4C0FA

Structure of the not-box domain of human cnot2
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
96
structure length
96
Chain Sequence
AIKLGRYGEDLLFYLYYMNGGDVLQLLAAVELFNRDWRYHKEERVWITRAPGMEPTMKTNTYERGTYYFFDCLNWRKVAKEFHLEYDKLEERPHLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords CCR4-NOT TRANSCRIPTION COMPLEX SUBUNIT 2
publication title Structure and Assembly of the not Module of the Human Ccr4-not Complex
pubmed doi rcsb
source organism Homo sapiens
molecule tags Gene regulation
total genus 19
structure length 96
sequence length 96
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-08-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.1020 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4c0fA00
4C0DC 4BY6B 4C0DB 5FU6C 4BY6C 4C0GA 5FU6B 5FU7B 5FU7C 4C0FA
chains in the Genus database with same CATH superfamily
2ZAEA 1T0JA 3I5SA 2QDLA 4C0FA 3CCMA 8ATCB 3OYFA 1VQLT 5EC7A 3SDZA 2CP7A 1YI2A 4LUDA 5IT9E 4M7DF 5CKBA 1IGQA 4M7AE 4IIMA 1VQ9A 4JPBW 2RM4A 3HRUA 1KG1A 2FB7A 1R0BG 4E47A 1VQPQ 3PIPA 2DVJA 1JEGA 2L2PA 3VS4A 2AHJB 2CZ0B 3EHRA 3MJXA 1K73C 3QZ5B 5GAN7 2BE9B 1AZGB 3JAME 4Y92A 3ZEHA 3OYNA 1TTHB 3GP8A 3R6NA 1D0ZA 1MMAA 2AT1B 4QT7A 5D6XA 1U1SA 2OTJQ 2AK5A 2E6ZA 3I56T 1ABQA 2CSIA 3UT1A 1FWZA 4RTZA 3JCMc 1WXUA 2DERA 1JO8A 3A8HB 2HEQA 3CD6T 2B86A 1U3OA 2A36A 4HKEA 3QXEB 1NYGA 1R8OB 2EPDA 1G3YA 3CXCS 2PVDB 2EIFA 2D0NA 3L2RA 1E6GA 1Q7YR 5GANe 2QK0A 1ZUUA 2OAWA 5D7UA 4ELYC 1WHHA 2DXCA 2PQWA 2CKKA 4DBQA 2QA4A 5DLOA 1Q86U 3CPWP 2JTMA 2L3QA 4DEYA 1R77A 3QZ9B 1KD1U 2OX7A 3M58A 1VQ4A 2FZGB 3P8HA 1WA7A 1BCMA 3JCMQ 2LCCA 3F70A 2L0AA 4B9WA 1KJWA 3V8KA 2X3XD 2GTOA 2ZCFB 1C0MA 4KGZB 5FWBA 5CR2A 2X35A 5LJ3d 4RUGA 4QQDA 4PJOA 1M90U 1Y96B 1VYVA 1AD5A 4LN2A 3E9FA 1I4K1 3QJYA 3S6WA 2RNAA 1FMWA 4C92A 4JLIA 4NS5A 3CPWS 2XHCA 4IUUA 1YJWA 1BU1A 4EMKC 2M0YA 2CZ7B 1ZSZA 1LOJA 2KSSA 3S3MA 1VQ8Q 1UJ0A 4KH1B 4J6XA 2YUQA 1TOVA 4MDWA 1Q86C 4J9IA 2GFUA 4F7UA 1HJDA 5LJ3j 3SD4A 3TQ7P 2EYXA 2K3YA 2RA2A 3FEOA 5HCKA 5GMKi 2HQXA 1AWWA 3O5ZA 2XD0A 4J9BA 1ZA2B 2FEIA 2L3SA 4OB0B 1UTIA 3NHNA 1BK2A 1KQ2A 2VWFA 5IXBA 3JCMf 2JS0A 3C95A 2KGTA 1D0YA 5I22A 2CP5A 3GBQA 4C8QE 2GQIA 5FRMA 1VQ5A 3ULRB 3UA7A 2ATCB 3QJ6A 2J05A 1YIJA 5KYYB 1WYXA 4M7DA 1TXQA 2QGGA 3CC4Q 3L2ZA 3L42A 3RDVA 2VYTA 2EYQA 3EGDA 3OW2P 4LUEA 1WDXA 5GMKe 4IUPA 2SEMA 1ZA1B 4BDZA 2DXUA 1LCKA 1BIAA 4P5NA 4BY6B 3CCUT 1S1NA 3VS6A 2B8AA 3SWNB 2J06A 2KRNA 2FHDA 2AZVA 4CC2A 3VRYA 1VQKQ 3BDUA 3CMEQ 1NG2A 4Z89A 4HT8A 1ZX6A 4C5IA 3X24B 3RKWA 3OW2S 2QEXQ 1OZ2A 2MIOA 4M75B 2O01E 5LJ5d 3JCMV 2BUDA 3HFNA 2OI3A 3C12A 3S3NA 2X51A 4OB2B 1VYTA 1XTDA 3M55A 3M0PA 2RH2A 2CUBA 3J80E 3EG0A 2XKOC 1W2BA 3L2WA 1G3SA 5AYFA 3LWIA 2MI6A 2KXCA 1HSQA 3PIOA 2HL3A 2RJDA 1OQKA 3FC3A 2IVWA 1TS9A 1XNIA 2E3HA 1YCSB 5KYWB 4M75D 5AT1B 2DM1A 3A8MB 2QDYB 1UGSB 1YWPA 5FLXE 5LJ5j 3G71Q 1RUWA 1B07A 1QCNA 2E5KA 2YRCA 3M54A 1WJRA 4KBMB 2KYBA 1H92A 4E6RA 1TSFA 2DK3A 4ZTFA 2YUPA 1KQSP 4ZGEB 1TUDA 2DRKA 2OTLQ 2RQWA 2JNGA 1WXBA 2X4YA 1NEGA 4M78A 3CCJQ 1I8FA 3NMZC 4M75G 4XU1A 4E2FB 5LJ3h 3A1PA 1M1FA 1IHVA 5GAN4 1SEMA 1WQWA 1OULA 3CCRA 3NTKA 3ASKA 1M9SA 2EAYA 5I2MA 1Z9QA 3FB9A 1MNDA 4XAXB 1K8AU 2XG8D 3OYJA 4GLKA 3CCVA 2JUFA 1KC8R 2XICA 1Q81U 2K7AA 2NLUA 1Q82C 2QGFB 4FU6A 4WCIA 2D0QB 1KQSS 2EQIA 1IGUA 3HKSA 3HPWA 2FRYA 4DA4A 1TU0B 5I11A 4PJOB 2DX1A 2KNBB 4HCZA 1NBEB 1F1BB 2A37A 1Q95G 3AT1B 2P4RA 4C92B 4PFOA 1GCQA 4CC4B 1M1GA 3MP1A 3GNGA 3E9GA 5KYXA 3PT9A 1ZSZB 2KAFA 2DA9A 2VKNA 2H3JA 1V29B 5GAMf 3CCMQ 2BKDN 5IHKA 1YI2Q 4LDVA 4FCYA 2O88A 4J6YA 4PJOD 2QQBA 1VQ9Q 1K8AC 5D6WA 4OP0A 2DETA 3G6EA 4C92D 2RQTA 1PNJA 1QKWA 3OYGA 1Q81C 2BZXA 3TREA 1WHLA 1UDLA 2MF2A 1D09B 1AHJB 2AKLA 2COWA 3OYYA 4XTVA 3CBPA 1A0NB 4DOVA 2ED1A 2CT4A 2KRMA 2Y4XA 4M75F 4CC3A 3X25B 3H8ZA 4PJOG 3CPFA 4BD3A 1IXDA 1WI7A 5HY6A 3RKXA 5IAYA 1VQ6A 2OTJT 2CP2A 3CCST 4M7DB 4XTWA 1QVPA 3QBYA 2DTOA 2RK2A 1WHKA 4C92G 2RI5A 3OYEA 3EGDB 5GJWB 1D1BA 2ZPGB 3JB9D 2CGHA 2X9HA 2EW3A 4N4IA 3JB9I 2O31A 1VA7A 2MWOA 1KHIA 4ME7A 3SWNC 1OZ3A 5DLQE 4FYVB 2KBTA 5LJ5h 5ECAA 4CI0C 2AKKA 1VQLA 1R0CB 4M7DD 4K11A 3VKIA 3CPWA 3DLMA 4JZ4A 2QA4Q 2DJZA 2PVGB 2L5QA 2DJQA 1N8RR 3JB9G 1X2KA 2L3PA 1ACMB 1VQ4Q 2F1LA 3EG1A 2DIQA 2DTHA 3EH2A 3NTHA 4F16A 1O75A 3Q1JA 2DRMA 2XDPA 3OBWA 3M0SA 3REAB 2RMOA 4M7DG 3CC7T 2K5IA 4RTTA 2GNCA 2F5TX 2YUOA 1OU9A 1WJSA 2X4WA 3I56A 1M1KR 5D6YA 4O6JA 3OSVA 5LJ3f 5M9OA 3S3OA 2MOXA 4XU0A 1SSFA 1WXTA 1X69A 3CD6A 3IQLA 1EIFA 3OS5A 4C8QF 4HVUA 4RG2A 4C0GA 1MHNA 4O5VA 3OS1A 4EIKA 3A98A 2C06A 3OBYA 4X1VA 2QYZA 1JRIA 4IUQA 3TSZA 4PFZA 1IHWA 1K1ZA 4M7AA 1PRLC 1W1FA 1IB8A 2A3LA 4C92F 4MZMA 2SRCA 2DD5A 2EKOA 1NEBA 3QPHA 5FU7B 1YJNT 4M78B 3UDCA 1WHJA 3PFSA 5KYYA 3VS7A 4DBRA 2JZ2A 2KQWA 2R5MA 2V1QA 4JS4A 1N9SA 3M4GA 2DD4A 1VQ5Q 4JRKA 3JCMg 4KGVB 2E1HA 1YIJQ 3VS0A 2HBPA 3LGFA 2LJ3A 5HKCA 3CC4T 1RAHB 3OW2A 1YFNA 1PHTA 1PSEA 1T0HA 4FYYB 3META 1VIEA 5L8RE 2P84A 4M78D 4R55A 2DXBA 2D8JA 4J83A 2H8HA 2ROTA 3M59A 1EZZB 3RR6A 4PJOC 3VS5A 1JJ2P 2K5FA 4QW2A 1B34B 2K6DA 2LDMA 1P92A 3URGA 2ABLA 1WIEA 5CAIA 4C92C 3TCJA 2FRWA 4EMHA 2YUNA 1Y71A 2KDSA 3I55T 4JJDA 2YLBA 1YN8A 4VUBA 3HTRA 4M75A 2LC4A 5KYXB 2EJ9A 3JCMJ 3MPUB 1ZSZC 3JV3A 5IN1A 1MNEA 3UF4A 4M78G 5GAMj 1N27A 2X4XA 3CCQT 1VQMT 3MEUA 4M77E 1YBYA 3M53A 5CKHA 1JJ2S 3OS2A 1HK9A 3PNWC 1Y7XA 2JMAA 3VS2A 1VUBA 2HBWA 1X27A 1XQHA 1Q7YC 5KYWA 1C6VX 3UPUA 1K4US 2K3XA 3FJPA 4N4HA 4ORZA 5LJ5f 3MCAB 2R57A 4RCBA 1WQ7A 1X43A 4QKUA 3M5AA 5J3BA 3BW1A 3HRTA 1QKXA 3M0TA 2CH4W 4QQ6A 2ZPHB 1WNLA 2EGAA 4M7DC 2KT8A 6AT1B 3HP9A 1YWOA 1FX7A 5CKDA 3CCUA 4L6V5 2DIGA 3OYBA 4A4FA 2DNUA 1N9RA 2RPNA 4OVAA 2E5QA 2RHIA 4RTYA 1KK7A 1YITT 1KQSA 2HZYA 1K9MR 4IIOA 1IZ6A 5CCAA 4JDSA 1UJYA 5GMKh 3G7ZA 1K73R 4F17A 5KYUA 1N6AA 1AWOA 4TVRA 2BTTA 1QP2A 2KY9A 1WGSA 1I07A 4QQGA 7AT1B 2HD0A 4FW1A 2YLCA 2ZPBB 4PJLA 1ZBXA 4BI8B 2EJFA 1SKUB 4X9CA 1RABB 2FZKB 4FM4B 1KIKA 2K4YA 4AFZC 4C8QA 3CCRQ 3RIRA 2IG0A 1RAEB 5LL6S 1Y57A 3ZFJA 2EGCA 1I1JA 5L23A 3CCVQ 3LH5A 1QQJA 2CH4A 1UGPB 4F04B 1QCOA 1WLPB 4M78F 1I81A 2DVEA 1G83A 3FRNA 3CCET 4YTLA 3WVEB 1AVZC 4OGCA 1YJ9T 4FYXB 2LCLA 3X28B 2VVKA 4ESRA 5A0GA 2C0OA 2Z0WA 1GCPA 2RQUA 2VXEA 2CREA 