4C0FA

Structure of the not-box domain of human cnot2
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
96
structure length
96
Chain Sequence
AIKLGRYGEDLLFYLYYMNGGDVLQLLAAVELFNRDWRYHKEERVWITRAPGMEPTMKTNTYERGTYYFFDCLNWRKVAKEFHLEYDKLEERPHLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure and Assembly of the not Module of the Human Ccr4-not Complex
pubmed doi rcsb
source organism Homo sapiens
molecule tags Gene regulation
molecule keywords CCR4-NOT TRANSCRIPTION COMPLEX SUBUNIT 2
total genus 19
structure length 96
sequence length 96
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-08-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.1020 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4c0fA00
5FU6C 4C0DB 4BY6C 5FU7B 4C0GA 4BY6B 4C0FA 5FU6B 4C0DC 5FU7C
chains in the Genus database with same CATH superfamily
2FRYA 4IUVA 1YP5A 4M77E 2QG9B 1YJNT 2HQXA 1ZHIA 2ROLA 3QG1A 2QEXQ 2Y90A 1EIFA 5KYWB 1KD1C 1OULA 2E6ZA 4IUQA 3DKMA 2FHDA 3PMTA 4J9IA 1VQPQ 4A4FA 4NOYA 3CMAQ 4Z02A 2DJZA 3V8LA 3P8BB 5LL6S 2OTJQ 2DE0X 2PU9B 4XU3A 2HBWA 1MMDA 2KR3A 1RAGB 1SHGA 4UC4A 4M77F 4EMHA 2OTJT 3KBGA 2KE9A 3J7AF 3G4ST 2DX1A 4QKUA 2HD0A 2BIVA 2X4JA 2HQEA 5IXBA 3M0PA 1WJRA 2FEIA 1YJWA 1T3LA 2ZPEB 1BI3A 5GMKi 1Q7YC 2M0OA 3NTIA 1R0CB 2V8IA 4Z89A 2JW4A 4O5VA 1VQ6T 5GAOp 1K73C 5FU7C 2E64A 2OTLA 2OTJA 4M75B 2KXCA 2JUFA 2XHCA 1UGRB 2NUTA 4BY6C 1LVKA 4A63B 2DXTA 1ZUYA 4FL6A 4A4HA 2X4YA 1DJ7B 2K2MA 2P4TA 5CO7A 2XK0A 3VKIA 3S3MA 1MUZA 4V2SA 1QVGS 4RTWA 1PWTA 4Y92A 4ELYC 3PIOA 2BZ8A 5KYXA 4JJNK 1BIAA 1YI2Q 5CKHA 3NMZC 1YIJQ 3GBQA 2RN8A 4XTWA 3H41A 1TS9A 2JM9A 4MZMA 3CCEA 3WXMB 2CZ0B 2VC8A 4E7LA 3I56A 1BI2A 2L0AA 3EG9B 1JJ2S 3JRZA 2DA9A 2W0ZA 4C92C 4IIOA 3TQ7P 2L3RA 3JB9I 1VQKT 5EG2A 5FU6C 1E6HA 3CPWS 2PUOB 1G5VA 1IGUA 3CC4T 4CI0C 