ZC4A 4LHYA 1A7JA 1G21E 1TQ4A 3V4RA 3KXLA 1NBMA 2EW1A 4TSFD 1G64A 4OQNA 2BMJA 4HAWA 3ZS9A 3ZVMA 2N46A 2CDNA 1JPJA 1QBKC 2PLRA 1E9FA 2WJIA 1XPRA 4Q03A 2E87A 3Q72A 3AVXA 3AVPA 1E6CA 2FSHA 4NDZA 4FN5A 3TLXA 3UMSA 4RFSB 1L2TA 3SNHA 3GJ7A 2XSZA 2Q9BA 3B1YA 5K8TA 4D0GA 2ORIA 4N3NA 4QFMA 1X3SA 2PLFA 4TMWA 3QXXA 2WJHA 4YXWD 4KU4A 4YDHB 2Z83A 3AGQA 4B3DA 1BOFA 3VAAA 2ZTSA 2BVNA 2KBEA 4F7WA 4A82A 1P62B 3WMFA 1LW7A 4DLTA 1PVOA 4Q7LA 2CHGA 3C7KA 1U8YA 4KAXA 1P60A 2VTKA 1II8B 4RKFA 3PUZA 4B76A 5FTJA 1OXVA 5HCNA 4MRSA 3SC3A 1E0KA 3VHLB 1PLJA 2WIBA 2IEYA 1WDTA 2AX4A 1KO4A 1QF9A 1E1QD 2VYFA 3CH5A 3T15A 5BQ5A 3T1VA 1DBSA 3U7GA 4BRWA 5L3RA 3FFAA 4LYJA 1KSFX 3WXMA 2IXEA 3NHAA 3ICEA 2OBLA 5J4VA 4LHZA 3HU1A 1N5JA 2GVDC 1KI8A 2NQ2C 1HQYE 2QTVB 1GDDA 3L0PA 4JBYA 4Q18A 1MO4A 4GPTA 4LJ8A 1R0YA 3O47A 4JLBA 1E9CA 3W3ZB 4V0ME 2B8TA 1OFUX 1Q1BA 2CE7A 2ZJ5A 4BWYA 3O8BA 2H7VA 3CBQA 3IIMA 3IQXA 1NL3A 5DI3A 3LWNA 2H1LA 3GJ8A 1ZD9A 4BASA 4ZI3A 1NMZA 2QBYB 1IN7A 5HZKA 4JLKA 4RY2A 5KSPA 5CIWA 5LB4A 2HT1A 1R0WA 2NTYC 1AA9A 1EX7A 2EYUA 2G6BA 4JVNA 3FFBA 4GOKA 1WA5A 5F98A 1H8HD 3PCRB 2HLDA 2AXPA 2ZI6A 3FKQA 3RSLA 2FSGA 3IHLA 4S2EA 1N6RA 3MD0A 3SN6A 5JSZB 1KNQA 1KDOA 1M7GA 4Q7KA 2ONKA 2OFWA 3K0AA 3MWKA 3SJCA 1W36D 1CU1A 3FOZA 4MRVA 1KTVA 3K9NA 3B9PA 2ASEA 3VKHA 1IHUA 4LUCA 1IY0A 1YVDA 2JDIA 4OQLA 4EFMA 3ND8A 2VPPA 4BLRA 3KXKA 2GNOA 2JA1A 3U44B 2FX3A 4HLCA 5AUPB 1NLFA 2GZDA 3M1IA 2XZLA 2XJ4A 4GZMA 3CR7A 3K0CC 5DGXA 3P26A 3QNUA 3LAWA 3QOFA 4NCHA 5GJVC 1EWQA 4B74A 2QGNA 4MKGA 1GITA 1L4UA 4M1YA 4UNPA 1YZQA 1U9IC 1RRFA 4JVMA 1U8ZA 1XNJA 2VHCA 1ZYUA 1NN1A 2ZU0C 4CGZA 1TL7C 1E79A 3JZAA 4UXHA 1NVVQ 3ZVNA 2C9CA 2BOVA 4NYIR 2ZS7A 2ZS8A 3AV0B 2J5XA 1W44A 2QAJA 1GUAA 1S4QA 3I62A 3GP8A 4O2RA 1KI3A 1E2KA 3K9GA 2V54A 4BE7B 1KO5A 3SFZA 1UBFA 2VP5A 1UEJA 2CJWA 3OFND 2RGNC 4HAZA 2A5DA 1Z28A 1G3RA 2BIFA 1VHTA 1SVIA 2AD5A 2AK2A 2HYDA 2ZRHA 3A4NA 4IEIA 1R0ZA 3BXZA 2C98A 1UBEA 4HYYA 1P7CA 1AQUA 3CPJB 4DZZA 2G77B 2WPDD 5JJKA 5BN4A 1U8AA 5K8IA 1RYHA 1LF5A 4OI0A 1R8SA 3K70B 1DAFA 1KY2A 1VMAA 1KK0A 4LPKA 2C77A 4XWOA 2BM0A 2XB2A 3DKPA 2F1JA 2PZFA 4KFTA 1DEKA 3S1AB 4DDVA 3T34A 1NI3A 1XDBA 3SQWA 1RC8A 1JR6A 5TXGA 1T4GA 3BB3A 4RZXA 3U60B 1SKYE 3RS0A 1ZU4A 4K46A 2PJZA 3ZZ0A 1ZRHA 2YC4C 5IHPA 1US8B 3LH5A 5D3QA 3DM5A 1G16A 3PXGA 1V43A 4UQOA 3VKGA 4A15A 3SBEA 2VHTA 5HKKD 1UADA 1F3OA 1ZM3A 3U4QA 1KK2A 4KITB 4FMCB 3MSXA 2PX0A 4DXAA 2QQEA 3PJRA 121PA 3L8YA 4ESHA 4NL4H 3OE7A 1R6BX 3GJXC 5DNYB 1XU4A 5EE1A 1GSIA 2BV3A 4UJ3A 3BB4A 3KB1A 4ARZB 4LRWA 5CDFA 2IXFA 3ZQJA 2IF0A 4DB2A 1KMQA 1P9WA 4TMZA 5AR1A 2R2AA 5JRZA 1DAEA 2ZYVX 3LFUA 3PFIA 4M1WA 4TYQA 2HCBA 4LBZA 1M74A 3QVVA 5FBQB 2QI9C 1E94E 2RGEA 3DZ8A 1GZSA 4US2R 2B21A 1EX6A 1RJ9B 2JDID 3OIUA 1I4TD 4JVLA 3VR3A 1N0WA 4AYXA 1OIVA 1R5BA 2O52A 3RRMA 1OXTA 1OFTA 3P4YA 1E2LA 4IFEA 4N0DA 4A1FA 1VKJA 2XNDA 1E2EA 3U3JA 5GADl 1IJFA 2O8DA 4JBXA 2NO6A 1VG1A 4D0LB 4TT3D 3VHXA 4DJTA 5KSZA 3B78A 3U5ZB 2OFXA 4NYIQ 1XBTA 2CEAA 2DFNA 2HYIC 5DI3B 3DMDA 2J1LA 5KTYA 1S3GA 4BFXA 2ZI7A 3B85A 2R6GA 1GILA 2BC9A 4KV9A 1KI9A 1TQ2A 5E3HA 3I73A 4DCSA 1VCNA 4TMVA 3SFVA 1E1RD 1MT0A 4CRWB 2H18A 4KFRA 4MRNA 1CJUC 1E4VA 3SBDA 3TVDA 5JS7A 1G5RA 2HCJB 2QPTA 2Q21A 1YZGA 2GXAA 1VYTA 2LCFA 3GEIA 2RAPA 3KX2A 2MMCA 3ADBA 2GEVA 2VBCA 2DWOA 3RS7A 4LJ5A 1WMSA 4IHQA 1OB2A 1KOFA 1XEWY 4IEEA 2ZRMA 3TR5A 1OIWA 2BKEA 2ZUDA 3I61A 1W1WA 2ZR7A 2P6RA 3I4LA 3QKSB 2DB3A 1Q1EA 1SGWA 2R44A 4FI3C 5FL3A 4QC2A 1XD2B 2OT3B 2ZE8A 2CCJA 1S8FA 2W6IA 4KVAA 5CM9C 2F3RA 4NTZA 2FFAA 3BH7A 4PAQA 1ONBA 2ZI4A 4MRPA 2Z4RA 2N1BA 4P4SB 2ZYTX 2GXUA 2KI5A 2V9PA 4Q4AB 3CB4A 3SEAA 2RGNA 2IYWA 4GOJA 1UKEA 5EXXA 1OV4A 1DAGA 2GJ9A 1Z08A 1E2QA 1TU3A 2AR7A 3UPUA 2Z6VA 4PX9A 3NVAA 3TNFA 5J5CA 3CRQA 1UKVY 4MUBA 1AJEA 2WSSD 5B30A 1WF3A 4YMUA 2EVWX 2I1VB 2FEOA 4R98A 3AKCA 1T3SA 3OEHA 5FPSA 3BWDD 2F1HA 2FPKA 1A82A 1VCOA 1PZNA 2OESA 1F6BA 5EE0A 3GLFB 4URZR 4RZUA 4MYHA 3NG1A 4P33A 4X8MA 3QPUA 4LJ4A 3A37A 4ZV4A 2O8FA 4CEHB 1Z6XA 3OEHD 1ETUA 2OCAA 2QE7A 1XCMA 5UKDA 2YNMA 5BWMA 1EFTA 2ATXA 3LX5A 2GTPA 1TAGA 2WOJA 2C9YA 4M0LA 3GJ3A 1E4YA 2X2FA 3ZIAA 1E0SA 4MH0R 1BMFA 4OI1A 4BZPA 4EQ6A 2XZOA 3EX7C 2GK6A 2CLSA 2EWWA 3LRPA 3TAUA 3NBZC 4NBSA 5A0FA 2IS1A 4B3XA 4D6PA 3WMEA 4QBIA 1ZP6A 4QL3A 2QL6A 2ZEJA 4LBWA 2A2ZA 2FV8A 4OQFA 2ZRCA 1E69A 2K5UA 5LD2C 4KJZA 2ERXA 1II0A 4ZI2A 3S1AA 1P9NA 2A78A 1GNQA 1M6NA 2YWHA 5BN5A 4PSVA 1KSGA 3IO3A 4DLUA 1XB2A 2JEOA 5BYJA 3ADCA 3T06B 3IGFA 3X2SA 2JJ1D 3KQLA 4PC2A 2F6RA 3DEFA 2NPIA 3Q5EA 1XPUA 4C0BA 2PL3A 1CRPA 4QXAA 5FI1B 1R0XA 1XMJA 3AF0A 3TH5A 1SXJB 2P3SA 4KSCA 2O8CB 3EPHA 4EDHA 4IVQA 4QNRA 1VYUA 2ORWA 1KJWA 1TQDA 2F43B 4Q47A 1CBUA 4GP7A 4ASUD 3QBVA 2ZRFA 1E98A 1SVWA 421PA 1HT1E 3N70A 1VHLA 4DIDA 2QSYA 4GBMA 4BLQA 2GXSA 2DFKB 3H86A 2GF9A 4G0NA 5HPYB 4TYYA 2ODBA 1E2GA 1QG2A 3KQNA 4E5UA 