1VQOT 2KXDA 1JXOA 2OAUA 3KXTA 1NLPC 1J3TA 2P0PA 2Y4YA 4E7JA 2MK5A 3JCMb 2RI3A 1ZUKA 1OV3A 2HKQB 2L89A 1VQ7T 2WSCE 4ZGDB 3CMAT 4M7AB 4II1A 4OF1A 2F5KA 5GAMg 4AMCA 3G6EQ 2L8DA 3U23A 3G4ST 4M78C 2XIDA 3TEEA 4B6MA 2E10A 1MMNA 3JRZA 5GAMh 2XDDA 3OYDA 2VV5A 4XK8E 1ABOA 3LW5E 5GAN6 1OEBA 3RUXA 2RD1A 1UGRB 2R58A 2PUKB 2HCKA 1IREB 1KD1R 2O4XB 1YP5A 2KK4A 2JTEA 4C5HA 4M7AD 3PTAA 1QMCA 2NUZA 1VQ6Q 5KE2A 1X6GA 2DFUA 3P8DA 3PGGA 2YT6A 2LQWA 4BE0A 1ZSGA 1BI2A 2EKHA 1JQQA 2HAXA 5CO7A 1D3BA 5CQYA 1UB4A 1QWFA 3H0FA 2VB6A 2RHYA 4OMLA 1M4ZA 2IPOB 3UATA 1M90R 1CSKA 4JJCA 1BCOA 1AEYA 2RHXA 1GCQC 1ZQ1A 1VQLQ 2AZSA 3CBOA 1UEBA 4M7AG 4F7UE 2DL3A 3CCLT 2RQVA 5KYNA 3H41A 1GFDA 1KC8U 4PL6A 4Z88A 2LRQA 2D8HA 1SRLA 4PLIA 1WPYA 2YDLA 5CVIA 1M5Q1 1TUGB 2QQ9A 3CC2T 1VQNT 2LX9A 4DBHA 4JLGA 5GAN2 2EBPA 1UUEA 3CQTA 3EFOA 5HK3A 2GCXA 2PTKA 1E6HA 2ED0A 2JOYA 2EYWA 2M0OA 1SPKA 1C1AA 1NM7A 1OPLA 4OGEA 1D1CA 3JCMW 1TG0A 2GBQA 2YRVA 1Q82U 3BFMA 3CCSA 3I56Q 5FW9A 1OOTA 4BE2A 2ZPIB 3UA6A 2OJ2A 2MAMA 3HRSA 1KFZA 2DL4A 2EVRA 3EFRA 3INZA 1AT1B 3X26B 2LNHB 3CD6Q 2X4JA 5GAOn 1H641 3PE0A 4RTUA 3OYKA 1UGQB 3V7SA 5LJ3g 2HQHA 1KC8C 3I9QA 4RKUE 2DILA 4PK4A 3NGPA 4AG2C 5GAN5 2NUPB 1ZLMA 2EFIA 3DB4A 2MMPA 1NPRA 1NJIR 1K9AA 3I35A 5KYUB 2EQJA 3OS0A 3KBGA 3AHUA 4NOYA 3KFVA 1YHQT 1LVKA 1E7OA 1GFCA 3M0UA 2KR3A 4BB7A 2CYZB 2EQUA 4A4GA 5IHIA 4WF2A 4LDWA 4C8QB 1TH7A 4M7AF 1S72T 5GAN8 5GANd 1B34A 2KYMA 2O2OA 3PMTA 3CC7A 3VUBA 2FO0A 4PKCC 5GJVB 1IRXA 2JVVA 5FWCA 3RNJA 2ECZA 1JJ2A 1I5LA 1EX4A 1O9SA 4C8QD 4N0AA 2EWNA 4JUVA 4HCKA 3OYCA 2J6FA 1M30A 2XU8A 4J9DA 2L3RA 4ELZC 5GANj 4PLLA 1ZUYA 1UHFA 3QYHB 3VYGA 2D6FA 3HFOA 2ZZDA 3A8GB 2JMCA 1VIFA 4A4EA 1VQPT 2XMFA 2QG9B 3QIIA 1YJNA 2CT3A 2LMJA 3EFSA 4M7AC 3PVQA 4V2SA 4PNOA 3MEWA 2BZ8A 4C8QG 3A5ZB 1Y0MA 1M1KU 4IUVA 2LNVA 2P0KA 2VC8A 3E19A 3MP8A 2W0ZA 4JJBA 4Y28E 4DOWA 4KUIA 3I5RA 4C0DB 3ZBDA 1SG5A 3C0CA 3QDRB 3OMGA 2DL5A 1KQ1A 3QWXX 4EMGA 5LJ5g 3PVLA 1LPLA 4BY6C 4Z02A 1HXDA 1K8AR 2QASA 1G2BA 3CCUQ 4ANJA 4CC7A 2YWWA 3SEMA 1QW1A 4DEXA 3GLXA 1D3BB 3JB9J 1AZEA 3RKYA 3I55A 4L59A 2RF0A 4NL3A 4PJMA 1BI3A 5GAN3 2R5AA 3FJ5A 4RTVA 2DPPB 3THKA 1M1KC 3C94A 2YSQA 2P0QA 3CCQA 4M75C 4XU2A 1VQMA 1UG1A 5CKFA 4J8OA 2QAZA 5GAOq 5EG2A 2RO0A 2JJ9A 4E7ZA 3QYGB 2RB6A 2HDAA 3CCRT 3M0RA 3M4YA 1GBQA 1KHCA 1NE8A 4OMQA 2KROA 3EFOB 2EYZA 1WZOA 3QHSA 1OX9A 3HSBA 2M02A 2EYYA 3WXMB 2GGRA 2C0IA 1YJWQ 3MP6A 5GMKj 1PKTA 1X75C 2QTXA 4UC4A 1VQ8T 4EMKB 5KH6A 3DLLA 4J9CA 3OYMA 1K0XA 2X3WD 2DEQA 2PZ1A 2BZYA 2F69A 2F2VA 2XI9A 1RADB 1YITA 1PSFA 4OMNA 4LDUA 5IHNA 1WFWA 3OYIA 4E7SA 2QXFA 1T3LA 2D1XA 3EHQA 3EG3A 4J7IA 2MCNA 4M77A 4MZTA 5GANh 2E4HA 2V8JA 1D1AA 1AWXA 2RN8A 4HA8A 2DAQA 3JCMP 4NL2A 2E64A 2O4XA 1ARKA 4F14A 1X2QA 1MMDA 1I0CA 1FMKA 1H8KA 3GPLA 2G6FX 1ZBJA 1RLQC 2NWMA 2V1RA 4C8QC 2JT4A 1Q7YU 3NPFA 4MZPA 2PNIA 4XTZA 4A63B 3CCEA 1YJ9A 3V7CA 2H3EB 1K9MU 2ZGWA 3OSSC 3L2UA 2LQKA 2K2VA 3BE3A 4BI3A 1VQKT 1PG5B 1BB9A 2RQRA 2E12A 4E7KA 2IIMA 3CMET 2DF6A 1VQOA 3MEVA 2AIRB 1RAGB 4QVDA 1MGQA 1TWBA 4MMKA 3DKMA 1U06A 2FVUA 1PWTA 2WSFE 3LLRA 1YCYA 1IO6A 2QEXT 5J39A 3H9NA 1VQ7A 2J6KA 2JW4A 3CMAA 2LT4A 5GAOp 5FU6B 1AOJA 4WTOB 1K0SA 3VUZA 3G4SA 1OPKA 1GBRA 2E70A 1OYXA 3CXCP 1BKBA 4LDXA 4A4HA 1SHGA 4X9DA 2J6OA 1K9MC 2KRSA 1PD0A 2ZPFB 1UE9A 2BE7D 2RI2A 2E3IA 4N4GA 2YHTA 2RK1A 1PKSA 3NFCA 4JRPA 3G71T 4C0DC 3CCSQ 1QCFA 4D8DA 1KSWA 1MMGA 4FYWB 1W6XA 2GF7A 2NUPA 4GBQA 2CP0A 5GMKm 2P4TA 2OTLT 3JSCA 1UHCA 1OU8A 3LYIA 1M2VA 1GRIA 3CCJT 2QTVA 2JM9A 3A8OB 1QVFA 4HCBA 2O9VA 3VS3A 2RHUA 4M75E 4OB3B 2XDBA 3REBB 3CCLA 4JRIA 1MUZA 4IKFA 4KRTA 3G1JA 3CC2A 4AFQC 3L1AA 1VQNA 1FYNA 1W70A 3BDLA 4R0KA 3JCMe 4LD6A 3QO3A 3QG1A 4JZ3A 3L2QA 3EGXB 2ROLA 3OYAA 1XJWB 1V76A 2LJ1A 2CP3A 3TVTA 4J6WA 1U1TA 2DZ9A 2Y90A 2HL5C 2DL8A 3LWHA 1NPPA 3JB9H 2CS7A 4JJNK 3CC7Q 1U8RA 4BDYA 3MEAA 1D0XA 3LX7A 3OMCA 5GANf 2F2WA 2DZCA 2A08A 2LX7A 2DBKA 3NTIA 4IURA 1JB0E 2HSEB 1NLOC 3TSWA 2E41A 4RTXA 3SHWA 4AFSC 2M9UA 3SFMA 1NYFA 4X34A 4EDUA 2YXYA 4J9FA 3CCMT 2E65A 4FSXA 5J26A 1VYUA 1YI2T 2KVQG 8AT1B 3RMQA 1M3BA 2JS2A 3E2UA 1VQ9T 1KD1C 2K2MA 2HQEA 3OYLA 3RESA 4RMOA 4E7HA 5FU7C 2A0FB 1QVGP 1JXMA 5IH2A 1BIBA 2CDTA 4ZN1A 5GAOm 2EJGA 1YJNQ 3OQ5A 2M16A 4M77B 5DY9A 3VYHB 1YHQA 2DYBA 4XTYA 1K76A 3M56A 1UGVA 4LD9K 4Q5WA 3OA6A 1Q86R 1BI1A 1FXXA 2FG0A 2JN0A 1M90C 4BUGA 4OMMA 3P8BB 1CKAA 2JXBA 3PMIA 3ME9A 3MHXA 3C4SA 1PM3A 1S72A 9ATCB 4GY5A 4PJOE 3DB3A 4C5GA 2EGEA 1AWJA 2DEUA 1PRMC 4PFPA 2HSPA 4C92E 2RJEA 4FL6A 5KCHA 1NZ9A 3T9NA 4M77D 3V7RA 4D8KA 1Y07A 1QVGS 2DE0X 1EFNA 2K9GA 1RACB 1NJIU 2HNIA 2JTFA 2M51A 3L2VA 4CRIA 4BE1A 3UWNA 2LTOA 2VGMA 1FMVA 3J81E 5DM7R 4KULA 5A0LA 2A7YA 2VXFA 4B9XA 3I55Q 3MKDA 4OMPA 3LGLA 3VU3C 2QA4T 2FPDA 4N0AC 4XTUA 2KI7A 2LQNA 1VQPA 4M77G 1VQ4T 1RI9A 1SRMA 3CCQQ 4ZTJA 1RL2A 2DKGA 2NUTA 1DJ7B 1VQMQ 2YRDA 2K5LA 1UFFA 1WHMA 2D9TA 5FU6C 4J9HA 3M0QA 3RBBB 4BI4A 2CP6A 1GL5A 1GXIE 5C0MA 3MO8A 1SF9A 2MWPA 4AFUC 4OMFB 2FPFA 2LJ0A 2CSQA 4EMKA 4M7DE 2OTJA 1MV0B 2V26A 2W10A 2DTIA 3WVDB 1NJIC 2KEAA 3EG9A 3QWYA 1Z9ZA 4EPCA 1T3SA 1M2OA 2VASA 3E1SA 1YJWT 2G3RA 2QQRA 3V8LA 2COZA 3QUIA 1B3QA 5FROA 1RI0A 1VOMA 2CZ1B 3VRZA 4QVCA 2GQVA 1QP3A 2WSEE 4QVZA 4E7LA 3FLGA 3RMSA 1YITQ 1BBZA 2COYA 2XK0A 1QVFP 1I5OB 2F2XA 3EAEA 5GAOr 4C5EA 2DYIA 5GAMe 1M2VB 2V8IA 2K79A 3X20B 4R56A 4XU3A 3H0HA 1X01A 1WJQA 2VGNA 4LE9A 2M1HA 4DBFA 1VQ5T 2LP5A 1X6BA 1X6OA 4PJJA 4XTXA 1G8XA 4PJNA 2QQSA 1YIJT 1M3CA 2LVMA 3H6ZA 2FPEA 1LNXA 1JU5C 1HD3A 1WHGA 3ER0A 4OMOA 3EG2A 1QVFS 2PU9B 4M77F 4FT2A 1M3AA 2FYKA 3CCEQ 2BIVA 1YJ9Q 4ZGJB 4M4ZA 3ZL7C 3EGUA 5I21A 1B7TA 1VQ8A 3EH1A 1RLPC 1N8RU 2I0NA 3V8JA 5A2QE 1G5VA 3R6OA 1QLYA 2FZCB 3QDFA 2EQMA 4C0ZA 1VQOQ 4FW2A 1Q82R 3OY9A 3CBMA 4ZN3A 3JCMd 4Z8AA 1XOVA 4L5GA 2WACA 3CEYA 2LT1A 3VS1A 2QI2A 4M78E 5A0DA 4J5YA 2QQAA 3BY7A 4F7UB 1VQ7Q 3OB9A 1OX8A 3HL8A 1RAAB 2C0TA 3CMAQ 1N5ZA 3VJPA 2PUOB 3H0IA 4BACA 5CKEA 5I2SA 4J7FA 5IXFA 3CXCA 4HT9A 4FIBA 3G4SQ 4M77C 1G3TA 4FT4A 1PD1A 4KT0E 1PC0A 3CC4A 4J9EA 4ATOA 1RAFB 1M27C 2E6NA 4OB1B 1N8RC 2HKNA 2O9SA 3GOXA 4JS5A 4E7IA 4HVWA 2RJFA 4RCCA 1LJOA 1U5SA 5C6SA 2DO3A 3FIFA 4AG1C 1Q81R 3RERA 3LH0A 2K57A 2RJCA 3M57A 5LJ3e 1WX6A 1VQKA 2GTJA 1W4SA 1BI0A 2CZ6B 2DXTA 3CMEA 1MV3A 2KT1A 5HK0A 5GMKl 1JBMA 2LQ8A 4A54A 1HYOA 2KE9A 4LDYA 2V8KA 4HXJA 1M8MA 4F7UG 2QEXA 4Y91A 3CCLQ 3TU4K 3M9QA 3EGXA 4LNPA 1CKBA 5KE3A 4XQ3A 4MMLA 4KH0B 1SHFA 4KUDK 3VV0A 4HCCA 3D7SB 1RAIB 3GIBA 2DL7A 3CC2Q 1VQNQ 3CCVT 5CIUA 2DMOA 2NUTB 1Y96A 3KUFA 2LZ6B 1W2BP 3GNFB 1TUCA 5FRNA 4JRQA 1G3WA 4A4KA 4D6WA 1SSHA 1M8VA 2ZPEB 4DQ2A 2KMTA 3GF5A 4FSSA 3G71A 1YNZA 2GFAA 2ENMA 2PVOB 3EG9B 1BYMA 2MPXC 2MYSA 2DBMA 2I2LA 3JCMX 3N5BB 5GANg 5CK9A 1QWEA 4RTWA 2OTLA 3SB2A 3FDRA 1UECA 1W2BS 2K3BA 2EQKA 5CQXA 3CCJA 4PJOF 2JM8A 2FL7A 4A53A 4HVVA 1QVGA 3G6ET 2VUBA 4LXCA 4J9GA 1V1CA 2DLPA 4KGXB 2RHZA 4IUTA 2CUDA 5GAOl 4AT1B 2J7IA 1YHQQ 5KCOA 3O8VA 3QSUA 3OYHA 3QKJA 3J7AF 1ZHIA 4F7UF 2NYSA 2HMAA 2A28A 3HHTB 1S72Q 1VQ6T 1H3HA 4GLMA 5LJ5e 1K73U 2ESWA 4ZNXA 3SWNA 2LCSA 4MDXA 1H3ZA 4RG8A 3JCMh 3JB9F 1PCXA 3A8LB 1OI1A 5GAMd