3QJYA 4AG2C 1Z9QA 2OI3A 3QWYA 1X69A 3CC7Q 3G71Q 3MEAA 1X6BA 5GANd 3CC2T 3WVDB 3CCQT 1IB8A 4VUBA 2CZ1B 3EG3A 1X6GA 3G7ZA 4PFZA 3X26B 1IRXA 1ZA2B 3LWHA 2LCCA 4CC3A 3L42A 1KQSS 1Y0MA 2DERA 2YRVA 2K9GA 5GAMg 2LNVA 3GP8A 2NUZA 4J8OA 5GAN3 1TOVA 4RTXA 5LJ3e 1SEMA 5GAMj 2EQIA 1WA7A 4KULA 4M7DA 2K6DA 1YITT 3L2WA 3REBB 2H3EB 2WACA 1K8AR 3DLMA 1NBEB 3I55Q 7AT1B 2LZ6B 2JS0A 3G4SA 1B34B 2JN0A 3X28B 2YWWA 5C0MA 4NL2A 4JRQA 5KYNA 4JZ4A 1Q86C 3CBOA 3FJ5A 4KGXB 3BFMA 2LP5A 4LE9A 2E5QA 4J6XA 1N8RR 3PVQA 1VQOQ 1M4ZA 2HBPA 2YLCA 3CCVQ 1XQHA 2ZPFB 1SHFA 1VQ5A 2FG0A 3CPWP 5D6YA 1BI0A 2BZYA 2HZYA 1HK9A 4C0ZA 2K2VA 2WSEE 1RUWA 1ZSZB 4XTXA 4C8QG 4RG2A 1KQ2A 2DRMA 3EG2A 4C92G 1OU9A 1B07A 4C92E 2IPOB 3L2RA 2DVEA 2A28A 1XOVA 3EGDB 1CKAA 1YWOA 4IKFA 4L5GA 5M9OA 3A8GB 3SHWA 3URGA 3JCMX 3CCET 1WHJA 1BKBA 2YDLA 5LJ5f 3OS1A 4L59A 5KH6A 5IHIA 3CC7A 2DKGA 1YCYA 2L3QA 2A7YA 1PCXA 1U06A 5FLXE 2ZGWA 2V26A 1I81A 1FMWA 2F69A 2RB6A 2RJCA 2YUOA 4QVCA 2EJ9A 1HXDA 2E41A 4KUDK 4XU1A 1RL2A 1PHTA 2DL4A 1VQLQ 3JCMg 4PJNA 2KAFA 1YI2A 2CZ6B 2V8KA 5FW9A 4BD3A 4PLIA 1C0MA 3T9NA 4EDUA 4NS5A 3PT9A 1TU0B 4ELZC 2EYWA 2RNAA 4OGEA 2RJDA 1T3SA 2LJ0A 4PL6A 1EX4A 4PJMA 1OU8A 2QXFA 2EGAA 1H3ZA 3CCJA 4JJCA 2YSQA 1TXQA 2KRMA 2PZ1A 1FYNA 4E47A 4J7IA 4XU0A 5CVIA 1YITA 5IAYA 2EWNA 4EMGA 2AKLA 4LN2A 2QQBA 3CCLT 2DJQA 3QZ9B 1WQWA 2EYYA 2GQIA 2DAQA 2FYKA 3CMET 1M8VA 1BYMA 2X3XD 4A4GA 1VQMQ 3NGPA 3OYCA 1IO6A 2RJEA 1HYOA 5LJ3h 1ARKA 1VQ5T 1UFFA 3RKWA 1X01A 1Q82C 1UGSB 2DK3A 1QVGP 1OPLA 2LJ3A 2AK5A 5GAN4 4AMCA 2E6NA 3META 1U8RA 2SEMA 4M4ZA 3RUXA 1RAFB 4J9FA 4C8QF 1GBRA 1WDXA 2DZCA 1Q7YU 5LJ5j 3PE0A 3JB9H 3M54A 2LQNA 5GANe 1W4SA 2F2VA 4RTTA 2LT4A 4EIKA 2DF6A 1QKXA 1VQ6A 2K3BA 3OY9A 3VUBA 1R8OB 1D3BB 3CC7T 2AHJB 4M7DB 3OQ5A 1VQNA 1A0NB 2RQWA 2CP3A 4JLGA 4C0FA 1UE9A 3CCUQ 1RABB 