4C0FA

Structure of the not-box domain of human cnot2
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
96
structure length
96
Chain Sequence
AIKLGRYGEDLLFYLYYMNGGDVLQLLAAVELFNRDWRYHKEERVWITRAPGMEPTMKTNTYERGTYYFFDCLNWRKVAKEFHLEYDKLEERPHLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure and Assembly of the not Module of the Human Ccr4-not Complex
pubmed doi rcsb
source organism Homo sapiens
molecule tags Gene regulation
molecule keywords CCR4-NOT TRANSCRIPTION COMPLEX SUBUNIT 2
total genus 19
structure length 96
sequence length 96
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-08-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.1020 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4c0fA00
5FU7C 5FU6B 4C0DB 4C0FA 4C0GA 4BY6B 5FU6C 5FU7B 4C0DC 4BY6C
chains in the Genus database with same CATH superfamily
5CK9A 1X6OA 5GAMg 2KYBA 4OB0B 4X9DA 1YJNQ 1MNDA 2YRDA 2A08A 1UHCA 4ZN1A 4C92D 5GMKj 3VS0A 2RQTA 4HVWA 3G71Q 3OMCA 1YITQ 3SHWA 5KE3A 2DLPA 3MCAB 1YWPA 5IHNA 4A4EA 2RD1A 3CMAA 1CKAA 3VV0A 4FCYA 2DX1A 4PKCC 3NHNA 3CBMA 3CCET 2LNVA 3RBBB 3OSSC 2X4WA 1X6GA 3HP9A 2NUTB 4XK8E 4HKEA 3NGPA 2K6DA 1V76A 1KD1C 5I2MA 4XU3A 2QEXQ 1N27A 2DO3A 5AT1B 4LUDA 1WHMA 2GF7A 2H3JA 3HFOA 2M0YA 4M77G 3ULRB 1OU8A 6AT1B 2MOXA 3OYGA 1VIEA 2RI5A 2V8IA 3T9NA 1NE8A 2BZ8A 2FZGB 1GCQA 4QKUA 2A0FB 2RJFA 1WI7A 1OI1A 2F69A 2L8DA 2DILA 2EPDA 2LQ8A 1KQSS 1RI9A 2YSQA 1HD3A 1X69A 2QQ9A 1B07A 3M0SA 3PMIA 5GAMj 5KYYB 4J7FA 2J6OA 1G2BA 4OF1A 3OYBA 4M7AB 4M7DA 2SRCA 3QZ9B 1WIEA 1QVGS 1BI2A 2R58A 2LJ0A 1N9SA 1MGQA 2DL7A 1VQ4A 1GCQC 3CC4Q 2X4JA 3M0UA 3EH2A 1MV0B 1JJ2S 2KQWA 5C0MA 3CMEA 5KYUB 1D09B 5KYUA 1K8AC 2WSFE 3V8KA 1K0SA 4ESRA 2J06A 2LC4A 3PNWC 2VVKA 2EQUA 1K4US 2EYQA 3GF5A 4M78B 4F7UB 1NBEB 3VS3A 1TUGB 4GLMA 1YI2A 2CZ1B 3QUIA 2CYZB 3OSVA 4CI0C 5CQYA 4A54A 5LJ5j 3CC2A 5I22A 1KQ2A 1PKTA 5GMKi 1W2BP 1VQKT 3OYCA 1EZZB 4AFUC 2CGHA 1KD1U 1PRLC 1VQ7Q 1KJWA 2GTOA 2QTVA 3RKWA 2KRMA 1PCXA 3TSWA 4DOWA 4LN2A 5FLXE 1ZHIA 2DD4A 2FL7A 1N8RR 1VQOA 2ATCB 3JCMd 4XQ3A 2XICA 2EGCA 3KXTA 1BU1A 2E5QA 1YIJA 4M7DC 3FIFA 5CVIA 4JZ3A 3N5BB 3RNJA 4JRQA 2GFAA 1GXIE 2HSEB 3OW2S 4C8QF 5ECAA 3P8HA 5IN1A 5DY9A 2FRWA 2J6KA 4HA8A 2DF6A 3UDCA 2HKNA 2CZ0B 1BI1A 1W6XA 2P4RA 3M4YA 1X6BA 4M75B 4L59A 3TEEA 2K5FA 4XTZA 4B6MA 2LCLA 1XJWB 2BE7D 3LW5E 3E1SA 4C92G 2YHTA 4KBMB 1Q81R 2B8AA 3QYHB 1RAEB 4GBQA 4D8KA 4BE0A 4UC4A 2K4YA 4C92C 8AT1B 1K76A 3EGUA 1UDLA 2KXDA 1KSWA 3EHRA 2F2WA 3J7AF 3JB9I 2DRMA 4FYYB 2YUOA 4QT7A 2RMOA 2L3RA 1QVGA 3PT9A 1TG0A 1QP3A 1TU0B 1IHVA 1SHGA 1IB8A 1K9AA 3EGDA 4MZMA 3CC7Q 2GBQA 1JO8A 3JCMe 4M7DG 2DVEA 4E47A 2JZ2A 2CP5A 1FXXA 1WX6A 2CZ7B 5LJ3f 2JMAA 2KYMA 3C12A 3I5RA 1FYNA 2JW4A 4QW2A 5HK0A 3CCRQ 1VQ9T 4B9XA 5IAYA 3HSBA 3C95A 2KE9A 2NUZA 3RIRA 3X24B 1VQ9Q 1ZSZC 3OYKA 3OBWA 3CCMA 3I5SA 1I0CA 4DBFA 2ZPGB 1I1JA 1WJSA 2K5IA 1G3YA 4JRIA 1N9RA 2Y4XA 3G6EQ 3OMGA 4FM4B 3NPFA 3G4SQ 2JUFA 4C0GA 2GTJA 2O31A 3X26B 3CCLQ 2WACA 2LNHB 3VYHB 3QWYA 4EMKA 1ABOA 4LDUA 2RK1A 2E3HA 5IT9E 1N8RC 2V1RA 1V29B 2X9HA 1SRMA 1PKSA 1YCSB 3OA6A 4LUEA 1BI0A 2K3YA 2B86A 3CD6T 2XKOC 3M0QA 3C4SA 2FO0A 1KHIA 1GRIA 2CP6A 4HCCA 1R8OB 2QQBA 3U23A 1IREB 1AD5A 5GJVB 3OYIA 2KEAA 3NTKA 3CCEQ 2DE0X 5D6WA 3URGA 1U1TA 2IVWA 5GANd 1OX8A 2F5KA 4M77D 3HPWA 2CREA 1RAIB 2QQAA 4LD6A 2D6FA 1JQQA 3LYIA 2A3LA 3MEWA 3S6WA 2EBPA 3CCQQ 4FIBA 4PK4A 1HXDA 1G3WA 2QEXT 2RH2A 4DOVA 1SSHA 3OYLA 3O8VA 4HCKA 4C5IA 3A8OB 4M7AA 1FMKA 5GMKl 3MHXA 3O5ZA 3P8DA 1C6VX 1OQKA 2NUPA 4O6JA 1WNLA 3CCRA 5CR2A 2DM1A 1WXBA 1Y57A 2K5LA 3CCVQ 5M9OA 2YUNA 3OYMA 5IHIA 2JT4A 2V8JA 2RB6A 2V8KA 1NJIC 2MK5A 2X51A 4M75E 2EW3A 1VOMA 1Q81C 2XG8D 5FU7C 3E9GA 2BZYA 3META 2COYA 5GAOq 3MP6A 4QQDA 3HFNA 4M7DD 4RCCA 5GAN8 2FYKA 1YIJT 4DBQA 4PLIA 1EIFA 4C92A 1M2OA 4BI8B 3JCMb 2QGGA 3HRUA 1YJWA 4XTVA 4A4FA 3RDVA 1Y0MA 3SWNA 1QVFA 4AMCA 5IXFA 3M58A 5CKHA 2MYSA 4ZN3A 4LXCA 4LE9A 3INZA 1H641 2L2PA 5KCOA 1ABQA 3DB3A 4HCZA 3X25B 1JJ2A 5CAIA 1ZUYA 1P92A 4E7LA 4N0AC 1I81A 2DYBA 1X75C 1XNIA 3A8GB 1EX4A 1M5Q1 4IUQA 4N4HA 2KRSA 5KYWB 5GAN5 2GQVA 3G4ST 1FX7A 3BE3A 3QIIA 2ED1A 3QYGB 2CZ6B 4AG1C 2OTLA 2D9TA 1O9SA 1ACMB 1KIKA 4JS5A 1YWOA 1BKBA 1ZSZB 2V1QA 2IG0A 2QEXA 1JJ2P 1M30A 2P0KA 3GLXA 1M1KU 4MMLA 2YUPA 2MMPA 3A5ZB 3E19A 3LWIA 4AG2C 2FPEA 5LJ5d 1K8AR 4M7DF 2PZ1A 2KAFA 5LJ3e 4E2FB 2ZPHB 2PNIA 4DA4A 1RACB 1UTIA 2LCCA 2KNBB 2VB6A 4ELZC 4J6WA 5EG2A 2QDYB 3M0TA 2K9GA 2ROLA 4E7HA 4RCBA 3ZEHA 3L2RA 3JV3A 1VQ6Q 2ED0A 4A53A 1ZQ1A 4C8QB 4M78G 2BE9B 1M1GA 1M3BA 1AZEA 2DJQA 1OPLA 4F16A 1NEBA 3CCJQ 2HCKA 3H8ZA 1V1CA 3SB2A 3JCMP 2K3BA 4F17A 1SSFA 3OB9A 2QXFA 1K73R 1SF9A 4J8OA 4ORZA 3CCJT 4A63B 3UT1A 7AT1B 2QA4A 1F1BB 2DXCA 3FJPA 3I56Q 4L5GA 3CCMQ 1UGRB 3OYJA 3ZFJA 4JDSA 5HCKA 3I55T 5GAMd 1K8AU 4IUPA 2DERA 4ATOA 1MV3A 4C92B 2DIGA 1PD1A 3G6EA 4M7AG 2VUBA 1IO6A 5GAOl 2M9UA 1NJIR 1KG1A 5LL6S 3I55A 1S72T 1H92A 2PVDB 5GAOn 5GAMh 5LJ3j 1ZBJA 5L23A 1VQ5A 4F7UF 4JLGA 3DB4A 3CMEQ 2GNCA 2K2MA 1X2KA 2R5AA 1VQ7A 4OB1B 1N6AA 2RA2A 1AWWA 3M0RA 4DBRA 4EIKA 1LCKA 2JXBA 2Y4YA 4C8QA 2AKKA 3HKSA 1M1KC 1VQLT 4PJLA 4OMFB 1WHJA 2RJEA 1GFDA 2PQWA 1VQKQ 4KH0B 1OULA 2RJCA 4FYVB 2BUDA 4PJOE 1G5VA 2ZPFB 1WQWA 2HL3A 1K9MU 1NEGA 4A4HA 4ME7A 2E70A 1M4ZA 3I56A 1MMGA 2I0NA 1ZX6A 2YUQA 1YFNA 5LJ5h 2CT4A 3JCMf 2M16A 4J83A 4JJNK 4RTWA 1TS9A 3HL8A 4E7IA 3L42A 3LLRA 4N4IA 2RJDA 1UB4A 1YCYA 3PFSA 3REAB 4BACA 2KT1A 2QI2A 4R55A 2ZAEA 2JM8A 4J6YA 3OYAA 2ZPBB 3KUFA 2QASA 3UF4A 2L89A 4FSXA 1AZGB 2RI3A 1WJQA 2EJFA 4CC7A 4EMHA 5CKBA 4BY6B 2NUPB 3VS7A 2JS2A 1M2VA 3H0HA 2CP7A 2DL4A 1B34B 2M0OA 1M9SA 3CBOA 4BDYA 5CKEA 1R0BG 1UGQB 2HBWA 2LT1A 3JCMh 4OVAA 3VS5A 1WZOA 4DEYA 3THKA 3VRYA 4BY6C 1H3ZA 1HK9A 2JTMA 1SG5A 3G4SA 3UA6A 3OY9A 3CC7A 2QTXA 3EFOA 4OGCA 1UG1A 4QVDA 1OOTA 1IZ6A 2DBKA 5IH2A 2EQJA 3UATA 2FEIA 2RHXA 4LDVA 2QAZA 2ZCFB 4NS5A 4NL2A 3ZL7C 4BI4A 2BKDN 4C0ZA 4L6V5 1JXOA 2RQRA 1Q86R 3EFRA 1AT1B 1X27A 4C0DB 1BYMA 2LJ1A 3C0CA 4M75D 3BW1A 4XTYA 2H3EB 2K79A 1VQKA 2ROTA 3CCLT 3M59A 2OAUA 2ABLA 1QKXA 2VWFA 1X2QA 3GBQA 3E9FA 4J9FA 3EG1A 2MWPA 3OW2P 4R56A 4BE1A 4LD9K 1AEYA 4A4KA 1UEBA 3G71A 2RHYA 1UGPB 2DZCA 1TXQA 2HD0A 2O9VA 1TUDA 2RF0A 1AHJB 4C0DC 5A2QE 1AVZC 