chains in the Genus database with same CATH topology
3NTIA 2X4JA 1JB0E 4IURA 5GAOn 2MWOA 1H641 3OYKA 1KHIA 2E41A 1UGQB 4ME7A 3SWNC 3V7SA 1OZ3A 2M9UA 3SFMA 4X34A 4C0FA 4EDUA 5LJ3g 3CCMT 1KC8C 5DLQE 2E65A 4FSXA 5J26A 5LJ5h 3CCMA 3OYFA 2KVQG 1YI2T 1VQLT 4RKUE 3SDZA 4CI0C 1YI2A 3RMQA 1VQLA 5IT9E 1VQ9T 5CKBA 4M7DF 4M7DD 5GAN5 1KD1C 3VKIA 4M7AE 1VQ9A 2EFIA 3DB4A 3DLMA 2MMPA 3CPWA 4LD9K 1NPRA 2HQEA 3OYLA 3RESA 2RM4A 3HRUA 4RMOA 4E7HA 1KG1A 2EQJA 5FU7C 2DJZA 3OS0A 2PVGB 3KBGA 2L5QA 3AHUA 2FB7A 1BIBA 4E47A 4ZN1A 3JB9G 5GAOm 2EJGA 4NOYA 3PIPA 3OQ5A 1YHQT 2M16A 4M77B 5DY9A 3VYHB 1YHQA 2DIQA 4XTYA 2DTHA 3NTHA 3M56A 4BB7A 2CYZB 2AHJB 4Q5WA 2EQUA 1O75A 2CZ0B 3OA6A 3Q1JA 1BI1A 4A4GA 1K73C 4WF2A 1FXXA 2JN0A 3QZ5B 4LDWA 4C8QB 5GAN7 4BUGA 1M90C 3P8BB 3JAME 2XDPA 3ZEHA 3OBWA 3OYNA 3PMIA 1TH7A 3ME9A 3GP8A 1S72T 4M7AF 2OTJT 5GAN8 5GANd 3MHXA 3C4SA 1S72A 4M7DG 1B34A 4GY5A 3CC7T 4PJOE 3DB3A 5D6XA 1U1SA 2K5IA 4C5GA 3PMTA 3CC7A 2E6ZA 2F5TX 3I56T 3VUBA 1WJSA 2X4WA 3UT1A 3I56A 5D6YA 1FWZA 4O6JA 3OSVA 4PKCC 5LJ3f 4C92E 2RJEA 2JVVA 4FL6A 5KCHA 3JCMc 5M9OA 1NZ9A 3T9NA 4M77D 3V7RA 1I5LA 3S3OA 1JJ2A 3A8HB 1Y07A 3CD6T 4XU0A 1SSFA 4HKEA 1QVGS 3CD6A 1EIFA 3QXEB 1R8OB 3OS5A 1O9SA 1G3YA 3CXCS 4C8QF 2PVDB 2EIFA 2HNIA 2JTFA 4N0AA 4C8QD 2EWNA 4CRIA 3L2RA 4JUVA 3UWNA 3L2VA 4BE1A 2LTOA 4RG2A 4C0GA 2VGMA 1MHNA 4O5VA 3OYCA 3OS1A 3J81E 2XU8A 2C06A 5GANe 5DM7R 3OBYA 2L3RA 4KULA 4ELZC 1JRIA 5GANj 5A0LA 2A7YA 2VXFA 4B9XA 4ELYC 4IUQA 4PLLA 2DXCA 3LGLA 3QYHB 3VYGA 3VU3C 2QA4T 4M7AA 2PQWA 2CKKA 2D6FA 4N0AC 2QA4A 3HFOA 2ZZDA 3A8GB 4XTUA 2A3LA 5DLOA 4C92F 4MZMA 1Q86U 2DD5A 1VIFA 2JTMA 2EKOA 3QPHA 4A4EA 1VQPT 5FU7B 1YJNT 3QZ9B 1VQPA 1KD1U 3QIIA 4M77G 1VQ4T 4M78B 1YJNA 3UDCA 4ZTJA 3PFSA 3M58A 1VQ4A 3EFSA 1RL2A 2DKGA 4M7AC 1DJ7B 4V2SA 3P8HA 2JZ2A 2K5LA 2KQWA 4PNOA 2R5MA 3MEWA 4JS4A 1N9SA 3M4GA 4C8QG 2D9TA 3A5ZB 2LCCA 3F70A 2DD4A 5FU6C 3JCMQ 4B9WA 1M1KU 4IUVA 3V8KA 2LNVA 4BI4A 2P0KA 2ZCFB 1GXIE 4JRKA 2VC8A 3E19A 3MO8A 5C0MA 2MWPA 3JCMg 2E1HA 4OMFB 3MP8A 5CR2A 2X35A 5LJ3d 2HBPA 4QQDA 3LGFA 4PJOA 4Y28E 4EMKA 5HKCA 3CC4T 1M90U 1Y96B 4M7DE 2OTJA 4DOWA 3E9FA 3OW2A 2DTIA 4KUIA 3WVDB 1PSEA 1I4K1 3QJYA 4C0DB 1NJIC 3S6WA 3ZBDA 3META 1VIEA 5L8RE 4M78D 4C92A 4EPCA 4JLIA 2DXBA 3QDRB 3OMGA 4NS5A 1KQ1A 4J83A 4EMGA 5LJ5g 4R55A 3CPWS 1YJWT 3E1SA 3M59A 2G3RA 2XHCA 4Z02A 4BY6C 4IUUA 4PJOC 1YJWA 1HXDA 2QQRA 3V8LA 2K5FA 4QW2A 3QUIA 5FROA 2CZ7B 4EMKC 1RI0A 1B34B 2CZ1B 2LDMA 1P92A 3URGA 4QVCA 1LOJA 2KSSA 3S3MA 2GQVA 5CAIA 4J6XA 1QP3A 1QW1A 4MDWA 3TCJA 4C92C 4EMHA 1Q86C 3GLXA 1D3BB 1Y71A 2KDSA 3I55T 3JB9J 2WSEE 4QVZA 4E7LA 3RKYA 3FLGA 3I55A 2GFUA 2YLBA 4L59A 4VUBA 4F7UA 3RMSA 5LJ3j 3SD4A 4NL3A 4M75A 2K3YA 2RA2A 3FEOA 5GMKi 2LC4A 2XK0A 2EJ9A 2HQXA 3JCMJ 1BI3A 5IN1A 3EAEA 5GAOr 2XD0A 4C5EA 5GAN3 2R5AA 4OB0B 5GAMe 2DPPB 4M78G 1M1KC 2V8IA 5GAMj 1N27A 2X4XA 3C94A 3CCQT 3X20B 1VQMT 2P0QA 3MEUA 4M75C 1YBYA 4M77E 4R56A 3CCQA 4XU3A 4XU2A 1VQMA 1X01A 3M53A 3JCMf 5CKFA 3C95A 1WJQA 2VGNA 4J8OA 5CKHA 5GAOq 2M1HA 5EG2A 2RO0A 3OS2A 1JJ2S 4C8QE 1HK9A 3PNWC 1Y7XA 3QYGB 1VQ5T 2RB6A 3CCRT 1X6OA 1VQ5A 1VUBA 5FRMA 4XTXA 1XQHA 1Q7YC 2QQSA 3M4YA 1YIJT 3UPUA 2K3XA 3FJPA 2LVMA 3H6ZA 3QJ6A 4N4HA 1YIJA 1KHCA 1NE8A 5LJ5f 1LNXA 3MCAB 4M7DA 2R57A 3ER0A 3L2ZA 4RCBA 3L42A 2VYTA 3QHSA 1QVFS 1WQ7A 2EYQA 2PU9B 3HSBA 4M77F 4FT2A 3M5AA 5J3BA 3WXMB 3BW1A 3HRTA 5GMKe 2FYKA 4IUPA 3MP6A 5GMKj 2BIVA 4QQ6A 2ZPHB 4ZGJB 2DXUA 1WNLA 1BIAA 4BDZA 4M7DC 4P5NA 1X75C 3HP9A 4BY6B 5I21A 2QTXA 4UC4A 3CCUT 1KQ2A 1FX7A 5CKDA 1VQ8T 2B8AA 4EMKB 4L6V5 3SWNB 2DIGA 3OYBA 3CCUA 5KH6A 1VQ8A 4A4FA 2FHDA 3DLLA 1N9RA 3OYMA 4OVAA 2E5QA 2RHIA 1N8RU 2DEQA 4N4IA 3V8JA 2F69A 5A2QE 3BDUA 2XI9A 1YITT 1G5VA 1KQSA 3R6OA 4C0ZA 2EQMA 1YITA 1PSFA 4LDUA 4HT8A 1IZ6A 5CCAA 4JDSA 5GMKh 3G7ZA 3OY9A 3CBMA 1N6AA 4ZN3A 3JCMd 3OYIA 1XOVA 4L5GA 4TVRA 1QP2A 2WACA 2KY9A 2LT1A 2QXFA 3CEYA 3X24B 4C5IA 1WGSA 4QQGA 2HD0A 3RKWA 2QI2A 2YLCA 2ZPBB 4M78E 5A0DA 1ZBXA 4J7IA 4BI8B 4M77A 4MZTA 4J5YA 3OW2S 2EJFA 2QQAA 3BY7A 4X9CA 4F7UB 5GANh 1OZ2A 3OB9A 4FM4B 3HL8A 4M75B 2V8JA 3VJPA 2K4YA 2O01E 2PUOB 4C8QA 4BACA 5LJ5d 1NJIU 3JCMV 2BUDA 5CKEA 5I2SA 3HFNA 4HA8A 3C12A 4J7FA 2DAQA 4OB2B 3JCMP 3S3NA 4NL2A 2E64A 3RIRA 1XTDA 2O4XA 4FIBA 3CXCA 2IG0A 3M55A 4HT9A 4M77C 2RH2A 5LL6S 3ZFJA 3J80E 2XKOC 1W2BA 1G3TA 4FT4A 3GPLA 4KT0E 3L2WA 1G3SA 5AYFA 3LWIA 2MI6A 3CC4A 3PIOA 4ATOA 4C8QC 1UGPB 2RJDA 4M78F 1Q7YU 4MZPA 3FC3A 4M7DB 1I81A 2IVWA 2DVEA 2E6NA 3FRNA 4OB1B 3CCET 4YTLA 1XNIA 4XTZA 3WVEB 4OGCA 1YJ9T 1N8RC 3CCEA 4M75D 1YJ9A 3GOXA 3V7CA 4JS5A 4E7IA 2LCLA 2RJFA 4RCCA 1K9MU 3A8MB 1LJOA 3X28B 2QDYB 2ZGWA 1UGSB 5FLXE 5C6SA 2DO3A 3FIFA 5LJ5j 3OSSC 3L2UA 3RERA 5A0GA 3M54A 2LQKA 2K2VA 4BI3A 3LH0A 1VQKT 2K57A 2RJCA 1WJRA 3M57A 4KBMB 2VXEA 5LJ3e 1VQKA 2E12A 4E7KA 2DK3A 3CMET 1VQOT 1W4SA 4ZTFA 1BI0A 2OAUA 2CZ6B 2DXTA 3CMEA 3KXTA 1VQOA 5HK0A 5GMKl 2P0PA 1JBMA 3MEVA 2Y4YA 4ZGEB 2LQ8A 4A54A 4E7JA 4QVDA 3JCMb 1MGQA 4MMKA 3DKMA 2JNGA 2FVUA 2RI3A 4LDYA 2X4YA 2WSFE 3LLRA 1YCYA 2V8KA 4M78A 4F7UG 2QEXT 2L89A 5J39A 1VQ7T 1I8FA 4XU1A 4M75G 2QEXA 2WSCE 4ZGDB 1VQ7A 3CMAT 4M7AB 5LJ3h 4II1A 4OF1A 4Y91A 2F5KA 5GAMg 3M9QA 3CMAA 3TU4K 1M1FA 5GAN4 2LT4A 5GAOp 1WQWA 5FU6B 5KE3A 2L8DA 3CCRA 3NTKA 4MMLA 4XQ3A 3G4ST 3ASKA 4M78C 1M9SA 2XIDA 4KUDK 3VUZA 2EAYA 5I2MA 3TEEA 