3VR1A 4W5HA 1Q3HA 2FSIA 3KJHA 1N5IA 5TARA 1HH4A 4TL6A 1UKZA 3F8TA 2IHBA 1UBGA 2YWGA 3PQCA 1IM2A 1BYIA 1MABA 3QENA 1MR3F 5DISB 2GBLC 5KSOA 4TMTA 4PPNA 1DAMA 4L5BA 4Q5IA 1RPZA 2PZEA 4GT1A 4MQBA 4U7DA 2ZJ8A 1N6OA 1IBRA 3L43A 3NC0C 1E0JA 1VDZA 3IPYA 5LDDC 4TLCA 4TYWA 1JNYA 1ZU5A 2PCJA 2WPDA 2R62A 4M21A 3WP0A 4WIAA 5J47A 2O8BA 3KFVA 3L8ZA 4MITA 2JASA 1Z29A 2QMUA 1WXQA 1G7CA 4QJ4A 1SZPA 5L3QB 4L9WA 2GKSA 2ZI3A 2AD1A 4ZKEA 1NMYA 5CYOA 3PEVA 1TF5A 3MG9A 2YV5A 4C30A 4PSAA 5HKKA 2O8BB 4QKQA 1VYVA 2P65A 5TY0A 4B71A 3B2EA 3RABA 4EPWA 1KI2A 1BO6A 3RS3A 1SXJC 1QVRA 3MMPA 4B2IA 1W36B 4PPGA 1CR4A 3V9PA 5J4LA 1FNMA 2VP4A 5EZ5A 4PZZA 4DSNA 2VP0A 3GLGE 1HV8A 1ZD8A 2R65A 2NMVA 3CZPA 3AVYA 5EZ6B 1TUEA 2QUZA 3GLHE 4G5SA 3T12A 4L16A 1IY2A 2WKRA 4ZKDA 1ZMXA 2E1RA 3N2IA 1SVMA 3L0IB 3IILA 2B92A 1YJ5A 2NPFA 3RANA 2GDJA 2GJAA 2IUSA 3EAQA 1KYIA 4OHYA 1EFHA 1KO8A 3TSZA 3VNVA 2JIZD 1T91A 2REBA 1M7HA 2G1JA 1ZIPA 2AN9A 2VF7A 4PZYA 2JLRA 1SHZA 1FOEB 4JLNA 1COWA 2B8WA 1HYQA 4LY6A 4WZ6A 1R8QA 1G1MA 1GL9B 1PLLA 1W0KA 3PEUA 5KNDA 1EG7A 1YR9A 2VP9A 1K6MA 3VKWA 4WA7A 2D62A 2IYYA 1EXMA 1IN6A 3DKVA 3K09A 1W2HA 1JB1A 4LV8B 4TL8A 1KGDA 4LV5B 4I1VA 4TTQA 2QRNA 2IF2A 4DUGA 2OAQ1 4O3MA 2WWWA 2VLIA 3REFA 1MO6A 1OPXA 1YZTA 4V0OA 2GJKA 4Q4JA 4M9QA 1TNDA 4JSYA 1M34E 2WOOA 4CEIA 1B23P 2GCOA 1DS6A 1A4RA 1GIAA 1G4AE 2YOFA 3O8CA 1KO1A 3TBKA 3THYA 3THWB 2NGRA 1E32A 3DOEA 4JZKA 4H1UA 4MGZR 1TU4A 4D2IA 3PG5A 4HLQB 5DHAA 2J7PA 4QRHA 4C2UA 3EZ6A 3SS8A 2QU8A 2XGJA 1AN0A 1G41A 3G0HA 1FQJA 2IYUA 5FR1A 4HUQA 2XJ9A 1P5ZB 3B8HA 1G8FA 3PUVA 4G5OA 3NH9A 4IW3B 4M22A 3BD9A 5C4GB 5TVKA 2BCGY 5FUWA 1KIMA 1DARA 2FPLA 1XJQA 1CP2A 2GHIA 2J87A 2QT0A 1AK2A 4EPRA 5FOSA 2GCPA 3AP1A 2F55A 5HZHA 1XXHE 2QM8A 5G41A 4JT2A 3X1YA 3CRW1 1ZNZA 2ZI5A 2ZE7A 2FZLA 5KDOA 4H9GA 1F2UA 4EJSC 1ZM9A 2ZVQX 3L0OA 1N6LA 4TQ9A 3A4MA 2IYXA 4BUJA 4JYCA 2GCNA 4PPFA 2FU5C 3Q7QA 5BXQC 5EP4A 2F43A 3SJAA 3QKRA 2A9KA 2LKCA 3QKTA 2BJWA 4B44A 2XXAA 2EQBA 1PLKA 4PANA 3QIAA 2FFBA 3QXJA 2C96A 4YXWA 3B9QA 5SZIA 4LI0A 3C14C 3H4MA 3AKDA 1WQ1R 1RKBA 2N42A 1KMHB 3LQRA 1GAJA 3OE7D 4GMDA 4EPYA 3QF4B 1Z0JA 1FX0A 1OH8A 5FUYA 1CS4C 4TYNA 1LV7A 2RHDA 4URUR 5DSZA 5CDFE 2GEDA 5AJZA 2J0UA 5IF9A 4LYHA 3K8YA 1GM5A 3CLVA 1N5LA 4YDSA 2Q9CA 3C41J 3DDCA 4LV6A 4YC7A 4IKEA 5DYIA 3KJEA 2IYSA 3BH6A 4IDPA 2BBWA 2GVZC 2H5EA 3FTQA 3WHKA 1G8GA 1VIAA 3BC1A 3I72A 1NY6A 1WE2A 2ZI9A 2ZR9A 3RNLA 2J59A 3ZD7A 5F2EA 4JVSB 1OKKD 4HSEA 4EPXA 1U0HC 2PMKA 2AK3A 2ZJZA 3AQ4A 4U02A 3O8DA 3D6TB 721PA 1D8TA 1OXUA 1DG3A 1RJ9A 4URVR 1VCMA 2QN6A 1Q44A 4O2LA 2B6HA 2FFHA 4BECA 3R9IA 3MAAC 4ZDKA 1UBCA 4BPBA 1G7RA 5L8VA 4B3FX 4JL8A 1Z0KA 2DYKA 3R8FA 4D4JA 1FTSA 1TF2A 4NU0A 1GOTA 3BAFA 3T35A 4C7OA 3TUZC 2GRJA 2ZVPX 3AGPA 3F0TA 4IOKA 3K70C 3FHCB 3CF0A 3NEYA 4JKIA 4RD3A 4BZXA 3GLHB 4AWXA 3P32A 1Z47A 3ONWA 3OAAA 4KCGA 3P20A 2EU8A 2IYQA 3RS2A 1G3MA 2QP3A 4P4TA 1OXXK 2OV2A 4P32A 2P5TB 3EZ9A 1FMLA 1N6NA 1G17A 1U94A 3HU3A 2BDTA 3EC2A 5DO9A 3RHFA 1WCV1 2ZRLA 5JJLA 3TAHA 3AVTA 4Q4AA 4NE2A 2ZJAA 4N0EA 3QY0A 3E70C 2O0JA 4HLUA 2VH5R 1LB1B 3FMPB 3LW8A 5J4YA 3PEWA 3WRYC 4IOMA 3K53A 3CNOA 2FA9A 4CDGA 1T8UA 2BJVA 2GA8A 1N0UA 3HYTA 5KOYA 4ARZA 1G20E 2FOLA 4DUGD 1OH7A 2UKDA 2X19A 1DG1G 3CNLA 2JIZA 2QY9A 3CX8A 4IDHA 3ZVLA 4B33A 2ZSFA 4EUNA 3H1TA 3WYFA 3AF2A 3W5JA 4QJ5A 4US1R 4IFBA 1NLYA 1TADA 2CJWB 3CPHA 2O8FB 4DT1B 1K8RA 3BBPA 1K5GA 4Q1CA 2WMOB 4FCTA 2IUUA 2FG5A 5JRJA 1RVDA 3BIFA 3ZH9B 1ZCAA 3AUXA 1Z0AA 4BFUA 1GL6A 5AUNB 1NRJB 3C5CA 5G3ZA 4PHHA 4JKYA 4FMDB 4AK9A 4P4UA 4XD7D 2J9RA 3MGCA 2QSZA 1KDPA 4EFLA 1R5OA 1OW3B 1W4BA 2O5VA 2WJYA 3D31A 4D4MA 3U6BA 2CNWA 1YQTA 4A2WA 1OT3A 4QM7A 1JALA 4KFUA 4DEXA 4DB4A 4A6XA 2QP9X 4PC6A 4KVGA 3CZQA 1NG1A 2X1VA 3G82C 2HLDD 5DN6D 3W5IA 3LY5A 3NHBA 1XPOA 1LS1A 4RD4A 2XOKD 4JLMA 2AHOA 4IDQA 4KYUA 2O8DB 4GNKA 5G53C 3SQXA 2VHUA 4A8JB 2AXNA 1P3JA 3L0SA 2IHYA 1N6HA 1XCPA 4QHTA 1DO2A 2R6AA 3QQ5A 4NCJA 3GLIB 1T6NA 2HJVA 2KBFA 4JT4A 4FMBB 3LX8A 3R7WB 1OE0A 2OE2A 1XTSA 2J41A 1ZNYA 2CXXA 2CCGA 4WXRA 3QVUA 1DTSA 1W4CA 5CLLA 2H17A 3W6PA 1YKSA 2C95A 4NP6A 2Q0HA 1XFAA 5LBIA 1BMFD 3EZFA 4C0HA 1AS3A 5E4FA 1X1SA 4ZDIA 4XVRA 1XRJA 3A1TA 4PO1A 3GMTA 5C4MA 2IUTA 1CR2A 4A9AA 2Z4SA 2IWRA 3M0EA 2GXQA 2IXGA 3W6NA 1JXOA 1G8PA 2DBYA 2GBLA 3GFPA 4HAVA 3OIWA 4W5WA 3HPQA 3P27A 4RSGA 1D6JA 2OLKA 1D2NA 4B3GA 3ZD6A 1E9DA 2IL1A 4AKHA 4A0HA 2IYVA 3FYHA 4FMCF 1A1VA 2FDCA 1TF7A 2PT7A 3UK6A 1DE0A 4RCZA 2QRZA 4F91B 3L82B 2A5GA 4MYCA 1KNXA 1VECA 2G83A 3QPWA 1KSJA 4G01B 1DO0A 3ZS8A 2V1UA 1Z83A 2ODNA 2R9VA 2ZRIA 2CMKA 2CCKA 1UAAA 1UEIA 2ZIAA 4MYTA 4Z51A 4FXPA 3I32A 4YQFA 4B35A 2GZHA 3KFXA 2J45A 5HE9A 4V0NA 3SYLA 3OFNA 1ESNA 4JLOA 2GZAA 4B3BA 1CJTC 1GL7A 4JLDA 3QPVA 1IJEA 3A58B 1W4RA 1KKLA 3WP1B 4DLWA 4HLUC 5FPYA 3W6OA 3T1OA 4AKIA 1I4DD 3LXXA 1IONA 3DPUA 3VNUA 2OEPA 1N25A 1W48A 