4X9CA 3VJPA 1TWBA 3PVQA 1UFFA 4AFQC 2L3SA 2PVGB 1LOJA 2FVUA 1NM7A 3CCUQ 3CCSA 3RKYA 3PIOA 2RK2A 2P0PA 3NMZC 2DZ9A 3CXCP 2O9SA 3LGLA 1JXMA 5A0GA 1T0JA 5FWCA 4BI3A 1TUCA 1I5OB 4RG2A 4CC4B 4XTXA 2O4XA 2CUBA 4J9IA 2FHDA 2E41A 2DYIA 1KQSP 4JPBW 3PGGA 5GMKh 5I2SA 1WXTA 2QGFB 1ZUKA 1G3SA 4FU6A 3DLMA 3NTHA 5CKFA 3I9QA 5D6YA 2EQMA 3CCVT 3DKMA 3EFOB 1G83A 3FEOA 3MEUA 4NL3A 2JTFA 2DVJA 2LX9A 2COWA 1GBQA 4RTXA 3QPHA 4JJDA 1DJ7B 4KGZB 4EPCA 3JCMJ 3CCLA 3VUZA 2MCNA 1W4SA 1BIAA 2OTJT 4MZTA 3QWXX 4D6WA 5KYYA 3TVTA 1VQOT 3MP8A 1VQ5T 4OMOA 3QBYA 4RG8A 3GNGA 2OTJA 2D1XA 2DAQA 3JB9H 3V8JA 3E2UA 2EYWA 3LGFA 1OZ3A 1X43A 4RTUA 1SRLA 3L2ZA 1T0HA 1NYGA 3VRZA 5FWBA 1K73C 3CCMT 3EGXA 4PJMA 4ZNXA 5C6SA 1TSFA 2EQKA 4FT4A 3H41A 1Y71A 2KGTA 3CCRT 3ZBDA 4J9GA 1BK2A 2CP3A 4PNOA 4DQ2A 5CO7A 2FRYA 3L2QA 1XOVA 2KROA 3OYNA 4J9CA 4M7AE 3CBPA 2XI9A 1A0NB 4F7UG 1I4K1 1BCMA 3FRNA 2A7YA 2CT3A 3TQ7P 3JCMc 5LJ5e 2QQSA 3QZ5B 1D1CA 3JB9J 2XHCA 3M54A 2HBPA 2ZPEB 3UWNA 4AFZC 2DL5A 3CCVA 4XU1A 1U06A 3OYHA 4M7DB 2KR3A 2OAWA 3M57A 5GAN4 1ZA2B 4JJBA 1S72A 2V26A 4KULA 4Z02A 1RLQC 2AKLA 3JB9G 3H9NA 1M1KR 1Q7YR 3M4GA 3CC2Q 2YDLA 4M78E 3MEVA 1VQLA 1WPYA 1GL5A 1K9MR 4NOYA 3I55Q 1UUEA 4ZGDB 2EGEA 1K0XA 2LP5A 4J9BA 1KHCA 1YJWQ 2DBMA 3M55A 4F7UA 5FRNA 4N4GA 2P84A 3KBGA 4ZTJA 2OTJQ 3CPWA 1Q81U 2CH4A 3X28B 4ANJA 1KC8R 2NUTA 2KY9A 3GPLA 1WLPB 2DRKA 2VV5A 2WSCE 1QQJA 2QA4Q 3I56T 1NYFA 3RMSA 3EFSA 4OMMA 1Q86C 4E7ZA 3ME9A 1YITT 1J3TA 2LZ6B 4J9EA 5LJ5f 5CIUA 3PMTA 2F1LA 3BY7A 1UJ0A 2XU8A 3WVEB 4HT9A 1WYXA 1S72Q 4B9WA 5AYFA 3M5AA 2YXYA 1ZA1B 3A1PA 3NTIA 4J5YA 1YJWT 1PWTA 1PM3A 5KE2A 5KH6A 2QG9B 2BZXA 2HQHA 2YRCA 2E3IA 3A8MB 4OGEA 3BDUA 2SEMA 2A36A 1QWEA 4PJOG 2DMOA 2JS0A 3M9QA 2DL3A 1XQHA 1OZ2A 2I2LA 3CXCA 4J7IA 1YHQQ 3D7SB 2DTIA 5FRMA 2HMAA 4J9HA 3JAME 3X20B 3GNFB 3RMQA 3EG9B 4OMPA 2LJ3A 2BIVA 2JTEA 3UPUA 2XIDA 1NLOC 3MO8A 2OX7A 1C1AA 3LWHA 3JCMg 3M53A 2W10A 3VS6A 2H8HA 2VASA 3SD4A 2VKNA 1RADB 2M1HA 2MWOA 3HRSA 3VS2A 4IURA 3L2UA 2VC8A 2LQWA 3QG1A 2E5KA 1FWZA 5GAN6 2RPNA 3VYGA 2ENMA 2PU9B 4IIMA 1KK7A 2G6FX 2DXBA 2XDBA 2YWWA 4Z8AA 1D0ZA 1MUZA 1YBYA 1I8FA 2VXFA 2QK0A 1YJNT 1Q86U 4LDYA 1D3BA 3SDZA 4BDZA 4KH1B 3A98A 2JVVA 1NZ9A 1KD1R 2X3WD 3MKDA 2CSIA 2DFUA 1VYTA 1WHKA 3J81E 3GOXA 3FDRA 2EYYA 4PFPA 1WQ7A 1YJNA 4IUTA 4N0AA 3H0FA 1IRXA 2GFUA 2L5QA 4FYXB 1RI0A 3EGDB 3M0PA 3LH5A 3OS0A 3EG0A 1VQNT 3GP8A 5FW9A 3CCJA 2DTHA 2OTLT 3FLGA 4FW1A 1VA7A 2FPDA 1VQNQ 1C0MA 2HNIA 8ATCB 1AWXA 1LPLA 2YRVA 1WHLA 1Y7XA 1KC8C 2W0ZA 4Y91A 1VQPT 4FL6A 3QHSA 1ARKA 2FG0A 3V7CA 4FT2A 4O5VA 5EC7A 1UECA 4M4ZA 3OW2A 3IQLA 1VQPQ 1Y96A 1N5ZA 3HRTA 5I21A 4M75A 2K2VA 3P8BB 3H6ZA 1YITA 1SEMA 5FROA 5A0DA 2XK0A 1E6HA 2A37A 4RUGA 4II1A 4PJOC 2DXTA 2DEUA 2RI2A 2E12A 3AHUA 2EGAA 2DJZA 4KGXB 1FMVA 5GAN2 2XMFA 2AK5A 1PD0A 1Q7YC 3H0IA 2WSEE 3CC4A 1D1AA 2XDPA 2RHZA 3QKJA 2DNUA 3PVLA 1M27C 3OYEA 4IUVA 3PE0A 5DM7R 1VQ4T 1LVKA 2PTKA 2LDMA 2J7IA 3EH1A 1VYVA 2ESWA 1B34A 2E10A 3OYYA 5J26A 4LDWA 2HQEA 2ZZDA 4PJOB 1I5LA 1GFCA 2ECZA 1RL2A 4FSSA 5D6XA 1LNXA 4MDWA 5KYXB 4C92F 1IGUA 5LJ3h 1B3QA 3CD6Q 4GY5A 4M75G 2E6ZA 1BI3A 2RQVA 5I11A 4BE2A 1QVFS 4EMKB 2D8JA 2PUOB 4PFZA 2X35A 3CCUA 4IKFA 4GLKA 5DLOA 4JRPA 3OYDA 4IIOA 5J39A 2HQXA 2FZCB 1E6GA 1NLPC 1OYXA 2DETA 1VQ6A 1Q82R 2MI6A 1QCFA 3RUXA 3JRZA 3S3OA 1O75A 2EVRA 1HSQA 1H3HA 4LDXA 2LMJA 2J05A 5LJ3d 2C0IA 4FYWB 1CSKA 4OMNA 1VQOQ 1ZUUA 4EMKC 1VQ5Q 1D0XA 4IUUA 3QDFA 1JU5C 5J3BA 2CSQA 4HVVA 4M78F 4HXJA 5KYWA 2KI7A 1AWOA 5GANg 2LVMA 4RMOA 2JMCA 1M8MA 3VS1A 2JM9A 3OBYA 1WDXA 1SPKA 2HEQA 3V7RA 2VGNA 2JOYA 3JB9D 2VGMA 2C0OA 2GCXA 4KT0E 4E7JA 4PFOA 1KQ1A 2JJ9A 2ZGWA 2EQIA 4MDXA 4JRKA 1E7OA 4MZPA 1I07A 3JCMX 2DPPB 2EJGA 1ZLMA 1NG2A 4MMKA 2DKGA 3CMAQ 4C92E 5GJWB 1T3LA 1B7TA 2CP0A 3TREA 1K1ZA 2EAYA 5GAMe 4P5NA 2GGRA 1FMWA 3CCSQ 2J6FA 1Y07A 2HDAA 1Z9QA 3HHTB 4JJCA 4DEXA 3OS2A 4QQGA 1IXDA 2RQWA 2HKQB 2KXCA 3CXCS 4HT8A 5KCHA 2NWMA 1M2VB 2QDLA 5KYNA 3CD6A 3JCMW 2E1HA 2NYSA 1QW1A 2D8HA 2FZKB 2LTOA 4LNPA 1M8VA 2DXUA 3LX7A 2L3QA 3LH0A 1VQ7T 4QQ6A 2RQUA 4PJNA 1YHQT 3L2WA 1BB9A 1YJ9A 4QVCA 3CCST 2RO0A 1HYOA 5HK3A 5GMKe 2E6NA 3MJXA 2EJ9A 2ZPIB 2QA4T 3REBB 3WVDB 2G3RA 4XTWA 2FB7A 1QMCA 2LT4A 5GAMf 4M7AD 3FC3A 1WXUA 3EHQA 4RTZA 3VS4A 2D0QB 2EWNA 4OB3B 2HZYA 3TSZA 1RLPC 3VKIA 4KUIA 3SFMA 2KK4A 3QJ6A 2DL8A 5FU6B 2O88A 5HY6A 3MEAA 2E4HA 5GANj 3JB9F 1ZSGA 3EG3A 1Q82C 4C8QC 1VQ8Q 3V7SA 2EKOA 3CCEA 4M77C 3QO3A 3WXMB 4HCBA 2A28A 2CS7A 2FPFA 4M78D 1RAGB 5LJ5g 2EYZA 5KYXA 3EG9A 5CQXA 4BB7A 4X34A 2CDTA 4OP0A 2QQRA 1UGVA 2K7AA 1PRMC 1VQMQ 1PSFA 1D0YA 3S3MA 3BDLA 1LJOA 4X1VA 3OS1A 2E64A 1YP5A 4C5HA 1VYUA 2RHUA 1D3BB 4HVUA 3UA7A 3RERA 3V8LA 1R77A 3S3NA 2MAMA 3R6OA 4A4GA 5GANe 3CC4T 1MMAA 3GIBA 4ZGEB 3RESA 1W2BA 4PJJA 1QP2A 3CMET 1UGSB 3FB9A 2MIOA 1JBMA 3EG2A 1VQ9A 1WFWA 1R0CB 3L1AA 5IXBA 4M77A 1MMDA 4KGVB 3JSCA 4ZTFA 4Q5WA 1RAAB 5IHKA 2RHIA 4C5GA 2P4TA 1TTHB 2EIFA 3VU3C 1H8KA 4BUGA 1IGQA 1M1FA 3C94A 2P0QA 1OPKA 1QVGP 1YI2Q 1IHWA 3TU4K 5DLQE 2DA9A 2AHJB 2EFIA 3CPWP 1BIBA 1VQ4Q 4YTLA 4Y92A 1YI2T 2CP2A 3CEYA 3QJYA 4VUBA 1VQNA 4WTOB 2D0NA 1Q82U 1PHTA 5GAOp 1S1NA 2AZVA 2YLBA 1M3AA 1VQ8A 1KFZA 1WJRA 4Y28E 4CC2A 2XDDA 2OTLQ 3G7ZA 4XAXB 4EMGA 3FJ5A 1PC0A 1RABB 3OYFA 1VQPA 1VUBA 1OV3A 4M75F 5L8RE 3SEMA 2O4XB 2X4YA 5HKCA 1VQLQ 2EKHA 2RN8A 4TVRA 2JNGA 2KDSA 2LQNA 1OX9A 2HL5C 3VUBA 3ASKA 2L0AA 4AFSC 1KC8U 4PJOA 3CPWS 1WHGA 4OMQA 1RAHB 1JB0E 4C0FA 4OMLA 1EFNA 2AZSA 1VQMT 2KT8A 1JEGA 1NPRA 5GAN3 1CKBA 3Q1JA 3RR6A 1Z9ZA 3AT1B 1VQ8T 2KSSA 1K73U 3SWNC 4K11A 2CUDA 2VXEA 2X4XA 2XD0A 4KUDK 2NLUA 4XU2A 2KVQG 1TOVA 1Q7YU 2DEQA 3QDRB 3I35A 4M77F 1YIJQ 2C0TA 1M90R 3CPFA 4V2SA 2PUKB 2OI3A 4F7UE 2AIRB 2KBTA 2Y90A 3A8LB 1M90C 4XTUA 1PG5B 4CC3A 2HSPA 1YJ9T 2GQIA 1PSEA 2E65A 1QCNA 1MNEA 1JRIA 4KRTA 1WGSA 2BTTA 1U8RA 2F2XA 2YT6A 1GBRA 1NJIU 4JZ4A 1YN8A 2LRQA 3OS5A 2L3PA 1OU9A 4M77B 2MF2A 9ATCB 3MPUB 4E7SA 1UJYA 2IIMA 2LX7A 1WHHA 2AT1B 2O01E 3J80E 1MMNA 4M75C 2RNAA 4JUVA 2KRNA 2M02A 1AOJA 2DD5A 3OQ5A 4M7AF 1QLYA 4JLIA 1Q95G 1QKWA 1U5SA 4JS4A 5GAOm 2DTOA 1X01A 3CC7T 4FW2A 2K57A 1ZSZA 4WF2A 1SKUB 3HTRA 1XTDA 4PJOF 4ZGJB 1RUWA 2JN0A 2CKKA 1U3OA 5GANh 2O2OA 4RTVA 4WCIA 4R0KA 3R6NA 4RTYA 5CKDA 1SHFA 4CRIA 3PTAA 2KMTA 3CCUT 4Z89A 4DBHA 1QCOA 4F04B 1QWFA 1PNJA 1W70A 4C8QE 1RAFB 3CCQT 5D7UA 4M77E 4C5EA 1N8RU 4QVZA 1TH7A 5GMKm 4PL6A 4J9DA 1U1SA 2RM4A 2K3XA 4M7AC 3DLLA 3CMAT 2M51A 1K9MC 2OJ2A 2COZA 1VQMA 2QYZA 4RKUE 1BBZA 3CCQA 1QVFP 1M90U 2LCSA 5FU7B 3G71T 4Z88A 1BCOA 1HJDA 2DIQA 4PJOD 3CQTA 2YLCA 3CC2T 1GCPA 2PVOB 2X3XD 4D8DA 4M7DE 2C06A 1M3CA 3JCMV 5FU6C 3M56A 2HAXA 2DK3A 3PIPA 5GAOr 4M78C 3NFCA 1WA7A 3JCMQ 3EAEA 5CCAA 1NPPA 2Z0WA 1VQ6T 2EYXA 4ELYC 3A8HB 1OEBA 2CH4W 4F14A 3TCJA 3EGXB 4RTTA 1YHQA 2VYTA 1YNZA 2F5TX 5GAN7 5A0LA 4EDUA 1G8XA 3L2VA 1G3TA 4E6RA 4OB2B 1W1FA 4E7KA 3QXEB 1YJ9Q 3G1JA 5LJ3g 3KFVA 4XU0A 1W2BS 4AT1B 1D1BA 1KQSA 1VIFA 2MPXC 4J6XA 1T3SA 1AWJA 1MHNA 3SWNB 4M78A 1QVPA 1ZBXA 3MP1A 4C8QD 5GANf 2F2VA 2R57A 3F70A 3ER0A 1UE9A 2IPOB 4BD3A 3G6ET 3QSUA 4PLLA 3BFMA 2R5MA 1Y96B 2LQKA 4C8QG 3RKXA 1UHFA
