4C0FA

Structure of the not-box domain of human cnot2
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
96
structure length
96
Chain Sequence
b'AIKLGRYGEDLLFYLYYMNGGDVLQLLAAVELFNRDWRYHKEERVWITRAPGMEPTMKTNTYERGTYYFFDCLNWRKVAKEFHLEYDKLEERPHLP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords CCR4-NOT TRANSCRIPTION COMPLEX SUBUNIT 2
publication title Structure and Assembly of the not Module of the Human Ccr4-not Complex
pubmed doi rcsb
source organism Homo sapiens
molecule tags Gene regulation
total genus 19
structure length 96
sequence length 96
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-08-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.1020 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4c0fA00
4C0DB 4BY6C 5FU7B 4C0DC 5FU6B 5FU6C 4BY6B 4C0GA 5FU7C 4C0FA
chains in the Genus database with same CATH superfamily
4R0KA 3OYHA 1O75A 2A37A 2QQSA 3UA6A 1I0CA 2ED0A 4M75G 1I5LA 1Y07A 2HQEA 4QKUA 2AKLA 2E3IA 2JZ2A 2EYXA 2P84A 4RMOA 1U1SA 1NM7A 1Q95G 5GAOq 2E6ZA 4KGXB 4ZN3A 3ZFJA 3OB9A 5GMKm 2A36A 5GAMj 2OAWA 2OTJT 2J06A 3OBYA 1WHKA 1M9SA 3RMSA 1RLQC 1WNLA 2OTJA 1AT1B 3NGPA 3X24B 1WGSA 1VQMT 5LJ3d 1NEGA 2H3EB 1VQ4Q 3PFSA 5A0DA 1K73R 2EGCA 1H641 2GTOA 3P8DA 2JTFA 3OW2S 3TSZA 3A5ZB 5L23A 2RQRA 4LD6A 1EFNA 2KT8A 3QDFA 3G6EA 2Z0WA 3CXCP 2XI9A 2ZPFB 2DVJA 3VU3C 2FRYA 2K5LA 5CKDA 3CCSQ 3CC2A 3CCJT 2CUBA 5I21A 2FHDA 3OMCA 3UF4A 1YBYA 3HRTA 2EPDA 1N5ZA 2RB6A 4JZ4A 3RKYA 2A08A 3OYNA 4CC4B 2VWFA 1PKTA 3R6OA 1BK2A 3VJPA 4DQ2A 1VQPT 1KG1A 1VQPA 2RI3A 1W70A 3UA7A 3ZL7C 2ZAEA 2EFIA 5GAN6 5LJ3j 1D3BA 1WXBA 2DLPA 3EGXA 1PSEA 2DMOA 1YIJQ 2YHTA 5I22A 3JB9D 3VV0A 2AHJB 4B9WA 2YUOA 5L8RE 2MK5A 2QEXA 3AHUA 1FXXA 2JT4A 4LNPA 1WZOA 3D7SB 1UG1A 4M77B 2PUKB 5GANg 4A4HA 4FCYA 2EQIA 4EMHA 3INZA 5LL6S 4PNOA 1Y71A 4C5IA 3CMAQ 2O31A 4DBQA 3E9GA 1QVGP 5CAIA 2L89A 2X4YA 4N4GA 1B34A 1A0NB 2QA4Q 2NWMA 4M77G 4FU6A 4OMPA 4IUVA 2C0TA 2IIMA 1ZUKA 1X69A 5FU6C 2GNCA 1SHFA 3GP8A 2LZ6B 2CKKA 3LX7A 2EYZA 1EZZB 2GFUA 1SSFA 4C5EA 4PJMA 2JS2A 2FPEA 4PJNA 3SB2A 2DRMA 5M9OA 3LW5E 4X1VA 4LDYA 4MMKA 1YJNT 4YTLA 2XMFA 2Y4YA 4RG2A 3CCQQ 5I11A 2DYIA 4F7UE 2QAZA 5IHNA 4OMOA 4OB1B 1PSFA 3FEOA 4ZTFA 4XU3A 4IURA 2LCCA 1AD5A 3EFSA 3LYIA 5KYYA 2DBKA 1VQ4A 3NMZC 5HK3A 1JBMA 1K9AA 4JRKA 1ACMB 4P5NA 5FU7C 2KE9A 3OS2A 1Q86U 3I35A 3I56T 4HCBA 3I56A 2HKNA 2CS7A 1UDLA 3M9QA 4LUEA 4MZTA 3A8MB 2DXTA 3J80E 5KCHA 3CCSA 4BE2A 5KE3A 4RTTA 1H3ZA 1C6VX 1SSHA 2ESWA 4DBHA 3UATA 2FRWA 4J9BA 1SHGA 1CKBA 1WJSA 3A8HB 3CPFA 2ABLA 3HFOA 4E7KA 1ZBJA 2AZSA 1KQSP 1TWBA 3QWYA 4BE1A 2HD0A 3GLXA 3LWIA 4HT9A 3GNGA 2O4XB 3RDVA 1Q82C 1C0MA 1YIJA 2AIRB 2CP2A 3THKA 1TG0A 3L2WA 2DPPB 1ABQA 1IHVA 1NLPC 5GMKl 5GAN3 2BTTA 2X4XA 2OX7A 3PIOA 1V29B 4JRIA 2D8JA 2WSCE 3DKMA 2DTHA 4LXCA 1OV3A 4KGVB 2KMTA 2L3RA 3MPUB 4QW2A 3CMAA 1IRXA 4C8QE 1BIBA 3I55Q 3VS7A 3DLLA 1VQ9Q 4JLIA 4ELYC 3EHRA 2QA4A 2P0PA 2YLBA 3ASKA 3JCMV 5IXFA 1GFCA 1GCPA 3JRZA 2E64A 1IGQA 1NLOC 1Q86R 1JO8A 2DA9A 4A4FA 3S3OA 2E10A 1KJWA 2BE9B 1FWZA 4DOVA 1QWEA 4M78A 1M2VA 3VKIA 4XQ3A 2CH4A 3JCMh 3P8BB 1QVPA 4KRTA 2LT1A 2K57A 3CCQA 2IPOB 2MYSA 4C8QC 1PD1A 2RQVA 4KULA 3OYJA 4Z02A 4AG2C 4M7DA 3CBMA 1RACB 3OY9A 3RR6A 3VS2A 4ZTJA 4R56A 4J5YA 1YHQT 4J9DA 3QXEB 1K9MC 5D6WA 3H6ZA 3BDLA 2KYMA 4E7SA 4M75C 3OYMA 2PQWA 1X27A 2VGMA 1G5VA 4XAXB 3H0IA 3GPLA 3KXTA 1QQJA 3ULRB 1JXOA 1YI2Q 1PG5B 2JMCA 4RG8A 1V1CA 4ZNXA 1TSFA 2EQMA 3JB9I 1YJ9T 2ATCB 2PVOB 4BDYA 3MHXA 2RM4A 2LVMA 4C0FA 1GBQA 2DNUA 4B9XA 3CXCA 5GAMg 3CCLQ 2KT1A 3EGUA 1I1JA 1WIEA 1NYGA 3EG9B 2X4JA 3EGDB 3CD6T 3EG3A 2F69A 5KYWB 3NFCA 2BE7D 1SKUB 5C0MA 1VOMA 1AWXA 4UC4A 4KUDK 2HSEB 4M78F 1BI2A 2FO0A 4Q5WA 1OX9A 4HCCA 2SRCA 3PNWC 4ESRA 1D0XA 3MJXA 4OB2B 3GOXA 2QG9B 3HSBA 3PE0A 1WPYA 2BKDN 2V8IA 1MNDA 5FWCA 4OMQA 1GRIA 2R5MA 3ME9A 2LNHB 4M7DF 2EGAA 2QI2A 2QTVA 3V8KA 3CPWS 3I55T 2XHCA 4DBFA 1VQLT 3M54A 2RPNA 3I55A 1SEMA 1VQLA 2BUDA 1H3HA 2MWPA 3QO3A 1D1BA 3O5ZA 4CC3A 5LJ3g 2HKQB 3UPUA 2J7IA 4CC7A 1QVGA 3N5BB 4F7UB 2NUPA 3CCUQ 2OTLQ 2VGNA 2MOXA 1NPRA 1G3SA 1UGSB 1S1NA 2RHYA 3HKSA 2DIQA 1SG5A 1U8RA 1VQ8Q 1WHGA 2OAUA 2ROLA 5D6YA 2KXDA 1M1FA 3JCMJ 5GMKe 4AMCA 2KRMA 1VQNT 5KYUA 1OZ3A 4F7UG 1VQNA 4B6MA 1MV0B 3NHNA 3H8ZA 4JJCA 2DAQA 4OMFB 2NYSA 5CVIA 4JPBW 5GANe 1WA7A 2RO0A 2K6DA 4NL3A 1ZX6A 3M4YA 1XJWB 1ABOA 2KVQG 2EQUA 1LVKA 4KBMB 2K7AA 2QTXA 1AOJA 4E6RA 5LJ5h 4XK8E 4Z8AA 1ZLMA 3FB9A 1X2QA 3FJPA 1YI2A 2CZ1B 4RCBA 1KHIA 2COWA 2KEAA 1M90C 1IB8A 1KIKA 2XD0A 1Q81U 3CC7T 3HL8A 2KNBB 4FT4A 3CCLA 1BKBA 1VQ7T 3PVLA 3F70A 4QQ6A 1PHTA 4QT7A 3CC4Q 2FPFA 2ZPIB 1RI9A 4FIBA 2XIDA 3SWNB 3OYFA 1BI0A 3QUIA 5CQXA 1MV3A 1MNEA 2LJ0A 1O9SA 4PLLA 1KQSA 1YWPA 2K79A 1WHLA 1WXUA 4LDWA 3JB9G 4L5GA 2HL3A 3JCMd 1KC8C 4BY6B 4C8QB 2DL8A 2DILA 2KRNA 2PUOB 2EW3A 4K11A 3TVTA 1X43A 2RMOA 2FB7A 1WHMA 2GGRA 4RUGA 4Y28E 1X6OA 1VQ5Q 2RF0A 4II1A 5IT9E 4HXJA 3BDUA 2KDSA 1R8OB 4BE0A 1CSKA 4M75F 2RQWA 5KH6A 2EQJA 1N9RA 4JLGA 4C8QG 2L5QA 5GAN5 5CKHA 4GBQA 1YN8A 2C06A 1M3BA 4OF1A 2X35A 2EJFA 4WF2A 2OTLT 4WCIA 3VRYA 5GANf 3CCUA 3HHTB 2OTLA 1QVFA 3A8LB 2ZZDA 1WQ7A 3CCMQ 1MMDA 2V8KA 3EFOB 2E65A 4L59A 1VQ8A 2CZ0B 2QQAA 4MDWA 2D0NA 2QK0A 1WQWA 1Q81R 1RAEB 1T0JA 4M78D 4OMMA 1KK7A 3M0PA 4N4IA 2MAMA 1NJIU 2WSFE 4M77A 1IREB 2LJ1A 2EIFA 2VV5A 4M7DD 2E5QA 3MKDA 2LQNA 2GQIA 1PRMC 2DTIA 1W4SA 4M7AA 2CH4W 3H41A 4PJOA 2LMJA 1W2BS 5IAYA 3M55A 5AYFA 3MEAA 1XQHA 2EJ9A 2C0IA 2RHXA 4A63B 2XICA 2VKNA 1NBEB 4IKFA 3G6ET 4XTYA 3OYEA 3QSUA 3DLMA 5GAN4 3QIIA 2CP3A 2KI7A 4JJBA 3CC2T 5D7UA 2XDPA 9ATCB 3CC4A 1KD1C 2JXBA 4FT2A 3O8VA 2HEQA 1WHJA 4E7LA 3E1SA 4R55A 5HY6A 1OU8A 3PGGA 4RTZA 4OVAA 1FMWA 3EH1A 2HQXA 2PVDB 3OMGA 4C0ZA 2FVUA 2JTEA 3R6NA 4C5GA 3EG1A 4LDVA 3C4SA 2RK2A 2XDBA 2GBQA 1UB4A 1RAIB 2DBMA 3CBOA 4J6XA 4HVVA 2DX1A 3NPFA 5GMKh 4XTXA 3CCEQ 5FRMA 4C92D 1VQ5A 2CDTA 2F5KA 7AT1B 5GANh 2QEXT 3WVEB 1YITQ 4J9GA 2QQ9A 3SD4A 3X28B 1NG2A 4M77F 4F04B 1KFZA 2CUDA 5ECAA 3PMIA 2KY9A 3MEWA 1G3WA 4CRIA 1W6XA 3Q1JA 1NJIR 2ED1A 5GAMe 4EMKC 5LJ5d 3TREA 1WX6A 2DZ9A 3S3MA 2RHIA 4M7AF 4PJOF 4FL6A 1HSQA 1GCQC 1ZUUA 2DRKA 3CCRQ 1X6GA 1BU1A 3VS4A 1LNXA 4J7IA 1BB9A 1RAAB 1M3AA 1QKXA 2KRSA 2RD1A 4QVZA 1SF9A 3G4SQ 4FYVB 3GBQA 3T9NA 