2JJ2D 4ACAA 2Q3MA 3UMRA 4BLTA 2V3CC 1JXMA 4C4PA 4EIWA 4QBFA 1HQCA 4OL0A 1GNPA 4M9ZA 2PBRA 1E9AA 5AWFC 3VR5A 1BYUA 1QHHB 3UG6A 4ZDJA 4AURA 1L7VC 4HDCA 4QNMA 1VG9B 4BFSA 5P21A 3R20A 4RD0A 4A0FA 4Z1MD 2ONJA 3CRVA 2O8EA 2WAXA 2GWHA 1X8LA 4B75A 2VSFA 3Q3JB 4CEJA 1PJRA 2ZJBA 2LWIA 4AY2A 1NSTA 4OHZA 1YZUA 4YLGA 1II9A 4ZPXA 2VA8A 4QGHA 5SZHB 4M1KA 4Q9LA 3AKYA 1AGRA 3KDSE 1P73A 4LK2A 3QF4A 3QEJA 4JLVA 4OK6A 5IRCD 3CWZA 1NN3A 1P2TA 2VRWA 3U3RA 1SXJA 2A30A 5EXSA 5HR5A 3GJ4A 4XSHA 2H16A 1CULC 4QJ3A 1EFCA 4H1VA 1H8EA 3U7FB 1HURA 3UIEA 3VX3A 5KU1A 3EA0A 4BFYA 3GQBA 4CZ2A 4XVQA 1ZM7A 3TQFA 5FFMA 1RRCA 1NP6A 1Z8FA 1P2VA 4B6FA 2ZRDA 2VHJA 5G3YA 1GKUB 4FIDA 2J0VA 1OIXA 3QKUA 2BMFA 4RCYA 2F9LA 2ZR0A 1KJZA 4XTCS 4M1TA 4C7OB 2REXB 5DIFA 4LJYA 4BEBA 1E96A 1IN8A 2D3WA 2IS6A 1QRAA 3F5FA 4LWZA 1W47A 2C99A 2QEQA 4B34A 3H0KA 1OLOA 2WIAA 3LXRA 5J4HA 2XZPA 1JI0A 2JCSA 4BLOA 3WY9A 2ODWA 1W2GA 2YVUA 3QG5A 4HATA 3AVVA 2RKOA 4IRUB 3FGNA 5EJEA 1MH1A 4NMMA 4RD1A 1MV5A 2V6JA 4W5JA 4WZBE 2BEJA 2WSMA 4UJ5A 4BLPA 2W0MA 4TLAA 3FE2A 2WV9A 3W8RA 1GNRA 3BERA 4MYUA 3WBKA 2DY1A 3WHLA 3X1DA 4AYTA 1F60A 2OG2A 2QA5A 1ZNWA 2GETA 4LC1A 5HTKA 4R71A 4I1OA 1XMSA 5F9FA 5B2ZA 3MRSA 3I92A 1H65A 1W4AA 2D2FA 2I3BA 1SVLA 1ZM4A 2VHQA 1NVXQ 2D2EA 2JLWA 1SQ5A 1FP7A 3K9HA 2HJGA 2KSQA 3H2YA 3LA6A 5K8LA 1OFHA 1VG0B 2WHXA 1BS1A 2WICA 3TSOA 1EFUA 1CR0A 2J46A 2ZRPA 3UWKA 3HPRA 2CVHA 2WWHA 4Q1EA 1NVUQ 3M4YA 2BBSA 1FPMA 5FL7A 4Q66C 4V02A 4BFVA 1OB5A 5JMTA 2YZ2A 4ZDWA 1AIPA 1G6OA 1L8QA 3CPEA 1NG9A 2JAQA 1SKYB 1FFHA 2PH1A 1HEIA 4P3YA 4A8JC 1W36C 2IYRA 1QHGA 1QHYA 2OXRA 2Z43A 1XTKA 3CKLA 3SJBA 4G5QA 4UKDA 4DEYA 2PEZA 1US8A 4PZLA 1NKSA 2IS2A 1P6XA 1Q0UA 3PR1A 3KKMA 3RYTC 4B2LA 2FH5B 4Q01A 3RAPR 4Z1MA 2QNRA 3NBXX 4QM6A 4P0TA 3K0SA 2MSCB 1J8MF 2HV8A 3K09C 3P1JA 4PPQA 1WRBA 4OHWA 2VL7A 3QG1A 2W58A 1X6VA 2G0NA 3B1VA 5LB2A 3PUWA 1E2NA 2J0UB 5CB6A 2C2HA 2R6DA 4F4CA 1KI6B 4TTRA 1S9DA 3C5HA 1FL9A 3IBYA 3RSOA 5J40A 3CUEF 3TR0A 2IYTA 3JVUA 4P31A 1IAQA 1E9BA 2X2EA 1NF3A 1XTRA 4Q4LA 3SYNA 5JI3E 2EYQA 4PHGA 4IDOA 1OJLA 5KNBA 2YKGA 4LCBA 4B6EA 4Q9KA 3AVOA 3CF2A 3LVQE 2FGJA 5JEEA 4V0KA 1CLUA 1P2UA 4HAYA 5K8UA 1S3SA 2CLDX 2CBZA 1I2MA 2GEUA 2YINC 3TK1A 3GPLA 3MLEA 4OJKA 1U2RA 3ZJYA 2IK8A 1CEEA 1ZUIA 4R9UC 4I81A 4R2HA 5FTLA 3NBFA 4G5GA 3PENA 1E1QA 3SHFA 4UNQA 1Z5ZA 2UZ3A 2ZXUA 2EFHB 1JJVA 5FBLB 4B73A 2YJTD 4FWIB 4RFSA 3U61B 2J3EA 3PEYA 4FCVA 3N2EA 3FWYA 4LJ7A 3B1XA 1XF9A 3WYAA 4JS0A 4RZ3A 2ZYWX 5KPDA 3AP3A 1RRPA 1TEXA 1G7SA 3W8NA 1N3BA 4KO8A 2IC5A 2PCLA 2MMGA 2BHRA 4Y0AA 1AKYA 1Q21A 4F38A 5JFGA 2GK7A 2IX3A 1LY1A 3VR6A 1ZIOA 1Z2AA 2F1IA 3RLFA 4LHVA 1GVNB 2BMDA 2JLQA 4PC3A 2IEZA 3WNBA 2P67A 5FTKA 5E7JA 1Z0IA 2A7QA 2XTMA 4DLXA 1XEFA 2FFQA 4RJLA 1XZQA 5EP1A 4YMWA 1R7RA 2V1XA 3TQCA 1P75A 2ZJYA 1KAGA 2BBOA 3UATA 1PUIA 1Z6YA 3TRFA 2W6JD 4LHXA 1ZNXA 4LDJA 3P4XA 3VQTA 1P61B 2W83A 1NJGA 2PX3A 3LD9A 4TN1A 2QPAA 2AFIE 2RB4A 4FMDF 4ILEA 4CVNA 2RGCA 5CLQA 1M1YE 1HA3A 3WNCA 1DAHA 5B57C 3GCGA 3EZ2A 1T0HB 3QXHA 2UVQA 4LPSA 2CNWD 4MUAA 1ZVQA 2XSZD 3FDIA 1KDRA 3CIOA 4PC7A 1QHSA 1R2QA 3THWA 2IBMA 4LHWA 3JVVA 3DM9B 3QBTA 3MJHA 1D9ZA 2VQSA 3W34A 2WBLC 2WKPA 4D4LA 5H8WA 1VG8A 1WP9A 4Q48A 5EQTA 3VTKA 4CIDA 4ZO4A 3D3QA 3KUCA 1BH2A 2W2VA 2OAP1 1E9EA 3PUXA 1KZ7B 5IDVA 1E2PA 1NLZA 3CW2A 2IT1A 3KZ1E 5FUVA 1NBMD 4ABYA 3R8CA 4NONA 5GJBA 1EESA 3OIYA 1J2JA 1XD9A 2GJ8A 1KK3A 4NCKA 4A8JA 5FPTA 2QP4A 1U98A 3KB2A 4OHXA 2QAGB 3AP2A 1NN0A 3LDAA 5A5GA 4CEIB 3AEZA 2VSOA 4Q02A 4DC9A 1X8JA 2R8RA 4AG5A 4BLSA 3OEEA 4URWR 3UG7A 3THXA 1R4AA 4PFSA 5JHHB 1IQPA 4CEJB 3T5DA 2GF0A 3K0FB 3UMFA 4AC9A 1SXJD 3CR8A 1YZKA 4HI0E 3GEHA 3WYGA 1DADA 3CH4B 2WJJA 3C8UA 3BFXA 2WWIA 1SKQA 2HF8A 1CR1A 4GI7A 4LGMA 4D81A 1JBKA 2YHSA 3LQQA 2YYZA 5JWOA 2C9OA 3OAAD 5LPNA 4E22A 4FCWA 5EUMA 2BMEA 1G4UR 1KI4A 1XMIA 3IEUA 5DYGA 3RS5A 1QZXA 1JEDA 5C18A 2H8KA 4DWJA 1S96A 2ZPTX 4HUTA 3IKJA 4KLZA 3X1WA 2NIPA 2W00A 1KAOA 5H70A 5FPKA 2AKAB 3ND9A 3BORA 1MRSA 4BZQA 4LJAA 4OYHA 1TTTA 5KHOC 2QTFA 3B13B 4WZAE 4B32A 2JLSA 2ZU6A 2W2XA 4C0SA 3KTAA 2WMNB 5JBQA 5JCPA 3AVWA 1WB9A 4HZUA 5E7IA 2FE4A 4Q7MB 4XSGA 3GLIE 1G3IA 2SHKA 4QBGB 3NTUA 1OKKA 5FUXA 4A36A 2ODEA 4QOSA 1Q20A 5FL7D 2Q3HA 4II7A 2OBMA 4S35A 1T5IA 3M6AA 4B2PA 4WOPA 4B3CA 2WTUA 4C0KA 3RDPA 2CL7X 4N1AA 3A8TA 1UDXA 2OXCA 2D4HA 1IXSB 4HDOB 5CIQA 5M04A 2W6JA 1LTQA 2AL7A 1SHKA 2ZSAA 4YONB 3SZRA 3TVTA 3VU9A 4IXMA 1G8YA 1N2CE 2FNAA 2REOA 3DO6A 3MWYW 4YMVA 4B48A 2CHVA 2ZS9A 3FMIA 2XTNA 3BB1A 4C3ZA 2RGGA 4L4UA 3EARA 4IDNA 3RVBA 3W90A 5HCIA 1S1CA 3THYB 4U00A 3A4LA 1G8HA 3ZZTA 5AUOB 2KB0A 2DWPA 4GOXA 4LX0A 1A2KC 4NH0A 1NJFA 3K0CA 4AKGA 2V6IA 4K81B 1IXRC 1KJYA 2QAGA 2WZQA 2FEMA 1HY3A 1EGAA 1E2JA 3KKNA 3D8BA 1JEEA 2ZRNA 1GKIA 1T3LA 2G1KA 5DLQC 5E7MA 3ZZUA 2VP6A 4HB3A 4NYJR 1S2MA 5JWRA 1K5DA 5AK0A 1S9HA 4D0NA 2GESA 4M1MA 