chains in the Genus database with same CATH topology
2D9TA 1O9SA 2HBPA 2ZPEB 5CK9A 1X6OA 3UWNA 5GAMg 3CCST 2RO0A 3CCVA 4XU1A 3OYHA 5HK3A 4OB0B 5GMKe 4JS5A 4M7DB 4X9DA 2E6NA 3M57A 5GAN4 1BKBA 1S72A 2IG0A 2EJ9A 2ZPIB 4KULA 4Z02A 2QEXA 2QA4T 4ZN1A 4C92D 5GMKj 3JB9G 3WVDB 2G3RA 4XTWA 2FB7A 2P0KA 3GLXA 1M1KU 4MMLA 2LT4A 2MMPA 3A5ZB 3E19A 3OMCA 3M4GA 5GAMf 3LWIA 4M7AD 3FC3A 4M78E 5KE3A 3MEVA 3MCAB 4A4EA 5LJ5d 2RD1A 1VQLA 3CMAA 4M7DF 1WPYA 3VV0A 2D0QB 2EWNA 4OB3B 2KAFA 4NOYA 3VKIA 4ZGDB 4PKCC 5LJ3e 4KUIA 3CBMA 3SFMA 2ZPHB 3CCET 2LNVA 4DA4A 2KK4A 3OSSC 3QJ6A 2X4WA 5FU6B 1KHCA 2LCCA 5HY6A 4ELZC 3HP9A 4J6WA 4XK8E 2QDYB 5EG2A 3M55A 3MEAA 4HKEA 4F7UA 4N4GA 4E7HA 5GANj 5FRNA 4RCBA 3JB9F 1Q82C 3KBGA 3ZEHA 3L2RA 4C8QC 1KD1C 4ZTJA 3V7SA 5I2MA 4A53A 2EKOA 3CCEA 4M77C 1ZQ1A 4XU3A 3CPWA 4C8QB 1Q81U 4M78G 1M1GA 1N27A 3QO3A 2DO3A 3WXMB 5J26A 3X28B 4HCBA 2CS7A 2GF7A 2H3JA 3HFOA 2KY9A 3GPLA 4M78D 4M77G 5LJ5g 3H8ZA 3SB2A 3JCMP 2VV5A 1SSFA 2WSCE 3OB9A 1VIEA 3OYGA 5CQXA 2QXFA 2RI5A 4X34A 4BB7A 2V8IA 3T9NA 1NE8A 4J8OA 4OP0A 3I56T 3RMSA 3EFSA 2QQRA 3CCJT 2RJFA 1Q86C 3UT1A 1OI1A 2QA4A 2F69A 3ME9A 1YITT 2L8DA 1PSFA 2DXCA 3FJPA 3S3MA 2LQ8A 3BDLA 4L5GA 1KQSS 5LJ5f 1UGRB 5CIUA 3ZFJA 3OYJA 1LJOA 3PMTA 2QQ9A 4JDSA 3BY7A 3I55T 2XU8A 5GAMd 2E64A 3PMIA 3WVEB 5GAMj 4IUPA 3OS1A 1K8AU 4ATOA 4HT9A 4C5HA 4C92B 2DIGA 4J7FA 4B9WA 5AYFA 2RHUA 1D3BB 3M5AA 4OF1A 3OYBA 3G6EA 2VUBA 3RERA 4M7AG 3V8LA 3NTIA 4J5YA 2MAMA 3R6OA 4M7AB 4A4GA 5GANe 5GAOl 2M9UA 3QZ9B 5KE2A 1YJWT 3CC4T 4M7DA 5KH6A 5LL6S 1KG1A 1QVGS 1BI2A 2R58A 3I55A 3GIBA 4ZGEB 1N9SA 1S72T 2PVDB 1MGQA 5GAOn 3RESA 5GAMh 1VQ4A 1W2BA 1QP2A 3CMET 1UGSB 3A8MB 5LJ3j 3FB9A 4OGEA 2X4JA 3BDUA 1VQ5A 1JBMA 4F7UF 4JLGA 4PJOG 1VQ9A 3DB4A 2R5AA 3M9QA 1JJ2S 1XQHA 1OZ2A 2I2LA 2KQWA 4OB1B 1N6AA 3L1AA 2RA2A 4J7IA 5C0MA 3CXCA 3CMEA 2WSFE 4M77A 3V8KA 1K8AC 2Y4YA 2LC4A 3JSCA 3PNWC 4C8QA 4ZTFA 2DTIA 2EQUA 3HKSA 4Q5WA 1M1KC 5FRMA 1VQLT 2RHIA 2EYQA 4C5GA 3JAME 3X20B 2P4TA 3GF5A 4M78B 4F7UB 3GNFB 3RMQA 2EIFA 3VU3C 4OMFB 1YI2A 2RJEA 4BUGA 2CZ1B 2PQWA 1M1FA 3QUIA 2BIVA 2CYZB 3C94A 2P0QA 3UPUA 3OSVA 2XIDA 4CI0C 5CQYA 4A54A 5DLQE 5LJ5j 3TU4K 3CC2A 2RJCA 3MO8A 1KQ2A 2BUDA 3LWHA 3JCMg 4PJOE 3M53A 1G5VA 2ZPFB 5GMKi 2AHJB 2EFIA 1BIBA 1VQKT 4YTLA 3OYCA 3SD4A 1WQWA 1YI2T 3CEYA 1K9MU 4A4HA 3QJYA 4ME7A 4VUBA 2E70A 1VQNA 1M4ZA 2M1HA 2CGHA 2MWOA 3HRSA 3I56A 1Q82U 1KD1U 5GAOp 2YLBA 4IURA 1VQ8A 5LJ5h 3JCMf 3L2UA 1WJRA 4Y28E 2M16A 4J83A 2VC8A 4JJNK 2XDDA 3RKWA 3G7ZA 4XAXB 4EMGA 3QG1A 1FWZA 5GAN6 3VYGA 4DOWA 2PU9B 3HL8A 5FLXE 4E7IA 2DXBA 1ZHIA 3OYFA 2XDBA 3L42A 3LLRA 4N4IA 1VQPA 2RJDA 2DD4A 1VUBA 1YBYA 1UB4A 2FL7A 1I8FA 1YCYA 2VXFA 3PFSA 4M75F 5L8RE 4BACA 1YJNT 1Q86U 4LDYA 1D3BA 1VQOA 2O4XB 2X4YA 3QYGB 3SDZA 5HKCA 4BDZA 3JCMd 4XQ3A 2XICA 2JVVA 3KXTA 2QI2A 2E5QA 1NZ9A 4TVRA 2JNGA 2KDSA 3FIFA 4J6YA 5CVIA 4R55A 3OYAA 2ZPBB 3KUFA 3N5BB 4M7DC 4JRQA 2GFAA 1GXIE 2L89A 4FSXA 3J81E 3GOXA 3FDRA 3VUBA 4C8QF 3ASKA 1WQ7A 2RI3A 1WJQA 1YJNA 1KC8U 3P8HA 2EJFA 4IUTA 5IN1A 5DY9A 3CPWS 4HA8A 4PJOA 4N0AA 3UDCA 1VQ7A 1JB0E 4EMHA 2CZ0B 1BI1A 4C0FA 5CKBA 4BY6B 2GFUA 2L5QA 3M4YA 1VQMT 1RI0A 4M75B 4L59A 3TEEA 2K5FA 4XTZA 1NPRA 5GAN3 3OS0A 2LCLA 1B34B 3LW5E 1VQNT 3E1SA 3Q1JA 4C92G 3GP8A 2M0OA 1M9SA 2YHTA 3CBOA 4KBMB 4BDYA 5CKEA 3CCJA 2DTHA 1UGQB 2OTLT 1VQ8T 3FLGA 2KSSA 1K73U 2B8AA 3QYHB 3SWNC 4BE0A 4UC4A 2K4YA 4C92C 2LT1A 2VXEA 4OVAA 3JCMh 2X4XA 2XD0A 4KUDK 2HNIA 2NLUA 4XU2A 2KVQG 2YRVA 1Y7XA 1Q7YU 2DEQA 3JB9I 3QDRB 1KC8C 3J7AF 4M77F 4Y91A 4BY6C 1VQPT 4FL6A 1H3ZA 3QHSA 1HK9A 2JTMA 2L3RA 3V7CA 3CPFA 3PT9A 4FT2A 1QP3A 4O5VA 2PUKB 3G4SA 1QVGA 4V2SA 4F7UE 3OY9A 3CC7A 2QTXA 2Y90A 3A8LB 4OGCA 3OW2A 1Y96A 3HRTA 4QVDA 4M75A 5I21A 4XTUA 1M90C 4MZMA 1IZ6A 2K2VA 3P8BB 3JCMe 3H6ZA 1YJ9T 1YITA 4M7DG 2EQJA 5FROA 5A0DA 1PSEA 2E65A 2DVEA 2XK0A 1JRIA 2JZ2A 4E47A 1FXXA 4II1A 1WGSA 4PJOC 2DXTA 1U8RA 2CZ7B 2RI2A 2RHXA 2E12A 4LDVA 5LJ3f 3C12A 3AHUA 1VQ9T 4QW2A 5HK0A 2ZCFB 4B9XA 5IAYA 4NS5A 3HSBA 1NJIU 2LRQA 4NL2A 3OS5A 2DJZA 4BI4A 3C95A 5GAN2 2BKDN 4C0ZA 4L6V5 4M77B 3EFRA 3RIRA 2MF2A 3X24B 1Q7YC 2WSEE 3CC4A 3OYKA 2XDPA 2RHZA 3OBWA 4C0DB 3CCMA 3QKJA 1BYMA 3OYEA 4IUVA 1VQ4T 5DM7R 2ZPGB 4M75D 2LDMA 3BW1A 4XTYA 2O01E 3J80E 1VQKA 1WJSA 2K5IA 3CCLT 4M75C 1G3YA 4JRIA 1B34A 2E10A 3M59A 1N9RA 2OAUA 2Y4XA 3OYYA 3OMGA 4JUVA 2HQEA 4FM4B 2ZZDA 4LDWA 4PJOB 1I5LA 2JUFA 4C0GA 2DD5A 3E9FA 1YIJA 1RL2A 3OQ5A 5D6XA 3X26B 4M7AF 2WACA 2MWPA 1LNXA 4MDWA 4R56A 4BE1A 4LD9K 4JLIA 4A4KA 3VYHB 4C92F 1UEBA 3G71A 2RHYA 4EMKA 5GAOm 4JS4A 1UGPB 2DZCA 2DTOA 4LDUA 1X01A 3CC7T 5LJ3h 2RK1A 2K57A 4GY5A 5IT9E 4M75G 2E6ZA 2HD0A 1N8RC 4WF2A 1V29B 1AHJB 4C0DC 1BI3A 5A2QE 4X9CA 3VJPA 1XTDA 4PJOF 4ZGJB 3OA6A 4BE2A 1QVFS 1BI0A 2K3YA 2JN0A 3CD6T 2CKKA 4EMKB 2XKOC 2PUOB 3C4SA 2X35A 3CCUA 2PVGB 5GANh 4IKFA 4GLKA 5DLOA 4JRPA 3OYDA 3OW2S 1LOJA 1KHIA 5J39A 2HQXA 2FVUA 3CCSA 1R8OB 3RKYA 4HCCA 2QQBA 3PIOA 2RK2A 1IREB 2P0PA 5CKDA 1OYXA 4CRIA 3PTAA 3OYIA 1VQ6A 2DZ9A 2MI6A 2KMTA 3NTKA 3CCUT 5D6WA 3RUXA 3URGA 1U1TA 2IVWA 3JRZA 5GANd 3S3NA 3S3OA 1O75A 4C8QE 3LGLA 2F5KA 3CCQT 5A0GA 4M77D 4LDXA 3HPWA 4M77E 4C5EA 1N8RU 5LJ3d 4QVZA 2QQAA 1TH7A 4BI3A 4LD6A 4PL6A 5GMKm 2D6FA 3LYIA 1U1SA 4RG2A 2RM4A 2K3XA 4XTXA 2A3LA 4M7AC 2O4XA 3MEWA 3DLLA 3S6WA 4EMKC 3CMAT 4FIBA 1K9MC 1HXDA 1G3WA 2QEXT 2RH2A 