1UGPB 1OU9A 1QW1A 1JJ2A 4ORZA 2LNVA 3PTAA 3NTIA 2V8JA 4ANJA 2KK4A 3L2ZA 2RHZA 1G3YA 2CZ6B 2RQTA 2K9GA 2DEUA 1Q7YC 1YFNA 3GIBA 2RK1A 3OS5A 4BD3A 2KROA 1VQ4T 2HBWA 3M4GA 5KYXA 5LJ5j 3EH2A 5HK0A 2MWOA 2J05A 1C1AA 3QYGB 2KQWA 3CBPA 2O88A 1QCOA 4EIKA 1OYXA 1ZQ1A 2DJQA 1ZBXA 4PJJA 2KAFA 1K4US 4HA8A 3CCST 2WSEE 3OYAA 2MPXC 3EFRA 2D6FA 2CSQA 2HNIA 3EGXB 2GF7A 2K3YA 2VXFA 2K2MA 2KGTA 4BDZA 3LGFA 1AVZC 1M5Q1 2COYA 1QKWA 2RJCA 2DXUA 1M8MA 2MI6A 2K3XA 2RA2A 2BZYA 5KE2A 2AZVA 2B8AA 1GBRA 1T0HA 4C92E 3J81E 5GAMf 1YIJT 4BB7A 2PU9B 3PT9A 4WTOB 1QCNA 3CCEA 3CCVQ 4D8DA 2DF6A 3FRNA 3L42A 2JOYA 3TEEA 1B34B 3C12A 1YITA 4DA4A 3V7CA 2EKOA 1UGRB 2CT4A 1X75C 2LQ8A 3EG2A 3M59A 1RADB 1PC0A 1TU0B 3VS3A 3CMAT 1IO6A 2HQHA 4IUUA 2Y90A 1TH7A 1UJYA 2JJ9A 3VS1A 1SRMA 3CCRT 2QA4T 1WYXA 3M57A 4RTYA 2E41A 3RKXA 3S6WA 4C92C 3CCRA 1QVFP 2QQRA 2K2VA 1YCSB 1UGQB 5CO7A 3QJ6A 1KD1U 4GY5A 3RKWA 5FW9A 3G4SA 5KYYB 2HAXA 4HT8A 2HSPA 2YLCA 1OX8A 3QWXX 4E7IA 3JB9J 3WXMB 3SWNC 2YWWA 1UGVA 2CP7A 5LJ3f 4Y92A 3CCQT 4F16A 1I8FA 2SEMA 2M1HA 4ELZC 1VA7A 4FM4B 2HCKA 4BY6C 1M3CA 2L3QA 5CCAA 2DYBA 2RNAA 2EYQA 4M77D 3SEMA 1LPLA 1YP5A 1K73C 2DD5A 3X20B 2CYZB 2Y4XA 1M4ZA 1BIAA 3QBYA 4M7AD 4OB0B 3JCMg 4PJOD 5GJVB 2EAYA 4A4EA 4EMKB 4AFSC 1X2KA 4RKUE 2VUBA 4F7UA 2WACA 2QYZA 2DE0X 3PIPA 3OYKA 2O2OA 3REAB 4HVWA 4J9HA 1MMGA 3LH5A 3L2VA 3OW2A 4X9CA 4BI4A 3UT1A 1M27C 3NTHA 2IVWA 4D6WA 3MEUA 2DVEA 3E19A 2LTOA 2DL4A 4FW2A 3UDCA 4XU2A 2JMAA 4IIMA 4A54A 2P0QA 3I5SA 2CP5A 4QQDA 1IGUA 1ARKA 2D0QB 1KD1R 1VIEA 2DD4A 1G83A 2CGHA 4Y91A 2V26A 4C5HA 4HKEA 3J7AF 2DTOA 4XTWA 1J3TA 1RI0A 3JB9H 1N6AA 3BW1A 1H92A 2QDLA 1VQ6Q 2L3SA 2P4TA 2M16A 2XDDA 1VUBA 2J6OA 1S72Q 1EX4A 1M2VB 2NUTA 1VQ9T 2LX9A 1VQKQ 3MEVA 4IUTA 3CPWP 1VQ9A 1M8VA 1NPPA 1K1ZA 1R0CB 3FIFA 3TCJA 1AWWA 2D8HA 4DEYA 2YT6A 3JCMQ 4M7DB 1HXDA 2EQKA 1B3QA 4F7UF 3EG0A 3A8OB 1U3OA 1T3SA 2FZCB 1JJ2P 2DJZA 1F1BB 4KH1B 1GFDA 1B07A 2E70A 4NL2A 1LCKA 4C8QA 2F2VA 2DXCA 4VUBA 1MMAA 3IQLA 2ZPHB 2LQWA 1KSWA 2EYWA 2JVVA 1GL5A 1W1FA 1N9SA 3KFVA 4M7DG 1Q82U 3V8JA 3E9FA 2H8HA 4J8OA 2XG8D 3OYDA 2E12A 3G7ZA 3M0QA 1H8KA 4PKCC 1ZSZC 4RTXA 4C0DC 4MMLA 4LD9K 4PFOA 1AWJA 1MGQA 1WXTA 4MZMA 2CREA 2LP5A 2DL5A 2E4HA 4M75A 4J7FA 4LN2A 4E7JA 4PL6A 2E1HA 3M56A 2JNGA 2RQUA 4XU1A 1YI2T 8AT1B 5GAOn 1UECA 2IG0A 2J6FA 4JZ3A 3H0HA 3QG1A 2A28A 1JU5C 4DOWA 5GAN2 2VC8A 2R58A 3KBGA 4C92B 3JB9F 3CCLT 2GQVA 2OTJQ 3EFOA 2M0OA 3GNFB 1YNZA 2LC4A 1OEBA 4NS5A 4JJDA 3URGA 1VQMQ 1ZUYA 5GAOm 5I2MA 5CKFA 3V7RA 3ZBDA 2YRVA 4ZGJB 2JW4A 5J39A 3OBWA 1BCMA 2XK0A 4OGEA 5LJ5g 2X4WA 3CMEQ 3TU4K 2P4RA 2EWNA 4C92G 2HDAA 1WJRA 2O9VA 2X9HA 1IXDA 4C8QF 1NZ9A 1SRLA 5GAOp 2DIGA 2P0KA 3CCJQ 4M4ZA 1EIFA 1XNIA 4LDXA 1VQ6A 4OB3B 1VIFA 2NUPB 1WJQA 3OYIA 1OULA 1K9MU 1S72T 4E47A 1VQPQ 3JCMb 1Q82R 1U06A 1S72A 1CKAA 2M9UA 2ROTA 1YJWQ 2G3RA 1VQKA 4PJLA 2D1XA 2ZPGB 3HPWA 3FLGA 2R5AA 3NTKA 2DERA 4PK4A 1ZA1B 2RJEA 3RUXA 1NEBA 3CCUT 2DFUA 2K5FA 1PNJA 2RHUA 3H0FA 1HD3A 3OSVA 3LWHA 3EHQA 4J6YA 1E6GA 5I2SA 5GAN8 2DXBA 3OS1A 1Q86C 1VQ8T 1PWTA 3TQ7P 1PM3A 2R57A 4J83A 2L2PA 3H9NA 1E7OA 3SHWA 2OJ2A 3PVQA 2K3BA 3QYHB 4X9DA 5A0LA 4F14A 4KT0E 5FRNA 2RN8A 1Y96B 1AWOA 1M30A 4Z88A 1ZSGA 1RAHB 5GAOr 3VUZA 4OP0A 1VYVA 4C0GA 1GXIE 4LDUA 4TVRA 1PD0A 4BI8B 1I4K1 2NUZA 3M0UA 4FSSA 3QDRB 2EGEA 1X6BA 2KXCA 1WFWA 3RESA 2YUPA 4NOYA 4QVDA 4EMGA 2COZA 5AT1B 2A7YA 1P92A 4JS5A 4AFZC 1YJNQ 1MMNA 2K5IA 1W2BP 2K4YA 3OW2P 2V1RA 2FPDA 2GTJA 5CKBA 4FSXA 2YSQA 2VB6A 3JCMc 3AT1B 1K9MR 2L8DA 3QZ5B 3CC4T 1VQMA 2AK5A 5FWBA 2VXEA 2AKKA 5DLQE 3FC3A 3CXCS 4X34A 3CMET 1QP2A 1WLPB 3BE3A 3M0RA 2RJFA 3I56Q 3CMEA 2X3XD 4OMNA 1TUGB 4A4GA 2W10A 5KYNA 1D1AA 5CQYA 3G71Q 2X3WD 2ZPEB 3C94A 3S3NA 2KBTA 4A4KA 1QP3A 3OYYA 4RTWA 5J26A 2I0NA 2F1LA 3MP8A 3CCJA 3HFNA 1YWOA 3I5RA 1ZSZB 4C0DB 5IHKA 1VQ5T 2O01E 4QQGA 2M51A 2QXFA 4KH0B 2O9SA 4FYXB 3JCMe 3RNJA 2DO3A 3VRZA 3OYCA 1QWFA 4BUGA 1T3LA 2YUQA 2DKGA 1YJWT 4CI0C 3L2RA 3SFMA 1YJWA 1NE8A 2LCSA 2BZXA 2YUNA 3M53A 4D8KA 1JRIA 1M90U 2ZGWA 1K76A 4KUIA 4LUDA 4QVCA 1D1CA 3ZEHA 1M1KC 3RERA 3CPWA 5J3BA 1M2OA 4J9CA 3CCMT 5CIUA 2LQKA 3SDZA 5A2QE 5EC7A 3CCMA 2FYKA 1QVGS 6AT1B 2XU8A 3M5AA 4M78E 2O4XA 5GAOl 3MO8A 4M7AB 1LOJA 1Y57A 4PJOB 3LH0A 5IH2A 2YRCA 3QJYA 3OA6A 1BI3A 2I2LA 2KYBA 4C8QD 4BI3A 5IXBA 1KC8U 4M7DE 1TUDA 2CP0A 2DM1A 3QKJA 4ZN1A 1K8AC 2RJDA 2ECZA 1JEGA 1E6HA 4XTZA 2ENMA 4M7AG 3TSWA 5DM7R 2YDLA 2EBPA 1I81A 3I9QA 4PJOG 1QCFA 3X25B 4M75D 5GAN7 3QZ9B 4AG1C 4IIOA 5LJ3e 2DL7A 4M78C 1YJNA 3V8LA 2L0AA 5A0GA 4RCCA 4XTUA 2JTMA 8ATCB 3OYGA 1N8RC 4J9FA 2G6FX 2VVKA 3A1PA 3A8GB 4OMLA 1D3BB 3C0CA 2KR3A 4M7DC 1OZ2A 5C6SA 1YHQQ 5CKEA 1FMVA 1LJOA 3JCMf 3P8HA 2JN0A 3G71T 1M90R 3G71A 4FYYB 1KQ2A 1JXMA 4OGCA 1TTHB 3C95A 5FLXE 1AHJB 1JQQA 2QGFB 2QQBA 3RIRA 3CCET 1YJ9Q 1KQSS 1BBZA 2M02A 4RTVA 4HVUA 2DK3A 2RI5A 1YITT 1XOVA 1RUWA 2HZYA 1DJ7B 4EDUA 1TOVA 1VYTA 4HCKA 4EMKA 3RBBB 3L2UA 3META 2MIOA 3CD6Q 2NLUA 2LDMA 1GCQA 1KC8R 1HYOA 3JCMP 1WI7A 1Y0MA 4IUPA 5LJ5e 3HTRA 3JV3A 2LJ3A 3EG9A 3EGDA 1D0ZA 2FZKB 3G4ST 4A53A 1N27A 5KYWA 1PRLC 5KYXB 3JSCA 4GLMA 1U5SA 1QVFS 1MHNA 2MMPA 2V1QA 1VQLQ 1AZEA 2ZCFB 2RH2A 5HCKA 4LE9A 1OPKA 3LLRA 1Q81C 3JCMW 2EJGA 1PKSA 3VUBA 2JM8A 2EYYA 2HL5C 2QDYB 4L6V5 1TUCA 2CSIA 4M75E 1XTDA 2PVGB 3EAEA 3VYGA 3L2QA 2GCXA 3JCMX 1UEBA 1D0YA 2DZCA 3VS0A 5GANd 5IHIA 1KHCA 1OI1A 5CK9A 2A3LA 2CZ7B 3PMTA 1HK9A 1U1TA 1VQNQ 2X51A 5FROA 2DL3A 4O5VA 2A0FB 1VQOQ 2LX7A 1UHFA 1M1KU 4E7HA 5GAMh 1I5OB 2GFAA 2E5KA 1W2BA 3MCAB 1YHQA 3OQ5A 3M58A 2EVRA 1QLYA 2F5TX 2FG0A 4DBRA 3OS0A 4N0AC 4Z89A 5DY9A 1FMKA 4JRPA 1OOTA 1UJ0A 2YRDA 3A98A 3OYBA 3DB4A 2FL7A 1ZA2B 5GMKj 3CCVT 3HP9A 1YJ9A 2LCLA 2L3PA 2XKOC 5GMKi 3CCVA 2B86A 2OI3A 2H3JA 1K8AU 1UFFA 1Q7YU 3CC7Q 5FU6B 4ZGEB 3RMQA 5GANj 2BZ8A 4XTVA 3VS5A 1R77A 5LJ5f 2AT1B 1VQ7Q 4PFZA 2DETA 3OSSC 2J6KA 1TS9A 2BIVA 4MDXA 2E3HA 1I07A 1G2BA 4V2SA 4E7ZA 3CD6A 1RL2A 2F2XA 4EPCA 4E2FB 3V7SA 2DEQA 4C92A 1RABB 4M78B 1NJIC 1G8XA 5LJ3h 1N8RU 2M0YA 3VYHB 4ZGDB 5IN1A 4KGZB 3SWNA 4N4HA 5FU7B 3VS6A 3FJ5A 4AFQC 2C0OA 4M78G 1UE9A 1UHCA 1BCOA 3U23A 1NYFA 3JAME 1AZGB 1VYUA 4FW1A 3QPHA 1M1KR 1FYNA 2PTKA 1ZHIA 1YCYA 1JJ2S 2JM9A 3BFMA 4J9EA 1B7TA 4CC2A 4JRQA 3HRSA 1V76A 1HJDA 4M77E 2MCNA 4RTUA 1IHWA 4AFUC 3OYLA 4DEXA 1WHHA 3UWNA 3CEYA 2QASA 2LRQA 4M7AE 3GF5A 4PJOE 2JS0A 4MZPA 4IUQA 4BACA 3KUFA 2FEIA 4FYWB 1VQOT 1K8AR 1Q7YR 2F2WA 4PFPA 5D6XA 4XU0A 1RAGB 1VQOA 4AT1B 1K0SA 2VYTA 3M0SA 1QMCA 3LGLA 1M1GA 1G3TA 4C92F 4O6JA 4N0AA 2HMAA 4JUVA 2MF2A 1AEYA 4M77C 2D9TA 1MUZA 1KQ1A 1Y7XA 1OPLA 2KSSA 5HKCA 1BI1A 2PZ1A 4JDSA 3CQTA 1Y96A 1D09B 1N8RR 1K0XA 1TXQA 4GLKA 4M7AC 3ER0A 4PJOC 5EG2A 3M0TA 3WVDB 4HCZA 4F17A 1PCXA 3G6EQ 2YXYA 2NUTB 5CR2A 2CP6A 1WDXA 3CC7A 1RAFB 3CC2Q 2JUFA 4ME7A 1VQ7A 1Z9ZA 1UTIA 1Z9QA 2HBPA 3REBB 3FDRA 1VQ6T 3DB3A 4J9IA 2W0ZA 2E6NA 2VASA 1JB0E 4JJNK 3BY7A 4ATOA 2FZGB 1K73U 1IZ6A 3QHSA 1OQKA 1VQKT 5KCOA 2RI2A 2ZPBB 2LT4A 5DLOA 3G1JA 3HRUA 4PLIA 5KYUB 3L1AA 3E2UA 1BYMA 1FX7A 5GAMd 2QEXQ 5GJWB 2QGGA 2EKHA 4J6WA 1RLPC 4JS4A 4M75B 2PNIA 3MP1A 1R0BG 1X01A 1SPKA 3MP6A 2CT3A 1UUEA 1ZSZA 3X26B