3VV0A 2E10A 3G4SA 4HCCA 3GIBA 2E70A 3JRZA 3FB9A 5GAMh 2XDDA 1OYXA 4XAXB 2XG8D 3OYDA 1K8AU 3CCVT 1BKBA 5CIUA 3OYJA 4LDXA 2VV5A 4GLKA 4A4HA 4XK8E 4X9DA 5GAN6 3LW5E 1Y96A 2JUFA 3KUFA 3CCVA 2XICA 3GNFB 1K9MC 1Q81U 2NLUA 3RUXA 1Q82C 2RD1A 2ZPFB 4FU6A 1KQSS 1UGRB 2D0QB 2R58A 2PUKB 5FRNA 4JRQA 1IREB 1G3WA 4A4KA 2RI2A 2O4XB 4D6WA 2KK4A 3HKSA 1M8VA 3HPWA 4C5HA 4N4GA 4M7AD 2YHTA 2ZPEB 3PTAA 4DA4A 4DQ2A 5KE2A 4PJOB 2RK1A 3P8DA 3PGGA 3NFCA 4JRPA 3G71T 4C0DC 4HCZA 2KMTA 3GF5A 3G71A 4BE0A 2GFAA 1BI2A 2HAXA 5CO7A 1D3BA 2PVOB 5CQYA 4C92B 1UB4A 1BYMA 1M1GA 3MP1A 3GNGA 2GF7A 2RHYA 3E9GA 5GMKm 1M4ZA 2P4TA 2I2LA 3JCMX 3N5BB 3PT9A 5GANg 2OTLT 3JSCA 5CK9A 2KAFA 2OTLA 3LYIA 3SB2A 2H3JA 3FDRA 1V29B 5GAMf 1W2BS 2EQKA 2RHXA 2BKDN 3CCJT 5CQXA 4LDVA 1ZQ1A 3CCJA 4PJOF 3CBOA 1UEBA 3A8OB 4J6YA 1QVFA 4M7AG 2FL7A 4F7UE 4A53A 4HCBA 4PJOD 3CCLT 2QQBA 2RHUA 4M75E 4OB3B 1K8AC 2XDBA 3CCLA 5D6WA 1KC8U 1QVGA 4PL6A 2VUBA 4JRIA 3G6ET 2LRQA 4OP0A 3G6EA 4C92D 4IKFA 3OYGA 4PLIA 1Q81C 1WPYA 5CVIA 1M5Q1 3CC2T 2QQ9A 3TREA 1VQNT 2LX9A 3CC2A 2MF2A 2RHZA 3L1AA 4IUTA 5GAOl 1AHJB 1VQNA 4JLGA 5GAN2 3BDLA 5KCOA 3O8VA 3JCMe 3QSUA 5HK3A 2GCXA 3OYHA 3OYYA 4LD6A 3QKJA 3JB9H 3QO3A 3QG1A 3L2QA 3J7AF 4XTVA 3CBPA 1ZHIA 4DOVA 2JOYA 3OYAA 2M0OA 4F7UF 2Y4XA 4M75F 4OGEA 3X25B 4J6WA 1U1TA 2DZ9A 3H8ZA 2Y90A 3CPFA 3HHTB 4PJOG 4BD3A 3JCMW 1VQ6T 5HY6A 3RKXA 5IAYA 1VQ6A 2YRVA 5LJ5e 1NPPA 3LWHA 3CCST 1Q82U 1K73U 2CS7A 1QVPA 3BFMA 2DTOA 2RK2A 3QBYA 4XTWA 3SWNA 3CCSA 4JJNK 4BDYA 1U8RA 4MDXA 3MEAA 1H3ZA 3OMCA 3LX7A 4RG8A 4C92G 2RI5A 5GANf 2ZPIB 3OYEA 4BE2A 3JCMh 2DZCA 3JB9F 2MAMA 2ZPGB 3HRSA 3JB9D 2CGHA 3A8LB 5GAMd 1OI1A 3JB9I 3EFRA 3INZA 3X26B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4C0D C;  4BY6 B;  4C0D B;  5FU6 C;  4BY6 C;  4C0G A;  5FU6 B;  5FU7 B;  5FU7 C;  4C0F A; 
#chains in the Genus database with same CATH topology
 2ZAE A;  1T0J A;  3I5S A;  2QDL A;  4C0F A;  3CCM A;  8ATC B;  3OYF A;  1VQL T;  5EC7 A;  3SDZ A;  2CP7 A;  1YI2 A;  4LUD A;  5IT9 E;  4M7D F;  5CKB A;  1IGQ A;  4M7A E;  4IIM A;  1VQ9 A;  4JPB W;  2RM4 A;  3HRU A;  1KG1 A;  2FB7 A;  1R0B G;  4E47 A;  1VQP Q;  3PIP A;  2DVJ A;  1JEG A;  2L2P A;  3VS4 A;  2AHJ B;  2CZ0 B;  3EHR A;  3MJX A;  1K73 C;  3QZ5 B;  5GAN 7;  2BE9 B;  1AZG B;  3JAM E;  4Y92 A;  3ZEH A;  3OYN A;  1TTH B;  3GP8 A;  3R6N A;  1D0Z A;  1MMA A;  2AT1 B;  4QT7 A;  5D6X A;  1U1S A;  2OTJ Q;  2AK5 A;  2E6Z A;  3I56 T;  1ABQ A;  2CSI A;  3UT1 A;  1FWZ A;  4RTZ A;  3JCM c;  1WXU A;  2DER A;  1JO8 A;  3A8H B;  2HEQ A;  3CD6 T;  2B86 A;  1U3O A;  2A36 A;  4HKE A;  3QXE B;  1NYG A;  1R8O B;  2EPD A;  1G3Y A;  3CXC S;  2PVD B;  2EIF A;  2D0N A;  3L2R A;  1E6G A;  1Q7Y R;  5GAN e;  2QK0 A;  1ZUU A;  2OAW A;  5D7U A;  4ELY C;  1WHH A;  2DXC A;  2PQW A;  2CKK A;  4DBQ A;  2QA4 A;  5DLO A;  1Q86 U;  3CPW P;  2JTM A;  2L3Q A;  4DEY A;  1R77 A;  3QZ9 B;  1KD1 U;  2OX7 A;  3M58 A;  1VQ4 A;  2FZG B;  3P8H A;  1WA7 A;  1BCM A;  3JCM Q;  2LCC A;  3F70 A;  2L0A A;  4B9W A;  1KJW A;  3V8K A;  2X3X D;  2GTO A;  2ZCF B;  1C0M A;  4KGZ B;  5FWB A;  5CR2 A;  2X35 A;  5LJ3 d;  4RUG A;  4QQD A;  4PJO A;  1M90 U;  1Y96 B;  1VYV A;  1AD5 A;  4LN2 A;  3E9F A;  1I4K 1;  3QJY A;  3S6W A;  2RNA A;  1FMW A;  4C92 A;  4JLI A;  4NS5 A;  3CPW S;  2XHC A;  4IUU A;  1YJW A;  1BU1 A;  4EMK C;  2M0Y A;  2CZ7 B;  1ZSZ A;  1LOJ A;  2KSS A;  3S3M A;  1VQ8 Q;  1UJ0 A;  4KH1 B;  4J6X A;  2YUQ A;  1TOV A;  4MDW A;  1Q86 C;  4J9I A;  2GFU A;  4F7U A;  1HJD A;  5LJ3 j;  3SD4 A;  3TQ7 P;  2EYX A;  2K3Y A;  2RA2 A;  3FEO A;  5HCK A;  5GMK i;  2HQX A;  1AWW A;  3O5Z A;  2XD0 A;  4J9B A;  1ZA2 B;  2FEI A;  2L3S A;  4OB0 B;  1UTI A;  3NHN A;  1BK2 A;  1KQ2 A;  2VWF A;  5IXB A;  3JCM f;  2JS0 A;  3C95 A;  2KGT A;  1D0Y A;  5I22 A;  2CP5 A;  3GBQ A;  4C8Q E;  2GQI A;  5FRM A;  1VQ5 A;  3ULR B;  3UA7 A;  2ATC B;  3QJ6 A;  2J05 A;  1YIJ A;  5KYY B;  1WYX A;  4M7D A;  1TXQ A;  2QGG A;  3CC4 Q;  3L2Z A;  3L42 A;  3RDV A;  2VYT A;  2EYQ A;  3EGD A;  3OW2 P;  4LUE A;  1WDX A;  5GMK e;  4IUP A;  2SEM A;  1ZA1 B;  4BDZ A;  2DXU A;  1LCK A;  1BIA A;  4P5N A;  4BY6 B;  3CCU T;  1S1N A;  3VS6 A;  2B8A A;  3SWN B;  2J06 A;  2KRN A;  2FHD A;  2AZV A;  4CC2 A;  3VRY A;  1VQK Q;  3BDU A;  3CME Q;  1NG2 A;  4Z89 A;  4HT8 A;  1ZX6 A;  4C5I A;  3X24 B;  3RKW A;  3OW2 S;  2QEX Q;  1OZ2 A;  2MIO A;  4M75 B;  2O01 E;  5LJ5 d;  3JCM V;  2BUD A;  3HFN A;  2OI3 A;  3C12 A;  3S3N A;  2X51 A;  4OB2 B;  1VYT A;  1XTD A;  3M55 A;  3M0P A;  2RH2 A;  2CUB A;  3J80 E;  3EG0 A;  2XKO C;  1W2B A;  3L2W A;  1G3S A;  5AYF A;  3LWI A;  2MI6 A;  2KXC A;  1HSQ A;  3PIO A;  2HL3 A;  2RJD A;  1OQK A;  3FC3 A;  2IVW A;  1TS9 A;  1XNI A;  2E3H A;  1YCS B;  5KYW B;  4M75 D;  5AT1 B;  2DM1 A;  3A8M B;  2QDY B;  1UGS B;  1YWP A;  5FLX E;  5LJ5 j;  3G71 Q;  1RUW A;  1B07 A;  1QCN A;  2E5K A;  2YRC A;  3M54 A;  1WJR A;  4KBM B;  2KYB A;  1H92 A;  4E6R A;  1TSF A;  2DK3 A;  4ZTF A;  2YUP A;  1KQS P;  4ZGE B;  1TUD A;  2DRK A;  2OTL Q;  2RQW A;  2JNG A;  1WXB A;  2X4Y A;  1NEG A;  4M78 A;  3CCJ Q;  1I8F A;  3NMZ C;  4M75 G;  4XU1 A;  4E2F B;  5LJ3 h;  3A1P A;  1M1F A;  1IHV A;  5GAN 4;  1SEM A;  1WQW A;  1OUL A;  3CCR A;  3NTK A;  3ASK A;  1M9S A;  2EAY A;  5I2M A;  1Z9Q A;  3FB9 A;  1MND A;  4XAX B;  1K8A U;  2XG8 D;  3OYJ A;  4GLK A;  3CCV A;  2JUF A;  1KC8 R;  2XIC A;  1Q81 U;  2K7A A;  2NLU A;  1Q82 C;  2QGF B;  4FU6 A;  4WCI A;  2D0Q B;  1KQS S;  2EQI A;  1IGU A;  3HKS A;  3HPW A;  2FRY A;  4DA4 A;  1TU0 B;  5I11 A;  4PJO B;  2DX1 A;  2KNB B;  4HCZ A;  1NBE B;  1F1B B;  2A37 A;  1Q95 G;  3AT1 B;  2P4R A;  4C92 B;  4PFO A;  1GCQ A;  4CC4 B;  1M1G A;  3MP1 A;  3GNG A;  3E9G A;  5KYX A;  3PT9 A;  1ZSZ B;  2KAF A;  2DA9 A;  2VKN A;  2H3J A;  1V29 B;  5GAM f;  3CCM Q;  2BKD N;  5IHK A;  1YI2 Q;  4LDV A;  4FCY A;  2O88 A;  4J6Y A;  4PJO D;  2QQB A;  1VQ9 Q;  1K8A C;  5D6W A;  4OP0 A;  2DET A;  3G6E A;  4C92 D;  2RQT A;  1PNJ A;  1QKW A;  3OYG A;  1Q81 C;  2BZX A;  3TRE A;  1WHL A;  1UDL A;  2MF2 A;  1D09 B;  1AHJ B;  2AKL A;  2COW A;  3OYY A;  4XTV A;  3CBP A;  1A0N B;  4DOV A;  2ED1 A;  