2OCBA 3EXAA 1A5TA 3EPJA 3EPKA 3NXSA 3HP1A 3KJGA 2CL0X 1P4SA 5AJWA 3G5UA 4I1SA 1RZ3A 2BBTA 1CIPA 2PZGA 2C5LA 1CJKC 2ZSBA 1KHTA 4FD2A 2I1QA 4A2QA 2O8EB 3GLGA 2HXYA 3U6KA 2VIIA 2OILA 3I8XA 4LJ6A 3THOA 2CK3A 1E99A 4Z54A 1OYWA 2F3TA 1ESMA 4GDFA 1ZW6A 4POAA 1UDWA 3GLGB 1RIFA 1KI7A 3EA5A 5H68A 1R10A 4RVCA 1Z07A 1T8TA 3PV0A 4M8NE 2NO7A 4NZYA 4Q1BA 2YWEA 5FOTA 1WBBA 4PSKA 5BN3A 3K9LA 2A5YB 1AZTA 3ZLJA 2BCJQ 1E79D 1W49A 1XP8A 4UNSA 1OH5A 4LYFA 3FHTA 5JLJA 1T9HA 4IOLA 5BYKA 1ZBDA 3IDQA 3K0AB 4KYIB 1ODFA 6Q21A 1AM4D 4M9SA 1DVRA 1MRNA 1HT2E 3GJ0A 4M4SA 2YOHA 3VR2A 4HZIA 2XAUA 3T5GA 4M1SA 4F4IA 3C4JA 3Q9LA 1QDEA 3E5HA 5EE3A 5JEDA 4UXJA 3PVSA 5SZJA 5C1BA 1FUKA 4X8LA 4KSBA 3KKPA 3ZDQA 4X8HA 4NYMR 4PQFA 4Q1DA 1IY1A 4HB2A 1YRBA 1H8HA 3T61A 3NH6A 1AGPA 1EFRA 3AB3A 4MA4A 4JL5A 4QHYA 3NWJA 2PT5A 1HE1C 5C2JB 4A0RA 1HUQA 2WJVA 4TLEA 4MKFA 1WBDA 1U90A 2FWRA 2ZUBA 1W5TA 1YRAA 3LLMA 4LOAA 2ZSEA 3AVUA 4RD6A 2XTZA 1GFIA 3QJYA 1GG2A 2ANCA 4J0QA 3THXB 1W46A 3IEVA 1G6HA 1B0UA 1MABB 1E2MA 4OQXA 3RC3A 1G18A 3AF4A 3CX7A 4Z8YA 4QHSA 4Q7JB 1ZUHA 4Q1AA 2ZROA 4EAQA 1XEXA 1Z0DA 4RKEA 4E09A 2WSSA 1YR8A 4XH9B 1W0JA 4F93B 3K0EA 4JSTA 3U3KA 5B64A 1JAHA 1X8KA 1RE0A 2ORVA 2JLUA 4EKDA 2ZYUX 1XZPA 2DFLA 3TJZA 5FBVB 3A1UA 1MKYA 1G291 3ZGXA 2I4IA 1SVSA 3TMKA 4KHZA 4DLYA 2GAOA 3MUFA 3W9YA 1XXHB 2CL6X 1ZAKA 1HTWA 1OHHA 4CYMA 4NYMQ 4XWAA 1II8A 2Z5FA 5GJWC 4TTPA 2KWIA 4EFNA 3LLUA 1JPNA 4V0LA 5FH9A 3H84A 4L9SA 2A5JA 1CTQA 2ZJOA 3MCAA 3V00A 4BRUA 3HYRA 3NDPA 1Z6AA 2DPXA 2IS4A 1N0VC 2Z0MA 3ASZA 3CWQA 1F2TA 1P9RA 3PIRA 2O0HA 2JLYA 1C9KA 1V5WA 4ZCMA 2XB4A 1GKYA 2ERYA 5D3MB 3ZVRA 2EFEB 4TWZA 3GJ6A 1M7BA 1NKTA 2NO0A 4DT1A 2DCUA 2AKYA 4LBVA 2HXSA 1GP2A 2YOGA 4YMSA 1Z63A 1E1RA 3VR4A 1UFQA 4M9XA 3AUYA 2XNSA 4MKIA 1XTQA 3K0FA 2GJSA 4HAXA 4W7SA 3A1SA 3AKEA 4NCNA 1KK1A 3ICQB 1OHHD 221PA 3HWSA 4JYBA 1N5KA 5DN6A 1NVWQ 2OSBA 3SOPA 1U0JA 1AS2A 2XNDD 4PO8A 2JATA 3TUJC 3PITA 3UANA 4MGYR 4OJQA 4E03A 3I8SA 3SDZA 2V7QA 2QMHA 3ASYA 3V4FA 3CRRA 4RD2A 2WVJA 4ACBA 3HDTA 1LVGA 3B6EA 4IVRA 4WBSA 1ZC3A 4QGGA 3QE0A 4DDTA 3MWLA 2DFTA 3NBYC 2OM2A 1NNEA 2V7QD 3CRMA 2ZE5A 1XWIA 4OBEA 4JL6A 4D82A 3BJIC 3LBIA 3RC8A 3OEED 2HEIA 1U9IA 1IOZA 4OI4A 1NY5A 1Y3AA 4B43A 1QG4A 1W0KD 3GLHA 2GILA 2EFCB 3EZ7A 4DCVA 4LBYA 2EWVA 1J70A 4OKSA 4DSOA 3ADKA 3TGPA 1F2TB 2C8VA 4Q9JA 4D25A 3VX4A 5FPHA 1HE8B 4UNRA 5IK2A 1D9XA 1Z6TA 4D80A 1QHNA 2BWJA 3TW8B 1SVOA 2ZSDA 4JJKA 3U3MA 2DWQA 2ZRBA 1VTKA 4PQRA 1UKYA 2QAGC 4R2IA 3GEEA 4ZIRA 5FR2A 1KI6A 2XX3A 3CF6R 1Q3TA 4JJZA 5A4JA 5JHGB 4UXIA 4WXPA 1PV4A 1Q22A 2O8CA 1RFLA 5KYKA 4G3XA 1Z2CA 2ZITA 2NZJA 5KDLA 3RS4A 3NKVA 2XITA 4KBGA 4CW7A 3CNNA 2W0SA 5JCZA 2IA5A 1J8YF 1UJ2A 2ZAMA 3KUDA 1G5PA 4HDQB 2QMEA 2ZRKA 2H57A 2R6CA 3GLFA 1FMJA 3TSWA 1P2SA 5LD2B 5DH9A 2RGXA 4PXAA 4JBWA 3HU2A 3BE4A 4ON9A 1E2DA 1KKMA 5CK4A 4ZCLA 4DSTA 1LF0A 2HF9A 3WMGA 4HB0A 3QUSA 3NDBB 1E2FA 5GJCA 4PAOA 3U2QA 4Q21A 4TL7A 3SE0A 2JLXA 3LBHA 3PUYA 4MGIR 1Y63A 3A1VA 3HJNA 1ZCBA 821PA 1LS6A 2OZEA 2DHRA 1RRGA 2GAAA 3FB4A 3WNDA 1Z22A 1E9SA 3TW4A 1W7AA 2ZQ5A 4GP6A 1XJ0A 1XD8A 5C46F 5EP3A 1JQLB 4BFTA 1YR7A 2A5FA 1AKEA 2TMKA 2D7DA 2QMOA 3U7EB 1Q1QA 4C0LA 4WVFA 3BH0A 3I5YA 4XD7A 3ZQ6A 3SYKA 4L8GA 3CONA 5EXPA 4QGFA 1KY3A 2E9SA 1E9RA 2FGKA 5L3QA 4KLNA 1ZD1A 2H92A 3TE6A 4BFWA 5L3VA 3ZYCA 1AS0A 4BQSA 3ADDA 2IYZA 1H8ED 3AH8A 1FP6A 4FINA 2ZRGA 3FMOB 5FBRB 3LO5A 1X86B 4EPTA 3RRNA 4DLSA 2G3YA 4GL2A 3TKLA 2ZRAA 1FQKA 1OFIA 3KJIA 4NKRA 4XOIA 4ASUA 4DVGA 5JSZA 2RGAA 4F4JA 2J0SA 4PR0A 2RGBA 4D4KA 4ESVA 1FW6A 3KKQA 2FN4A 4A6PA 5EE9A 1A2BA 4MKHA 1VIYA 1FTNA 4JLAA 1YZNA 3FKSA 1M8PA 3T1TA 2J7PD 4GSYA 5HE8A 2JJ1A 2RCNA 2AWNA 1JQJC 1NIJA 1XMVA 4O0MA 2AFHE 2VF8A 4G1UC 3LBNA 4HAUA 1QVAA 4YMTA 1FUUA 2CHQA 3B82A 3ECCA 4TQUS 2FZ4A 4DHEA 2CK3D 4GFDA 2RHMA 4ZIRB 1AZSC 4KODA 4DDWA 3KKOA 1XTIA 3N5CA 3IPXA 4OQMA 2JLZA 1NBME 2OFOA 3AM1A 1KDTA 3A6PC 4NCIA 3B7GA 1JJ7A 2ZJ2A 4US0R 4QBHA 4DRZA 1D5CA 4URXR 1KO7A 1SULA 2Q6TA 1L4YA 3UKDA 5AJVB 3X1XA 2W2TA 4DSUA 3E1SA 3QXCA 4ERNA 4URYR 4DCNA 2QBYA 5FBWB 3Q8XB 2VP2A 4M53A 3CX6A 4TYPA 4R7ZA 1T5LA 1QHXA 3WRXC 5B58C 1GWNA 1Z6GA 2B7CA 5G40A 3QSYA 1T0JB 4NYJQ 3GLIA 5D3MA 1DELA 4Q1FA 4JLJA 5E95A 5SZKB 3IBGA 2C04A 1ZM2A 2QE7D 1VCIA 4CF7A 3I1FA 3VU9B 1Q12A 3FPAA 3BGWA 4WAUA 3MWJA 4KXFB 4IJMA 4EQ6B 2WWYA 4OHVA 3OF5A 5JJIA 1IXZA 2ZANA 4PTLA 3CM0A 5KO2A 2OCPA 4C9BA 2B7BA 3U3OA 1S0UA 1F5NA 1NN5A 3J81k 4DIEA 1TQ6A 4OI2A 2P0EA 5CYPA 2EFGA 1CXZA 3Q5DA 3AVQA 3U44A 4ITRC 1DAIA 3SHWA 3BFKA 2OCYC 4XVUA 1G19A 4O25A 3TUIC 1G3UA 1SXJE 3IIJA 4HUQB 2Q3FA 3LNCA 4TMXA 1VPLA 1XD2A 3LVRE 1E0AA 3F3YA 2PMDA 2WAYA 3KTAB 2OBNA 4L15A 1X1RA 4PQYA 1JR3A 4K8OA 8OHMA 4V03A 2BKUA 3RRYA 5EUQB 3ZIAD 5EE5B 2X77A 5TDHA 4W9MC 3EW9A 2G9NA 1Z0FA 5JS8A 2ECKA 2ZRJA 1C1YA 4LJ9A 2QQ0A 1IN5A 3DHWC 3EC1A 1Z3IX 2KJQA 4CT5A 4RZ2A 2XXAB 2QROA 