chains in the Genus database with same CATH topology
2YLCA 4PJOB 3LH0A 4E7IA 3JB9J 3WXMB 3QJYA 2VGNA 3SWNC 1NPRA 3OYHA 1BI3A 3OA6A 1G3SA 1O75A 2I2LA 1UGSB 4C8QD 2QQSA 2RHYA 3HKSA 2DIQA 4M75G 4BI3A 1I5LA 1Y07A 2HQEA 5LJ3f 1KC8U 3CCQT 1U8RA 4M7DE 2JZ2A 1I8FA 2OAUA 2M1HA 3QKJA 5D6YA 4ELZC 1K8AC 1M1FA 4ZN1A 3JCMJ 2RJDA 5GMKe 4FM4B 4XTZA 4BY6C 1VQNT 1OZ3A 4RMOA 4M7AG 5DM7R 1U1SA 4F7UG 5CCAA 1VQNA 1I81A 4PJOG 4OMFB 3H8ZA 5CVIA 2DAQA 5GAOq 2E6ZA 3X25B 5GANe 4M75D 4ZN3A 2EYQA 4M77D 3OB9A 2RO0A 3ZFJA 5GMKm 5GAN7 3QZ9B 5GAMj 4NL3A 5LJ3e 3M4YA 4M78C 1K73C 2OTJT 2DD5A 3X20B 2KVQG 3OBYA 2CYZB 3V8LA 1YJNA 2Y4XA 2EQUA 1M9SA 3RMSA 1WNLA 1M4ZA 1BIAA 2JTMA 4KBMB 4RCCA 4XTUA 2QTXA 3X24B 2OTJA 3QBYA 3OYGA 1WGSA 1VQMT 4M7AD 5LJ3d 4OB0B 5LJ5h 3JCMg 1N8RC 4PJOD 2EAYA 4XK8E 4A4EA 3PFSA 4EMKB 5A0DA 4RKUE 2VUBA 4F7UA 2WACA 3A8GB 3FB9A 1H641 1D3BB 3FJPA 3P8DA 2JTFA 3OW2S 3PIPA 3OYKA 3A5ZB 4M7DC 1YI2A 2CZ1B 4RCBA 3L2VA 1KHIA 4LD6A 3OW2A 1M90C 4X9CA 1OZ2A 5C6SA 5CKEA 1LJOA 3JCMf 2XD0A 3P8HA 4BI4A 1Q81U 3UT1A 3G6EA 3CC7T 3HL8A 2JN0A 3G71T 3NTHA 4FT4A 2XI9A 2ZPFB 3CCLA 2IVWA 1BKBA 3MEUA 4D6WA 1VQ7T 2DVEA 3VU3C 3G71A 2K5LA 5CKDA 3E19A 2LTOA 3F70A 4QQ6A 3CC2A 4OGCA 1KQ2A 3UDCA 3CCJT 3C95A 4XU2A 5FLXE 5I21A 2ZPIB 1AHJB 2QQBA 2FHDA 3OMCA 3RIRA 4FIBA 4A54A 3CCET 2XIDA 2P0QA 3SWNB 1YBYA 3OYFA 1BI0A 3HRTA 1KQSS 3QUIA 2RB6A 3RKYA 3OYNA 4QQDA 5CQXA 3R6OA 2D0QB 2DK3A 2RI5A 4PLLA 1O9SA 3VJPA 1VIEA 2DD4A 4M7AB 4DQ2A 1VQPT 1KQSA 1KG1A 1YITT 4LDWA 3JB9G 1XOVA 2CGHA 4Y91A 4L5GA 4C5HA 1VQPA 2RI3A 4HKEA 1DJ7B 3J7AF 4EDUA 2DTOA 3JCMd 1KC8C 4BY6B 4XTWA 4C8QB 4EMKA 1RI0A 3JB9H 1N6AA 2EFIA 3META 3L2UA 5GAN6 5LJ3j 2PUOB 3BW1A 1D3BA 2NLUA 2LDMA 1PSEA 2FB7A 2YHTA 4Y28E 1X6OA 2P4TA 4II1A 2M16A 5IT9E 3JB9D 3VV0A 3BDUA 2KDSA 2XDDA 1VUBA 2AHJB 1R8OB 4B9WA 3JCMP 5L8RE 4BE0A 2QEXA 1VQ9T 1FXXA 3AHUA 4M75F 2LX9A 5KH6A 2EQJA 4IUPA 1N9RA 3MEVA 4IUTA 5LJ5e 4M77B 1VQ9A 1M8VA 4JLGA 4C8QG 2PUKB 5GANg 4A4HA 2L5QA 1NPPA 5GAN5 5CKHA 3G4ST 4A53A 3FIFA 3TCJA 1N27A 4EMHA 3INZA 2C06A 3JCMQ 5LL6S 4PNOA 1Y71A 4C5IA 4OF1A 4M7DB 1HXDA 2EQKA 2X35A 4F7UF 2EJFA 3A8OB 3JSCA 4WF2A 2OTLT 1QVFS 1MHNA 2MMPA 3E9GA 5GANf 5CAIA 3CCUA 2L89A 3HHTB 2OTLA 2DJZA 2X4YA 4N4GA 1B34A 2RH2A 2ZCFB 1QVFA 3A8LB 2ZZDA 2E70A 1WQ7A 3LLRA 4NL2A 4M77G 4FU6A 4C8QA 2DXCA 4IUVA 4VUBA 1Q81C 2V8KA 3JCMW 2EJGA 2E65A 5FU6C 4L59A 2ZPHB 3GP8A 1VQ8A 3VUBA 2CKKA 3LX7A 2CZ0B 2JVVA 2QQAA 4MDWA 2GFUA 2QDYB 1N9SA 4M7DG 1SSFA 1WQWA 1Q82U 3V8JA 3E9FA 4C5EA 4L6V5 4J8OA 2XG8D 4M75E 2E12A 3OYDA 1XTDA 2PVGB 3G7ZA 4M78D 4PKCC 3EAEA 4C0DC 4MMLA 3VYGA 3SB2A 3L2QA 4LD9K 2GCXA 4N4IA 1MGQA 3JCMX 5M9OA 1UEBA 2MAMA 3LW5E 4LDYA 4MMKA 4MZMA 1NJIU 1YJNT 2DZCA 4M75A 4YTLA 2Y4YA 4J7FA 2WSFE 4M77A 4RG2A 1IREB 5GANd 4F7UE 1KHCA 1OI1A 4E7JA 5CK9A 2EIFA 2VV5A 4PL6A 4M7DD 2E5QA 1PSFA 2A3LA 3FEOA 4OB1B 2CZ7B 4ZTFA 3PMTA 4XU3A 1HK9A 1U1TA 2E1HA 2LCCA 2JNGA 3EFSA 3LYIA 3M56A 4IURA 4XU1A 5FROA 2DTIA 4O5VA 1W4SA 1VQ4A 4M7AA 1YI2T 5HK3A 4PJOA 1W2BS 1JBMA 5IAYA 4JRKA 4E7HA 3M55A 5GAMh 1M1KU 5GAOn 4P5NA 2GFAA 3MEAA 1XQHA 2EJ9A 2IG0A 5AYFA 2RHXA 1W2BA 2XICA 5FU7C 3MCAB 3QG1A 3OS2A 1Q86U 3I56T 4IKFA 3G6ET 4DOWA 4XTYA 5GAN2 2VC8A 4HCBA 3OYEA 1YHQA 3QSUA 2R58A 3DLMA 3KBGA 3OQ5A 3M58A 2GQVA 3QIIA 4C92B 5GAN4 3CCLT 3GNFB 2M0OA 3I56A 2CS7A 2F5TX 2LC4A 4NS5A 3CC2T 3M9QA 3OS0A 3URGA 4MZTA 2XDPA 4N0AC 5GAOm 3A8MB 2DXTA 5CKFA 5DY9A 5I2MA 5KCHA 3J80E 3V7RA 3ZBDA 2YRVA 4ZGJB 3CCSA 5J39A 4BE2A 3CC4A 3OBWA 4JRPA 1KD1C 5KE3A 4FT2A 3O8VA 2XK0A 1H3ZA 4OGEA 5LJ5g 3OYBA 3DB4A 2FL7A 5GMKj 3CCVT 4E7LA 3E1SA 2X4WA 3HP9A 3PGGA 5HY6A 4R55A 1YJ9A 3TU4K 2EWNA 2LCLA 4OVAA 2XKOC 5GMKi 3CCVA 2HQXA 2PVDB 1WJSA 3A8HB 4C92G 2H3JA 3CPFA 1K8AU 1WJRA 3HFOA 3OMGA 4F7UB 1Q7YU 4E7KA 4C0ZA 5FU6B 2FVUA 4ZGEB 4C5GA 3RMQA 4LDVA 5GANj 3C4SA 2RK2A 4XTVA 5LJ5f 4C8QF 1NZ9A 5GAOp 2XDBA 2DIGA 1UB4A 2HD0A 3CBOA 3OSSC 4J6XA 4BE1A 3GLXA 3LWIA 2BIVA 4MDXA 2P0KA 4V2SA 5GMKh 3CD6A 4HT9A 1RL2A 3GNGA 2O4XB 1EIFA 4XTXA 5FRMA 1XNIA 4LDXA 4EPCA 1Q82C 1VQ6A 4OB3B 3V7SA 1VIFA 1YIJA 4C92D 1VQ5A 1WJQA 2DEQA 3OYIA 2F5KA 1K9MU 5GANh 3L2WA 2QEXT 3WVEB 1S72T 4C92A 2DPPB 4E47A 4M78B 5GMKl 3JCMb 5GAN3 2X4XA 1S72A 1NJIC 2QQ9A 3SD4A 3X28B 3PIOA 4M77F 5LJ3h 1N8RU 1V29B 2M9UA 4JRIA 2G3RA 1VQKA 3PMIA 2KY9A 3VYHB 3MEWA 1G3WA 2WSCE 2ZPGB 3DKMA 2DTHA 3HPWA 4CRIA 3Q1JA 4ZGDB 3FLGA 2R5AA 3NTKA 5IN1A 5GAMe 3X26B 2KMTA 3TREA 4EMKC 5LJ5d 3S3MA 2DZ9A 2L3RA 3SWNA 2RHIA 4M7AF 4QW2A 2RJEA 4N4HA 5FU7B 4PJOF 3RUXA 3CMAA 3CCUT 4FL6A 2K5FA 4C8QE 1BIBA 2RHUA 4M78G 3DLLA 3OSVA 3LWHA 4J6YA 3JAME 4JLIA 5I2SA 5GAN8 2DXBA 3OS1A 1Q86C 1LNXA 4ELYC 2QA4A 4J7IA 3QPHA 2P0PA 2YLBA 1VQ8T 3ASKA 3JCMV 2RD1A 4QVZA 1ZHIA 1YCYA 2R57A 1JJ2S 3BFMA 3JRZA 2E64A 4J83A 3T9NA 1UGPB 4JRQA 1QW1A 4A4FA 3S3OA 1JJ2A 3HRSA 3QYHB 2E10A 4X9DA 5A0LA 4KT0E 4M77E 2LNVA 5FRNA 3PTAA 1FWZA 4DOVA 1Y96B 3NTIA 2V8JA 4M78A 3VKIA 4XQ3A 2KK4A 3VUZA 5GAOr 3L2ZA 2RHZA 3OYLA 3JCMh 3P8BB 1QVPA 3UWNA 1G3YA 2CZ6B 2LT1A 3CEYA 4OP0A 2LRQA 4M7AE 3GF5A 2K57A 1Q7YC 3CCQA 3GIBA 4PJOE 4C0GA 2RK1A 1GXIE 3OS5A 4LDUA 4TVRA 4BI8B 4BD3A 1I4K1 4KULA 4IUQA 4MZPA 4C8QC 3OYJA 4BACA 1VQ4T 4Z02A 3M4GA 3KUFA 4M7DA 3CBMA 3QDRB 1VQOT 3OY9A 5LJ5j 5D6XA 4XU0A 1VQOA 5HK0A 3RESA 2MWOA 4NOYA 4QVDA 4EMGA 2VYTA 4R56A 4ZTJA 3LGLA 4J5YA 3QYGB 2A7YA 1P92A 1YHQT 4JS5A 