2FHDA 4DOVA 1VQMA 4RKUE 2E41A 3OYLA 3CCQA 1M90U 3O8VA 4IUUA 5FU7B 3G71T 4C5IA 3A8OB 2DIQA 4PJOD 4M7AA 5GMKl 3PGGA 3MHXA 5GMKh 2YLCA 5I2SA 1G3SA 3CC2T 4FU6A 5J3BA 3DLMA 3P8DA 2PVOB 4M7DE 3NTHA 5CKFA 2C06A 5D6YA 2EQMA 4M78F 1WNLA 4O6JA 3JCMV 3DKMA 3CCVT 5FU6C 3FEOA 3MEUA 3M56A 5GANg 3CCRA 4NL3A 2HAXA 2LVMA 2JTFA 2DK3A 5CR2A 4RMOA 2LX9A 3PIPA 2K5LA 3OBYA 5M9OA 3V7RA 3OYMA 2VGNA 3QPHA 3JCMJ 1DJ7B 4EPCA 5GAOr 2V8JA 4M78C 3NFCA 2JOYA 2RB6A 3JB9D 3CCLA 2VGMA 3JCMQ 3VUZA 3EAEA 5CCAA 3L2WA 1NPPA 2GCXA 2V8KA 4KT0E 4E7JA 1NJIC 1VQ6T 4M75E 1W4SA 4ELYC 1BIAA 2OTJT 1KQ1A 3A8HB 2ZGWA 4MZTA 1Q81C 2XG8D 5FU7C 4D6WA 3E9GA 4MDXA 4JRKA 3META 4MZPA 3TCJA 3JCMX 2DPPB 2EJGA 5GAOq 1VQOT 3MP6A 4QQDA 4MMKA 2DKGA 3MP8A 3HFNA 1VQ5T 4C92E 3QBYA 4RCCA 4RG8A 4M7DD 3GNGA 1YHQA 3TREA 5GAN8 2EAYA 2FYKA 2VYTA 5GAMe 2F5TX 1YIJT 2OTJA 2DAQA 4PLIA 1EIFA 3V8JA 4C92A 5A0LA 4P5NA 5GAN7 4EDUA 3JB9H 4BI8B 3LGFA 1OZ3A 3JCMb 3L2ZA 3L2VA 1G3TA 3HRUA 1YJWA 1Y07A 1K73C 4OB2B 4XTVA 4A4FA 4E7KA 3SWNA 3QXEB 3CCMT 1QVFA 3HHTB 5LJ3g 3OS2A 4XU0A 4QQGA 1W2BS 5C6SA 3M58A 5CKHA 2EQKA 4ZN3A 4FT4A 1KQSA 1VIFA 1Y71A 3CCRT 3INZA 3ZBDA 4J6XA 1H641 5KCOA 3CXCS 1MHNA 3DB3A 4HCZA 3X25B 3SWNB 4M78A 4PNOA 5KCHA 1JJ2A 4HT8A 5CAIA 4DQ2A 1P92A 1QVPA 5CO7A 3CD6A 3JCMW 3L2QA 2E1HA 4E7LA 1XOVA 1ZBXA 3MP1A 1I81A 4N0AC 1QW1A 4C8QD 5GANf 1X75C 2R57A 3OYNA 2LTOA 1XNIA 3A8GB 3ER0A 3F70A 4M7AE 1M5Q1 4IUQA 1M8VA 2DXUA 3CBPA 2XI9A 3LX7A 4N4HA 4BD3A 3LH0A 4F7UG 1I4K1 3G6ET 5GAN5 3FRNA 2GQVA 1VQ7T 4QQ6A 2A7YA 3G4ST 4PLLA 3QSUA 1FX7A 3BFMA 2R5MA 1Y96B 2LQKA 3QIIA 3JCMc 3RKXA 2QQSA 4C8QG 5LJ5e 3QZ5B 1YHQT 3JB9J 2XHCA 2CZ6B 3M54A 2OTLA 1YJ9A 4QVCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FU7 C;  5FU6 B;  4C0D B;  4C0F A;  4C0G A;  4BY6 B;  5FU6 C;  5FU7 B;  4C0D C;  4BY6 C; 
#chains in the Genus database with same CATH topology
 5CK9 A;  1X6O A;  5GAM g;  2KYB A;  4OB0 B;  4X9D A;  1YJN Q;  1MND A;  2YRD A;  2A08 A;  1UHC A;  4ZN1 A;  4C92 D;  5GMK j;  3VS0 A;  2RQT A;  4HVW A;  3G71 Q;  3OMC A;  1YIT Q;  3SHW A;  5KE3 A;  2DLP A;  3MCA B;  1YWP A;  5IHN A;  4A4E A;  2RD1 A;  3CMA A;  1CKA A;  3VV0 A;  4FCY A;  2DX1 A;  4PKC C;  3NHN A;  3CBM A;  3CCE T;  2LNV A;  3RBB B;  3OSS C;  2X4W A;  1X6G A;  3HP9 A;  2NUT B;  4XK8 E;  4HKE A;  3NGP A;  2K6D A;  1V76 A;  1KD1 C;  5I2M A;  4XU3 A;  2QEX Q;  1N27 A;  2DO3 A;  5AT1 B;  4LUD A;  1WHM A;  2GF7 A;  2H3J A;  3HFO A;  2M0Y A;  4M77 G;  3ULR B;  1OU8 A;  6AT1 B;  2MOX A;  3OYG A;  1VIE A;  2RI5 A;  2V8I A;  3T9N A;  1NE8 A;  2BZ8 A;  2FZG B;  1GCQ A;  4QKU A;  2A0F B;  2RJF A;  1WI7 A;  1OI1 A;  2F69 A;  2L8D A;  2DIL A;  2EPD A;  2LQ8 A;  1KQS S;  1RI9 A;  2YSQ A;  1HD3 A;  1X69 A;  2QQ9 A;  1B07 A;  3M0S A;  3PMI A;  5GAM j;  5KYY B;  4J7F A;  2J6O A;  1G2B A;  4OF1 A;  3OYB A;  4M7A B;  4M7D A;  2SRC A;  3QZ9 B;  1WIE A;  1QVG S;  1BI2 A;  2R58 A;  2LJ0 A;  1N9S A;  1MGQ A;  2DL7 A;  1VQ4 A;  1GCQ C;  3CC4 Q;  2X4J A;  3M0U A;  3EH2 A;  1MV0 B;  1JJ2 S;  2KQW A;  5C0M A;  3CME A;  5KYU B;  1D09 B;  5KYU A;  1K8A C;  2WSF E;  3V8K A;  1K0S A;  4ESR A;  2J06 A;  2LC4 A;  3PNW C;  2VVK A;  2EQU A;  1K4U S;  2EYQ A;  3GF5 A;  4M78 B;  4F7U B;  1NBE B;  3VS3 A;  1TUG B;  4GLM A;  1YI2 A;  2CZ1 B;  3QUI A;  2CYZ B;  3OSV A;  4CI0 C;  5CQY A;  4A54 A;  5LJ5 j;  3CC2 A;  5I22 A;  1KQ2 A;  1PKT A;  5GMK i;  1W2B P;  1VQK T;  3OYC A;  1EZZ B;  4AFU C;  2CGH A;  1KD1 U;  1PRL C;  1VQ7 Q;  1KJW A;  2GTO A;  2QTV A;  3RKW A;  2KRM A;  1PCX A;  3TSW A;  4DOW A;  4LN2 A;  5FLX E;  1ZHI A;  2DD4 A;  2FL7 A;  1N8R R;  1VQO A;  2ATC B;  3JCM d;  4XQ3 A;  2XIC A;  2EGC A;  3KXT A;  1BU1 A;  2E5Q A;  1YIJ A;  4M7D C;  3FIF A;  5CVI A;  4JZ3 A;  3N5B B;  3RNJ A;  4JRQ A;  2GFA A;  1GXI E;  2HSE B;  3OW2 S;  4C8Q F;  5ECA A;  3P8H A;  5IN1 A;  5DY9 A;  2FRW A;  2J6K A;  4HA8 A;  2DF6 A;  3UDC A;  2HKN A;  2CZ0 B;  1BI1 A;  1W6X A;  2P4R A;  3M4Y A;  1X6B A;  4M75 B;  4L59 A;  3TEE A;  2K5F A;  4XTZ A;  4B6M A;  2LCL A;  1XJW B;  2BE7 D;  3LW5 E;  3E1S A;  4C92 G;  2YHT A;  4KBM B;  1Q81 R;  2B8A A;  3QYH B;  1RAE B;  4GBQ A;  4D8K A;  4BE0 A;  4UC4 A;  2K4Y A;  4C92 C;  8AT1 B;  1K76 A;  3EGU A;  1UDL A;  2KXD A;  1KSW A;  3EHR A;  2F2W A;  3J7A F;  3JB9 I;  2DRM A;  4FYY B;  2YUO A;  4QT7 A;  2RMO A;  2L3R A;  1QVG A;  3PT9 A;  1TG0 A;  1QP3 A;  1TU0 B;  1IHV A;  1SHG A;  1IB8 A;  1K9A A;  3EGD A;  4MZM A;  3CC7 Q;  2GBQ A;  1JO8 A;  3JCM e;  4M7D G;  2DVE A;  4E47 A;  2JZ2 A;  2CP5 A;  1FXX A;  1WX6 A;  2CZ7 B;  5LJ3 f;  2JMA A;  2KYM A;  3C12 A;  3I5R A;  1FYN A;  2JW4 A;  4QW2 A;  5HK0 A;  3CCR Q;  1VQ9 T;  4B9X A;  5IAY A;  3HSB A;  3C95 A;  2KE9 A;  2NUZ A;  3RIR A;  3X24 B;  1VQ9 Q;  1ZSZ C;  3OYK A;  3OBW A;  3CCM A;  3I5S A;  1I0C A;  4DBF A;  2ZPG B;  1I1J A;  1WJS A;  2K5I A;  1G3Y A;  4JRI A;  1N9R A;  2Y4X A;  3G6E Q;  3OMG A;  4FM4 B;  3NPF A;  3G4S Q;  2JUF A;  4C0G A;  2GTJ A;  2O31 A;  3X26 B;  3CCL Q;  2WAC A;  2LNH B;  3VYH B;  3QWY A;  4EMK A;  1ABO A;  4LDU A;  2RK1 A;  2E3H A;  5IT9 E;  1N8R C;  2V1R A;  1V29 B;  2X9H A;  1SRM A;  1PKS A;  1YCS B;  3OA6 A;  4LUE A;  1BI0 A;  2K3Y A;  2B86 A;  3CD6 T;  2XKO C;  3M0Q A;  3C4S A;  2FO0 A;  1KHI A;  1GRI A;  2CP6 A;  4HCC A;  1R8O B;  2QQB A;  3U23 A;  1IRE B;  1AD5 A;  5GJV B;  3OYI A;  2KEA A;  3NTK A;  3CCE Q;  2DE0 X;  5D6W A;  3URG A;  1U1T A;  2IVW A;  5GAN d;  1OX8 A;  2F5K A;  4M77 D;  3HPW A;  2CRE A;  1RAI B;  2QQA A;  4LD6 A;  2D6F A;  1JQQ A;  3LYI A;  2A3L A;  3MEW A;  3S6W A;  2EBP A;  3CCQ Q;  4FIB A;  4PK4 A;  1HXD A;  1G3W A;  2QEX T;  2RH2 A;  4DOV A;  1SSH A;  3OYL A;  3O8V A;  4HCK A;  4C5I A;  3A8O B;  4M7A A;  1FMK A;  5GMK l;  3MHX A;  3O5Z A;  3P8D A;  1C6V X;  1OQK A;  2NUP A;  4O6J A;  1WNL A;  3CCR A;  5CR2 A;  2DM1 A;  1WXB A;  1Y57 A;  2K5L A;  3CCV Q;  5M9O A;  2YUN A;  3OYM A;  5IHI A;  2JT4 A;  2V8J A;  2RB6 A;  2V8K A;  1NJI C;  2MK5 A;  2X51 A;  4M75 E;  2EW3 A;  1VOM A;  1Q81 C;  2XG8 D;  5FU7 C;  3E9G A;  2BZY A;  3MET A;  2COY A;  5GAO q;  3MP6 A;  4QQD A;  3HFN A;  4M7D D;  4RCC A;  5GAN 8;  2FYK