5JI2E 4GZLA 5GVRA 3QKRB 3SU8A 1JAIA 3RRZA 5TB5A 3SJZA 2ZM5A 5F9HA 4TSFA 2R6FA 3BOSA 1CRQA 1N6PA 3EASA 3R9WA 1DAKA 4X8OA 3RWMB 2ZE6A 1CJVC 2A3RA 1GTVA 4I1UA 1SVKA 5FTMA 5CITA 4AYWA 2P5SA 1EWRA 3EG5A 3GJ5A 1D2EA 2CE2X 1XJCA 3OESA 4NPHA 4P4SA 4TLBA 4A0GA 4TQAA 4CEHA 2HDNB 1UF9A 2QORA 1KMHA 1EFRD 1C4OA 2QM7A 1OXSC 3A36A 4Q9HA 5KDDA 1T3HA 4HEJA 3JZMA 4I99A 4JMPA 1LFDB 1QHHA 3EWSA 3DOFA 3DZDA 1JR3E 3B1ZA 3QI2A 2IW3A 3R9XA 1ZINA 3KQHA 1BKDR 3GLFE 2ZUCA 4TT3A 3UXMA 4Q19A 4EJSB 3C16C 2OO7A 2FJUA 4IOJA 4DLRA 1RW4A 3BS4A 1NSFA 1UM8A 2IYLD 3FHOA 2L0XA 2PEYA 2CLCX 4FW9A 3REGA 4AG6A 4A92A 5ANRB 5IK2D 4MDFA 3Q7PA 2MSDB 1N6IA 1ELOA 4PAMA 2F1RA 1KI1A 2JJ2A 3EWAA 1XTJA 1AQYA 2DR3A 2O0KA 1ANKA 2OUKA 3K70D 1XXHA 2Y8EA 4WW0A 2NOAA 4XWKA 1E3MA 3NIBA 3FKSD 3B5JA 4NHOA 1OSNA 1YU9A 3DL0A 1TPZA 1NIPA 3BFVA 4HZUB 3DVLA 3LW7A 4UNNA 2QTHA 1F2UB 2NO9A 1EK0A 1N6KA 5FOVA 4BGDA 4C0AC 2QG6A 5EP2A 4IVPA 4LZZA 1XEXB 2YWFA 3QXSA 1G9XA 4DCUA 5CM8B 4Z8XA 1G5TA 3D7MA 2NO1A 1FZQA 4C0QC 3NC1C 1BIFA 2ATVA 4M2LA 1E2HA 4PHTA 621PA 3BK7A 3GFOA 2ZETA 2D06A 3GD7A 5GVSA 3Q85A 5J4KA 1KZGB 1GRQA 1R5NA 2WWXA 4A4DA 2RH5A 4AKEA 4GRAA 4EPVA 3QF7A 1I4LD 2FPMA 2RMKA 1ZJ6A 2RGDA 4Q4HB 3VFDA 1E2IA 4DLVA 1W5SA 1FX0B 2AWOA 2XEXA 4F92B 4DDUA 2BM1A 1U81A 1F48A 1ZUNB 4Q00A 5FOWA 5AJYA 4A2PA 2QPOA 5EXTA 3OHMA 3B60A 4V0MA 4GMXA 3KL4A 2D74A 3TIFA 1TX4B 2QZ4A 2IWHA 3T1QA 1TUIA 5KSYA 1Q57A 4G5RA 1JECA 2OLJA 3EPLA 1CJMA 2CVFA 2J7KA 3BRWD 2FMXA 2D7CA 3NEJA 5L3SB 2UZIR 1GRRA 1Z06A 4TMKA 2ZREA 1COWD 2ZAOA 4DBLC 4DCTA 4MRRA
chains in the Genus database with same CATH superfamily
1GNZA 1LPMA 5ELXA 3O6VA 4DSLA 1XZNA 1X8DA 5C4IA 4Z3DA 3QHQA 3D7LA 1P8GA 5IXSA 3SC7X 4DABA 4ZJZA 2CYYA 5I42A 4DLZA 4FSJA 5EQUA 4LO4B 2Q0QA 3DLLQ 1DOAA 3MMCA 1YR6A 5CQGA 1LLUA 2DTJA 1IUKA 1ZH6A 3TQEA 1DG9A 2W87A 3SI7A 4XURA 3G8SA 5ISLA 3ZFFC 1YS6A 5GZCA 1NM5C 3UJPA 3TRHA 1CIVA 4K4WA 4OHUA 5H1YA 4O3SA 5JZVA 2YKPA 4R9RA 1I4OA 3ZYHA 1XEWX 3CRNA 2KE5A 2VT3A 1AV7A 3KYBA 4RLSA 4PYAA 4KMOA 4X62B 4DE5A 2J8SA 5B1SA 1KD1T 3LQKA 1SVUA 1T29A 5AC92 4DLAA 4R9NA 1GZ4A 2VDLB 4DMKA 2WI8A 5H3HA 3SR0A 3ZYFA 2IFXA 2HHLA 3R3TA 4XCVA 4P4NA 2QL9A 3IT8A 4R0NA 2VDOB 1ASJ2 1PZXA 1YJ9S 1TZOA 4N7IA 4MS3A 2OVUA 3P2IA 4LBOA 1QBKC 5FIIA 1Z74A 4YJGB 4FCCA 2DUNA 1NK5A 5EUBA 3BIEA 2FSHA 1U3TA 3D0RA 2AZ1A 4N3NA 4P9WA 1X3SA 2PLFA 4UPEA 4UTPA 4KO0B 1JYNA 2E49A 4LHKA 2YQ3A 1UIJA 2QFIA 3WMFA 2DR8A 2VTKA 4CLEA 1X5PA 4RKFA 3CUKA 3QP9A 3AFGA 2Q6IA 5FZDA 3DL3A 1Y4AE 1QF9A 3PR4A 3STXA 5KTRA 4U0KA 3NHAA 1USWA 2AG5A 1GMWA 1MORA 3MWBA 1QGAA 5AXAA 3UCXA 4Q18A 3O47A 1TKBA 1XNGA 3TD2A 5G0VA 1TV6A 4BNMA 2NQPA 1R8XA 4GSLA 2D2XA 4ES8A 2XNHA 1ULAA 3K15A 2H2GA 1IN7A 5LXTA 3DLIA 2QYTA 3H2ZA 1LWEA 5F98A 1M06G 3PCRB 4YJ2B 4GSKA 1GHTA 3UUEA 4KHPJ 1NQVA 2E5JA 1CU1A 3FCCA 1R89A 4MRVA 1KTVA 4EB6A 3COJA 1ZAVA 2H0BA 2VBXA 4OYBA 1UBMS 2MJNA 2YV8A 2C58A 1HSOA 2XR4A 1L4LA 3LAWA 3FBEA 3AZVA 1WWHA 3P2KA 4CA9A 2V2ZA 4WKOA 5LMCA 4A46A 4QQRA 4QPZA 5B12A 1W85A 3GUZA 1XNJA 4GWIA 1KVIA 5CA1F 1Z62A 3WK7A 1UAIA 1KL7A 4AZTA 2VAUA 4N8EA 3C2PA 3OFND 5L4SA 3GELA 2W5UA 1YI8A 1MBZA 1JLGA 1DKUA 2RGNC 2X23A 1RMU3 2ZKNA 4N82A 1IH8A 1R0ZA 5B1DA 1O0BA 2G77B 4A23A 3HS3A 1MQTA 3KSCA 5K8IA 3I56S 1GYQA 1RT9A 1R8SA 3K70B 3SIPA 2NXUA 2A9RA 4LPKA 1DEKA 1B76A 1RBMA 4GQAA 2F17A 3VSEA 1RC8A 2AV5A 4ZWNA 4Q4X1 1U5AA 4DCGA 5FI3A 2BR5A 3NATA 5E9QA 5D8AC 1S99A 3P0JA 1EVLA 4RJTA 3A1YG 3SYZA 3U4QA 5LMUJ 1TMJA 4AY4A 2YKQA 4ITCA 1R6BX 2DCZA 4LRWA 5AQ1A 5CDFA 4A41A 2VOVA 1FQOA 2ZYVX 3OBTA 4IKPA 2A9OA 4Q0MA 3O1TA 3TXAA 1PKXA 1SLTA 2FQXA 3AL3A 1X9SA 4K88A 1C8M1 3W5VA 2FP4A 1A9TA 4LNHA 2WR8A 4O4LA 2Y1RI 4HOOA 1D2GA 2GAUA 4M76B 5IVIA 5K0UB 3ONDA 2F62A 2NO6A 1ZGBA 1FDBA 4FVCA 3KUXA 3QBQA 1TD1A 4QUHA 2GPYA 2R6GA 3TI9A 3T7AA 2ZUVA 4DF3A 5KAPA 3FLPA 3H2LA 2BBAA 2YW9A 1KONA 2HFJA 3SBDA 5JS7A 2IXDA 4USJC 1RHUB 2XPCA 4RWZA 3CR3C 5L4LA 2HPHA 4FHFA 2J9ZB 2PGDA 3C8XA 2BW0A 4EHBA 1SGWA 2R5FA 3R7NB 4XUGB 4NXNF 4JB2A 3TVZA 3UOAB 2OPWA 1L5QA 4MRPA 1ZPWX 1LWNA 1UM9A 4Q4AB 1UKEA 3SXWA 4AKTA 1RXCA 3SIRA 2CPIA 1I3KA 3U4MA 1IBCB 3NVAA 5A7WB 5EX3A 3KVYA 3PFBA 1S6OA 5A9TA 5FPXA 2V74B 4R69A 2ROEA 2FPKA 1BKYA 2H85A 1LWFB 3RSZA 1HBUB 4KWUA 2IOHA 3A37A 4ZHRB 1EA5A 5HLFB 4Z3OA 3G9XA 1T36B 4R0VA 3HY4A 3TNDA 4XKJA 2W9BA 3DT9A 3ZBUA 4HEA6 3FMBA 2JGJA 2Z8QA 1WXGA 5HBMB 4OZ2A 1M2NA 4O44A 3OHBA 3M32A 5KFJA 1JZ3A 2FW6A 3CVUA 1TVKB 1WZEA 2ZRCA 1AZDA 4KJZA 1GNQA 4TWRA 1JKJA 5FB3A 4LZNA 3R7SB 3UL2A 1S2GA 2HLTA 2JEOA 4LBQD 2OBXA 3NTOA 4U7FA 5ALWA 5FI1B 1R0XA 2VK2A 3A3NA 2ACVA 5FZEA 3CCCA 2ZAHA 3I7DA 4KN6A 3AR8A 3N70A 4AL7A 3GRYA 5FPVA 2WF5A 2VOPA 2DH9A 5L7OC 1R0CB 2GF9A 3RH0A 3V1UA 4COUA 2VNSA 3VR1A 4W5HA 3JWEA 1VKHA 3HCBA 1O89A 3PNYA 3PQCA 3QENA 3IUQA 2WN2A 2L08A 1O5IA 5CFCC 4C08A 3I54A 3IPYA 5LDDC 3JAKB 3L6UA 2XWYA 3RSFA 3VBOC 1BWEA 