2KQWA 1M1GA 3CBPA 1QVGA 1G3TA 3JB9F 3QXEB 2K5IA 1K9MC 4C92F 2K4YA 4O6JA 5D6WA 4N0AA 4JUVA 3H6ZA 3BDLA 1OYXA 1ZQ1A 2MF2A 1ZBXA 4M75C 2KAFA 3OYMA 4M77C 2PQWA 4FSXA 5CKBA 2D9TA 2VGMA 1G5VA 4XAXB 4HA8A 3CCST 3JCMc 2WSEE 2L8DA 3QZ5B 3OYAA 1KQ1A 3EFRA 1Y7XA 3GPLA 3CC4T 1VQMA 2D6FA 3KXTA 2KSSA 2HNIA 5HKCA 1BI1A 4JDSA 2GF7A 2K3YA 4RG8A 1Y96A 2VXEA 2VXFA 5DLQE 2EQMA 3JB9I 3FC3A 2PVOB 1YJ9T 3CXCS 4GLKA 4X34A 3MHXA 3CMET 4BDYA 3LGFA 4BDZA 4M7AC 1QP2A 3ER0A 4PJOC 1M5Q1 2RM4A 2LVMA 5EG2A 3WVDB 4C0FA 2RJFA 2RJCA 4HCZA 3CXCA 4B9XA 3CMEA 2DXUA 4A4GA 5GAMg 5CR2A 5CQYA 3CC7A 2ZPEB 3C94A 3S3NA 2JUFA 4ME7A 2MI6A 4A4KA 1VQ7A 2X4JA 2K3XA 3CD6T 1QP3A 2RA2A 5KE2A 2F69A 2B8AA 3NFCA 2HBPA 3OYYA 5J26A 3MP8A 3FDRA 4C92E 3HFNA 5GAMf 3J81E 3CCJA 1VQ6T 1YIJT 4BB7A 4C0DB 3DB3A 2O01E 2PU9B 3PT9A 5C0MA 1VQ5T 4QQGA 2QXFA 2E6NA 3CCEA 1JB0E 4JJNK 3FRNA 4UC4A 3JCMe 3L42A 3BY7A 2JOYA 2DO3A 4ATOA 1K73U 4KUDK 4M78F 3OYCA 3TEEA 1B34B 1BI2A 1IZ6A 3QHSA 4Q5WA 3C12A 4BUGA 1YITA 4DA4A 4HCCA 3V7CA 1VQKT 5KCOA 2RI2A 2DKGA 2EKOA 4CI0C 1YJWT 3PNWC 1UGRB 1X75C 2LQ8A 2ZPBB 3M59A 4OB2B 3SFMA 3L2RA 3GOXA 1YJWA 3HSBA 1WPYA 2BKDN 2LT4A 1NE8A 2V8IA 5DLOA 3HRUA 4PLIA 2R5MA 3M53A 3ME9A 4M7DF 3L1AA 3CMAT 1JRIA 1M90U 2ZGWA 1BYMA 2QI2A 4KUIA 3V8KA 3CPWS 4QVCA 1FX7A 3I55T 2XHCA 3ZEHA 1M1KC 4IUUA 2Y90A 5GAMd 1TH7A 3M54A 1VQLT 3RERA 3CPWA 5A0GA 3I55A 3CCRT 2QA4T 4J6WA 1VQLA 5J3BA 3M57A 2BUDA 4JS4A 4M75B 2E41A 3RKXA 3S6WA 3MP1A 4C92C 3CCRA 3CCMT 5CIUA 2MWPA 1X01A 2QQRA 3QO3A 2LQKA 3SDZA 2K2VA 3MP6A 5A2QE 1UGQB 5CO7A 3QJ6A 3CCMA 1KD1U 2FYKA 1QVGS 4GY5A 3RKWA 2XU8A 3M5AA 5LJ3g 3G4SA 4M78E 2O4XA 2HAXA 3UPUA 4HT8A 5GAOl 3MO8A 1LOJA 3N5BB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4C0D B;  4BY6 C;  5FU7 B;  4C0D C;  5FU6 B;  5FU6 C;  4BY6 B;  4C0G A;  5FU7 C;  4C0F A; 
#chains in the Genus database with same CATH topology
 4R0K A;  3OYH A;  1O75 A;  2A37 A;  2QQS A;  3UA6 A;  1I0C A;  2ED0 A;  4M75 G;  1I5L A;  1Y07 A;  2HQE A;  4QKU A;  2AKL A;  2E3I A;  2JZ2 A;  2EYX A;  2P84 A;  4RMO A;  1U1S A;  1NM7 A;  1Q95 G;  5GAO q;  2E6Z A;  4KGX B;  4ZN3 A;  3ZFJ A;  3OB9 A;  5GMK m;  2A36 A;  5GAM j;  2OAW A;  2OTJ T;  2J06 A;  3OBY A;  1WHK A;  1M9S A;  3RMS A;  1RLQ C;  1WNL A;  2OTJ A;  1AT1 B;  3NGP A;  3X24 B;  1WGS A;  1VQM T;  5LJ3 d;  1NEG A;  2H3E B;  1VQ4 Q;  3PFS A;  5A0D A;  1K73 R;  2EGC A;  1H64 1;  2GTO A;  3P8D A;  2JTF A;  3OW2 S;  3TSZ A;  3A5Z B;  5L23 A;  2RQR A;  4LD6 A;  1EFN A;  2KT8 A;  3QDF A;  3G6E A;  2Z0W A;  3CXC P;  2XI9 A;  2ZPF B;  2DVJ A;  3VU3 C;  2FRY A;  2K5L A;  5CKD A;  3CCS Q;  3CC2 A;  3CCJ T;  2CUB A;  5I21 A;  2FHD A;  3OMC A;  3UF4 A;  1YBY A;  3HRT A;  2EPD A;  1N5Z A;  2RB6 A;  4JZ4 A;  3RKY A;  2A08 A;  3OYN A;  4CC4 B;  2VWF A;  1PKT A;  3R6O A;  1BK2 A;  3VJP A;  4DQ2 A;  1VQP T;  1KG1 A;  1VQP A;  2RI3 A;  1W70 A;  3UA7 A;  3ZL7 C;  2ZAE A;  2EFI A;  5GAN 6;  5LJ3 j;  1D3B A;  1WXB A;  2DLP A;  3EGX A;  1PSE A;  2DMO A;  1YIJ Q;  2YHT A;  5I22 A;  3JB9 D;  3VV0 A;  2AHJ B;  4B9W A;  2YUO A;  5L8R E;  2MK5 A;  2QEX A;  3AHU A;  1FXX A;  2JT4 A;  4LNP A;  1WZO A;  3D7S B;  1UG1 A;  4M77 B;  2PUK B;  5GAN g;  4A4H A;  4FCY A;  2EQI A;  4EMH A;  3INZ A;  5LL6 S;  4PNO A;  1Y71 A;  4C5I A;  3CMA Q;  2O31 A;  4DBQ A;  3E9G A;  1QVG P;  5CAI A;  2L89 A;  2X4Y A;  4N4G A;  1B34 A;  1A0N B;  2QA4 Q;  2NWM A;  4M77 G;  4FU6 A;  4OMP A;  4IUV A;  2C0T A;  2IIM A;  1ZUK A;  1X69 A;  5FU6 C;  2GNC A;  1SHF A;  3GP8 A;  2LZ6 B;  2CKK A;  3LX7 A;  2EYZ A;  1EZZ B;  2GFU A;  1SSF A;  4C5E A;  4PJM A;  2JS2 A;  2FPE A;  4PJN A;  3SB2 A;  2DRM A;  5M9O A;  3LW5 E;  4X1V A;  4LDY A;  4MMK A;  1YJN T;  4YTL A;  2XMF A;  2Y4Y A;  4RG2 A;  3CCQ Q;  5I11 A;  2DYI A;  4F7U E;  2QAZ A;  5IHN A;  4OMO A;  4OB1 B;  1PSF A;  3FEO A;  4ZTF A;  4XU3 A;  4IUR A;  2LCC A;  1AD5 A;  3EFS A;  3LYI A;  5KYY A;  2DBK A;  1VQ4 A;  3NMZ C;  5HK3 A;  1JBM A;  1K9A A;  4JRK A;  1ACM B;  4P5N A;  5FU7 C;  2KE9 A;  3OS2 A;  1Q86 U;  3I35 A;  3I56 T;  4HCB A;  3I56 A;  2HKN A;  2CS7 A;  1UDL A;  3M9Q A;  4LUE A;  4MZT A;  3A8M B;  2DXT A;  3J80 E;  5KCH A;  3CCS A;  4BE2 A;  5KE3 A;  4RTT A;  1H3Z A;  1C6V X;  1SSH A;  2ESW A;  4DBH A;  3UAT A;  2FRW A;  4J9B A;  1SHG A;  1CKB A;  1WJS A;  3A8H B;  3CPF A;  2ABL A;  3HFO A;  4E7K A;  1ZBJ A;  2AZS A;  1KQS P;  1TWB A;  3QWY A;  4BE1 A;  2HD0 A;  3GLX A;  3LWI A;  4HT9 A;  3GNG A;  2O4X B;  3RDV A;  1Q82 C;  1C0M A;  1YIJ A;  2AIR B;  2CP2 A;  3THK A;  1TG0 A;  3L2W A;  2DPP B;  1ABQ A;  1IHV A;  1NLP C;  5GMK l;  5GAN 3;  2BTT A;  2X4X A;  2OX7 A;  3PIO A;  1V29 B;  4JRI A;  2D8J A;  2WSC E;  3DKM A;  2DTH A;  4LXC A;  1OV3 A;  4KGV B;  2KMT A;  2L3R A;  3MPU B;  4QW2 A;  3CMA A;  1IRX A;  4C8Q E;  1BIB A;  3I55 Q;  3VS7 A;  3DLL A;  1VQ9 Q;  4JLI A;  4ELY C;  3EHR A;  2QA4 A;  2P0P A;  2YLB A;  3ASK A;  3JCM V;  5IXF A;  1GFC A;  1GCP A;  3JRZ A;  2E64 A;  1IGQ A;  1NLO C;  1Q86 R;  1JO8 A;  2DA9 A;  4A4F A;  3S3O A;  2E10 A;  1KJW A;  2BE9 B;  1FWZ A;  4DOV A;  1QWE A;  4M78 A;  1M2V A;  3VKI A;  4XQ3 A;  2CH4 A;  3JCM h;  3P8B B;  1QVP A;  4KRT A;  2LT1 A;  2K57 A;  3CCQ A;  2IPO B;  2MYS A;  4C8Q C;  1PD1 A;  2RQV A;  4KUL A;  3OYJ A;  4Z02 A;  4AG2 C;  4M7D A;  3CBM A;  1RAC B;  3OY9 A;  3RR6 A;  3VS2 A;  4ZTJ A;  4R56 A;  4J5Y A;  1YHQ T;  4J9D A;  3QXE B;  1K9M C;  5D6W A;  3H6Z A;  3BDL A;  2KYM A;  4E7S A;  4M75 C;  3OYM A;  2PQW A;  1X27 A;  2VGM A;  1G5V A;  4XAX B;  3H0I A;  3GPL A;  3KXT A;  1QQJ A;  3ULR B;  1JXO A;  1YI2 Q;  1PG5 B;  2JMC A;  4RG8 A;  1V1C A;  4ZNX A;  1TSF A;  2EQM A;  3JB9 I;  1YJ9 T;  2ATC B;  2PVO B;  4BDY A;  3MHX A;  2RM4 A;  2LVM A;  4C0F A;  1GBQ A;  2DNU A;  4B9X A;  3CXC A;  5GAM g;  3CCL Q;  2KT1 A;  3EGU A;  1I1J A;  1WIE A;  1NYG A;  3EG9 B;  2X4J A;  3EGD B;  3CD6 T;  3EG3 A;  2F69 A;  5KYW B;  3NFC A;  2BE7 D;  1SKU B;  5C0M A;  1VOM A;  1AWX A;  4UC4 A;  4KUD K;  2HSE B;  4M78 F;  1BI2 A;  2FO0 A;  4Q5W A;  1OX9 A;  4HCC A;  2SRC A;  3PNW C;  4ESR A;  1D0X A;  3MJX A;  4OB2 B;  3GOX A;  2QG9 B;  3HSB A;  3PE0 A;  1WPY A;  