2GF7A 3R6NA 3CCEQ 3OB9A 4JUVA 3I9QA 1KD1R 2EVRA 2AIRB 4F7UF 1G8XA 1VQ7T 5HY6A 3EGUA 2W10A 1J3TA 2E3IA 2QQAA 1QWEA 2DD4A 3HTRA 1IREB 1KC8U 5DLQE 3CCMA 5GMKl 5A0LA 2LX7A 3JCMV 3CC2Q 1ZSZA 1AT1B 3M55A 3G71T 1YIJA 2A0FB 1I8FA 2M51A 3CCRT 3VS6A 1AOJA 4J5YA 5GAMh 3M0TA 1V1CA 4LXCA 1K9MR 1XJWB 1D0ZA 4F7UB 3JB9J 1PD1A 4M77B 2WSFE 1VQKQ 4GLKA 2COWA 4RCBA 4D8DA 1S72A 1Q86R 2DL8A 1N6AA 4Z8AA 1OX9A 2XDBA 2O31A 3R6OA 6AT1B 3TSWA 4ZGDB 1BI1A 2NWMA 4PJOG 1RAIB 2QASA 1ZBXA 4L6V5 3CXCS 1K8AC 1VQMT 1YITQ 5J3BA 2EIFA 2JTMA 2DTIA 4PLLA 3S3OA 1ZX6A 3G4SQ 2CKKA 4FYYB 4OMMA 2P0KA 3OYFA 2C0TA 1GCQA 3HRTA 3M0RA 3X24B 2RHZA 4JS4A 1G3SA 1NYGA 2ZZDA 4Y28E 3FIFA 3JB9G 1ABOA 2E65A 1I5LA 3UATA 2VWFA 2ESWA 5L8RE 2SRCA 1NLPC 3HKSA 1JXMA 1VQ4A 2YRCA 2PUKB 1X75C 1UDLA 1IHVA 2C0IA 3QBYA 4E7IA 2HKQB 1KQSA 4QVDA 3JCMJ 1G3TA 1OEBA 3VS5A 1SF9A 3VS4A 1AWJA 2DL5A 1KQSP 2KEAA 5GAN2 1PKSA 2QTXA 2QA4A 1K4US 3DLLA 1E6GA 5IT9E 3OYKA 4KGZB 3CPWA 4JLIA 2J6OA 4YTLA 3EGXA 1QVPA 4RUGA 1P92A 3EGDA 4MDWA 2EGCA 3CCSQ 2BTTA 3OYDA 2DTOA 5GANh 4M77G 1VQNQ 1RLPC 3H0FA 1QLYA 4E7KA 3V7CA 4HVVA 1PRLC 2A36A 2HNIA 2CUBA 4M75E 2HKNA 3UA6A 3PGGA 4OMFB 3J80E 4M7AA 2L8DA 1LJOA 2DFUA 1QW1A 4K11A 1AEYA 2FPEA 1OQKA 3QDRB 2X4WA 3CCRA 2FZCB 5LJ5h 4OMNA 2BUDA 2JM8A 4FSSA 5GANj 4M7DE 2JTFA 1NG2A 1D1CA 5GANg 5FWBA 5GMKh 3JCMd 3RBBB 2VXFA 1AHJB 4JS5A 2NYSA 4IUUA 4N0AA 3RERA 1M27C 2YUPA 4DOVA 2IG0A 2R57A 3M0SA 3NTKA 3OS5A 2RQTA 2FZGB 4ZNXA 1KHCA 2RPNA 3RDVA 4DA4A 5CIUA 4MZTA 3A8OB 1OYXA 2MI6A 1BBZA 3REAB 1VQPA 5GAMe 5LJ3j 4ZGEB 1RAHB 5LJ3d 3PMIA 5LJ3g 4M7AE 5CCAA 1YN8A 2J06A 4M7AG 2OTLT 1YBYA 2ZPHB 3LYIA 4BDZA 2ROTA 1VQ4T 1ZQ1A 3QKJA 1V76A 4F7UE 2K3XA 1SSFA 1SSHA 4RTZA 3LH0A 5D6WA 5CK9A 2IVWA 1VQ9T 2LT1A 1K73U 3SWNA 3HFNA 5FWCA 1RAAB 4LNPA 2P84A 5FRNA 3CD6A 3M56A 3L2ZA 1X2QA 1UUEA 1FX7A 