A;  1YIJ T;  4DBQ A;  4PLI A;  1EIF A;  4C92 A;  1M2O A;  4BI8 B;  3JCM b;  2QGG A;  3HRU A;  1YJW A;  4XTV A;  4A4F A;  3RDV A;  1Y0M A;  3SWN A;  1QVF A;  4AMC A;  5IXF A;  3M58 A;  5CKH A;  2MYS A;  4ZN3 A;  4LXC A;  4LE9 A;  3INZ A;  1H64 1;  2L2P A;  5KCO A;  1ABQ A;  3DB3 A;  4HCZ A;  3X25 B;  1JJ2 A;  5CAI A;  1ZUY A;  1P92 A;  4E7L A;  4N0A C;  1I81 A;  2DYB A;  1X75 C;  1XNI A;  3A8G B;  1EX4 A;  1M5Q 1;  4IUQ A;  4N4H A;  2KRS A;  5KYW B;  5GAN 5;  2GQV A;  3G4S T;  1FX7 A;  3BE3 A;  3QII A;  2ED1 A;  3QYG B;  2CZ6 B;  4AG1 C;  2OTL A;  2D9T A;  1O9S A;  1ACM B;  1KIK A;  4JS5 A;  1YWO A;  1BKB A;  1ZSZ B;  2V1Q A;  2IG0 A;  2QEX A;  1JJ2 P;  1M30 A;  2P0K A;  3GLX A;  1M1K U;  4MML A;  2YUP A;  2MMP A;  3A5Z B;  3E19 A;  3LWI A;  4AG2 C;  2FPE A;  5LJ5 d;  1K8A R;  4M7D F;  2PZ1 A;  2KAF A;  5LJ3 e;  4E2F B;  2ZPH B;  2PNI A;  4DA4 A;  1RAC B;  1UTI A;  2LCC A;  2KNB B;  2VB6 A;  4ELZ C;  4J6W A;  5EG2 A;  2QDY B;  3M0T A;  2K9G A;  2ROL A;  4E7H A;  4RCB A;  3ZEH A;  3L2R A;  3JV3 A;  1VQ6 Q;  2ED0 A;  4A53 A;  1ZQ1 A;  4C8Q B;  4M78 G;  2BE9 B;  1M1G A;  1M3B A;  1AZE A;  2DJQ A;  1OPL A;  4F16 A;  1NEB A;  3CCJ Q;  2HCK A;  3H8Z A;  1V1C A;  3SB2 A;  3JCM P;  2K3B A;  4F17 A;  1SSF A;  3OB9 A;  2QXF A;  1K73 R;  1SF9 A;  4J8O A;  4ORZ A;  3CCJ T;  4A63 B;  3UT1 A;  7AT1 B;  2QA4 A;  1F1B B;  2DXC A;  3FJP A;  3I56 Q;  4L5G A;  3CCM Q;  1UGR B;  3OYJ A;  3ZFJ A;  4JDS A;  5HCK A;  3I55 T;  5GAM d;  1K8A U;  4IUP A;  2DER A;  4ATO A;  1MV3 A;  4C92 B;  2DIG A;  1PD1 A;  3G6E A;  4M7A G;  2VUB A;  1IO6 A;  5GAO l;  2M9U A;  1NJI R;  1KG1 A;  5LL6 S;  3I55 A;  1S72 T;  1H92 A;  2PVD B;  5GAO n;  5GAM h;  5LJ3 j;  1ZBJ A;  5L23 A;  1VQ5 A;  4F7U F;  4JLG A;  3DB4 A;  3CME Q;  2GNC A;  2K2M A;  1X2K A;  2R5A A;  1VQ7 A;  4OB1 B;  1N6A A;  2RA2 A;  1AWW A;  3M0R A;  4DBR A;  4EIK A;  1LCK A;  2JXB A;  2Y4Y A;  4C8Q A;  2AKK A;  3HKS A;  1M1K C;  1VQL T;  4PJL A;  4OMF B;  1WHJ A;  2RJE A;  1GFD A;  2PQW A;  1VQK Q;  4KH0 B;  1OUL A;  2RJC A;  4FYV B;  2BUD A;  4PJO E;  1G5V A;  2ZPF B;  1WQW A;  2HL3 A;  1K9M U;  1NEG A;  4A4H A;  4ME7 A;  2E70 A;  1M4Z A;  3I56 A;  1MMG A;  2I0N A;  1ZX6 A;  2YUQ A;  1YFN A;  5LJ5 h;  2CT4 A;  3JCM f;  2M16 A;  4J83 A;  4JJN K;  4RTW A;  1TS9 A;  3HL8 A;  4E7I A;  3L42 A;  3LLR A;  4N4I A;  2RJD A;  1UB4 A;  1YCY A;  3PFS A;  3REA B;  4BAC A;  2KT1 A;  2QI2 A;  4R55 A;  2ZAE A;  2JM8 A;  4J6Y A;  3OYA A;  2ZPB B;  3KUF A;  2QAS A;  3UF4 A;  2L89 A;  4FSX A;  1AZG B;  2RI3 A;  1WJQ A;  2EJF A;  4CC7 A;  4EMH A;  5CKB A;  4BY6 B;  2NUP B;  3VS7 A;  2JS2 A;  1M2V A;  3H0H A;  2CP7 A;  2DL4 A;  1B34 B;  2M0O A;  1M9S A;  3CBO A;  4BDY A;  5CKE A;  1R0B G;  1UGQ B;  2HBW A;  2LT1 A;  3JCM h;  4OVA A;  3VS5 A;  1WZO A;  4DEY A;  3THK A;  3VRY A;  4BY6 C;  1H3Z A;  1HK9 A;  2JTM A;  1SG5 A;  3G4S A;  3UA6 A;  3OY9 A;  3CC7 A;  2QTX A;  3EFO A;  4OGC A;  1UG1 A;  4QVD A;  1OOT A;  1IZ6 A;  2DBK A;  5IH2 A;  2EQJ A;  3UAT A;  2FEI A;  2RHX A;  4LDV A;  2QAZ A;  2ZCF B;  4NS5 A;  4NL2 A;  3ZL7 C;  4BI4 A;  2BKD N;  4C0Z A;  4L6V 5;  1JXO A;  2RQR A;  1Q86 R;  3EFR A;  1AT1 B;  1X27 A;  4C0D B;  1BYM A;  2LJ1 A;  3C0C A;  4M75 D;  3BW1 A;  4XTY A;  2H3E B;  2K79 A;  1VQK A;  2ROT A;  3CCL T;  3M59 A;  2OAU A;  2ABL A;  1QKX A;  2VWF A;  1X2Q A;  3GBQ A;  3E9F A;  4J9F A;  3EG1 A;  2MWP A;  3OW2 P;  4R56 A;  4BE1 A;  4LD9 K;  1AEY A;  4A4K A;  1UEB A;  3G71 A;  2RHY A;  1UGP B;  2DZC A;  1TXQ A;  2HD0 A;  2O9V A;  1TUD A;  2RF0 A;  1AHJ B;  4C0D C;  5A2Q E;  1AVZ C;  4X9C A;  3VJP A;  1TWB A;  3PVQ A;  1UFF A;  4AFQ C;  2L3S A;  2PVG B;  1LOJ A;  2FVU A;  1NM7 A;  3CCU Q;  3CCS A;  3RKY A;  3PIO A;  2RK2 A;  2P0P A;  3NMZ C;  2DZ9 A;  3CXC P;  2O9S A;  3LGL A;  1JXM A;  5A0G A;  1T0J A;  5FWC A;  4BI3 A;  1TUC A;  1I5O B;  4RG2 A;  4CC4 B;  4XTX A;  2O4X A;  2CUB A;  4J9I A;  2FHD A;  2E41 A;  2DYI A;  1KQS P;  4JPB W;  3PGG A;  5GMK h;  5I2S A;  1WXT A;  2QGF B;  1ZUK A;  1G3S A;  4FU6 A;  3DLM A;  3NTH A;  5CKF A;  3I9Q A;  5D6Y A;  2EQM A;  3CCV T;  3DKM A;  3EFO B;  1G83 A;  3FEO A;  3MEU A;  4NL3 A;  2JTF A;  2DVJ A;  2LX9 A;  2COW A;  1GBQ A;  4RTX A;  3QPH A;  4JJD A;  1DJ7 B;  4KGZ B;  4EPC A;  3JCM J;  3CCL A;  3VUZ A;  2MCN A;  1W4S A;  1BIA A;  2OTJ T;  4MZT A;  3QWX X;  4D6W A;  5KYY A;  3TVT A;  1VQO T;  3MP8 A;  1VQ5 T;  4OMO A;  3QBY A;  4RG8 A;  3GNG A;  2OTJ A;  2D1X A;  2DAQ A;  3JB9 H;  3V8J A;  3E2U A;  2EYW A;  3LGF A;  1OZ3 A;  1X43 A;  4RTU A;  1SRL A;  3L2Z A;  1T0H A;  1NYG A;  3VRZ A;  5FWB A;  1K73 C;  3CCM T;  3EGX A;  4PJM A;  4ZNX A;  5C6S A;  1TSF A;  2EQK A;  4FT4 A;  3H41 A;  1Y71 A;  2KGT A;  3CCR T;  3ZBD A;  4J9G A;  1BK2 A;  2CP3 A;  4PNO A;  4DQ2 A;  5CO7 A;  2FRY A;  3L2Q A;  1XOV A;  2KRO A;  3OYN A;  4J9C A;  4M7A E;  3CBP A;  2XI9 A;  1A0N B;  4F7U G;  1I4K 1;  1BCM A;  3FRN A;  2A7Y A;  2CT3 A;  3TQ7 P;  3JCM c;  5LJ5 e;  2QQS A;  3QZ5 B;  1D1C A;  3JB9 J;  2XHC A;  3M54 A;  2HBP A;  2ZPE B;  3UWN A;  4AFZ C;  2DL5 A;  3CCV A;  4XU1 A;  1U06 A;  3OYH A;  4M7D B;  2KR3 A;  2OAW A;  3M57 A;  5GAN 4;  1ZA2 B;  4JJB A;  1S72 A;  2V26 A;  4KUL A;  4Z02 A;  1RLQ C;  2AKL A;  3JB9 G;  3H9N A;  1M1K R;  1Q7Y R;  3M4G A;  3CC2 Q;  2YDL A;  4M78 E;  3MEV A;  1VQL A;  1WPY A;  1GL5 A;  1K9M R;  4NOY A;  3I55 Q;  1UUE A;  4ZGD B;  2EGE A;  1K0X A;  2LP5 A;  4J9B A;  1KHC A;  1YJW Q;  2DBM A;  3M55 A;  4F7U A;  5FRN A;  4N4G A;  2P84 A;  3KBG A;  4ZTJ A;  2OTJ Q;  3CPW A;  1Q81 U;  2CH4 A;  3X28 B;  4ANJ A;  1KC8 R;  2NUT A;  2KY9 A;  3GPL A;  1WLP B;  2DRK A;  2VV5 A;  2WSC E;  1QQJ A;  2QA4 Q;  3I56 T;  1NYF A;  3RMS A;  3EFS A;  4OMM A;  1Q86 C;  4E7Z A;  3ME9 A;  1YIT T;  1J3T A;  2LZ6 B;  4J9E A;  5LJ5 f;  5CIU A;  3PMT A;  2F1L A;  3BY7 A;  1UJ0 A;  2XU8 A;  3WVE B;  4HT9 A;  1WYX A;  1S72 Q;  4B9W A;  5AYF A;  3M5A A;  2YXY A;  1ZA1 B;  3A1P A;  3NTI A;  4J5Y A;  1YJW T;  1PWT A;  1PM3 A;  5KE2 A;  5KH6 A;  2QG9 B;  2BZX A;  2HQH A;  2YRC A;  2E3I A;  3A8M B;  4OGE A;  3BDU A;  2SEM A;  2A36 