2BKD N;  2V8I A;  1MND A;  5FWC A;  4OMQ A;  1GRI A;  2R5M A;  3ME9 A;  2LNH B;  4M7D F;  2EGA A;  2QI2 A;  2QTV A;  3V8K A;  3CPW S;  3I55 T;  2XHC A;  4DBF A;  1VQL T;  3M54 A;  2RPN A;  3I55 A;  1SEM A;  1VQL A;  2BUD A;  1H3H A;  2MWP A;  3QO3 A;  1D1B A;  3O5Z A;  4CC3 A;  5LJ3 g;  2HKQ B;  3UPU A;  2J7I A;  4CC7 A;  1QVG A;  3N5B B;  4F7U B;  2NUP A;  3CCU Q;  2OTL Q;  2VGN A;  2MOX A;  1NPR A;  1G3S A;  1UGS B;  1S1N A;  2RHY A;  3HKS A;  2DIQ A;  1SG5 A;  1U8R A;  1VQ8 Q;  1WHG A;  2OAU A;  2ROL A;  5D6Y A;  2KXD A;  1M1F A;  3JCM J;  5GMK e;  4AMC A;  2KRM A;  1VQN T;  5KYU A;  1OZ3 A;  4F7U G;  1VQN A;  4B6M A;  1MV0 B;  3NHN A;  3H8Z A;  4JJC A;  2DAQ A;  4OMF B;  2NYS A;  5CVI A;  4JPB W;  5GAN e;  1WA7 A;  2RO0 A;  2K6D A;  4NL3 A;  1ZX6 A;  3M4Y A;  1XJW B;  1ABO A;  2KVQ G;  2EQU A;  1LVK A;  4KBM B;  2K7A A;  2QTX A;  1AOJ A;  4E6R A;  5LJ5 h;  4XK8 E;  4Z8A A;  1ZLM A;  3FB9 A;  1X2Q A;  3FJP A;  1YI2 A;  2CZ1 B;  4RCB A;  1KHI A;  2COW A;  2KEA A;  1M90 C;  1IB8 A;  1KIK A;  2XD0 A;  1Q81 U;  3CC7 T;  3HL8 A;  2KNB B;  4FT4 A;  3CCL A;  1BKB A;  1VQ7 T;  3PVL A;  3F70 A;  4QQ6 A;  1PHT A;  4QT7 A;  3CC4 Q;  2FPF A;  2ZPI B;  1RI9 A;  4FIB A;  2XID A;  3SWN B;  3OYF A;  1BI0 A;  3QUI A;  5CQX A;  1MV3 A;  1MNE A;  2LJ0 A;  1O9S A;  4PLL A;  1KQS A;  1YWP A;  2K79 A;  1WHL A;  1WXU A;  4LDW A;  3JB9 G;  4L5G A;  2HL3 A;  3JCM d;  1KC8 C;  4BY6 B;  4C8Q B;  2DL8 A;  2DIL A;  2KRN A;  2PUO B;  2EW3 A;  4K11 A;  3TVT A;  1X43 A;  2RMO A;  2FB7 A;  1WHM A;  2GGR A;  4RUG A;  4Y28 E;  1X6O A;  1VQ5 Q;  2RF0 A;  4II1 A;  5IT9 E;  4HXJ A;  3BDU A;  2KDS A;  1R8O B;  4BE0 A;  1CSK A;  4M75 F;  2RQW A;  5KH6 A;  2EQJ A;  1N9R A;  4JLG A;  4C8Q G;  2L5Q A;  5GAN 5;  5CKH A;  4GBQ A;  1YN8 A;  2C06 A;  1M3B A;  4OF1 A;  2X35 A;  2EJF A;  4WF2 A;  2OTL T;  4WCI A;  3VRY A;  5GAN f;  3CCU A;  3HHT B;  2OTL A;  1QVF A;  3A8L B;  2ZZD A;  1WQ7 A;  3CCM Q;  1MMD A;  2V8K A;  3EFO B;  2E65 A;  4L59 A;  1VQ8 A;  2CZ0 B;  2QQA A;  4MDW A;  2D0N A;  2QK0 A;  1WQW A;  1Q81 R;  1RAE B;  1T0J A;  4M78 D;  4OMM A;  1KK7 A;  3M0P A;  4N4I A;  2MAM A;  1NJI U;  2WSF E;  4M77 A;  1IRE B;  2LJ1 A;  2EIF A;  2VV5 A;  4M7D D;  2E5Q A;  3MKD A;  2LQN A;  2GQI A;  1PRM C;  2DTI A;  1W4S A;  4M7A A;  2CH4 W;  3H41 A;  4PJO A;  2LMJ A;  1W2B S;  5IAY A;  3M55 A;  5AYF A;  3MEA A;  1XQH A;  2EJ9 A;  2C0I A;  2RHX A;  4A63 B;  2XIC A;  2VKN A;  1NBE B;  4IKF A;  3G6E T;  4XTY A;  3OYE A;  3QSU A;  3DLM A;  5GAN 4;  3QII A;  2CP3 A;  2KI7 A;  4JJB A;  3CC2 T;  5D7U A;  2XDP A;  9ATC B;  3CC4 A;  1KD1 C;  2JXB A;  4FT2 A;  3O8V A;  2HEQ A;  1WHJ A;  4E7L A;  3E1S A;  4R55 A;  5HY6 A;  1OU8 A;  3PGG A;  4RTZ A;  4OVA A;  1FMW A;  3EH1 A;  2HQX A;  2PVD B;  3OMG A;  4C0Z A;  2FVU A;  2JTE A;  3R6N A;  4C5G A;  3EG1 A;  4LDV A;  3C4S A;  2RK2 A;  2XDB A;  2GBQ A;  1UB4 A;  1RAI B;  2DBM A;  3CBO A;  4J6X A;  4HVV A;  2DX1 A;  3NPF A;  5GMK h;  4XTX A;  3CCE Q;  5FRM A;  4C92 D;  1VQ5 A;  2CDT A;  2F5K A;  7AT1 B;  5GAN h;  2QEX T;  3WVE B;  1YIT Q;  4J9G A;  2QQ9 A;  3SD4 A;  3X28 B;  1NG2 A;  4M77 F;  4F04 B;  1KFZ A;  2CUD A;  5ECA A;  3PMI A;  2KY9 A;  3MEW A;  1G3W A;  4CRI A;  1W6X A;  3Q1J A;  1NJI R;  2ED1 A;  5GAM e;  4EMK C;  5LJ5 d;  3TRE A;  1WX6 A;  2DZ9 A;  3S3M A;  2RHI A;  4M7A F;  4PJO F;  4FL6 A;  1HSQ A;  1GCQ C;  1ZUU A;  2DRK A;  3CCR Q;  1X6G A;  1BU1 A;  3VS4 A;  1LNX A;  4J7I A;  1BB9 A;  1RAA B;  1M3A A;  1QKX A;  2KRS A;  2RD1 A;  4QVZ A;  1SF9 A;  3G4S Q;  4FYV B;  3GBQ A;  3T9N A;  1UGP B;  1OU9 A;  1QW1 A;  1JJ2 A;  4ORZ A;  2LNV A;  3PTA A;  3NTI A;  2V8J A;  4ANJ A;  2KK4 A;  3L2Z A;  2RHZ A;  1G3Y A;  2CZ6 B;  2RQT A;  2K9G A;  2DEU A;  1Q7Y C;  1YFN A;  3GIB A;  2RK1 A;  3OS5 A;  4BD3 A;  2KRO A;  1VQ4 T;  2HBW A;  3M4G A;  5KYX A;  5LJ5 j;  3EH2 A;  5HK0 A;  2MWO A;  2J05 A;  1C1A A;  3QYG B;  2KQW A;  3CBP A;  2O88 A;  1QCO A;  4EIK A;  1OYX A;  1ZQ1 A;  2DJQ A;  1ZBX A;  4PJJ A;  2KAF A;  1K4U S;  4HA8 A;  3CCS T;  2WSE E;  3OYA A;  2MPX C;  3EFR A;  2D6F A;  2CSQ A;  2HNI A;  3EGX B;  2GF7 A;  2K3Y A;  2VXF A;  2K2M A;  2KGT A;  4BDZ A;  3LGF A;  1AVZ C;  1M5Q 1;  2COY A;  1QKW A;  2RJC A;  2DXU A;  1M8M A;  2MI6 A;  2K3X A;  2RA2 A;  2BZY A;  5KE2 A;  2AZV A;  2B8A A;  1GBR A;  1T0H A;  4C92 E;  3J81 E;  5GAM f;  1YIJ T;  4BB7 A;  2PU9 B;  3PT9 A;  4WTO B;  1QCN A;  3CCE A;  3CCV Q;  4D8D A;  2DF6 A;  3FRN A;  3L42 A;  2JOY A;  3TEE A;  1B34 B;  3C12 A;  1YIT A;  4DA4 A;  3V7C A;  2EKO A;  1UGR B;  2CT4 A;  1X75 C;  2LQ8 A;  3EG2 A;  3M59 A;  1RAD B;  1PC0 A;  1TU0 B;  3VS3 A;  3CMA T;  1IO6 A;  2HQH A;  4IUU A;  2Y90 A;  1TH7 A;  1UJY A;  2JJ9 A;  3VS1 A;  1SRM A;  3CCR T;  2QA4 T;  1WYX A;  3M57 A;  4RTY A;  2E41 A;  3RKX A;  3S6W A;  4C92 C;  3CCR A;  1QVF P;  2QQR A;  2K2V A;  1YCS B;  1UGQ B;  5CO7 A;  3QJ6 A;  1KD1 U;  4GY5 A;  3RKW A;  5FW9 A;  3G4S A;  5KYY B;  2HAX A;  4HT8 A;  2HSP A;  2YLC A;  1OX8 A;  3QWX X;  4E7I A;  3JB9 J;  3WXM B;  3SWN C;  2YWW A;  1UGV A;  2CP7 A;  5LJ3 f;  4Y92 A;  3CCQ T;  4F16 A;  1I8F A;  2SEM A;  2M1H A;  4ELZ C;  1VA7 A;  4FM4 B;  2HCK A;  4BY6 C;  1M3C A;  2L3Q A;  5CCA A;  2DYB A;  2RNA A;  2EYQ A;  4M77 D;  3SEM A;  1LPL A;  1YP5 A;  1K73 C;  2DD5 A;  3X20 B;  2CYZ B;  2Y4X A;  1M4Z A;  1BIA A;  3QBY A;  4M7A D;  4OB0 B;  3JCM g;  4PJO D;  5GJV B;  2EAY A;  4A4E A;  4EMK B;  4AFS C;  1X2K A;  4RKU E;  2VUB A;  4F7U A;  2WAC A;  2QYZ A;  2DE0 X;  3PIP A;  3OYK A;  2O2O A;  3REA B;  4HVW A;  4J9H A;  1MMG A;  3LH5 A;  3L2V A;  3OW2 A;  4X9C A;  4BI4 A;  3UT1 A;  1M27 C;  3NTH A;  2IVW A;  4D6W A;  3MEU A;  2DVE A;  3E19 A;  2LTO A;  2DL4 A;  4FW2 A;  3UDC A;  4XU2 A;  2JMA A;  4IIM A;  4A54 A;  2P0Q A;  3I5S A;  2CP5 A;  4QQD A;  1IGU A;  1ARK A;  2D0Q B;  1KD1 R;  1VIE A;  2DD4 A;  1G83 A;  2CGH A;  4Y91 A;  2V26 A;  4C5H A;  4HKE A;  3J7A F;  2DTO A;  4XTW A;  1J3T A;  1RI0 A;  3JB9 H;  1N6A A;  3BW1 A;  1H92 A;  2QDL A;  1VQ6 Q;  2L3S A;  2P4T A;  2M16 A;  2XDD A;  1VUB A;  2J6O A;  1S72 Q;  1EX4 A;  