3Q10A 1LHNA 3NCQA 1RAIA 3MDFA 1RUNA 3V1TC 2A7AA 2VQFF 4QIVA 4BJHB 3IDZA 1Q4RA 3PGVA 5FKBA 2Y1WA 3HXKA 2GSDA 1QSLA 3QTTA 2D5AA 4CCMA 4XGQA 4U1RA 4FT8A 4F6RA 4KE5A 5CFMA 4ZU4A 1T8WA 2ZIZA 1H05A 5KFVA 3RR2A 4X45A 4W8GA 1QNWA 1WI6A 2AC7A 2B92A 4R1OA 4OHCA 5DIZA 1OVMA 3TZEA 2OMLA 1D4M2 1K8QA 2JD0A 3TDKA 1ZGGA 4U4AA 4N47A 2JIZD 5CMLA 2X0FA 3AYDA 4FUQA 1T2DA 3FDFA 2YYYA 5JMPA 4KPEC 1SHJA 4IQ4A 3IG1B 4FHGA 3CMES 1GL9B 4B3IA 1Q50A 2WVAA 2KB2A 2QZ9A 2X13A 1V70A 1IN6A 1UIMA 3LC1O 3TNLA 5ES4B 1RXFA 5I9TA 4G41A 3ZK7A 1VRTB 1BHQ1 3DQPA 1JEQA 4MHTA 2VLIA 4DV6F 2EP7A 4DR2B 2AMVA 2HNYB 4TU9A 1FUYB 5L1KA 5J2TA 3DP7A 3KV5A 5LM3A 3NWPA 1KVQA 1BJQA 3HKEB 1CE8A 2EKDA 4FVMA 1G41A 1SKUB 1CB0A 1V9U2 4OJMX 1FEHA 3FPLA 3NH9A 5FUWA 3GR6A 1DARA 2FPLA 2W47A 1GOGA 2R2TA 5JDIC 3S8YA 1URXA 3BOPA 4Y2CA 2FRDA 5EJIA 3I23A 1IJKA 3A26A 1PAEX 3LE0A 4PO3X 3KLVA 2FU5C 1YOVA 5IM4A 1VLLA 4H2AA 4HL0A 1PLKA 3TNPB 5E6SB 3AMMA 2FFBA 4LZOA 3H8VA 1NXTA 3BIOA 4CWBA 2QF7A 1E8DA 1GT8A 1XVIA 3A14A 2N42A 5LP6A 1O7JA 1OY8A 3GYBA 2B4TO 3DBHA 3PXBA 1WF0A 4FYMA 2Y0BA 3C41J 3I42A 5I7SA 3W78A 3BS9A 5JJBA 2WA3A 2J59A 3PEFA 2VIHA 3V9AA 4HTAA 1T6BX 2ATEA 1ULOA 1DG3A 1VCMA 1Q44A 1GPH1 3OWHA 4C20A 3R9IA 1CUYA 1UBCA 5BSKA 2O7VA 2DGUA 1A98A 2HBZA 1NCLA 3GRKA 2F6BA 2NQYA 3A0UA 5E3RA 2O06A 1V6AA 1OXXK 2O2DA 2RR13 3DLJA 1WUVA 5E3PA 1Z2PX 5K0ZA 1XZIA 3JSBA 4K3UA 1H6XA 2ACEA 3L18A 1B3BA 1CQXA 2NYYA 3A10A 3OC6A 3THVA 1N0UA 3R8YA 1G8SA 2MQLA 1N88A 2XCAA 3VD5A 3WYFA 3CPHA 5TRTA 2ZBVA 1K8RA 4F3KA 5BNOA 1X4DA 3RBEA 5LBFA 2JFOA 4JZRA 3FIUA 3MF9A 4ZXEA 1ZTTA 3HNYM 3EPIA 3MCMA 1PR4A 2BFBA 3VVMA 2DK2A 4XVHA 2QLWA 2OEJA 2Q1UA 4A2WA 1Y5LB 3CZMA 1DIHA 3H11B 4RD4A 2XLJA 3RLIA 1JYSA 3TW8A 5ARBA 5TQVA 4X90A 3QQ5A 3G85A 3FROA 3OG9A 1CY7A 2G0IA 5HSPA 4WVZA 3PXUA 3W6PA 3HF5A 1LAJA 2ZJ7A 3BHIA 4XVRA 4FYPA 5KFKA 3ZDVA 4GVLA 1T9VA 2C7BA 3KV4A 2BSAA 3M0EA 4MH0E 4ZOBA 1ACMB 3W6NA 4KNCA 5FY8A 1O1YA 2WVGA 4HGYA 4S2DA 3VBHB 2ONCA 4B3GA 5FUMA 5LQAA 3CTRA 4DXRA 1TJ5A 2ZH1A 4FMCF 3H1WA 2H4FA 2HFKA 4F36A 5A3OA 1TF7A 5LBBA 1C41A 4FEYA 3L82B 2OVFA 5JPNB 1YKFA 1YQ6A 1E60A 1NSYA 3I39X 4RW7A 13PKA 1U7LA 1SUBA 2EDAA 3RC2A 2PUJA 1SOAA 1JDZA 3FBTA 3ZUPA 3ZTPA 3MB8A 5JZGC 2ZWOA 3O0WA 3BMCA 5BNWA 3MPDA 3GZNB 2QRLA 3URKA 1GRVA 5L7TA 5D5PA 4ZS2A 2XWXA 1IJEA 5SV5A 4P9JA 3FJYA 3C6TB 4EN6B 2OEPA 2YASA 2YBPA 2CC2A 4BLTA 1ISHA 1CW2B 5CW1A 2AT1B 3NP5A 1HQCA 5IASA 2CKMA 5K8MA 3OJXA 1H4TA 5HBRA 2XB8A 4LHLA 3FN4A 4A0FA 5FKJA 1SUDA 1D4ZA 4TV9B 2O1EA 4QIHA 1B1AA 2P6OA 1TK9A 5AM4A 1WZCA 2OGWA 3KK1A 2A1UB 2A30A 3G3EA 2QLBA 4LR7A 3ABIA 2REQB 3U7FB 2QIOA 4RESA 1SIOA 3KM0A 4BNFA 1CVIA 3RKSA 2Q5JA 3KD4A 2I62A 1CEQA 3KOUA 2XAAA 2DVAA 4J90A 3F5FA 1FNBA 4MYDA 3WHUA 5ILGA 4DSKA 3IP6A 3OM0A 3IEMA 3AVVA 3KMHA 3DDWA 1RZVA 3HLKA 3FE2A 2H6CA 3FYTA 1NNLA 1GNRA 2I7CA 5CAZA 5KAMA 2DY1A 4DCCA 2XG3A 3ZWPA 3CD6S 4I1OA 1WULS 3R5AA 4HACB 4AG4A 4YLZA 1J00A 1R64A 3BD8A 3CDAA 1FP7A 3KLGB 1NDHA 3OR1A 2VWHA 2XWSA 2CJFA 3E7FA 1ZHHA 5EZYA 3ZV5A 1BWQA 4CCNA 4WJKB 4ZDWA 1NG9A 3MI8A 3NFYA 4U2AA 4DKJA 4G5QA 5I9SA 4NCBA 3MTGA 1NK7A 2OGZA 4I09A 2GW8A 5HM6A 3RAPR 3K2YA 3WJ2A 1T2UA 4MP8A 3K09C 3RTEA 5LB2A 5I47A 3Q88A 4RZSA 5K4LA 4DU7A 3OM1A 2IYTA 1IAQA 5GZGA 1CPYA 1PYGA 3E18A 3SYNA 4TMFA 2FWNA 4XRRA 1GZ5A 3VYRB 5C53B 1TKAA 4G0OA 1DPGA 4E6EA 3T95A 3TARA 2XGQA 3O9VA 4E32A 3BQ2A 2I91A 3B1XA 3PCOB 3H0CA 3R0ZA 3SD7A 2E9RX 2AUMA 3W8NA 4XCQA 3HJVA 1WDLA 5IC4B 3K2OA 2KFYA 3EVAA 4KIGA 2IXIA 1ZIOA 1Z2AA 3A70A 2EZTA 3O84A 4LAFA 3KS9A 5HBAA 4JGZB 4MJXA 2E4XA 2KL8A 3F56A 5EP1A 3UWSA 3W5DA 1IKYA 4BH9A 3EDRA 5L19A 3TBHA 1QMJA 3VQTA 1VSUA 3IWLA 2RB4A 1HA3A 3DTYA 4OFBA 3OTIA 4HKTA 4C2BA 5DGCA 2CDQA 1XR6A 1JPUA 4FILA 5FWYA 3VBRB 3DD1A 3EMBA 5HOEA 4LHWA 3DM9B 4AJHA 3HHNB 5IC6B 1S02A 3BG5A 5CLHA 2JRSA 3RU9A 4DILA 1XWLA 3HXQA 2DU1A 1XQ9A 4EBCA 5E3JA 3OL8A 3D4BA 4G3YC 2VQFJ 1VE7A 3CF6E 1NCQB 4G23A 4R25A 2GQ0A 2O4UX 4J2TA 3LDAA 4BDVB 2I9SA 2TRSB 5IKMA 3S6EA 3TOXA 2HSZA 1LNSA 3ZFFB 2IPOB 3S8MA 3C8UA 1QUEA 2HF8A 1I3MA 3Q7TA 3JQEA 1E18A 4XDQA 4EW1A 5K9ZA 3AX4A 5EFZA 4YEAA 1E0DA 3G71S 1GTRA 4MCJA 3LPYA 4C7JA 3WK4A 3K05A 3LC2O 1OFVA 3IKJA 2W00A 1OPIA 3VV2A 2Q99A 4DGSA 1EIZA 3KYCB 5T6BA 3FAKA 1O5TA 1RR6A 4A36A 1SC3A 3A1CA 2XMAA 1JMYA 1SZCA 3K46A 4PQ9A 5KFGA 3CLTC 1DSSG 4FFPA 1LTQA 3QYJA 3UC5A 3UJQA 3C3KA 3TVTA 2NLWA 5B0DA 3MWYW 3N6XA 4C3ZA 3UW3A 3KCQA 1DBNA 4OGWA 1X9PA 5FXXA 3VSBA 4OV1A 5KFLA 2OV1A 2QA4G 1RTVA 3AR6A 5JR7B 1KJYA 3V1LA 1GUFA 1OOPA 3KKNA 2C4VA 2W6QA 4YM3A 2ZD1A 2OH2A 1KTQA 1CFZA 4LBKA 3GHHA 4M3CA 1FFWB 1DKOA 3KJGA 3KLIB 4N40A 4WNCA 2XMUA 3IP7A 2G1MA 5BW4A 5CEJA 3FJ1A 2HRBA 1UP1A 2OILA 3AM3A 1C30A 2HWKA 4CMIB 1O97C 3SAJA 4YRSA 3H50A 4JBCA 2NO7A 1PGJA 4P3PA 1W2AX 5I7RA 1I32A 4ZVNA 4LW8A 4MLOA 1NJ1A 3NWBA 2RDJA 2HFVA 4E0DA 4HFMA 4GR5A 3V6KA 1B0PA 3C4JA 3NMBA 2XMCA 