A;  1QWE A;  4PJO G;  2DMO A;  2JS0 A;  3M9Q A;  2DL3 A;  1XQH A;  1OZ2 A;  2I2L A;  3CXC A;  4J7I A;  1YHQ Q;  3D7S B;  2DTI A;  5FRM A;  2HMA A;  4J9H A;  3JAM E;  3X20 B;  3GNF B;  3RMQ A;  3EG9 B;  4OMP A;  2LJ3 A;  2BIV A;  2JTE A;  3UPU A;  2XID A;  1NLO C;  3MO8 A;  2OX7 A;  1C1A A;  3LWH A;  3JCM g;  3M53 A;  2W10 A;  3VS6 A;  2H8H A;  2VAS A;  3SD4 A;  2VKN A;  1RAD B;  2M1H A;  2MWO A;  3HRS A;  3VS2 A;  4IUR A;  3L2U A;  2VC8 A;  2LQW A;  3QG1 A;  2E5K A;  1FWZ A;  5GAN 6;  2RPN A;  3VYG A;  2ENM A;  2PU9 B;  4IIM A;  1KK7 A;  2G6F X;  2DXB A;  2XDB A;  2YWW A;  4Z8A A;  1D0Z A;  1MUZ A;  1YBY A;  1I8F A;  2VXF A;  2QK0 A;  1YJN T;  1Q86 U;  4LDY A;  1D3B A;  3SDZ A;  4BDZ A;  4KH1 B;  3A98 A;  2JVV A;  1NZ9 A;  1KD1 R;  2X3W D;  3MKD A;  2CSI A;  2DFU A;  1VYT A;  1WHK A;  3J81 E;  3GOX A;  3FDR A;  2EYY A;  4PFP A;  1WQ7 A;  1YJN A;  4IUT A;  4N0A A;  3H0F A;  1IRX A;  2GFU A;  2L5Q A;  4FYX B;  1RI0 A;  3EGD B;  3M0P A;  3LH5 A;  3OS0 A;  3EG0 A;  1VQN T;  3GP8 A;  5FW9 A;  3CCJ A;  2DTH A;  2OTL T;  3FLG A;  4FW1 A;  1VA7 A;  2FPD A;  1VQN Q;  1C0M A;  2HNI A;  8ATC B;  1AWX A;  1LPL A;  2YRV A;  1WHL A;  1Y7X A;  1KC8 C;  2W0Z A;  4Y91 A;  1VQP T;  4FL6 A;  3QHS A;  1ARK A;  2FG0 A;  3V7C A;  4FT2 A;  4O5V A;  5EC7 A;  1UEC A;  4M4Z A;  3OW2 A;  3IQL A;  1VQP Q;  1Y96 A;  1N5Z A;  3HRT A;  5I21 A;  4M75 A;  2K2V A;  3P8B B;  3H6Z A;  1YIT A;  1SEM A;  5FRO A;  5A0D A;  2XK0 A;  1E6H A;  2A37 A;  4RUG A;  4II1 A;  4PJO C;  2DXT A;  2DEU A;  2RI2 A;  2E12 A;  3AHU A;  2EGA A;  2DJZ A;  4KGX B;  1FMV A;  5GAN 2;  2XMF A;  2AK5 A;  1PD0 A;  1Q7Y C;  3H0I A;  2WSE E;  3CC4 A;  1D1A A;  2XDP A;  2RHZ A;  3QKJ A;  2DNU A;  3PVL A;  1M27 C;  3OYE A;  4IUV A;  3PE0 A;  5DM7 R;  1VQ4 T;  1LVK A;  2PTK A;  2LDM A;  2J7I A;  3EH1 A;  1VYV A;  2ESW A;  1B34 A;  2E10 A;  3OYY A;  5J26 A;  4LDW A;  2HQE A;  2ZZD A;  4PJO B;  1I5L A;  1GFC A;  2ECZ A;  1RL2 A;  4FSS A;  5D6X A;  1LNX A;  4MDW A;  5KYX B;  4C92 F;  1IGU A;  5LJ3 h;  1B3Q A;  3CD6 Q;  4GY5 A;  4M75 G;  2E6Z A;  1BI3 A;  2RQV A;  5I11 A;  4BE2 A;  1QVF S;  4EMK B;  2D8J A;  2PUO B;  4PFZ A;  2X35 A;  3CCU A;  4IKF A;  4GLK A;  5DLO A;  4JRP A;  3OYD A;  4IIO A;  5J39 A;  2HQX A;  2FZC B;  1E6G A;  1NLP C;  1OYX A;  2DET A;  1VQ6 A;  1Q82 R;  2MI6 A;  1QCF A;  3RUX A;  3JRZ A;  3S3O A;  1O75 A;  2EVR A;  1HSQ A;  1H3H A;  4LDX A;  2LMJ A;  2J05 A;  5LJ3 d;  2C0I A;  4FYW B;  1CSK A;  4OMN A;  1VQO Q;  1ZUU A;  4EMK C;  1VQ5 Q;  1D0X A;  4IUU A;  3QDF A;  1JU5 C;  5J3B A;  2CSQ A;  4HVV A;  4M78 F;  4HXJ A;  5KYW A;  2KI7 A;  1AWO A;  5GAN g;  2LVM A;  4RMO A;  2JMC A;  1M8M A;  3VS1 A;  2JM9 A;  3OBY A;  1WDX A;  1SPK A;  2HEQ A;  3V7R A;  2VGN A;  2JOY A;  3JB9 D;  2VGM A;  2C0O A;  2GCX A;  4KT0 E;  4E7J A;  4PFO A;  1KQ1 A;  2JJ9 A;  2ZGW A;  2EQI A;  4MDX A;  4JRK A;  1E7O A;  4MZP A;  1I07 A;  3JCM X;  2DPP B;  2EJG A;  1ZLM A;  1NG2 A;  4MMK A;  2DKG A;  3CMA Q;  4C92 E;  5GJW B;  1T3L A;  1B7T A;  2CP0 A;  3TRE A;  1K1Z A;  2EAY A;  5GAM e;  4P5N A;  2GGR A;  1FMW A;  3CCS Q;  2J6F A;  1Y07 A;  2HDA A;  1Z9Q A;  3HHT B;  4JJC A;  4DEX A;  3OS2 A;  4QQG A;  1IXD A;  2RQW A;  2HKQ B;  2KXC A;  3CXC S;  4HT8 A;  5KCH A;  2NWM A;  1M2V B;  2QDL A;  5KYN A;  3CD6 A;  3JCM W;  2E1H A;  2NYS A;  1QW1 A;  2D8H A;  2FZK B;  2LTO A;  4LNP A;  1M8V A;  2DXU A;  3LX7 A;  2L3Q A;  3LH0 A;  1VQ7 T;  4QQ6 A;  2RQU A;  4PJN A;  1YHQ T;  3L2W A;  1BB9 A;  1YJ9 A;  4QVC A;  3CCS T;  2RO0 A;  1HYO A;  5HK3 A;  5GMK e;  2E6N A;  3MJX A;  2EJ9 A;  2ZPI B;  2QA4 T;  3REB B;  3WVD B;  2G3R A;  4XTW A;  2FB7 A;  1QMC A;  2LT4 A;  5GAM f;  4M7A D;  3FC3 A;  1WXU A;  3EHQ A;  4RTZ A;  3VS4 A;  2D0Q B;  2EWN A;  4OB3 B;  2HZY A;  3TSZ A;  1RLP C;  3VKI A;  4KUI A;  3SFM A;  2KK4 A;  3QJ6 A;  2DL8 A;  5FU6 B;  2O88 A;  5HY6 A;  3MEA A;  2E4H A;  5GAN j;  3JB9 F;  1ZSG A;  3EG3 A;  1Q82 C;  4C8Q C;  1VQ8 Q;  3V7S A;  2EKO A;  3CCE A;  4M77 C;  3QO3 A;  3WXM B;  4HCB A;  2A28 A;  2CS7 A;  2FPF A;  4M78 D;  1RAG B;  5LJ5 g;  2EYZ A;  5KYX A;  3EG9 A;  5CQX A;  4BB7 A;  4X34 A;  2CDT A;  4OP0 A;  2QQR A;  1UGV A;  2K7A A;  1PRM C;  1VQM Q;  1PSF A;  1D0Y A;  3S3M A;  3BDL A;  1LJO A;  4X1V A;  3OS1 A;  2E64 A;  1YP5 A;  4C5H A;  1VYU A;  2RHU A;  1D3B B;  4HVU A;  3UA7 A;  3RER A;  3V8L A;  1R77 A;  3S3N A;  2MAM A;  3R6O A;  4A4G A;  5GAN e;  3CC4 T;  1MMA A;  3GIB A;  4ZGE B;  3RES A;  1W2B A;  4PJJ A;  1QP2 A;  3CME T;  1UGS B;  3FB9 A;  2MIO A;  1JBM A;  3EG2 A;  1VQ9 A;  1WFW A;  1R0C B;  3L1A A;  5IXB A;  4M77 A;  1MMD A;  4KGV B;  3JSC A;  4ZTF A;  4Q5W A;  1RAA B;  5IHK A;  2RHI A;  4C5G A;  2P4T A;  1TTH B;  2EIF A;  3VU3 C;  1H8K A;  4BUG A;  1IGQ A;  1M1F A;  3C94 A;  2P0Q A;  1OPK A;  1QVG P;  1YI2 Q;  1IHW A;  3TU4 K;  5DLQ E;  2DA9 A;  2AHJ B;  2EFI A;  3CPW P;  1BIB A;  1VQ4 Q;  4YTL A;  4Y92 A;  1YI2 T;  2CP2 A;  3CEY A;  3QJY A;  4VUB A;  1VQN A;  4WTO B;  2D0N A;  1Q82 U;  1PHT A;  5GAO p;  1S1N A;  2AZV A;  2YLB A;  1M3A A;  1VQ8 A;  1KFZ A;  1WJR A;  4Y28 E;  4CC2 A;  2XDD A;  2OTL Q;  3G7Z A;  4XAX B;  4EMG A;  3FJ5 A;  1PC0 A;  1RAB B;  3OYF A;  1VQP A;  1VUB A;  1OV3 A;  4M75 F;  5L8R E;  3SEM A;  2O4X B;  2X4Y A;  5HKC A;  1VQL Q;  2EKH A;  2RN8 A;  4TVR A;  2JNG A;  2KDS A;  2LQN A;  1OX9 A;  2HL5 C;  3VUB A;  3ASK A;  2L0A A;  4AFS C;  1KC8 U;  4PJO A;  3CPW S;  1WHG A;  4OMQ A;  1RAH B;  1JB0 E;  4C0F A;  4OML A;  1EFN A;  2AZS A;  1VQM T;  2KT8 A;  1JEG A;  1NPR A;  5GAN 3;  1CKB A;  3Q1J A;  3RR6 A;  1Z9Z A;  3AT1 B;  1VQ8 T;  2KSS A;  1K73 U;  3SWN C;  4K11 A;  2CUD A;  2VXE A;  2X4X A;  2XD0 A;  4KUD K;  2NLU A;  4XU2 A;  2KVQ G;  1TOV A;  1Q7Y U;  2DEQ A;  3QDR B;  3I35 A;  4M77 F;  1YIJ Q;  2C0T A;  1M90 R;  3CPF A;  4V2S A;  2PUK B;  2OI3 A;  4F7U E;  2AIR B;  2KBT A;  2Y90 A;  3A8L B;  1M90 C;  4XTU A;  1PG5 B;  4CC3 A;  2HSP A;  1YJ9 T;  2GQI A;  1PSE A;  2E65 A;  1QCN A;  1MNE A;  1JRI A;  4KRT A;  1WGS A;  2BTT A;  1U8R A;  2F2X A;  2YT6 A;  1GBR A;  1NJI U;  4JZ4 A;  1YN8 A;  