1M2V B;  2NUT A;  1VQ9 T;  2LX9 A;  1VQK Q;  3MEV A;  4IUT A;  3CPW P;  1VQ9 A;  1M8V A;  1NPP A;  1K1Z A;  1R0C B;  3FIF A;  3TCJ A;  1AWW A;  2D8H A;  4DEY A;  2YT6 A;  3JCM Q;  4M7D B;  1HXD A;  2EQK A;  1B3Q A;  4F7U F;  3EG0 A;  3A8O B;  1U3O A;  1T3S A;  2FZC B;  1JJ2 P;  2DJZ A;  1F1B B;  4KH1 B;  1GFD A;  1B07 A;  2E70 A;  4NL2 A;  1LCK A;  4C8Q A;  2F2V A;  2DXC A;  4VUB A;  1MMA A;  3IQL A;  2ZPH B;  2LQW A;  1KSW A;  2EYW A;  2JVV A;  1GL5 A;  1W1F A;  1N9S A;  3KFV A;  4M7D G;  1Q82 U;  3V8J A;  3E9F A;  2H8H A;  4J8O A;  2XG8 D;  3OYD A;  2E12 A;  3G7Z A;  3M0Q A;  1H8K A;  4PKC C;  1ZSZ C;  4RTX A;  4C0D C;  4MML A;  4LD9 K;  4PFO A;  1AWJ A;  1MGQ A;  1WXT A;  4MZM A;  2CRE A;  2LP5 A;  2DL5 A;  2E4H A;  4M75 A;  4J7F A;  4LN2 A;  4E7J A;  4PL6 A;  2E1H A;  3M56 A;  2JNG A;  2RQU A;  4XU1 A;  1YI2 T;  8AT1 B;  5GAO n;  1UEC A;  2IG0 A;  2J6F A;  4JZ3 A;  3H0H A;  3QG1 A;  2A28 A;  1JU5 C;  4DOW A;  5GAN 2;  2VC8 A;  2R58 A;  3KBG A;  4C92 B;  3JB9 F;  3CCL T;  2GQV A;  2OTJ Q;  3EFO A;  2M0O A;  3GNF B;  1YNZ A;  2LC4 A;  1OEB A;  4NS5 A;  4JJD A;  3URG A;  1VQM Q;  1ZUY A;  5GAO m;  5I2M A;  5CKF A;  3V7R A;  3ZBD A;  2YRV A;  4ZGJ B;  2JW4 A;  5J39 A;  3OBW A;  1BCM A;  2XK0 A;  4OGE A;  5LJ5 g;  2X4W A;  3CME Q;  3TU4 K;  2P4R A;  2EWN A;  4C92 G;  2HDA A;  1WJR A;  2O9V A;  2X9H A;  1IXD A;  4C8Q F;  1NZ9 A;  1SRL A;  5GAO p;  2DIG A;  2P0K A;  3CCJ Q;  4M4Z A;  1EIF A;  1XNI A;  4LDX A;  1VQ6 A;  4OB3 B;  1VIF A;  2NUP B;  1WJQ A;  3OYI A;  1OUL A;  1K9M U;  1S72 T;  4E47 A;  1VQP Q;  3JCM b;  1Q82 R;  1U06 A;  1S72 A;  1CKA A;  2M9U A;  2ROT A;  1YJW Q;  2G3R A;  1VQK A;  4PJL A;  2D1X A;  2ZPG B;  3HPW A;  3FLG A;  2R5A A;  3NTK A;  2DER A;  4PK4 A;  1ZA1 B;  2RJE A;  3RUX A;  1NEB A;  3CCU T;  2DFU A;  2K5F A;  1PNJ A;  2RHU A;  3H0F A;  1HD3 A;  3OSV A;  3LWH A;  3EHQ A;  4J6Y A;  1E6G A;  5I2S A;  5GAN 8;  2DXB A;  3OS1 A;  1Q86 C;  1VQ8 T;  1PWT A;  3TQ7 P;  1PM3 A;  2R57 A;  4J83 A;  2L2P A;  3H9N A;  1E7O A;  3SHW A;  2OJ2 A;  3PVQ A;  2K3B A;  3QYH B;  4X9D A;  5A0L A;  4F14 A;  4KT0 E;  5FRN A;  2RN8 A;  1Y96 B;  1AWO A;  1M30 A;  4Z88 A;  1ZSG A;  1RAH B;  5GAO r;  3VUZ A;  4OP0 A;  1VYV A;  4C0G A;  1GXI E;  4LDU A;  4TVR A;  1PD0 A;  4BI8 B;  1I4K 1;  2NUZ A;  3M0U A;  4FSS A;  3QDR B;  2EGE A;  1X6B A;  2KXC A;  1WFW A;  3RES A;  2YUP A;  4NOY A;  4QVD A;  4EMG A;  2COZ A;  5AT1 B;  2A7Y A;  1P92 A;  4JS5 A;  4AFZ C;  1YJN Q;  1MMN A;  2K5I A;  1W2B P;  2K4Y A;  3OW2 P;  2V1R A;  2FPD A;  2GTJ A;  5CKB A;  4FSX A;  2YSQ A;  2VB6 A;  3JCM c;  3AT1 B;  1K9M R;  2L8D A;  3QZ5 B;  3CC4 T;  1VQM A;  2AK5 A;  5FWB A;  2VXE A;  2AKK A;  5DLQ E;  3FC3 A;  3CXC S;  4X34 A;  3CME T;  1QP2 A;  1WLP B;  3BE3 A;  3M0R A;  2RJF A;  3I56 Q;  3CME A;  2X3X D;  4OMN A;  1TUG B;  4A4G A;  2W10 A;  5KYN A;  1D1A A;  5CQY A;  3G71 Q;  2X3W D;  2ZPE B;  3C94 A;  3S3N A;  2KBT A;  4A4K A;  1QP3 A;  3OYY A;  4RTW A;  5J26 A;  2I0N A;  2F1L A;  3MP8 A;  3CCJ A;  3HFN A;  1YWO A;  3I5R A;  1ZSZ B;  4C0D B;  5IHK A;  1VQ5 T;  2O01 E;  4QQG A;  2M51 A;  2QXF A;  4KH0 B;  2O9S A;  4FYX B;  3JCM e;  3RNJ A;  2DO3 A;  3VRZ A;  3OYC A;  1QWF A;  4BUG A;  1T3L A;  2YUQ A;  2DKG A;  1YJW T;  4CI0 C;  3L2R A;  3SFM A;  1YJW A;  1NE8 A;  2LCS A;  2BZX A;  2YUN A;  3M53 A;  4D8K A;  1JRI A;  1M90 U;  2ZGW A;  1K76 A;  4KUI A;  4LUD A;  4QVC A;  1D1C A;  3ZEH A;  1M1K C;  3RER A;  3CPW A;  5J3B A;  1M2O A;  4J9C A;  3CCM T;  5CIU A;  2LQK A;  3SDZ A;  5A2Q E;  5EC7 A;  3CCM A;  2FYK A;  1QVG S;  6AT1 B;  2XU8 A;  3M5A A;  4M78 E;  2O4X A;  5GAO l;  3MO8 A;  4M7A B;  1LOJ A;  1Y57 A;  4PJO B;  3LH0 A;  5IH2 A;  2YRC A;  3QJY A;  3OA6 A;  1BI3 A;  2I2L A;  2KYB A;  4C8Q D;  4BI3 A;  5IXB A;  1KC8 U;  4M7D E;  1TUD A;  2CP0 A;  2DM1 A;  3QKJ A;  4ZN1 A;  1K8A C;  2RJD A;  2ECZ A;  1JEG A;  1E6H A;  4XTZ A;  2ENM A;  4M7A G;  3TSW A;  5DM7 R;  2YDL A;  2EBP A;  1I81 A;  3I9Q A;  4PJO G;  1QCF A;  3X25 B;  4M75 D;  5GAN 7;  3QZ9 B;  4AG1 C;  4IIO A;  5LJ3 e;  2DL7 A;  4M78 C;  1YJN A;  3V8L A;  2L0A A;  5A0G A;  4RCC A;  4XTU A;  2JTM A;  8ATC B;  3OYG A;  1N8R C;  4J9F A;  2G6F X;  2VVK A;  3A1P A;  3A8G B;  4OML A;  1D3B B;  3C0C A;  2KR3 A;  4M7D C;  1OZ2 A;  5C6S A;  1YHQ Q;  5CKE A;  1FMV A;  1LJO A;  3JCM f;  3P8H A;  2JN0 A;  3G71 T;  1M90 R;  3G71 A;  4FYY B;  1KQ2 A;  1JXM A;  4OGC A;  1TTH B;  3C95 A;  5FLX E;  1AHJ B;  1JQQ A;  2QGF B;  2QQB A;  3RIR A;  3CCE T;  1YJ9 Q;  1KQS S;  1BBZ A;  2M02 A;  4RTV A;  4HVU A;  2DK3 A;  2RI5 A;  1YIT T;  1XOV A;  1RUW A;  2HZY A;  1DJ7 B;  4EDU A;  1TOV A;  1VYT A;  4HCK A;  4EMK A;  3RBB B;  3L2U A;  3MET A;  2MIO A;  3CD6 Q;  2NLU A;  2LDM A;  1GCQ A;  1KC8 R;  1HYO A;  3JCM P;  1WI7 A;  1Y0M A;  4IUP A;  5LJ5 e;  3HTR A;  3JV3 A;  2LJ3 A;  3EG9 A;  3EGD A;  1D0Z A;  2FZK B;  3G4S T;  4A53 A;  1N27 A;  5KYW A;  1PRL C;  5KYX B;  3JSC A;  4GLM A;  1U5S A;  1QVF S;  1MHN A;  2MMP A;  2V1Q A;  1VQL Q;  1AZE A;  2ZCF B;  2RH2 A;  5HCK A;  4LE9 A;  1OPK A;  3LLR A;  1Q81 C;  3JCM W;  2EJG A;  1PKS A;  3VUB A;  2JM8 A;  2EYY A;  2HL5 C;  2QDY B;  4L6V 5;  1TUC A;  2CSI A;  4M75 E;  1XTD A;  2PVG B;  3EAE A;  3VYG A;  3L2Q A;  2GCX A;  3JCM X;  1UEB A;  1D0Y A;  2DZC A;  3VS0 A;  5GAN d;  5IHI A;  1KHC A;  1OI1 A;  5CK9 A;  2A3L A;  2CZ7 B;  3PMT A;  1HK9 A;  1U1T A;  1VQN Q;  2X51 A;  5FRO A;  2DL3 A;  4O5V A;  2A0F B;  1VQO Q;  2LX7 A;  1UHF A;  1M1K U;  4E7H A;  5GAM h;  1I5O B;  2GFA A;  2E5K A;  1W2B A;  3MCA B;  1YHQ A;  3OQ5 A;  3M58 A;  2EVR A;  1QLY A;  2F5T X;  2FG0 A;  4DBR A;  3OS0 A;  4N0A C;  4Z89 A;  5DY9 A;  1FMK A;  4JRP A;  1OOT A;  1UJ0 A;  2YRD A;  3A98 A;  3OYB A;  3DB4 A;  2FL7 A;  1ZA2 B;  5GMK j;  3CCV T;  3HP9 A;  1YJ9 A;  2LCL A;  2L3P A;  2XKO C;  5GMK i;  3CCV A;  2B86 A;  2OI3 A;  2H3J A;  1K8A U;  1UFF A;  1Q7Y U;  3CC7 Q;  5FU6 B;  4ZGE B;  3RMQ A;  5GAN j;  2BZ8 A;  4XTV A;  3VS5 A;  1R77 A;  5LJ5 f;  2AT1 B;  1VQ7 Q;  4PFZ A;  2DET A;  3OSS C;  2J6K A;  1TS9 A;  2BIV A;  4MDX A;  2E3H A;  