2CT4 A;  2KRM A;  2Y4X A;  4M75 F;  4CC3 A;  3X25 B;  3H8Z A;  4PJO G;  3CPF A;  4BD3 A;  1IXD A;  1WI7 A;  5HY6 A;  3RKX A;  5IAY A;  1VQ6 A;  2OTJ T;  2CP2 A;  3CCS T;  4M7D B;  4XTW A;  1QVP A;  3QBY A;  2DTO A;  2RK2 A;  1WHK A;  4C92 G;  2RI5 A;  3OYE A;  3EGD B;  5GJW B;  1D1B A;  2ZPG B;  3JB9 D;  2CGH A;  2X9H A;  2EW3 A;  4N4I A;  3JB9 I;  2O31 A;  1VA7 A;  2MWO A;  1KHI A;  4ME7 A;  3SWN C;  1OZ3 A;  5DLQ E;  4FYV B;  2KBT A;  5LJ5 h;  5ECA A;  4CI0 C;  2AKK A;  1VQL A;  1R0C B;  4M7D D;  4K11 A;  3VKI A;  3CPW A;  3DLM A;  4JZ4 A;  2QA4 Q;  2DJZ A;  2PVG B;  2L5Q A;  2DJQ A;  1N8R R;  3JB9 G;  1X2K A;  2L3P A;  1ACM B;  1VQ4 Q;  2F1L A;  3EG1 A;  2DIQ A;  2DTH A;  3EH2 A;  3NTH A;  4F16 A;  1O75 A;  3Q1J A;  2DRM A;  2XDP A;  3OBW A;  3M0S A;  3REA B;  2RMO A;  4M7D G;  3CC7 T;  2K5I A;  4RTT A;  2GNC A;  2F5T X;  2YUO A;  1OU9 A;  1WJS A;  2X4W A;  3I56 A;  1M1K R;  5D6Y A;  4O6J A;  3OSV A;  5LJ3 f;  5M9O A;  3S3O A;  2MOX A;  4XU0 A;  1SSF A;  1WXT A;  1X69 A;  3CD6 A;  3IQL A;  1EIF A;  3OS5 A;  4C8Q F;  4HVU A;  4RG2 A;  4C0G A;  1MHN A;  4O5V A;  3OS1 A;  4EIK A;  3A98 A;  2C06 A;  3OBY A;  4X1V A;  2QYZ A;  1JRI A;  4IUQ A;  3TSZ A;  4PFZ A;  1IHW A;  1K1Z A;  4M7A A;  1PRL C;  1W1F A;  1IB8 A;  2A3L A;  4C92 F;  4MZM A;  2SRC A;  2DD5 A;  2EKO A;  1NEB A;  3QPH A;  5FU7 B;  1YJN T;  4M78 B;  3UDC A;  1WHJ A;  3PFS A;  5KYY A;  3VS7 A;  4DBR A;  2JZ2 A;  2KQW A;  2R5M A;  2V1Q A;  4JS4 A;  1N9S A;  3M4G A;  2DD4 A;  1VQ5 Q;  4JRK A;  3JCM g;  4KGV B;  2E1H A;  1YIJ Q;  3VS0 A;  2HBP A;  3LGF A;  2LJ3 A;  5HKC A;  3CC4 T;  1RAH B;  3OW2 A;  1YFN A;  1PHT A;  1PSE A;  1T0H A;  4FYY B;  3MET A;  1VIE A;  5L8R E;  2P84 A;  4M78 D;  4R55 A;  2DXB A;  2D8J A;  4J83 A;  2H8H A;  2ROT A;  3M59 A;  1EZZ B;  3RR6 A;  4PJO C;  3VS5 A;  1JJ2 P;  2K5F A;  4QW2 A;  1B34 B;  2K6D A;  2LDM A;  1P92 A;  3URG A;  2ABL A;  1WIE A;  5CAI A;  4C92 C;  3TCJ A;  2FRW A;  4EMH A;  2YUN A;  1Y71 A;  2KDS A;  3I55 T;  4JJD A;  2YLB A;  1YN8 A;  4VUB A;  3HTR A;  4M75 A;  2LC4 A;  5KYX B;  2EJ9 A;  3JCM J;  3MPU B;  1ZSZ C;  3JV3 A;  5IN1 A;  1MNE A;  3UF4 A;  4M78 G;  5GAM j;  1N27 A;  2X4X A;  3CCQ T;  1VQM T;  3MEU A;  4M77 E;  1YBY A;  3M53 A;  5CKH A;  1JJ2 S;  3OS2 A;  1HK9 A;  3PNW C;  1Y7X A;  2JMA A;  3VS2 A;  1VUB A;  2HBW A;  1X27 A;  1XQH A;  1Q7Y C;  5KYW A;  1C6V X;  3UPU A;  1K4U S;  2K3X A;  3FJP A;  4N4H A;  4ORZ A;  5LJ5 f;  3MCA B;  2R57 A;  4RCB A;  1WQ7 A;  1X43 A;  4QKU A;  3M5A A;  5J3B A;  3BW1 A;  3HRT A;  1QKX A;  3M0T A;  2CH4 W;  4QQ6 A;  2ZPH B;  1WNL A;  2EGA A;  4M7D C;  2KT8 A;  6AT1 B;  3HP9 A;  1YWO A;  1FX7 A;  5CKD A;  3CCU A;  4L6V 5;  2DIG A;  3OYB A;  4A4F A;  2DNU A;  1N9R A;  2RPN A;  4OVA A;  2E5Q A;  2RHI A;  4RTY A;  1KK7 A;  1YIT T;  1KQS A;  2HZY A;  1K9M R;  4IIO A;  1IZ6 A;  5CCA A;  4JDS A;  1UJY A;  5GMK h;  3G7Z A;  1K73 R;  4F17 A;  5KYU A;  1N6A A;  1AWO A;  4TVR A;  2BTT A;  1QP2 A;  2KY9 A;  1WGS A;  1I07 A;  4QQG A;  7AT1 B;  2HD0 A;  4FW1 A;  2YLC A;  2ZPB B;  4PJL A;  1ZBX A;  4BI8 B;  2EJF A;  1SKU B;  4X9C A;  1RAB B;  2FZK B;  4FM4 B;  1KIK A;  2K4Y A;  4AFZ C;  4C8Q A;  3CCR Q;  3RIR A;  2IG0 A;  1RAE B;  5LL6 S;  1Y57 A;  3ZFJ A;  2EGC A;  1I1J A;  5L23 A;  3CCV Q;  3LH5 A;  1QQJ A;  2CH4 A;  1UGP B;  4F04 B;  1QCO A;  1WLP B;  4M78 F;  1I81 A;  2DVE A;  1G83 A;  3FRN A;  3CCE T;  4YTL A;  3WVE B;  1AVZ C;  4OGC A;  1YJ9 T;  4FYX B;  2LCL A;  3X28 B;  2VVK A;  4ESR A;  5A0G A;  2C0O A;  2Z0W A;  1GCP A;  2RQU A;  2VXE A;  2CRE A;  1VQO T;  2KXD A;  1JXO A;  2OAU A;  3KXT A;  1NLP C;  1J3T A;  2P0P A;  2Y4Y A;  4E7J A;  2MK5 A;  3JCM b;  2RI3 A;  1ZUK A;  1OV3 A;  2HKQ B;  2L89 A;  1VQ7 T;  2WSC E;  4ZGD B;  3CMA T;  4M7A B;  4II1 A;  4OF1 A;  2F5K A;  5GAM g;  4AMC A;  3G6E Q;  2L8D A;  3U23 A;  3G4S T;  4M78 C;  2XID A;  3TEE A;  4B6M A;  2E10 A;  1MMN A;  3JRZ A;  5GAM h;  2XDD A;  3OYD A;  2VV5 A;  4XK8 E;  1ABO A;  3LW5 E;  5GAN 6;  1OEB A;  3RUX A;  2RD1 A;  1UGR B;  2R58 A;  2PUK B;  2HCK A;  1IRE B;  1KD1 R;  2O4X B;  1YP5 A;  2KK4 A;  2JTE A;  4C5H A;  4M7A D;  3PTA A;  1QMC A;  2NUZ A;  1VQ6 Q;  5KE2 A;  1X6G A;  2DFU A;  3P8D A;  3PGG A;  2YT6 A;  2LQW A;  4BE0 A;  1ZSG A;  1BI2 A;  2EKH A;  1JQQ A;  2HAX A;  5CO7 A;  1D3B A;  5CQY A;  1UB4 A;  1QWF A;  3H0F A;  2VB6 A;  2RHY A;  4OML A;  1M4Z A;  2IPO B;  3UAT A;  1M90 R;  1CSK A;  4JJC A;  1BCO A;  1AEY A;  2RHX A;  1GCQ C;  1ZQ1 A;  1VQL Q;  2AZS A;  3CBO A;  1UEB A;  4M7A G;  4F7U E;  2DL3 A;  3CCL T;  2RQV A;  5KYN A;  3H41 A;  1GFD A;  1KC8 U;  4PL6 A;  4Z88 A;  2LRQ A;  2D8H A;  1SRL A;  4PLI A;  1WPY A;  2YDL A;  5CVI A;  1M5Q 1;  1TUG B;  2QQ9 A;  3CC2 T;  1VQN T;  2LX9 A;  4DBH A;  4JLG A;  5GAN 2;  2EBP A;  1UUE A;  3CQT A;  3EFO A;  5HK3 A;  2GCX A;  2PTK A;  1E6H A;  2ED0 A;  2JOY A;  2EYW A;  2M0O A;  1SPK A;  1C1A A;  1NM7 A;  1OPL A;  4OGE A;  1D1C A;  3JCM W;  1TG0 A;  2GBQ A;  2YRV A;  1Q82 U;  3BFM A;  3CCS A;  3I56 Q;  5FW9 A;  1OOT A;  4BE2 A;  2ZPI B;  3UA6 A;  2OJ2 A;  2MAM A;  3HRS A;  1KFZ A;  2DL4 A;  2EVR A;  3EFR A;  3INZ A;  1AT1 B;  3X26 B;  2LNH B;  3CD6 Q;  2X4J A;  5GAO n;  1H64 1;  3PE0 A;  4RTU A;  3OYK A;  1UGQ B;  3V7S A;  5LJ3 g;  2HQH A;  1KC8 C;  3I9Q A;  4RKU E;  2DIL A;  4PK4 A;  3NGP A;  4AG2 C;  5GAN 5;  2NUP B;  1ZLM A;  2EFI A;  3DB4 A;  2MMP A;  1NPR A;  1NJI R;  1K9A A;  3I35 A;  5KYU B;  2EQJ A;  3OS0 A;  3KBG A;  3AHU A;  4NOY A;  3KFV A;  1YHQ T;  1LVK A;  1E7O A;  1GFC A;  3M0U A;  2KR3 A;  4BB7 A;  2CYZ B;  2EQU A;  4A4G A;  5IHI A;  4WF2 A;  4LDW A;  4C8Q B;  1TH7 A;  4M7A F;  1S72 T;  5GAN 8;  5GAN d;  1B34 A;  2KYM A;  2O2O A;  3PMT A;  3CC7 A;  3VUB A;  2FO0 A;  4PKC C;  5GJV B;  1IRX A;  2JVV A;  5FWC A;  3RNJ A;  2ECZ A;  1JJ2 A;  1I5L A;  1EX4 A;  1O9S A;  4C8Q D;  4N0A A;  2EWN A;  4JUV A;  4HCK A;  3OYC A;  2J6F A;  1M30 A;  2XU8 A;  4J9D A;  2L3R A;  4ELZ C;  5GAN j;  4PLL A;  1ZUY A;  1UHF A;  3QYH B;  3VYG A;  2D6F A;  3HFO A;  2ZZD A;  3A8G B;  2JMC A;  1VIF A;  4A4E A;  1VQP T;  