2LRQ A;  3OS5 A;  2L3P A;  1OU9 A;  4M77 B;  2MF2 A;  9ATC B;  3MPU B;  4E7S A;  1UJY A;  2IIM A;  2LX7 A;  1WHH A;  2AT1 B;  2O01 E;  3J80 E;  1MMN A;  4M75 C;  2RNA A;  4JUV A;  2KRN A;  2M02 A;  1AOJ A;  2DD5 A;  3OQ5 A;  4M7A F;  1QLY A;  4JLI A;  1Q95 G;  1QKW A;  1U5S A;  4JS4 A;  5GAO m;  2DTO A;  1X01 A;  3CC7 T;  4FW2 A;  2K57 A;  1ZSZ A;  4WF2 A;  1SKU B;  3HTR A;  1XTD A;  4PJO F;  4ZGJ B;  1RUW A;  2JN0 A;  2CKK A;  1U3O A;  5GAN h;  2O2O A;  4RTV A;  4WCI A;  4R0K A;  3R6N A;  4RTY A;  5CKD A;  1SHF A;  4CRI A;  3PTA A;  2KMT A;  3CCU T;  4Z89 A;  4DBH A;  1QCO A;  4F04 B;  1QWF A;  1PNJ A;  1W70 A;  4C8Q E;  1RAF B;  3CCQ T;  5D7U A;  4M77 E;  4C5E A;  1N8R U;  4QVZ A;  1TH7 A;  5GMK m;  4PL6 A;  4J9D A;  1U1S A;  2RM4 A;  2K3X A;  4M7A C;  3DLL A;  3CMA T;  2M51 A;  1K9M C;  2OJ2 A;  2COZ A;  1VQM A;  2QYZ A;  4RKU E;  1BBZ A;  3CCQ A;  1QVF P;  1M90 U;  2LCS A;  5FU7 B;  3G71 T;  4Z88 A;  1BCO A;  1HJD A;  2DIQ A;  4PJO D;  3CQT A;  2YLC A;  3CC2 T;  1GCP A;  2PVO B;  2X3X D;  4D8D A;  4M7D E;  2C06 A;  1M3C A;  3JCM V;  5FU6 C;  3M56 A;  2HAX A;  2DK3 A;  3PIP A;  5GAO r;  4M78 C;  3NFC A;  1WA7 A;  3JCM Q;  3EAE A;  5CCA A;  1NPP A;  2Z0W A;  1VQ6 T;  2EYX A;  4ELY C;  3A8H B;  1OEB A;  2CH4 W;  4F14 A;  3TCJ A;  3EGX B;  4RTT A;  1YHQ A;  2VYT A;  1YNZ A;  2F5T X;  5GAN 7;  5A0L A;  4EDU A;  1G8X A;  3L2V A;  1G3T A;  4E6R A;  4OB2 B;  1W1F A;  4E7K A;  3QXE B;  1YJ9 Q;  3G1J A;  5LJ3 g;  3KFV A;  4XU0 A;  1W2B S;  4AT1 B;  1D1B A;  1KQS A;  1VIF A;  2MPX C;  4J6X A;  1T3S A;  1AWJ A;  1MHN A;  3SWN B;  4M78 A;  1QVP A;  1ZBX A;  3MP1 A;  4C8Q D;  5GAN f;  2F2V A;  2R57 A;  3F70 A;  3ER0 A;  1UE9 A;  2IPO B;  4BD3 A;  3G6E T;  3QSU A;  4PLL A;  3BFM A;  2R5M A;  1Y96 B;  2LQK A;  4C8Q G;  3RKX A;  1UHF A; 
#chains in the Genus database with same CATH homology
 2D9T A;  1O9S A;  2HBP A;  2ZPE B;  5CK9 A;  1X6O A;  3UWN A;  5GAM g;  3CCS T;  2RO0 A;  3CCV A;  4XU1 A;  3OYH A;  5HK3 A;  4OB0 B;  5GMK e;  4JS5 A;  4M7D B;  4X9D A;  2E6N A;  3M57 A;  5GAN 4;  1BKB A;  1S72 A;  2IG0 A;  2EJ9 A;  2ZPI B;  4KUL A;  4Z02 A;  2QEX A;  2QA4 T;  4ZN1 A;  4C92 D;  5GMK j;  3JB9 G;  3WVD B;  2G3R A;  4XTW A;  2FB7 A;  2P0K A;  3GLX A;  1M1K U;  4MML A;  2LT4 A;  2MMP A;  3A5Z B;  3E19 A;  3OMC A;  3M4G A;  5GAM f;  3LWI A;  4M7A D;  3FC3 A;  4M78 E;  5KE3 A;  3MEV A;  3MCA B;  4A4E A;  5LJ5 d;  2RD1 A;  1VQL A;  3CMA A;  4M7D F;  1WPY A;  3VV0 A;  2D0Q B;  2EWN A;  4OB3 B;  2KAF A;  4NOY A;  3VKI A;  4ZGD B;  4PKC C;  5LJ3 e;  4KUI A;  3CBM A;  3SFM A;  2ZPH B;  3CCE T;  2LNV A;  4DA4 A;  2KK4 A;  3OSS C;  3QJ6 A;  2X4W A;  5FU6 B;  1KHC A;  2LCC A;  5HY6 A;  4ELZ C;  3HP9 A;  4J6W A;  4XK8 E;  2QDY B;  5EG2 A;  3M55 A;  3MEA A;  4HKE A;  4F7U A;  4N4G A;  4E7H A;  5GAN j;  5FRN A;  4RCB A;  3JB9 F;  1Q82 C;  3KBG A;  3ZEH A;  3L2R A;  4C8Q C;  1KD1 C;  4ZTJ A;  3V7S A;  5I2M A;  4A53 A;  2EKO A;  3CCE A;  4M77 C;  1ZQ1 A;  4XU3 A;  3CPW A;  4C8Q B;  1Q81 U;  4M78 G;  1M1G A;  1N27 A;  3QO3 A;  2DO3 A;  3WXM B;  5J26 A;  3X28 B;  4HCB A;  2CS7 A;  2GF7 A;  2H3J A;  3HFO A;  2KY9 A;  3GPL A;  4M78 D;  4M77 G;  5LJ5 g;  3H8Z A;  3SB2 A;  3JCM P;  2VV5 A;  1SSF A;  2WSC E;  3OB9 A;  1VIE A;  3OYG A;  5CQX A;  2QXF A;  2RI5 A;  4X34 A;  4BB7 A;  2V8I A;  3T9N A;  1NE8 A;  4J8O A;  4OP0 A;  3I56 T;  3RMS A;  3EFS A;  2QQR A;  3CCJ T;  2RJF A;  1Q86 C;  3UT1 A;  1OI1 A;  2QA4 A;  2F69 A;  3ME9 A;  1YIT T;  2L8D A;  1PSF A;  2DXC A;  3FJP A;  3S3M A;  2LQ8 A;  3BDL A;  4L5G A;  1KQS S;  5LJ5 f;  1UGR B;  5CIU A;  3ZFJ A;  3OYJ A;  1LJO A;  3PMT A;  2QQ9 A;  4JDS A;  3BY7 A;  3I55 T;  2XU8 A;  5GAM d;  2E64 A;  3PMI A;  3WVE B;  5GAM j;  4IUP A;  3OS1 A;  1K8A U;  4ATO A;  4HT9 A;  4C5H A;  4C92 B;  2DIG A;  4J7F A;  4B9W A;  5AYF A;  2RHU A;  1D3B B;  3M5A A;  4OF1 A;  3OYB A;  3G6E A;  2VUB A;  3RER A;  4M7A G;  3V8L A;  3NTI A;  4J5Y A;  2MAM A;  3R6O A;  4M7A B;  4A4G A;  5GAN e;  5GAO l;  2M9U A;  3QZ9 B;  5KE2 A;  1YJW T;  3CC4 T;  4M7D A;  5KH6 A;  5LL6 S;  1KG1 A;  1QVG S;  1BI2 A;  2R58 A;  3I55 A;  3GIB A;  4ZGE B;  1N9S A;  1S72 T;  2PVD B;  1MGQ A;  5GAO n;  3RES A;  5GAM h;  1VQ4 A;  1W2B A;  1QP2 A;  3CME T;  1UGS B;  3A8M B;  5LJ3 j;  3FB9 A;  4OGE A;  2X4J A;  3BDU A;  1VQ5 A;  1JBM A;  4F7U F;  4JLG A;  4PJO G;  1VQ9 A;  3DB4 A;  2R5A A;  3M9Q A;  1JJ2 S;  1XQH A;  1OZ2 A;  2I2L A;  2KQW A;  4OB1 B;  1N6A A;  3L1A A;  2RA2 A;  4J7I A;  5C0M A;  3CXC A;  3CME A;  2WSF E;  4M77 A;  3V8K A;  1K8A C;  2Y4Y A;  2LC4 A;  3JSC A;  3PNW C;  4C8Q A;  4ZTF A;  2DTI A;  2EQU A;  3HKS A;  4Q5W A;  1M1K C;  5FRM A;  1VQL T;  2RHI A;  2EYQ A;  4C5G A;  3JAM E;  3X20 B;  2P4T A;  3GF5 A;  4M78 B;  4F7U B;  3GNF B;  3RMQ A;  2EIF A;  3VU3 C;  4OMF B;  1YI2 A;  2RJE A;  4BUG A;  2CZ1 B;  2PQW A;  1M1F A;  3QUI A;  2BIV A;  2CYZ B;  3C94 A;  2P0Q A;  3UPU A;  3OSV A;  2XID A;  4CI0 C;  5CQY A;  4A54 A;  5DLQ E;  5LJ5 j;  3TU4 K;  3CC2 A;  2RJC A;  3MO8 A;  1KQ2 A;  2BUD A;  3LWH A;  3JCM g;  4PJO E;  3M53 A;  1G5V A;  2ZPF B;  5GMK i;  2AHJ B;  2EFI A;  1BIB A;  1VQK T;  4YTL A;  3OYC A;  3SD4 A;  1WQW A;  1YI2 T;  3CEY A;  1K9M U;  4A4H A;  3QJY A;  4ME7 A;  4VUB A;  2E70 A;  1VQN A;  1M4Z A;  2M1H A;  2CGH A;  2MWO A;  3HRS A;  3I56 A;  1Q82 U;  1KD1 U;  5GAO p;  2YLB A;  4IUR A;  1VQ8 A;  5LJ5 h;  3JCM f;  3L2U A;  1WJR A;  4Y28 E;  2M16 A;  4J83 A;  2VC8 A;  4JJN K;  2XDD A;  3RKW A;  3G7Z A;  4XAX B;  4EMG A;  3QG1 A;  1FWZ A;  5GAN 6;  3VYG A;  4DOW A;  2PU9 B;  3HL8 A;  5FLX E;  4E7I A;  2DXB A;  1ZHI A;  3OYF A;  2XDB A;  3L42 A;  3LLR A;  4N4I A;  1VQP A;  2RJD A;  2DD4 A;  1VUB A;  1YBY A;  1UB4 A;  2FL7 A;  1I8F A;  1YCY A;  2VXF A;  3PFS A;  4M75 F;  5L8R E;  4BAC A;  1YJN T;  1Q86 U;  4LDY A;  1D3B A;  1VQO A;  2O4X B;  2X4Y A;  3QYG B;  3SDZ A;  5HKC A;  4BDZ A;  3JCM d;  4XQ3 A;  2XIC A;  2JVV A;  3KXT A;  2QI2 A;  2E5Q A;  1NZ9 A;  4TVR A;  2JNG A;  2KDS A;  3FIF A;  4J6Y A;  5CVI A;  4R55 A;  3OYA A;  2ZPB B;  3KUF A;  3N5B B;  4M7D C;  4JRQ A;  