1I07 A;  1G2B A;  4V2S A;  4E7Z A;  3CD6 A;  1RL2 A;  2F2X A;  4EPC A;  4E2F B;  3V7S A;  2DEQ A;  4C92 A;  1RAB B;  4M78 B;  1NJI C;  1G8X A;  5LJ3 h;  1N8R U;  2M0Y A;  3VYH B;  4ZGD B;  5IN1 A;  4KGZ B;  3SWN A;  4N4H A;  5FU7 B;  3VS6 A;  3FJ5 A;  4AFQ C;  2C0O A;  4M78 G;  1UE9 A;  1UHC A;  1BCO A;  3U23 A;  1NYF A;  3JAM E;  1AZG B;  1VYU A;  4FW1 A;  3QPH A;  1M1K R;  1FYN A;  2PTK A;  1ZHI A;  1YCY A;  1JJ2 S;  2JM9 A;  3BFM A;  4J9E A;  1B7T A;  4CC2 A;  4JRQ A;  3HRS A;  1V76 A;  1HJD A;  4M77 E;  2MCN A;  4RTU A;  1IHW A;  4AFU C;  3OYL A;  4DEX A;  1WHH A;  3UWN A;  3CEY A;  2QAS A;  2LRQ A;  4M7A E;  3GF5 A;  4PJO E;  2JS0 A;  4MZP A;  4IUQ A;  4BAC A;  3KUF A;  2FEI A;  4FYW B;  1VQO T;  1K8A R;  1Q7Y R;  2F2W A;  4PFP A;  5D6X A;  4XU0 A;  1RAG B;  1VQO A;  4AT1 B;  1K0S A;  2VYT A;  3M0S A;  1QMC A;  3LGL A;  1M1G A;  1G3T A;  4C92 F;  4O6J A;  4N0A A;  2HMA A;  4JUV A;  2MF2 A;  1AEY A;  4M77 C;  2D9T A;  1MUZ A;  1KQ1 A;  1Y7X A;  1OPL A;  2KSS A;  5HKC A;  1BI1 A;  2PZ1 A;  4JDS A;  3CQT A;  1Y96 A;  1D09 B;  1N8R R;  1K0X A;  1TXQ A;  4GLK A;  4M7A C;  3ER0 A;  4PJO C;  5EG2 A;  3M0T A;  3WVD B;  4HCZ A;  4F17 A;  1PCX A;  3G6E Q;  2YXY A;  2NUT B;  5CR2 A;  2CP6 A;  1WDX A;  3CC7 A;  1RAF B;  3CC2 Q;  2JUF A;  4ME7 A;  1VQ7 A;  1Z9Z A;  1UTI A;  1Z9Q A;  2HBP A;  3REB B;  3FDR A;  1VQ6 T;  3DB3 A;  4J9I A;  2W0Z A;  2E6N A;  2VAS A;  1JB0 E;  4JJN K;  3BY7 A;  4ATO A;  2FZG B;  1K73 U;  1IZ6 A;  3QHS A;  1OQK A;  1VQK T;  5KCO A;  2RI2 A;  2ZPB B;  2LT4 A;  5DLO A;  3G1J A;  3HRU A;  4PLI A;  5KYU B;  3L1A A;  3E2U A;  1BYM A;  1FX7 A;  5GAM d;  2QEX Q;  5GJW B;  2QGG A;  2EKH A;  4J6W A;  1RLP C;  4JS4 A;  4M75 B;  2PNI A;  3MP1 A;  1R0B G;  1X01 A;  1SPK A;  3MP6 A;  2CT3 A;  1UUE A;  1ZSZ A;  3X26 B; 
#chains in the Genus database with same CATH homology
 2YLC A;  4PJO B;  3LH0 A;  4E7I A;  3JB9 J;  3WXM B;  3QJY A;  2VGN A;  3SWN C;  1NPR A;  3OYH A;  1BI3 A;  3OA6 A;  1G3S A;  1O75 A;  2I2L A;  1UGS B;  4C8Q D;  2QQS A;  2RHY A;  3HKS A;  2DIQ A;  4M75 G;  4BI3 A;  1I5L A;  1Y07 A;  2HQE A;  5LJ3 f;  1KC8 U;  3CCQ T;  1U8R A;  4M7D E;  2JZ2 A;  1I8F A;  2OAU A;  2M1H A;  3QKJ A;  5D6Y A;  4ELZ C;  1K8A C;  1M1F A;  4ZN1 A;  3JCM J;  2RJD A;  5GMK e;  4FM4 B;  4XTZ A;  4BY6 C;  1VQN T;  1OZ3 A;  4RMO A;  4M7A G;  5DM7 R;  1U1S A;  4F7U G;  5CCA A;  1VQN A;  1I81 A;  4PJO G;  4OMF B;  3H8Z A;  5CVI A;  2DAQ A;  5GAO q;  2E6Z A;  3X25 B;  5GAN e;  4M75 D;  4ZN3 A;  2EYQ A;  4M77 D;  3OB9 A;  2RO0 A;  3ZFJ A;  5GMK m;  5GAN 7;  3QZ9 B;  5GAM j;  4NL3 A;  5LJ3 e;  3M4Y A;  4M78 C;  1K73 C;  2OTJ T;  2DD5 A;  3X20 B;  2KVQ G;  3OBY A;  2CYZ B;  3V8L A;  1YJN A;  2Y4X A;  2EQU A;  1M9S A;  3RMS A;  1WNL A;  1M4Z A;  1BIA A;  2JTM A;  4KBM B;  4RCC A;  4XTU A;  2QTX A;  3X24 B;  2OTJ A;  3QBY A;  3OYG A;  1WGS A;  1VQM T;  4M7A D;  5LJ3 d;  4OB0 B;  5LJ5 h;  3JCM g;  1N8R C;  4PJO D;  2EAY A;  4XK8 E;  4A4E A;  3PFS A;  4EMK B;  5A0D A;  4RKU E;  2VUB A;  4F7U A;  2WAC A;  3A8G B;  3FB9 A;  1H64 1;  1D3B B;  3FJP A;  3P8D A;  2JTF A;  3OW2 S;  3PIP A;  3OYK A;  3A5Z B;  4M7D C;  1YI2 A;  2CZ1 B;  4RCB A;  3L2V A;  1KHI A;  4LD6 A;  3OW2 A;  1M90 C;  4X9C A;  1OZ2 A;  5C6S A;  5CKE A;  1LJO A;  3JCM f;  2XD0 A;  3P8H A;  4BI4 A;  1Q81 U;  3UT1 A;  3G6E A;  3CC7 T;  3HL8 A;  2JN0 A;  3G71 T;  3NTH A;  4FT4 A;  2XI9 A;  2ZPF B;  3CCL A;  2IVW A;  1BKB A;  3MEU A;  4D6W A;  1VQ7 T;  2DVE A;  3VU3 C;  3G71 A;  2K5L A;  5CKD A;  3E19 A;  2LTO A;  3F70 A;  4QQ6 A;  3CC2 A;  4OGC A;  1KQ2 A;  3UDC A;  3CCJ T;  3C95 A;  4XU2 A;  5FLX E;  5I21 A;  2ZPI B;  1AHJ B;  2QQB A;  2FHD A;  3OMC A;  3RIR A;  4FIB A;  4A54 A;  3CCE T;  2XID A;  2P0Q A;  3SWN B;  1YBY A;  3OYF A;  1BI0 A;  3HRT A;  1KQS S;  3QUI A;  2RB6 A;  3RKY A;  3OYN A;  4QQD A;  5CQX A;  3R6O A;  2D0Q B;  2DK3 A;  2RI5 A;  4PLL A;  1O9S A;  3VJP A;  1VIE A;  2DD4 A;  4M7A B;  4DQ2 A;  1VQP T;  1KQS A;  1KG1 A;  1YIT T;  4LDW A;  3JB9 G;  1XOV A;  2CGH A;  4Y91 A;  4L5G A;  4C5H A;  1VQP A;  2RI3 A;  4HKE A;  1DJ7 B;  3J7A F;  4EDU A;  2DTO A;  3JCM d;  1KC8 C;  4BY6 B;  4XTW A;  4C8Q B;  4EMK A;  1RI0 A;  3JB9 H;  1N6A A;  2EFI A;  3MET A;  3L2U A;  5GAN 6;  5LJ3 j;  2PUO B;  3BW1 A;  1D3B A;  2NLU A;  2LDM A;  1PSE A;  2FB7 A;  2YHT A;  4Y28 E;  1X6O A;  2P4T A;  4II1 A;  2M16 A;  5IT9 E;  3JB9 D;  3VV0 A;  3BDU A;  2KDS A;  2XDD A;  1VUB A;  2AHJ B;  1R8O B;  4B9W A;  3JCM P;  5L8R E;  4BE0 A;  2QEX A;  1VQ9 T;  1FXX A;  3AHU A;  4M75 F;  2LX9 A;  5KH6 A;  2EQJ A;  4IUP A;  1N9R A;  3MEV A;  4IUT A;  5LJ5 e;  4M77 B;  1VQ9 A;  1M8V A;  4JLG A;  4C8Q G;  2PUK B;  5GAN g;  4A4H A;  2L5Q A;  1NPP A;  5GAN 5;  5CKH A;  3G4S T;  4A53 A;  3FIF A;  3TCJ A;  1N27 A;  4EMH A;  3INZ A;  2C06 A;  3JCM Q;  5LL6 S;  4PNO A;  1Y71 A;  4C5I A;  4OF1 A;  4M7D B;  1HXD A;  2EQK A;  2X35 A;  4F7U F;  2EJF A;  3A8O B;  3JSC A;  4WF2 A;  2OTL T;  1QVF S;  1MHN A;  2MMP A;  3E9G A;  5GAN f;  5CAI A;  3CCU A;  2L89 A;  3HHT B;  2OTL A;  2DJZ A;  2X4Y A;  4N4G A;  1B34 A;  2RH2 A;  2ZCF B;  1QVF A;  3A8L B;  2ZZD A;  2E70 A;  1WQ7 A;  3LLR A;  4NL2 A;  4M77 G;  4FU6 A;  4C8Q A;  2DXC A;  4IUV A;  4VUB A;  1Q81 C;  2V8K A;  3JCM W;  2EJG A;  2E65 A;  5FU6 C;  4L59 A;  2ZPH B;  3GP8 A;  1VQ8 A;  3VUB A;  2CKK A;  3LX7 A;  2CZ0 B;  2JVV A;  2QQA A;  4MDW A;  2GFU A;  2QDY B;  1N9S A;  4M7D G;  1SSF A;  1WQW A;  1Q82 U;  3V8J A;  3E9F A;  4C5E A;  4L6V 5;  4J8O A;  2XG8 D;  4M75 E;  2E12 A;  3OYD A;  1XTD A;  2PVG B;  3G7Z A;  4M78 D;  4PKC C;  3EAE A;  4C0D C;  4MML A;  3VYG A;  3SB2 A;  3L2Q A;  4LD9 K;  2GCX A;  4N4I A;  1MGQ A;  3JCM X;  5M9O A;  1UEB A;  2MAM A;  3LW5 E;  4LDY A;  4MMK A;  4MZM A;  1NJI U;  1YJN T;  2DZC A;  4M75 A;  4YTL A;  2Y4Y A;  4J7F A;  2WSF E;  4M77 A;  4RG2 A;  1IRE B;  5GAN d;  4F7U E;  1KHC A;  1OI1 A;  4E7J A;  5CK9 A;  2EIF A;  2VV5 A;  4PL6 A;  4M7D D;  2E5Q A;  1PSF A;  2A3L A;  3FEO A;  4OB1 B;  2CZ7 B;  4ZTF A;  3PMT A;  4XU3 A;  1HK9 A;  1U1T A;  2E1H A;  2LCC A;  2JNG A;  