4AE2A 3H9BA 4RSRA 4Q1DA 1IY1A 1JZ5A 1G21A 2MPFA 1NONA 2ERRA 2XWBF 3AUAA 4KBYA 2WJVA 2FHKA 2VBIA 4J7XA 3BR9A 4ECAA 2MLZA 4I1TA 3LCPA 3IEVA 4D42A 1Y9OA 4USIA 3WGTA 2AFRA 5T41A 2FPGA 1WEZA 2O2EA 4E09A 1IHDA 4HSGA 1RXUA 2Q5LA 1EK1A 1ZZCA 2CQHA 5B64A 2R85A 1G9FA 4IO0A 3OBAA 4RW8A 1I6WA 1K7FB 1PS9A 4ZFNA 3VB9A 1OHHA 4ZRNA 6AT1A 3KLFA 4NYMQ 1I6JA 2DURA 2Z5FA 1NAHA 5JAQA 1RTKA 4XQ4A 3ROTA 1RNLA 1CTQA 4HPKB 5A6XA 1U2QA 1XQXA 5CD9A 2XCQA 3QPCA 4GVBA 1H3DA 1QQBA 2ERYA 4HI2A 1G59A 2EW8A 2YOGA 1V6IA 4RXTA 1K6EA 1H8TA 4ZU6X 3MRXA 3BJZA 3H25A 4JVOA 1RUG2 2O3UA 4A8SA 4KV8A 4J0CA 5HF8A 3TUJC 3TRKA 5FBHA 5LYJA 3ASYA 2VZEA 2V09A 4WBSA 4OUEA 2C61A 1NXPA 3MWLA 1NNEA 1PDVA 5INTA 3EGVA 1FYWA 3DXUA 3BTYA 2E1CA 1LX7A 1IZ3A 3ICLA 3IP5A 3PGXA 1AURA 2C3MA 3EZ7A 2J3JA 4JUFA 1DLJA 3ZNPA 2LBPA 4LBQB 1D9XA 1QHNA 2HHWA 3S2EA 1XKQA 3QGMA 5FY5A 5FUNA 3OX2A 1S0MA 5AXMA 3FPBA 3I49A 1TKTB 5FR3A 3Q11A 1O95D 2P17A 1FXRA 3LEKA 2JHEA 3SXPA 1E2UA 3WBBA 3MW8A 2VJYA 1R50A 3PRHA 3W05A 2QMEA 1RUC3 5LASA 4ALMA 4WCVA 1LF0A 3NDBB 1GPNA 3U2QA 2RJOA 2JICA 5TQ0A 4DX6A 4YV1A 1Y6QA 1WTFA 2NUBA 2O19A 1MPXA 4XUQA 4PYQA 1MP0A 2GYUA 4CO0A 1PBTA 5H9VA 4IG0A 1RXIA 3CEMA 4C0LA 4NLOA 5LA6B 3UGKA 1YI9A 4HN4B 5ES3A 3HJFA 1RL3A 3BXXA 3JQ9C 5A7FA 1F0PA 3GAFA 3OLXA 4DLSA 2FGOA 3HQUA 5AHWA 3PIGA 4YMLA 5EGYA 3HZOA 3JAMA 3GAZA 1Y8CA 4E2FB 1E7SA 2Q8CA 5AI0A 4MKVA 4OGGA 2H1SA 4R8SA 5A4AA 5IVHA 3FI0A 1C2TA 2GMHA 1Y7IA 3H7JA 1QDCA 4G1UC 3V97A 2D5LA 1P8AA 1RWVA 4ALNA 1BCSB 3PKMA 3PWKA 4DOMA 4JQRA 1VQLS 5FMOS 3OUJA 3QAUA 3Q8SB 2OFOA 3ONNA 4PSUA 5CA0F 5CFLA 1X8EA 1FXWF 3WE7A 1A4UA 4NPCA 2ZHBA 2XJRA 4UOFA 4NYJQ 3E9RA 3FF1A 4GQIA 5SZKB 1W581 4JLJA 3A3YA 4YR7A 4CDXB 4JEUA 4BTVA 4F3TA 2R2GA 1T05A 2GWRA 5CDGA 2O3RA 1S72S 1N2IA 1JGTA 3I6MA 1GPWB 3SC4A 2ECPA 2CLFB 1Z0HA 1XD2A 5A3PA 5CD4A 1K5PA 3IHKA 5HP4A 4RDXA 2A4MA 3HK2A 5TMBA 3JPYA 2Q8QA 4H15A 3L5KA 5TDHA 1FIUA 3EW9A 5TLSA 3K9CA 2ECKA 1MMLA 5FY9A 3BILA 2J67A 2C2BA 3AIOA 4PLNA 4D94A 2XTJP 1XLUA 3B2NA 1EMDA 4FYKA 1SBNE 2H7YA 3CQ9A 3RTAA 4U2KA 1SVKA 2P5SA 5BSUA 4A0GA 3RZGA 1UF9A 4H3HB 2HA7A 2QM7A 1STMA 4ENOA 1T3HA 1OSDA 3OCZA 3A6LA 1QHHA 5D5QA 2V2KA 2X1LA 1UY3A 4ECRA 3ZI7A 2H1WA 4NESA 1KC1A 4UDYX 1U8WA 3M8SA 2C2DA 2FJUA 4MEJA 3GDFA 3WYNA 3E01A 3FHOA 4KKVA 1XQNA 1ZA1B 5IWAJ 4AG6A 4YGXB 2KYXA 4WOCA 1H6YA 5BR8F 1IC6A 1S57A 3EZLA 4MS3B 4J3FA 1A5AB 2EKBA 5IDYA 2OUKA 2AJ8A 4EG5A 4U3JA 3GXUA 3FKSD 4RPFA 2IHKA 2PWZA 2BHLA 3QEMA 4YJHA 3WC0A 3WX8A 3OJEA 2QG6A 2HHXA 3HHPA 4BCDA 2FDFA 3WIUA 2DYCA 4OG2A 4FB4A 3BK7A 1ZZ7A 4AECA 2QM3A 3GF4A 2E1AA 4NROA 4EG4A 2HRDA 3JALB 1R5NA 1NVGA 1NMEB 2DEJA 1I4LD 3UHAA 4Q4HB 1PS0A 1RMU1 2B45X 4DLVA 3UYKA 3I8TA 5AVTA 1SG6A 1F48A 2CDPA 2V3VA 3OW2R 1CQNA 4JEHA 3X1LB 1ENOA 2ZUAA 4HNTA 2YVKA 2BTQB 4C3LA 1TT7A 2PZ8A 1Y5IB 1TRHA 4NEYA 4J76A 3RC9A 2D1FA 5JCJD 4MRRA 4MROA 4DSIA 4QX8A 4TNOA 2VVFA 3HT1A 1Z6PA 4X9XA 4Y0VA 2RI1A 1KDYA 2QYHA 3GF6A 3ILVA 1Y5RA 4QYZJ 3K9WA 3W9JA 3U7HB 3A6ZA 5I42B 3OIVA 2G07A 1YJ8A 5CB8A 4QR0A 3ZTOA 3NWEA 2Y3IA 3B48A 3W8DA 4TL9A 2PC6A 1A9PA 2VTDA 4G9EA 4MI6A 1XXLA 4W8HA 2Z1DA 1JE0A 4QG7A 4NLSA 4HH3C 5KNCA 1GZWA 2V4ZA 4L99A 2OFHX 4LS3A 4QFCA 2JJ8A 3KQUA 1RBZA 3HPOA 4RFVA 2Z42A 4Z2XA 4MKZA 3EXEB 1Y8QB 1U6BA 4Y0NA 4DIFA 1TLLA 1UPTA 4ND1A 1TJ3A 1XRQA 4JI6F 4XTRA 4M1OA 3E9YA 1GPYA 5F9LA 4KX5A 5GQSA 4PO9A 2QQKA 5C7OO 1WPQA 3D4PA 1W87A 3D5QA 1KFKB 4TXLA 4XDHA 1KHVA 4ONEA 2HUPA 3O14A 1PG5B 3OFVA 3WB2A 1FFDA 3R0VA 2AGPA 2I4OA 3NY0A 1G64A 2WT2A 2CDNA 4LNUA 2VDIA 2B6AB 1AXGA 2CWSA 4YMIA 4GWMA 1OBVA 3ZU6A 5JTTA 2BCEA 2HYIB 1NSKL 1OI3A 4D98A 3I3OA 4QFMA 3EM1A 2KDOA 2CVEA 2Z83A 4CIVA 4MSVA 1NXMA 2HVDA 1ZIXA 2CHGA 5FLIA 1RT7A 4WZAA 3VNBA 3K17A 3CJ0A 2AEEA 4IH6A 3VRHA 4PXYA 5KJFA 4U6NA 1RTDB 3TDNA 2PSJA 4E2FA 4FQ7A 2BNOA 1L0BA 1UCFA 3EMKA 2I4RA 5BQ5A 2BEWA 3T1VA 4F5YA 2J3IA 3NS6A 5B5SA 1N1DA 5G2OA 1GDDA 4QX3A 2W2IA 2WSFC 3JB8A 1E9CA 4H08A 3E1F1 2CSUA 1AYM3 1AQJA 3O8BA 1R9GA 4HNVA 1CDEA 3CX3A 2BPOA 1JG6A 3ZXFA 5HZKA 3EXFA 2PTMA 4IHJB 2BWAA 1C80A 3KOYA 1L7RA 3V8VA 2HWF1 4R2MA 2AXPA 1ILWA 1LQTA 2SCUB 4QOEA 2R7VA 5J2UF 5T4HA 1KNQA 4D02A 4Q7KA 4YCAA 1UXIA 4MP6A 3HBZA 3PRDA 5CFDC 3CFYA 1PE0A 1R8PA 3M8QB 1SBFA 1I5OB 3U1TA 2ZH9A 3ZDSA 1CPMA 4CHTA 3QNUA 4NCHA 2OZJA 3WQQA 5FOJB 1CZOA 1RZUA 3W65A 4W92B 4UNPA 3HJUA 5HBGA 2I65A 1TC2A 1ZYUA 3K73O 3W4IA 5BWLA 3M81A 2ZBJA 1ITZA 1GUAA 1OZ0A 4FOYA 5G4KB 1YHZA 1FP4B 5AMXA 2N0SA 5HILA 2C4XA 2XNJA 1QH1A 1OY6A 2Z09A 1RT6B 1XERA 4LBNA 2QN1A 4DZZA 4PYMA 4HS9A 1WVMA 3RQSA 3F6BX 3JQPA 2ZB2A 4HX2A 5CVJA 2WLSA 3X29B 1YWGO 4MIKA 2NN8A 2X8WA 4TZKA 1LU2A 6GPBA 3WV5A 3FUCA 3EXHA 2AEZA 1QXPA 2GQQA 1U0OC 3DAFA 5DM60 1XXNA 1KHWA 1VC2A 5F3IA 4B7AA 1IMOA 2GRAA 3ETCA 3KOWA 4I3HA 2VHTA 3JSXA 1T2NA 2YX1A 1EHCA 4I4TB 3M2UA 3R3YA 2C84A 4ESHA 4B3SB 2PSSA 1Q0TA 5IK5A 1J39A 3FYDA 5F5IA 2RU9A 