2XMF A;  2QG9 B;  3QII A;  1YJN A;  2CT3 A;  2LMJ A;  3EFS A;  4M7A C;  3PVQ A;  4V2S A;  4PNO A;  3MEW A;  2BZ8 A;  4C8Q G;  3A5Z B;  1Y0M A;  1M1K U;  4IUV A;  2LNV A;  2P0K A;  2VC8 A;  3E19 A;  3MP8 A;  2W0Z A;  4JJB A;  4Y28 E;  4DOW A;  4KUI A;  3I5R A;  4C0D B;  3ZBD A;  1SG5 A;  3C0C A;  3QDR B;  3OMG A;  2DL5 A;  1KQ1 A;  3QWX X;  4EMG A;  5LJ5 g;  3PVL A;  1LPL A;  4BY6 C;  4Z02 A;  1HXD A;  1K8A R;  2QAS A;  1G2B A;  3CCU Q;  4ANJ A;  4CC7 A;  2YWW A;  3SEM A;  1QW1 A;  4DEX A;  3GLX A;  1D3B B;  3JB9 J;  1AZE A;  3RKY A;  3I55 A;  4L59 A;  2RF0 A;  4NL3 A;  4PJM A;  1BI3 A;  5GAN 3;  2R5A A;  3FJ5 A;  4RTV A;  2DPP B;  3THK A;  1M1K C;  3C94 A;  2YSQ A;  2P0Q A;  3CCQ A;  4M75 C;  4XU2 A;  1VQM A;  1UG1 A;  5CKF A;  4J8O A;  2QAZ A;  5GAO q;  5EG2 A;  2RO0 A;  2JJ9 A;  4E7Z A;  3QYG B;  2RB6 A;  2HDA A;  3CCR T;  3M0R A;  3M4Y A;  1GBQ A;  1KHC A;  1NE8 A;  4OMQ A;  2KRO A;  3EFO B;  2EYZ A;  1WZO A;  3QHS A;  1OX9 A;  3HSB A;  2M02 A;  2EYY A;  3WXM B;  2GGR A;  2C0I A;  1YJW Q;  3MP6 A;  5GMK j;  1PKT A;  1X75 C;  2QTX A;  4UC4 A;  1VQ8 T;  4EMK B;  5KH6 A;  3DLL A;  4J9C A;  3OYM A;  1K0X A;  2X3W D;  2DEQ A;  2PZ1 A;  2BZY A;  2F69 A;  2F2V A;  2XI9 A;  1RAD B;  1YIT A;  1PSF A;  4OMN A;  4LDU A;  5IHN A;  1WFW A;  3OYI A;  4E7S A;  2QXF A;  1T3L A;  2D1X A;  3EHQ A;  3EG3 A;  4J7I A;  2MCN A;  4M77 A;  4MZT A;  5GAN h;  2E4H A;  2V8J A;  1D1A A;  1AWX A;  2RN8 A;  4HA8 A;  2DAQ A;  3JCM P;  4NL2 A;  2E64 A;  2O4X A;  1ARK A;  4F14 A;  1X2Q A;  1MMD A;  1I0C A;  1FMK A;  1H8K A;  3GPL A;  2G6F X;  1ZBJ A;  1RLQ C;  2NWM A;  2V1R A;  4C8Q C;  2JT4 A;  1Q7Y U;  3NPF A;  4MZP A;  2PNI A;  4XTZ A;  4A63 B;  3CCE A;  1YJ9 A;  3V7C A;  2H3E B;  1K9M U;  2ZGW A;  3OSS C;  3L2U A;  2LQK A;  2K2V A;  3BE3 A;  4BI3 A;  1VQK T;  1PG5 B;  1BB9 A;  2RQR A;  2E12 A;  4E7K A;  2IIM A;  3CME T;  2DF6 A;  1VQO A;  3MEV A;  2AIR B;  1RAG B;  4QVD A;  1MGQ A;  1TWB A;  4MMK A;  3DKM A;  1U06 A;  2FVU A;  1PWT A;  2WSF E;  3LLR A;  1YCY A;  1IO6 A;  2QEX T;  5J39 A;  3H9N A;  1VQ7 A;  2J6K A;  2JW4 A;  3CMA A;  2LT4 A;  5GAO p;  5FU6 B;  1AOJ A;  4WTO B;  1K0S A;  3VUZ A;  3G4S A;  1OPK A;  1GBR A;  2E70 A;  1OYX A;  3CXC P;  1BKB A;  4LDX A;  4A4H A;  1SHG A;  4X9D A;  2J6O A;  1K9M C;  2KRS A;  1PD0 A;  2ZPF B;  1UE9 A;  2BE7 D;  2RI2 A;  2E3I A;  4N4G A;  2YHT A;  2RK1 A;  1PKS A;  3NFC A;  4JRP A;  3G71 T;  4C0D C;  3CCS Q;  1QCF A;  4D8D A;  1KSW A;  1MMG A;  4FYW B;  1W6X A;  2GF7 A;  2NUP A;  4GBQ A;  2CP0 A;  5GMK m;  2P4T A;  2OTL T;  3JSC A;  1UHC A;  1OU8 A;  3LYI A;  1M2V A;  1GRI A;  3CCJ T;  2QTV A;  2JM9 A;  3A8O B;  1QVF A;  4HCB A;  2O9V A;  3VS3 A;  2RHU A;  4M75 E;  4OB3 B;  2XDB A;  3REB B;  3CCL A;  4JRI A;  1MUZ A;  4IKF A;  4KRT A;  3G1J A;  3CC2 A;  4AFQ C;  3L1A A;  1VQN A;  1FYN A;  1W70 A;  3BDL A;  4R0K A;  3JCM e;  4LD6 A;  3QO3 A;  3QG1 A;  4JZ3 A;  3L2Q A;  3EGX B;  2ROL A;  3OYA A;  1XJW B;  1V76 A;  2LJ1 A;  2CP3 A;  3TVT A;  4J6W A;  1U1T A;  2DZ9 A;  2Y90 A;  2HL5 C;  2DL8 A;  3LWH A;  1NPP A;  3JB9 H;  2CS7 A;  4JJN K;  3CC7 Q;  1U8R A;  4BDY A;  3MEA A;  1D0X A;  3LX7 A;  3OMC A;  5GAN f;  2F2W A;  2DZC A;  2A08 A;  2LX7 A;  2DBK A;  3NTI A;  4IUR A;  1JB0 E;  2HSE B;  1NLO C;  3TSW A;  2E41 A;  4RTX A;  3SHW A;  4AFS C;  2M9U A;  3SFM A;  1NYF A;  4X34 A;  4EDU A;  2YXY A;  4J9F A;  3CCM T;  2E65 A;  4FSX A;  5J26 A;  1VYU A;  1YI2 T;  2KVQ G;  8AT1 B;  3RMQ A;  1M3B A;  2JS2 A;  3E2U A;  1VQ9 T;  1KD1 C;  2K2M A;  2HQE A;  3OYL A;  3RES A;  4RMO A;  4E7H A;  5FU7 C;  2A0F B;  1QVG P;  1JXM A;  5IH2 A;  1BIB A;  2CDT A;  4ZN1 A;  5GAO m;  2EJG A;  1YJN Q;  3OQ5 A;  2M16 A;  4M77 B;  5DY9 A;  3VYH B;  1YHQ A;  2DYB A;  4XTY A;  1K76 A;  3M56 A;  1UGV A;  4LD9 K;  4Q5W A;  3OA6 A;  1Q86 R;  1BI1 A;  1FXX A;  2FG0 A;  2JN0 A;  1M90 C;  4BUG A;  4OMM A;  3P8B B;  1CKA A;  2JXB A;  3PMI A;  3ME9 A;  3MHX A;  3C4S A;  1PM3 A;  1S72 A;  9ATC B;  4GY5 A;  4PJO E;  3DB3 A;  4C5G A;  2EGE A;  1AWJ A;  2DEU A;  1PRM C;  4PFP A;  2HSP A;  4C92 E;  2RJE A;  4FL6 A;  5KCH A;  1NZ9 A;  3T9N A;  4M77 D;  3V7R A;  4D8K A;  1Y07 A;  1QVG S;  2DE0 X;  1EFN A;  2K9G A;  1RAC B;  1NJI U;  2HNI A;  2JTF A;  2M51 A;  3L2V A;  4CRI A;  4BE1 A;  3UWN A;  2LTO A;  2VGM A;  1FMV A;  3J81 E;  5DM7 R;  4KUL A;  5A0L A;  2A7Y A;  2VXF A;  4B9X A;  3I55 Q;  3MKD A;  4OMP A;  3LGL A;  3VU3 C;  2QA4 T;  2FPD A;  4N0A C;  4XTU A;  2KI7 A;  2LQN A;  1VQP A;  4M77 G;  1VQ4 T;  1RI9 A;  1SRM A;  3CCQ Q;  4ZTJ A;  1RL2 A;  2DKG A;  2NUT A;  1DJ7 B;  1VQM Q;  2YRD A;  2K5L A;  1UFF A;  1WHM A;  2D9T A;  5FU6 C;  4J9H A;  3M0Q A;  3RBB B;  4BI4 A;  2CP6 A;  1GL5 A;  1GXI E;  5C0M A;  3MO8 A;  1SF9 A;  2MWP A;  4AFU C;  4OMF B;  2FPF A;  2LJ0 A;  2CSQ A;  4EMK A;  4M7D E;  2OTJ A;  1MV0 B;  2V26 A;  2W10 A;  2DTI A;  3WVD B;  1NJI C;  2KEA A;  3EG9 A;  3QWY A;  1Z9Z A;  4EPC A;  1T3S A;  1M2O A;  2VAS A;  3E1S A;  1YJW T;  2G3R A;  2QQR A;  3V8L A;  2COZ A;  3QUI A;  1B3Q A;  5FRO A;  1RI0 A;  1VOM A;  2CZ1 B;  3VRZ A;  4QVC A;  2GQV A;  1QP3 A;  2WSE E;  4QVZ A;  4E7L A;  3FLG A;  3RMS A;  1YIT Q;  1BBZ A;  2COY A;  2XK0 A;  1QVF P;  1I5O B;  2F2X A;  3EAE A;  5GAO r;  4C5E A;  2DYI A;  5GAM e;  1M2V B;  2V8I A;  2K79 A;  3X20 B;  4R56 A;  4XU3 A;  3H0H A;  1X01 A;  1WJQ A;  2VGN A;  4LE9 A;  2M1H A;  4DBF A;  1VQ5 T;  2LP5 A;  1X6B A;  1X6O A;  4PJJ A;  4XTX A;  1G8X A;  4PJN A;  2QQS A;  1YIJ T;  1M3C A;  2LVM A;  3H6Z A;  2FPE A;  1LNX A;  1JU5 C;  1HD3 A;  1WHG A;  3ER0 A;  4OMO A;  3EG2 A;  1QVF S;  2PU9 B;  4M77 F;  4FT2 A;  1M3A A;  2FYK A;  3CCE Q;  2BIV A;  1YJ9 Q;  4ZGJ B;  4M4Z A;  3ZL7 C;  3EGU A;  5I21 A;  1B7T A;  1VQ8 A;  3EH1 A;  1RLP C;  1N8R U;  2I0N A;  3V8J A;  5A2Q E;  1G5V A;  3R6O A;  1QLY A;  2FZC B;  3QDF A;  2EQM A;  4C0Z A;  1VQO Q;  4FW2 A;  1Q82 R;  3OY9 A;  3CBM A;  4ZN3 A;  3JCM d;  4Z8A A;  1XOV A;  4L5G A;  2WAC A;  3CEY A;  2LT1 A;  3VS1 A;  2QI2 A;  4M78 E;  5A0D A;  4J5Y A;  2QQA A;  3BY7 A;  4F7U B;  1VQ7 Q;  3OB9 A;  1OX8 A;  