3EFS A;  3LYI A;  3M56 A;  4IUR A;  4XU1 A;  5FRO A;  2DTI A;  4O5V A;  1W4S A;  1VQ4 A;  4M7A A;  1YI2 T;  5HK3 A;  4PJO A;  1W2B S;  1JBM A;  5IAY A;  4JRK A;  4E7H A;  3M55 A;  5GAM h;  1M1K U;  5GAO n;  4P5N A;  2GFA A;  3MEA A;  1XQH A;  2EJ9 A;  2IG0 A;  5AYF A;  2RHX A;  1W2B A;  2XIC A;  5FU7 C;  3MCA B;  3QG1 A;  3OS2 A;  1Q86 U;  3I56 T;  4IKF A;  3G6E T;  4DOW A;  4XTY A;  5GAN 2;  2VC8 A;  4HCB A;  3OYE A;  1YHQ A;  3QSU A;  2R58 A;  3DLM A;  3KBG A;  3OQ5 A;  3M58 A;  2GQV A;  3QII A;  4C92 B;  5GAN 4;  3CCL T;  3GNF B;  2M0O A;  3I56 A;  2CS7 A;  2F5T X;  2LC4 A;  4NS5 A;  3CC2 T;  3M9Q A;  3OS0 A;  3URG A;  4MZT A;  2XDP A;  4N0A C;  5GAO m;  3A8M B;  2DXT A;  5CKF A;  5DY9 A;  5I2M A;  5KCH A;  3J80 E;  3V7R A;  3ZBD A;  2YRV A;  4ZGJ B;  3CCS A;  5J39 A;  4BE2 A;  3CC4 A;  3OBW A;  4JRP A;  1KD1 C;  5KE3 A;  4FT2 A;  3O8V A;  2XK0 A;  1H3Z A;  4OGE A;  5LJ5 g;  3OYB A;  3DB4 A;  2FL7 A;  5GMK j;  3CCV T;  4E7L A;  3E1S A;  2X4W A;  3HP9 A;  3PGG A;  5HY6 A;  4R55 A;  1YJ9 A;  3TU4 K;  2EWN A;  2LCL A;  4OVA A;  2XKO C;  5GMK i;  3CCV A;  2HQX A;  2PVD B;  1WJS A;  3A8H B;  4C92 G;  2H3J A;  3CPF A;  1K8A U;  1WJR A;  3HFO A;  3OMG A;  4F7U B;  1Q7Y U;  4E7K A;  4C0Z A;  5FU6 B;  2FVU A;  4ZGE B;  4C5G A;  3RMQ A;  4LDV A;  5GAN j;  3C4S A;  2RK2 A;  4XTV A;  5LJ5 f;  4C8Q F;  1NZ9 A;  5GAO p;  2XDB A;  2DIG A;  1UB4 A;  2HD0 A;  3CBO A;  3OSS C;  4J6X A;  4BE1 A;  3GLX A;  3LWI A;  2BIV A;  4MDX A;  2P0K A;  4V2S A;  5GMK h;  3CD6 A;  4HT9 A;  1RL2 A;  3GNG A;  2O4X B;  1EIF A;  4XTX A;  5FRM A;  1XNI A;  4LDX A;  4EPC A;  1Q82 C;  1VQ6 A;  4OB3 B;  3V7S A;  1VIF A;  1YIJ A;  4C92 D;  1VQ5 A;  1WJQ A;  2DEQ A;  3OYI A;  2F5K A;  1K9M U;  5GAN h;  3L2W A;  2QEX T;  3WVE B;  1S72 T;  4C92 A;  2DPP B;  4E47 A;  4M78 B;  5GMK l;  3JCM b;  5GAN 3;  2X4X A;  1S72 A;  1NJI C;  2QQ9 A;  3SD4 A;  3X28 B;  3PIO A;  4M77 F;  5LJ3 h;  1N8R U;  1V29 B;  2M9U A;  4JRI A;  2G3R A;  1VQK A;  3PMI A;  2KY9 A;  3VYH B;  3MEW A;  1G3W A;  2WSC E;  2ZPG B;  3DKM A;  2DTH A;  3HPW A;  4CRI A;  3Q1J A;  4ZGD B;  3FLG A;  2R5A A;  3NTK A;  5IN1 A;  5GAM e;  3X26 B;  2KMT A;  3TRE A;  4EMK C;  5LJ5 d;  3S3M A;  2DZ9 A;  2L3R A;  3SWN A;  2RHI A;  4M7A F;  4QW2 A;  2RJE A;  4N4H A;  5FU7 B;  4PJO F;  3RUX A;  3CMA A;  3CCU T;  4FL6 A;  2K5F A;  4C8Q E;  1BIB A;  2RHU A;  4M78 G;  3DLL A;  3OSV A;  3LWH A;  4J6Y A;  3JAM E;  4JLI A;  5I2S A;  5GAN 8;  2DXB A;  3OS1 A;  1Q86 C;  1LNX A;  4ELY C;  2QA4 A;  4J7I A;  3QPH A;  2P0P A;  2YLB A;  1VQ8 T;  3ASK A;  3JCM V;  2RD1 A;  4QVZ A;  1ZHI A;  1YCY A;  2R57 A;  1JJ2 S;  3BFM A;  3JRZ A;  2E64 A;  4J83 A;  3T9N A;  1UGP B;  4JRQ A;  1QW1 A;  4A4F A;  3S3O A;  1JJ2 A;  3HRS A;  3QYH B;  2E10 A;  4X9D A;  5A0L A;  4KT0 E;  4M77 E;  2LNV A;  5FRN A;  3PTA A;  1FWZ A;  4DOV A;  1Y96 B;  3NTI A;  2V8J A;  4M78 A;  3VKI A;  4XQ3 A;  2KK4 A;  3VUZ A;  5GAO r;  3L2Z A;  2RHZ A;  3OYL A;  3JCM h;  3P8B B;  1QVP A;  3UWN A;  1G3Y A;  2CZ6 B;  2LT1 A;  3CEY A;  4OP0 A;  2LRQ A;  4M7A E;  3GF5 A;  2K57 A;  1Q7Y C;  3CCQ A;  3GIB A;  4PJO E;  4C0G A;  2RK1 A;  1GXI E;  3OS5 A;  4LDU A;  4TVR A;  4BI8 B;  4BD3 A;  1I4K 1;  4KUL A;  4IUQ A;  4MZP A;  4C8Q C;  3OYJ A;  4BAC A;  1VQ4 T;  4Z02 A;  3M4G A;  3KUF A;  4M7D A;  3CBM A;  3QDR B;  1VQO T;  3OY9 A;  5LJ5 j;  5D6X A;  4XU0 A;  1VQO A;  5HK0 A;  3RES A;  2MWO A;  4NOY A;  4QVD A;  4EMG A;  2VYT A;  4R56 A;  4ZTJ A;  3LGL A;  4J5Y A;  3QYG B;  2A7Y A;  1P92 A;  1YHQ T;  4JS5 A;  2KQW A;  1M1G A;  3CBP A;  1QVG A;  1G3T A;  3JB9 F;  3QXE B;  2K5I A;  1K9M C;  4C92 F;  2K4Y A;  4O6J A;  5D6W A;  4N0A A;  4JUV A;  3H6Z A;  3BDL A;  1OYX A;  1ZQ1 A;  2MF2 A;  1ZBX A;  4M75 C;  2KAF A;  3OYM A;  4M77 C;  2PQW A;  4FSX A;  5CKB A;  2D9T A;  2VGM A;  1G5V A;  4XAX B;  4HA8 A;  3CCS T;  3JCM c;  2WSE E;  2L8D A;  3QZ5 B;  3OYA A;  1KQ1 A;  3EFR A;  1Y7X A;  3GPL A;  3CC4 T;  1VQM A;  2D6F A;  3KXT A;  2KSS A;  2HNI A;  5HKC A;  1BI1 A;  4JDS A;  2GF7 A;  2K3Y A;  4RG8 A;  1Y96 A;  2VXE A;  2VXF A;  5DLQ E;  2EQM A;  3JB9 I;  3FC3 A;  2PVO B;  1YJ9 T;  3CXC S;  4GLK A;  4X34 A;  3MHX A;  3CME T;  4BDY A;  3LGF A;  4BDZ A;  4M7A C;  1QP2 A;  3ER0 A;  4PJO C;  1M5Q 1;  2RM4 A;  2LVM A;  5EG2 A;  3WVD B;  4C0F A;  2RJF A;  2RJC A;  4HCZ A;  3CXC A;  4B9X A;  3CME A;  2DXU A;  4A4G A;  5GAM g;  5CR2 A;  5CQY A;  3CC7 A;  2ZPE B;  3C94 A;  3S3N A;  2JUF A;  4ME7 A;  2MI6 A;  4A4K A;  1VQ7 A;  2X4J A;  2K3X A;  3CD6 T;  1QP3 A;  2RA2 A;  5KE2 A;  2F69 A;  2B8A A;  3NFC A;  2HBP A;  3OYY A;  5J26 A;  3MP8 A;  3FDR A;  4C92 E;  3HFN A;  5GAM f;  3J81 E;  3CCJ A;  1VQ6 T;  1YIJ T;  4BB7 A;  4C0D B;  3DB3 A;  2O01 E;  2PU9 B;  3PT9 A;  5C0M A;  1VQ5 T;  4QQG A;  2QXF A;  2E6N A;  3CCE A;  1JB0 E;  4JJN K;  3FRN A;  4UC4 A;  3JCM e;  3L42 A;  3BY7 A;  2JOY A;  2DO3 A;  4ATO A;  1K73 U;  4KUD K;  4M78 F;  3OYC A;  3TEE A;  1B34 B;  1BI2 A;  1IZ6 A;  3QHS A;  4Q5W A;  3C12 A;  4BUG A;  1YIT A;  4DA4 A;  4HCC A;  3V7C A;  1VQK T;  5KCO A;  2RI2 A;  2DKG A;  2EKO A;  4CI0 C;  1YJW T;  3PNW C;  1UGR B;  1X75 C;  2LQ8 A;  2ZPB B;  3M59 A;  4OB2 B;  3SFM A;  3L2R A;  3GOX A;  1YJW A;  3HSB A;  1WPY A;  2BKD N;  2LT4 A;  1NE8 A;  2V8I A;  5DLO A;  3HRU A;  4PLI A;  2R5M A;  3M53 A;  3ME9 A;  4M7D F;  3L1A A;  3CMA T;  1JRI A;  1M90 U;  2ZGW A;  1BYM A;  2QI2 A;  4KUI A;  3V8K A;  3CPW S;  4QVC A;  1FX7 A;  3I55 T;  2XHC A;  3ZEH A;  1M1K C;  4IUU A;  2Y90 A;  5GAM d;  1TH7 A;  3M54 A;  1VQL T;  3RER A;  3CPW A;  5A0G A;  3I55 A;  3CCR T;  2QA4 T;  4J6W A;  1VQL A;  5J3B A;  3M57 A;  2BUD A;  4JS4 A;  4M75 B;  2E41 A;  3RKX A;  3S6W A;  3MP1 A;  4C92 C;  3CCR A;  3CCM T;  5CIU A;  2MWP A;  1X01 A;  2QQR A;  3QO3 A;  2LQK A;  3SDZ A;  2K2V A;  3MP6 A;  5A2Q E;  1UGQ B;  5CO7 A;  3QJ6 A;  3CCM A;  1KD1 U;  2FYK A;  1QVG S;  4GY5 A;  3RKW A;  2XU8 A;  3M5A A;  5LJ3 g;  3G4S A;  4M78 E;  2O4X A;  2HAX A;  3UPU A;  4HT8 A;  5GAO l;  3MO8 A;  1LOJ A;  3N5B B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...