1DLOB 5GAHU 1T24A 3NM5A 3SOZA 4FVTA 2JLFA 3QVVA 4QGSA 2AXQA 1Q95G 4BYMA 1GAXA 2R68A 2VVEA 2O52A 2QQGA 4ZHQA 1CIYA 2HSJA 1YZ6A 1PKUA 4AX8A 3TLBA 3UPFA 2E32A 3FCYA 4J43A 4TT3D 1TME3 4Q3AA 3ZJVA 4K4VA 3B85A 3RYFB 3ZXGA 2B51A 4OAPA 2ONZA 3OTOF 5JROA 1E4VA 3BPSP 4CM9A 1MVQA 2ZCWA 1VP9A 4JSRA 3ADBA 1IWGA 2OPSA 4G8CA 2RQ4A 4GO1A 1L5RA 4EBEA 4WXYB 2NP0A 1JLFB 1EJ7L 1EQ0A 2ZUDA 4AYBD 3E22B 2HJWA 3U39A 2MSWA 1K4MA 3KLHA 1SCJB 4RE5A 3I6QA 3CB4A 4X6RB 4I6GA 5EXXA 1JLEB 3T2TA 2QQMA 3DPRA 1IU9A 4L7QA 1RTZA 3TNFA 1MJ5A 4MUBA 3QZUA 1VBXA 4GKKJ 4OM7A 5AXLA 2WSSD 2EIEA 1NSQA 2GGPA 3MCTA 3BWDD 1LQ9A 4AEKA 4C3UA 2EHJA 2ZDGA 4IF4A 5B1YA 2JI6A 5DM70 1NA5A 3POWA 2NZUG 3W8EA 4CEHB 2NUTA 5C80A 1QOOA 2YNMA 2WOJA 2Y6KA 2NVWA 2O66A 4I2QA 4K6KA 2X2FA 2P6HA 1HNWJ 3WWEA 4R8MA 2GB4A 1M2WA 4A8OA 4WP9A 4BZPA 2MDAA 5B08A 1I3LA 3NBMA 1HE4A 3CXRA 3UFXA 3D0IE 1O4TA 4MKBA 3BFPA 1XB2A 3CIZA 4KGGA 1IBKF 4B6SA 2QA4S 1T8EA 3N3HA 4IBOA 2LQJA 3RBDA 5JR3A 1VYUA 3I0MA 4IZIA 5ICEA 2POKA 1SVWA 2AF3C 3UH1A 1HT1E 1RK8A 2WUDA 1UU5A 1P4AA 3IERA 4DV0B 4BLQA 4KMMA 4MGEA 4LBQA 4MR9B 1ODLA 4RF5A 2HWD1 3KHBA 4H7MA 4QUGA 1XMQB 1WCSA 1YBFA 1U09A 1TM1E 1F5AA 1IUOA 5GM1A 1NVAA 3QMQA 5C2CA 4WL0A 3ZXKA 5KQLA 1CESA 4PX2A 2C0PA 1J09A 2CNKA 1X60A 2ZVIA 2OHVA 2IEBA 3JSMA 2RI6A 3LQ4A 4CIYA 3H5VA 5J47A 2O8BA 4MITA 3A4UA 4EJFA 1G7CA 1BMV1 4V1CA 4BNKA 5CYOA 3TQOA 3PEVA 2JS7A 5HKKA 2YV5A 4HYKA 2ECQA 4MTLA 2ROPA 4B71A 1IKQA 4EPWA 2K6GA 2EQAA 4PIZA 4B40A 1CY4A 3IBFB 3V9PA 4M0UA 5EZ5A 2VP0A 4QD2A 4Q4W1 1BXRB 3GY0A 3MT9A 3JY6A 3GLGE 4OYAA 1SUAA 2NO5A 1TYDE 4AXOA 3MS7A 3K51A 4MIAA 1KBOA 2AYEA 3MWFA 1Y00A 5A4KA 2E7TA 5AKIA 2VQ0A 1XAIA 3L0IB 3VSAA 4B7UA 1Y1LA 3SEZA 2H65A 3LOUA 2C9BA 2P5UA 1M73E 2IOFK 2AG6A 2JLRA 1R8QA 3PEUA 1VBA3 3HM9A 1H2UX 4LMZA 4FP2A 1Q56A 3OEBA 4OZ5A 4RIIA 4D7YA 3F3SA 4JI3B 3VYWA 3N9NA 3NRUA 5SYAA 1SB8A 1OBCA 3MELA 2GJKA 3HCOA 4Q4JA 2R043 4ID3A 3CCUS 2YOFA 1KO1A 4G67A 1E32A 4H1UA 5FNVF 1ZHOA 4XCAA 3H4TA 1UPMB 3K5NA 4RU9A 4ZT5A 4KQ2A 3AVSA 1L1QA 4M22A 4K4SA 4JI3J 5ABPA 1UBJS 3EISA 3KWLA 3VBUA 4BEVA 1SU8A 5C1PA 4R0EA 4CCOA 2WO3A 2MSNA 2YBVA 3AOBA 1RWUA 2F3QA 4RQTA 1ZM9A 2WD7B 3FCOA 2VDJA 1MW8X 1D1QA 1QFXA 2LKCA 2FMDA 5FEMA 4WPAA 2Y26A 2ZBQA 4RD7A 5L51A 2Z4TA 5K3EA 5SZIA 5KQRA 3C14C 4ES1A 4CXXA 3RRHA 1I14A 3KEOA 4HCJA 2D1TA 3ZJTA 2J0UA 5EMLA 1V7PC 4YDSA 2Q9CA 4EHNA 3PLAE 2GX8A 1N4DA 2BFNA 5ICMA 3TTTA 1VBMA 1S77D 2KS6A 1NY6A 1US3A 4WOKA 2ZJZA 3AQ4A 3NKTA 3D6TB 1W4LA 1S1XA 5AI9A 4URVR 3JQKA 1F3LA 2FFHA 4Q3EA 3F97A 3WFIA 1BXGB 5CLGA 4JL8A 3EB7A 2DYKA 1O91A 1LODA 1PRYA 4MLZA 5A62A 3M49A 4DJ5X 4RD3A 3V6MA 1HRI1 1LDEA 4HSLA 3LP0B 1WC6A 2PHUA 1Z47A 1VE1A 2IYQA 2DBRA 3RS2A 4P4TA 2IJFA 1Q0ZA 5C8CC 4R81A 5JJLA 3PX2A 3AVTA 2JBAB 3RFTA 3KM5A 4N0EA 3QY0A 3D54A 5FA8A 2JKYA 1BZYA 4LJMA 3IP3A 3LZ6A 5KOYA 3KLEA 3HA5A 3HJRA 1ECPA 4NK5A 3DU6A 3MWEA 2HF7A 3HUFA 2Y1FA 2CZCA 4OCTA 1VRH2 5JRJA 1XRPA 2JARA 2RGRA 3E5XA 4ZXFA 1RUI1 5AUNB 3K3NA 4A5OA 1KDPA 2X4LA 1HE2A 1UKAA 4O08A 4KFUA 1AKRA 2HHUA 3JQBA 2EVXA 1NG1A 5KT4A 1MR5A 1XPOA 3L01A 2WIIB 5EI5A 4JXZA 2K7FA 1WQ4A 1YL5A 4DQSA 1FRVA 2VCBA 2WSBA 3JRXA 3PQ5A 3OZGA 1DTSA 1AXQA 2GMWA 3UAXA 4HMQA 3J81U 2QLMA 3WO1A 5EJ4A 1VHWA 3RJZA 2XBMA 3A1TA 3H98A 3QRQA 3NRCA 2IZZA 5BQOA 2W71A 3FF4A 1NF8A 3N1UA 3V0BB 3BT7A 1LI4A 2C2NA 4MCHA 5FP4A 1J24A 1KNXA 4WK6A 1QKJA 1U7UA 4DR3B 4FNOA 4O0LA 5CHYA 1LTHR 4FYYA 1ZD3A 3N6RA 4O65A 4B35A 5J2PA 3IVMA 3OFGA 4UTOA 2ETEA 1SBCA 4P3OA 2HA6A 1M5VC 3HL0A 5CFQA 4F9GA 1T02A 2YWDA 1T6GC 4RR3B 4A44A 4DR6J 3IOMA 1HLDA 4TZDA 4ZJLA 4XOUA 1BYUA 4G09A 3UG6A 1NKCA 4BO8A 4G07A 1FDTA 4Z1MD 2ISCA 3H19A 3BGAA 1KMMA 1X8LA 1UT5A 1N2OA 2KZMA 3PNBA 3ENKA 2PFWA 2JGLA 3QF4A 4JLVA 3WMWA 5F3RA 1RWPA 3JBG2 4LQRA 1JLHA 4KUHA 5T3NA 4ZQBA 1L6RA 1CULC 2W8BA 4O1MA 4H1VA 1TVEA 3BMQA 1U3WA 1ZZGA 5H9WA 3DXFA 4NZOA 3DOLB 2P41A 4ZOCA 4YJGA 5D1IA 3D43A 1IN8A 1W47A 4YWAA 1OLOA 3W2GA 5CA6A 3NUGA 5AI8A 1R1A1 2PL5A 1MH1A 2ZGUA 4IEFB 3TPCA 3LOQA 4DY6A 3VR4H 2HLPA 1FY2A 1C5KA 2VBYA 3BERA 2M5YA 2NAPA 3G68A 2Q50A 3IP1A 4DA8A 1YS4A 4D9GA 5ETOA 3QV1A 4HDAA 2F4LA 3K4PA 2I3BA 3GWZA 2VHQA 2NADA 4JUZA 5JZ9A 1KVJA 1GMUA 4YM1A 1FLDA 2KSQA 3VLBB 4PRZA 1VBE3 3WGQA 1SELA 4S1TA 5KREA 3LDBA 5F35A 1M8GA 4IL7A 1W39A 4BFVA 1QIKA 1JN2P 3U4GA 2H2WA 4GWKA 3J8F2 5AW1A 2GDZA 4PZLA 5BXXA 2VOXA 2E85A 2FGCA 4XDOA 4KB5A 3QUCA 4HG6B 4EE2A 2Q1TA 4TTRA 2DBIA 5KYYA 3JYNA 4I6WA 4BNTA 4EU0A 1JODA 3W59A 1XTRA 3NT5A 4B6EA 3RVRA 1FNZA 2YDXA 3AVOA 3PNPA 2B1RA 3IBTA 1XYPA 4HAYA 2YIMA 5KC9A 5IFMA 1PJLA 3T3GA 1EP4A 3DD5A 3RARA 4MCIA 3PI6A 3ZJYA 3K31A 2QI9F 5LMZA 3FCHA 2YJNA 2BJ7A 4UNQA 4WASA 4QPGC 3MM5B 1JJVA 2EFPA 4H4MA 1PJQA 3WYAA 4K20A 4LF5J 5C3MA 3ELNA 3QX7A 2C2ZB 3NV3A 1CAVA 1NQJA 2WO7A 2NU6A 5FTKA 5E7JA 1U0TA 1LENA 1J7JA 3TN91 1GZ3A 2FFQA 5T50A 4QXRA 1XZQA 1HI9A 3REQB 1KJNA 3O8WA