3HL8 A;  1RAA B;  2C0T A;  3CMA Q;  1N5Z A;  3VJP A;  2PUO B;  3H0I A;  4BAC A;  5CKE A;  5I2S A;  4J7F A;  5IXF A;  3CXC A;  4HT9 A;  4FIB A;  3G4S Q;  4M77 C;  1G3T A;  4FT4 A;  1PD1 A;  4KT0 E;  1PC0 A;  3CC4 A;  4J9E A;  4ATO A;  1RAF B;  1M27 C;  2E6N A;  4OB1 B;  1N8R C;  2HKN A;  2O9S A;  3GOX A;  4JS5 A;  4E7I A;  4HVW A;  2RJF A;  4RCC A;  1LJO A;  1U5S A;  5C6S A;  2DO3 A;  3FIF A;  4AG1 C;  1Q81 R;  3RER A;  3LH0 A;  2K57 A;  2RJC A;  3M57 A;  5LJ3 e;  1WX6 A;  1VQK A;  2GTJ A;  1W4S A;  1BI0 A;  2CZ6 B;  2DXT A;  3CME A;  1MV3 A;  2KT1 A;  5HK0 A;  5GMK l;  1JBM A;  2LQ8 A;  4A54 A;  1HYO A;  2KE9 A;  4LDY A;  2V8K A;  4HXJ A;  1M8M A;  4F7U G;  2QEX A;  4Y91 A;  3CCL Q;  3TU4 K;  3M9Q A;  3EGX A;  4LNP A;  1CKB A;  5KE3 A;  4XQ3 A;  4MML A;  4KH0 B;  1SHF A;  4KUD K;  3VV0 A;  4HCC A;  3D7S B;  1RAI B;  3GIB A;  2DL7 A;  3CC2 Q;  1VQN Q;  3CCV T;  5CIU A;  2DMO A;  2NUT B;  1Y96 A;  3KUF A;  2LZ6 B;  1W2B P;  3GNF B;  1TUC A;  5FRN A;  4JRQ A;  1G3W A;  4A4K A;  4D6W A;  1SSH A;  1M8V A;  2ZPE B;  4DQ2 A;  2KMT A;  3GF5 A;  4FSS A;  3G71 A;  1YNZ A;  2GFA A;  2ENM A;  2PVO B;  3EG9 B;  1BYM A;  2MPX C;  2MYS A;  2DBM A;  2I2L A;  3JCM X;  3N5B B;  5GAN g;  5CK9 A;  1QWE A;  4RTW A;  2OTL A;  3SB2 A;  3FDR A;  1UEC A;  1W2B S;  2K3B A;  2EQK A;  5CQX A;  3CCJ A;  4PJO F;  2JM8 A;  2FL7 A;  4A53 A;  4HVV A;  1QVG A;  3G6E T;  2VUB A;  4LXC A;  4J9G A;  1V1C A;  2DLP A;  4KGX B;  2RHZ A;  4IUT A;  2CUD A;  5GAO l;  4AT1 B;  2J7I A;  1YHQ Q;  5KCO A;  3O8V A;  3QSU A;  3OYH A;  3QKJ A;  3J7A F;  1ZHI A;  4F7U F;  2NYS A;  2HMA A;  2A28 A;  3HHT B;  1S72 Q;  1VQ6 T;  1H3H A;  4GLM A;  5LJ5 e;  1K73 U;  2ESW A;  4ZNX A;  3SWN A;  2LCS A;  4MDX A;  1H3Z A;  4RG8 A;  3JCM h;  3JB9 F;  1PCX A;  3A8L B;  1OI1 A;  5GAM d; 
#chains in the Genus database with same CATH homology
 3NTI A;  2X4J A;  1JB0 E;  4IUR A;  5GAO n;  2MWO A;  1H64 1;  3OYK A;  1KHI A;  2E41 A;  1UGQ B;  4ME7 A;  3SWN C;  3V7S A;  1OZ3 A;  2M9U A;  3SFM A;  4X34 A;  4C0F A;  4EDU A;  5LJ3 g;  3CCM T;  1KC8 C;  5DLQ E;  2E65 A;  4FSX A;  5J26 A;  5LJ5 h;  3CCM A;  3OYF A;  2KVQ G;  1YI2 T;  1VQL T;  4RKU E;  3SDZ A;  4CI0 C;  1YI2 A;  3RMQ A;  1VQL A;  5IT9 E;  1VQ9 T;  5CKB A;  4M7D F;  4M7D D;  5GAN 5;  1KD1 C;  3VKI A;  4M7A E;  1VQ9 A;  2EFI A;  3DB4 A;  3DLM A;  2MMP A;  3CPW A;  4LD9 K;  1NPR A;  2HQE A;  3OYL A;  3RES A;  2RM4 A;  3HRU A;  4RMO A;  4E7H A;  1KG1 A;  2EQJ A;  5FU7 C;  2DJZ A;  3OS0 A;  2PVG B;  3KBG A;  2L5Q A;  3AHU A;  2FB7 A;  1BIB A;  4E47 A;  4ZN1 A;  3JB9 G;  5GAO m;  2EJG A;  4NOY A;  3PIP A;  3OQ5 A;  1YHQ T;  2M16 A;  4M77 B;  5DY9 A;  3VYH B;  1YHQ A;  2DIQ A;  4XTY A;  2DTH A;  3NTH A;  3M56 A;  4BB7 A;  2CYZ B;  2AHJ B;  4Q5W A;  2EQU A;  1O75 A;  2CZ0 B;  3OA6 A;  3Q1J A;  1BI1 A;  4A4G A;  1K73 C;  4WF2 A;  1FXX A;  2JN0 A;  3QZ5 B;  4LDW A;  4C8Q B;  5GAN 7;  4BUG A;  1M90 C;  3P8B B;  3JAM E;  2XDP A;  3ZEH A;  3OBW A;  3OYN A;  3PMI A;  1TH7 A;  3ME9 A;  3GP8 A;  1S72 T;  4M7A F;  2OTJ T;  5GAN 8;  5GAN d;  3MHX A;  3C4S A;  1S72 A;  4M7D G;  1B34 A;  4GY5 A;  3CC7 T;  4PJO E;  3DB3 A;  5D6X A;  1U1S A;  2K5I A;  4C5G A;  3PMT A;  3CC7 A;  2E6Z A;  2F5T X;  3I56 T;  3VUB A;  1WJS A;  2X4W A;  3UT1 A;  3I56 A;  5D6Y A;  1FWZ A;  4O6J A;  3OSV A;  4PKC C;  5LJ3 f;  4C92 E;  2RJE A;  2JVV A;  4FL6 A;  5KCH A;  3JCM c;  5M9O A;  1NZ9 A;  3T9N A;  4M77 D;  3V7R A;  1I5L A;  3S3O A;  1JJ2 A;  3A8H B;  1Y07 A;  3CD6 T;  4XU0 A;  1SSF A;  4HKE A;  1QVG S;  3CD6 A;  1EIF A;  3QXE B;  1R8O B;  3OS5 A;  1O9S A;  1G3Y A;  3CXC S;  4C8Q F;  2PVD B;  2EIF A;  2HNI A;  2JTF A;  4N0A A;  4C8Q D;  2EWN A;  4CRI A;  3L2R A;  4JUV A;  3UWN A;  3L2V A;  4BE1 A;  2LTO A;  4RG2 A;  4C0G A;  2VGM A;  1MHN A;  4O5V A;  3OYC A;  3OS1 A;  3J81 E;  2XU8 A;  2C06 A;  5GAN e;  5DM7 R;  3OBY A;  2L3R A;  4KUL A;  4ELZ C;  1JRI A;  5GAN j;  5A0L A;  2A7Y A;  2VXF A;  4B9X A;  4ELY C;  4IUQ A;  4PLL A;  2DXC A;  3LGL A;  3QYH B;  3VYG A;  3VU3 C;  2QA4 T;  4M7A A;  2PQW A;  2CKK A;  2D6F A;  4N0A C;  2QA4 A;  3HFO A;  2ZZD A;  3A8G B;  4XTU A;  2A3L A;  5DLO A;  4C92 F;  4MZM A;  1Q86 U;  2DD5 A;  1VIF A;  2JTM A;  2EKO A;  3QPH A;  4A4E A;  1VQP T;  5FU7 B;  1YJN T;  3QZ9 B;  1VQP A;  1KD1 U;  3QII A;  4M77 G;  1VQ4 T;  4M78 B;  1YJN A;  3UDC A;  4ZTJ A;  3PFS A;  3M58 A;  1VQ4 A;  3EFS A;  1RL2 A;  2DKG A;  4M7A C;  1DJ7 B;  4V2S A;  3P8H A;  2JZ2 A;  2K5L A;  2KQW A;  4PNO A;  2R5M A;  3MEW A;  4JS4 A;  1N9S A;  3M4G A;  4C8Q G;  2D9T A;  3A5Z B;  2LCC A;  3F70 A;  2DD4 A;  5FU6 C;  3JCM Q;  4B9W A;  1M1K U;  4IUV A;  3V8K A;  2LNV A;  4BI4 A;  2P0K A;  2ZCF B;  1GXI E;  4JRK A;  2VC8 A;  3E19 A;  3MO8 A;  5C0M A;  2MWP A;  3JCM g;  2E1H A;  4OMF B;  3MP8 A;  5CR2 A;  2X35 A;  5LJ3 d;  2HBP A;  4QQD A;  3LGF A;  4PJO A;  4Y28 E;  4EMK A;  5HKC A;  3CC4 T;  1M90 U;  1Y96 B;  4M7D E;  2OTJ A;  4DOW A;  3E9F A;  3OW2 A;  2DTI A;  4KUI A;  3WVD B;  1PSE A;  1I4K 1;  3QJY A;  4C0D B;  1NJI C;  3S6W A;  3ZBD A;  3MET A;  1VIE A;  5L8R E;  4M78 D;  4C92 A;  4EPC A;  4JLI A;  2DXB A;  3QDR B;  3OMG A;  4NS5 A;  1KQ1 A;  4J83 A;  4EMG A;  5LJ5 g;  4R55 A;  3CPW S;  1YJW T;  3E1S A;  3M59 A;  2G3R A;  2XHC A;  4Z02 A;  4BY6 C;  4IUU A;  4PJO C;  1YJW A;  1HXD A;  2QQR A;  3V8L A;  2K5F A;  4QW2 A;  3QUI A;  5FRO A;  2CZ7 B;  4EMK C;  1RI0 A;  1B34 B;  2CZ1 B;  2LDM A;  1P92 A;  3URG A;  4QVC A;  1LOJ A;  2KSS A;  3S3M A;  2GQV A;  5CAI A;  4J6X A;  1QP3 A;  1QW1 A;  4MDW A;  3TCJ A;  4C92 C;  4EMH A;  1Q86 C;  3GLX A;  1D3B B;  1Y71 A;  2KDS A;  3I55 T;  3JB9 J;  2WSE E;  4QVZ A;  4E7L A;  3RKY A;  3FLG A;  3I55 A;  2GFU A;  2YLB A;  4L59 A;  4VUB A;  4F7U A;  3RMS A;  5LJ3 j;  3SD4 A;  4NL3 A;  4M75 A;  2K3Y A;  2RA2 A;  3FEO A;  5GMK i;  2LC4 A;  2XK0 A;  2EJ9 A;  2HQX A;  3JCM J;  1BI3 A;  5IN1 A;  3EAE A;  5GAO r;  2XD0 A;  4C5E A;  5GAN 3;  2R5A A;  4OB0 B;  5GAM e;  2DPP B;  4M78 G;  1M1K C;  2V8I A;  5GAM j;  1N27 A;  2X4X A;  3C94 A;  3CCQ T;  3X20 B;  1VQM T;  2P0Q A;  3MEU A;  