2GFA A;  1GXI E;  2L89 A;  4FSX A;  3J81 E;  3GOX A;  3FDR A;  3VUB A;  4C8Q F;  3ASK A;  1WQ7 A;  2RI3 A;  1WJQ A;  1YJN A;  1KC8 U;  3P8H A;  2EJF A;  4IUT A;  5IN1 A;  5DY9 A;  3CPW S;  4HA8 A;  4PJO A;  4N0A A;  3UDC A;  1VQ7 A;  1JB0 E;  4EMH A;  2CZ0 B;  1BI1 A;  4C0F A;  5CKB A;  4BY6 B;  2GFU A;  2L5Q A;  3M4Y A;  1VQM T;  1RI0 A;  4M75 B;  4L59 A;  3TEE A;  2K5F A;  4XTZ A;  1NPR A;  5GAN 3;  3OS0 A;  2LCL A;  1B34 B;  3LW5 E;  1VQN T;  3E1S A;  3Q1J A;  4C92 G;  3GP8 A;  2M0O A;  1M9S A;  2YHT A;  3CBO A;  4KBM B;  4BDY A;  5CKE A;  3CCJ A;  2DTH A;  1UGQ B;  2OTL T;  1VQ8 T;  3FLG A;  2KSS A;  1K73 U;  2B8A A;  3QYH B;  3SWN C;  4BE0 A;  4UC4 A;  2K4Y A;  4C92 C;  2LT1 A;  2VXE A;  4OVA A;  3JCM h;  2X4X A;  2XD0 A;  4KUD K;  2HNI A;  2NLU A;  4XU2 A;  2KVQ G;  2YRV A;  1Y7X A;  1Q7Y U;  2DEQ A;  3JB9 I;  3QDR B;  1KC8 C;  3J7A F;  4M77 F;  4Y91 A;  4BY6 C;  1VQP T;  4FL6 A;  1H3Z A;  3QHS A;  1HK9 A;  2JTM A;  2L3R A;  3V7C A;  3CPF A;  3PT9 A;  4FT2 A;  1QP3 A;  4O5V A;  2PUK B;  3G4S A;  1QVG A;  4V2S A;  4F7U E;  3OY9 A;  3CC7 A;  2QTX A;  2Y90 A;  3A8L B;  4OGC A;  3OW2 A;  1Y96 A;  3HRT A;  4QVD A;  4M75 A;  5I21 A;  4XTU A;  1M90 C;  4MZM A;  1IZ6 A;  2K2V A;  3P8B B;  3JCM e;  3H6Z A;  1YJ9 T;  1YIT A;  4M7D G;  2EQJ A;  5FRO A;  5A0D A;  1PSE A;  2E65 A;  2DVE A;  2XK0 A;  1JRI A;  2JZ2 A;  4E47 A;  1FXX A;  4II1 A;  1WGS A;  4PJO C;  2DXT A;  1U8R A;  2CZ7 B;  2RI2 A;  2RHX A;  2E12 A;  4LDV A;  5LJ3 f;  3C12 A;  3AHU A;  1VQ9 T;  4QW2 A;  5HK0 A;  2ZCF B;  4B9X A;  5IAY A;  4NS5 A;  3HSB A;  1NJI U;  2LRQ A;  4NL2 A;  3OS5 A;  2DJZ A;  4BI4 A;  3C95 A;  5GAN 2;  2BKD N;  4C0Z A;  4L6V 5;  4M77 B;  3EFR A;  3RIR A;  2MF2 A;  3X24 B;  1Q7Y C;  2WSE E;  3CC4 A;  3OYK A;  2XDP A;  2RHZ A;  3OBW A;  4C0D B;  3CCM A;  3QKJ A;  1BYM A;  3OYE A;  4IUV A;  1VQ4 T;  5DM7 R;  2ZPG B;  4M75 D;  2LDM A;  3BW1 A;  4XTY A;  2O01 E;  3J80 E;  1VQK A;  1WJS A;  2K5I A;  3CCL T;  4M75 C;  1G3Y A;  4JRI A;  1B34 A;  2E10 A;  3M59 A;  1N9R A;  2OAU A;  2Y4X A;  3OYY A;  3OMG A;  4JUV A;  2HQE A;  4FM4 B;  2ZZD A;  4LDW A;  4PJO B;  1I5L A;  2JUF A;  4C0G A;  2DD5 A;  3E9F A;  1YIJ A;  1RL2 A;  3OQ5 A;  5D6X A;  3X26 B;  4M7A F;  2WAC A;  2MWP A;  1LNX A;  4MDW A;  4R56 A;  4BE1 A;  4LD9 K;  4JLI A;  4A4K A;  3VYH B;  4C92 F;  1UEB A;  3G71 A;  2RHY A;  4EMK A;  5GAO m;  4JS4 A;  1UGP B;  2DZC A;  2DTO A;  4LDU A;  1X01 A;  3CC7 T;  5LJ3 h;  2RK1 A;  2K57 A;  4GY5 A;  5IT9 E;  4M75 G;  2E6Z A;  2HD0 A;  1N8R C;  4WF2 A;  1V29 B;  1AHJ B;  4C0D C;  1BI3 A;  5A2Q E;  4X9C A;  3VJP A;  1XTD A;  4PJO F;  4ZGJ B;  3OA6 A;  4BE2 A;  1QVF S;  1BI0 A;  2K3Y A;  2JN0 A;  3CD6 T;  2CKK A;  4EMK B;  2XKO C;  2PUO B;  3C4S A;  2X35 A;  3CCU A;  2PVG B;  5GAN h;  4IKF A;  4GLK A;  5DLO A;  4JRP A;  3OYD A;  3OW2 S;  1LOJ A;  1KHI A;  5J39 A;  2HQX A;  2FVU A;  3CCS A;  1R8O B;  3RKY A;  4HCC A;  2QQB A;  3PIO A;  2RK2 A;  1IRE B;  2P0P A;  5CKD A;  1OYX A;  4CRI A;  3PTA A;  3OYI A;  1VQ6 A;  2DZ9 A;  2MI6 A;  2KMT A;  3NTK A;  3CCU T;  5D6W A;  3RUX A;  3URG A;  1U1T A;  2IVW A;  3JRZ A;  5GAN d;  3S3N A;  3S3O A;  1O75 A;  4C8Q E;  3LGL A;  2F5K A;  3CCQ T;  5A0G A;  4M77 D;  4LDX A;  3HPW A;  4M77 E;  4C5E A;  1N8R U;  5LJ3 d;  4QVZ A;  2QQA A;  1TH7 A;  4BI3 A;  4LD6 A;  4PL6 A;  5GMK m;  2D6F A;  3LYI A;  1U1S A;  4RG2 A;  2RM4 A;  2K3X A;  4XTX A;  2A3L A;  4M7A C;  2O4X A;  3MEW A;  3DLL A;  3S6W A;  4EMK C;  3CMA T;  4FIB A;  1K9M C;  1HXD A;  1G3W A;  2QEX T;  2RH2 A;  2FHD A;  4DOV A;  1VQM A;  4RKU E;  2E41 A;  3OYL A;  3CCQ A;  1M90 U;  3O8V A;  4IUU A;  5FU7 B;  3G71 T;  4C5I A;  3A8O B;  2DIQ A;  4PJO D;  4M7A A;  5GMK l;  3PGG A;  3MHX A;  5GMK h;  2YLC A;  5I2S A;  1G3S A;  3CC2 T;  4FU6 A;  5J3B A;  3DLM A;  3P8D A;  2PVO B;  4M7D E;  3NTH A;  5CKF A;  2C06 A;  5D6Y A;  2EQM A;  4M78 F;  1WNL A;  4O6J A;  3JCM V;  3DKM A;  3CCV T;  5FU6 C;  3FEO A;  3MEU A;  3M56 A;  5GAN g;  3CCR A;  4NL3 A;  2HAX A;  2LVM A;  2JTF A;  2DK3 A;  5CR2 A;  4RMO A;  2LX9 A;  3PIP A;  2K5L A;  3OBY A;  5M9O A;  3V7R A;  3OYM A;  2VGN A;  3QPH A;  3JCM J;  1DJ7 B;  4EPC A;  5GAO r;  2V8J A;  4M78 C;  3NFC A;  2JOY A;  2RB6 A;  3JB9 D;  3CCL A;  2VGM A;  3JCM Q;  3VUZ A;  3EAE A;  5CCA A;  3L2W A;  1NPP A;  2GCX A;  2V8K A;  4KT0 E;  4E7J A;  1NJI C;  1VQ6 T;  4M75 E;  1W4S A;  4ELY C;  1BIA A;  2OTJ T;  1KQ1 A;  3A8H B;  2ZGW A;  4MZT A;  1Q81 C;  2XG8 D;  5FU7 C;  4D6W A;  3E9G A;  4MDX A;  4JRK A;  3MET A;  4MZP A;  3TCJ A;  3JCM X;  2DPP B;  2EJG A;  5GAO q;  1VQO T;  3MP6 A;  4QQD A;  4MMK A;  2DKG A;  3MP8 A;  3HFN A;  1VQ5 T;  4C92 E;  3QBY A;  4RCC A;  4RG8 A;  4M7D D;  3GNG A;  1YHQ A;  3TRE A;  5GAN 8;  2EAY A;  2FYK A;  2VYT A;  5GAM e;  2F5T X;  1YIJ T;  2OTJ A;  2DAQ A;  4PLI A;  1EIF A;  3V8J A;  4C92 A;  5A0L A;  4P5N A;  5GAN 7;  4EDU A;  3JB9 H;  4BI8 B;  3LGF A;  1OZ3 A;  3JCM b;  3L2Z A;  3L2V A;  1G3T A;  3HRU A;  1YJW A;  1Y07 A;  1K73 C;  4OB2 B;  4XTV A;  4A4F A;  4E7K A;  3SWN A;  3QXE B;  3CCM T;  1QVF A;  3HHT B;  5LJ3 g;  3OS2 A;  4XU0 A;  4QQG A;  1W2B S;  5C6S A;  3M58 A;  5CKH A;  2EQK A;  4ZN3 A;  4FT4 A;  1KQS A;  1VIF A;  1Y71 A;  3CCR T;  3INZ A;  3ZBD A;  4J6X A;  1H64 1;  5KCO A;  3CXC S;  1MHN A;  3DB3 A;  4HCZ A;  3X25 B;  3SWN B;  4M78 A;  4PNO A;  5KCH A;  1JJ2 A;  4HT8 A;  5CAI A;  4DQ2 A;  1P92 A;  1QVP A;  5CO7 A;  3CD6 A;  3JCM W;  3L2Q A;  2E1H A;  4E7L A;  1XOV A;  1ZBX A;  3MP1 A;  1I81 A;  4N0A C;  1QW1 A;  4C8Q D;  5GAN f;  1X75 C;  2R57 A;  3OYN A;  2LTO A;  1XNI A;  3A8G B;  3ER0 A;  3F70 A;  4M7A E;  1M5Q 1;  4IUQ A;  1M8V A;  2DXU A;  3CBP A;  2XI9 A;  3LX7 A;  4N4H A;  4BD3 A;  3LH0 A;  4F7U G;  1I4K 1;  3G6E T;  5GAN 5;  3FRN A;  2GQV A;  1VQ7 T;  4QQ6 A;  2A7Y A;  3G4S T;  4PLL A;  3QSU A;  1FX7 A;  3BFM A;  2R5M A;  1Y96 B;  2LQK A;  3QII A;  3JCM c;  3RKX A;  2QQS A;  4C8Q G;  5LJ5 e;  3QZ5 B;  1YHQ T;  3JB9 J;  2XHC A;  2CZ6 B;  3M54 A;  2OTL A;  1YJ9 A;  4QVC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...