4M75 C;  1YBY A;  4M77 E;  4R56 A;  3CCQ A;  4XU3 A;  4XU2 A;  1VQM A;  1X01 A;  3M53 A;  3JCM f;  5CKF A;  3C95 A;  1WJQ A;  2VGN A;  4J8O A;  5CKH A;  5GAO q;  2M1H A;  5EG2 A;  2RO0 A;  3OS2 A;  1JJ2 S;  4C8Q E;  1HK9 A;  3PNW C;  1Y7X A;  3QYG B;  1VQ5 T;  2RB6 A;  3CCR T;  1X6O A;  1VQ5 A;  1VUB A;  5FRM A;  4XTX A;  1XQH A;  1Q7Y C;  2QQS A;  3M4Y A;  1YIJ T;  3UPU A;  2K3X A;  3FJP A;  2LVM A;  3H6Z A;  3QJ6 A;  4N4H A;  1YIJ A;  1KHC A;  1NE8 A;  5LJ5 f;  1LNX A;  3MCA B;  4M7D A;  2R57 A;  3ER0 A;  3L2Z A;  4RCB A;  3L42 A;  2VYT A;  3QHS A;  1QVF S;  1WQ7 A;  2EYQ A;  2PU9 B;  3HSB A;  4M77 F;  4FT2 A;  3M5A A;  5J3B A;  3WXM B;  3BW1 A;  3HRT A;  5GMK e;  2FYK A;  4IUP A;  3MP6 A;  5GMK j;  2BIV A;  4QQ6 A;  2ZPH B;  4ZGJ B;  2DXU A;  1WNL A;  1BIA A;  4BDZ A;  4M7D C;  4P5N A;  1X75 C;  3HP9 A;  4BY6 B;  5I21 A;  2QTX A;  4UC4 A;  3CCU T;  1KQ2 A;  1FX7 A;  5CKD A;  1VQ8 T;  2B8A A;  4EMK B;  4L6V 5;  3SWN B;  2DIG A;  3OYB A;  3CCU A;  5KH6 A;  1VQ8 A;  4A4F A;  2FHD A;  3DLL A;  1N9R A;  3OYM A;  4OVA A;  2E5Q A;  2RHI A;  1N8R U;  2DEQ A;  4N4I A;  3V8J A;  2F69 A;  5A2Q E;  3BDU A;  2XI9 A;  1YIT T;  1G5V A;  1KQS A;  3R6O A;  4C0Z A;  2EQM A;  1YIT A;  1PSF A;  4LDU A;  4HT8 A;  1IZ6 A;  5CCA A;  4JDS A;  5GMK h;  3G7Z A;  3OY9 A;  3CBM A;  1N6A A;  4ZN3 A;  3JCM d;  3OYI A;  1XOV A;  4L5G A;  4TVR A;  1QP2 A;  2WAC A;  2KY9 A;  2LT1 A;  2QXF A;  3CEY A;  3X24 B;  4C5I A;  1WGS A;  4QQG A;  2HD0 A;  3RKW A;  2QI2 A;  2YLC A;  2ZPB B;  4M78 E;  5A0D A;  1ZBX A;  4J7I A;  4BI8 B;  4M77 A;  4MZT A;  4J5Y A;  3OW2 S;  2EJF A;  2QQA A;  3BY7 A;  4X9C A;  4F7U B;  5GAN h;  1OZ2 A;  3OB9 A;  4FM4 B;  3HL8 A;  4M75 B;  2V8J A;  3VJP A;  2K4Y A;  2O01 E;  2PUO B;  4C8Q A;  4BAC A;  5LJ5 d;  1NJI U;  3JCM V;  2BUD A;  5CKE A;  5I2S A;  3HFN A;  4HA8 A;  3C12 A;  4J7F A;  2DAQ A;  4OB2 B;  3JCM P;  3S3N A;  4NL2 A;  2E64 A;  3RIR A;  1XTD A;  2O4X A;  4FIB A;  3CXC A;  2IG0 A;  3M55 A;  4HT9 A;  4M77 C;  2RH2 A;  5LL6 S;  3ZFJ A;  3J80 E;  2XKO C;  1W2B A;  1G3T A;  4FT4 A;  3GPL A;  4KT0 E;  3L2W A;  1G3S A;  5AYF A;  3LWI A;  2MI6 A;  3CC4 A;  3PIO A;  4ATO A;  4C8Q C;  1UGP B;  2RJD A;  4M78 F;  1Q7Y U;  4MZP A;  3FC3 A;  4M7D B;  1I81 A;  2IVW A;  2DVE A;  2E6N A;  3FRN A;  4OB1 B;  3CCE T;  4YTL A;  1XNI A;  4XTZ A;  3WVE B;  4OGC A;  1YJ9 T;  1N8R C;  3CCE A;  4M75 D;  1YJ9 A;  3GOX A;  3V7C A;  4JS5 A;  4E7I A;  2LCL A;  2RJF A;  4RCC A;  1K9M U;  3A8M B;  1LJO A;  3X28 B;  2QDY B;  2ZGW A;  1UGS B;  5FLX E;  5C6S A;  2DO3 A;  3FIF A;  5LJ5 j;  3OSS C;  3L2U A;  3RER A;  5A0G A;  3M54 A;  2LQK A;  2K2V A;  4BI3 A;  3LH0 A;  1VQK T;  2K57 A;  2RJC A;  1WJR A;  3M57 A;  4KBM B;  2VXE A;  5LJ3 e;  1VQK A;  2E12 A;  4E7K A;  2DK3 A;  3CME T;  1VQO T;  1W4S A;  4ZTF A;  1BI0 A;  2OAU A;  2CZ6 B;  2DXT A;  3CME A;  3KXT A;  1VQO A;  5HK0 A;  5GMK l;  2P0P A;  1JBM A;  3MEV A;  2Y4Y A;  4ZGE B;  2LQ8 A;  4A54 A;  4E7J A;  4QVD A;  3JCM b;  1MGQ A;  4MMK A;  3DKM A;  2JNG A;  2FVU A;  2RI3 A;  4LDY A;  2X4Y A;  2WSF E;  3LLR A;  1YCY A;  2V8K A;  4M78 A;  4F7U G;  2QEX T;  2L89 A;  5J39 A;  1VQ7 T;  1I8F A;  4XU1 A;  4M75 G;  2QEX A;  2WSC E;  4ZGD B;  1VQ7 A;  3CMA T;  4M7A B;  5LJ3 h;  4II1 A;  4OF1 A;  4Y91 A;  2F5K A;  5GAM g;  3M9Q A;  3CMA A;  3TU4 K;  1M1F A;  5GAN 4;  2LT4 A;  5GAO p;  1WQW A;  5FU6 B;  5KE3 A;  2L8D A;  3CCR A;  3NTK A;  4MML A;  4XQ3 A;  3G4S T;  3ASK A;  4M78 C;  1M9S A;  2XID A;  4KUD K;  3VUZ A;  2EAY A;  5I2M A;  3TEE A;  3VV0 A;  2E10 A;  3G4S A;  4HCC A;  3GIB A;  2E70 A;  3JRZ A;  3FB9 A;  5GAM h;  2XDD A;  1OYX A;  4XAX B;  2XG8 D;  3OYD A;  1K8A U;  3CCV T;  1BKB A;  5CIU A;  3OYJ A;  4LDX A;  2VV5 A;  4GLK A;  4A4H A;  4XK8 E;  4X9D A;  5GAN 6;  3LW5 E;  1Y96 A;  2JUF A;  3KUF A;  3CCV A;  2XIC A;  3GNF B;  1K9M C;  1Q81 U;  2NLU A;  3RUX A;  1Q82 C;  2RD1 A;  2ZPF B;  4FU6 A;  1KQS S;  1UGR B;  2D0Q B;  2R58 A;  2PUK B;  5FRN A;  4JRQ A;  1IRE B;  1G3W A;  4A4K A;  2RI2 A;  2O4X B;  4D6W A;  2KK4 A;  3HKS A;  1M8V A;  3HPW A;  4C5H A;  4N4G A;  4M7A D;  2YHT A;  2ZPE B;  3PTA A;  4DA4 A;  4DQ2 A;  5KE2 A;  4PJO B;  2RK1 A;  3P8D A;  3PGG A;  3NFC A;  4JRP A;  3G71 T;  4C0D C;  4HCZ A;  2KMT A;  3GF5 A;  3G71 A;  4BE0 A;  2GFA A;  1BI2 A;  2HAX A;  5CO7 A;  1D3B A;  2PVO B;  5CQY A;  4C92 B;  1UB4 A;  1BYM A;  1M1G A;  3MP1 A;  3GNG A;  2GF7 A;  2RHY A;  3E9G A;  5GMK m;  1M4Z A;  2P4T A;  2I2L A;  3JCM X;  3N5B B;  3PT9 A;  5GAN g;  2OTL T;  3JSC A;  5CK9 A;  2KAF A;  2OTL A;  3LYI A;  3SB2 A;  2H3J A;  3FDR A;  1V29 B;  5GAM f;  1W2B S;  2EQK A;  2RHX A;  2BKD N;  3CCJ T;  5CQX A;  4LDV A;  1ZQ1 A;  3CCJ A;  4PJO F;  3CBO A;  1UEB A;  3A8O B;  4J6Y A;  1QVF A;  4M7A G;  2FL7 A;  4F7U E;  4A53 A;  4HCB A;  4PJO D;  3CCL T;  2QQB A;  2RHU A;  4M75 E;  4OB3 B;  1K8A C;  2XDB A;  3CCL A;  5D6W A;  1KC8 U;  1QVG A;  4PL6 A;  2VUB A;  4JRI A;  3G6E T;  2LRQ A;  4OP0 A;  3G6E A;  4C92 D;  4IKF A;  3OYG A;  4PLI A;  1Q81 C;  1WPY A;  5CVI A;  1M5Q 1;  3CC2 T;  2QQ9 A;  3TRE A;  1VQN T;  2LX9 A;  3CC2 A;  2MF2 A;  2RHZ A;  3L1A A;  4IUT A;  5GAO l;  1AHJ B;  1VQN A;  4JLG A;  5GAN 2;  3BDL A;  5KCO A;  3O8V A;  3JCM e;  3QSU A;  5HK3 A;  2GCX A;  3OYH A;  3OYY A;  4LD6 A;  3QKJ A;  3JB9 H;  3QO3 A;  3QG1 A;  3L2Q A;  3J7A F;  4XTV A;  3CBP A;  1ZHI A;  4DOV A;  2JOY A;  3OYA A;  2M0O A;  4F7U F;  2Y4X A;  4M75 F;  4OGE A;  3X25 B;  4J6W A;  1U1T A;  2DZ9 A;  3H8Z A;  2Y90 A;  3CPF A;  3HHT B;  4PJO G;  4BD3 A;  3JCM W;  1VQ6 T;  5HY6 A;  3RKX A;  5IAY A;  1VQ6 A;  2YRV A;  5LJ5 e;  1NPP A;  3LWH A;  3CCS T;  1Q82 U;  1K73 U;  2CS7 A;  1QVP A;  3BFM A;  2DTO A;  2RK2 A;  3QBY A;  4XTW A;  3SWN A;  3CCS A;  4JJN K;  4BDY A;  1U8R A;  4MDX A;  3MEA A;  1H3Z A;  3OMC A;  3LX7 A;  4RG8 A;  4C92 G;  2RI5 A;  5GAN f;  2ZPI B;  3OYE A;  4BE2 A;  3JCM h;  2DZC A;  3JB9 F;  2MAM A;  2ZPG B;  3HRS A;  3JB9 D;  2CGH A;  3A8L B;  5GAM d;  1OI1 A;  3JB9 I;  3EFR A;  3INZ A;  3X26 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...