3EG1A 5CQXA 3QUIA 5HKCA 1WIEA 5LJ3f 2QA4T 1KFZA 1M1FA 1BCMA 2PTKA 5KCHA 2XIDA 4HCKA 1H641 2B8AA 1M1KU 3FLGA 2LMJA 1VQKA 1ZA1B 3ZFJA 3RESA 4FYXB 1QVFS 3MPUB 5KYUA 1Q81R 4M7DD 3DB3A 2KRSA 1FWZA 1WLPB 9ATCB 1WHLA 1TWBA 1I4K1 3A8LB 3M59A 3OA6A 1GCPA 4FT2A 3KFVA 4RCCA 2MWPA 2DETA 2FRWA 1N9RA 4BB7A 5GANf 2JMAA 4GY5A 2MOXA 1G83A 1UHCA 1N5ZA 2RO0A 5GAOr 2CYZB 5GAN6 1VIFA 3P8HA 2MCNA 3CCSA 1Y71A 1M2OA 2OX7A 4GLMA 1EFNA 2K57A 1Q95G 2GNCA 4FSXA 3A1PA 3G6EQ 2JXBA 4FW1A 2J05A 1TUDA 3JCMP 2QQSA 1H3HA 3KUFA 3NTHA 3THKA 2NLUA 2YT6A 4F7UA 4J9BA 2LNHB 5FROA 1NEBA 2K3YA 1I5OB 4QVZA 4RG8A 2A37A 2E1HA 5GMKe 2DEUA 1WHHA 5I11A 2BE9B 2XG8D 5CAIA 2KY9A 1M3BA 2ZPBB 2EAYA 4OMQA 1VQNT 1M2VA 1QP3A 2EYXA 3FRNA 2ENMA 2HL3A 1QKWA 5J39A 3EAEA 1SRLA 4E2FB 5DY9A 1Y57A 4OF1A 3FEOA 2RF0A 3CD6T 2I2LA 4MMKA 1NE8A 2XICA 3QPHA 4IURA 2JS2A 4C8QB 2MIOA 1OV3A 3PIPA 3CCLQ 3WVEB 4AFUC 2LCSA 1ABQA 2AZSA 2YUNA 4ZN3A 5A0GA 2LVMA 4Y91A 3N5BB 1AWOA 2KYMA 3H0HA 4OMPA 3CCMT 5GAOm 2EFIA 3L1AA 2MK5A 4X34A 1K1ZA 2F5TX 3OYNA 2GQVA 1W6XA 1WHMA 2RD1A 1FXXA 5GJVB 4O6JA 4C8QD 2RHXA 1SKUB 1XNIA 5A0DA 3EFRA 2X9HA 1N27A 4WTOB 2AT1B 3M4GA 5HCKA 2O88A 1I1JA 3HPWA 4M7DG 5LJ5d 4PFOA 3VRZA 4FT4A 1OZ3A 1VQLT 4M7AD 4IIMA 4LDUA 2K5IA 1VQ5Q 4KBMB 3P8DA 1WFWA 2M0YA 1GBQA 3A8HB 3UF4A 4M78F 4OB3B 2H3JA 3OYGA 3OYEA 2ABLA 2O9VA 4A53A 1R77A 2DBMA 2X35A 1B34A 2L3PA 2FPFA 3GIBA 1T0JA 3CQTA 3CCLA 4WCIA 2BE7D 5I22A 3PFSA 2COZA 3CCVT 1K76A 1M1GA 4A4KA 2DNUA 4DOWA 4C92B 4C8QE 2V8JA 1K9MC 2KBTA 2P4RA 3VJPA 3VS0A 3O8VA 1KSWA 4BE0A 3QYGB 2F5KA 5IN1A 5FRMA 2CGHA 3CCRQ 2CUDA 3PTAA 4DQ2A 4XK8E 4PNOA 2PVOB 4BI8B 4X9DA 2D0QB 2EPDA 4J6YA 2LC4A 1QMCA 4PJLA 4PJOD 3ULRB 2HMAA 3H6ZA 1Y07A 2BZXA 5CKDA 1R0BG 1U1SA 1GXIE 4R55A 4GBQA 1IZ6A 3KXTA 2DYIA 3OSVA 1TUCA 4KGVB 3UWNA 4M78B 3OYAA 3I56T 5GJWB 3ZEHA 1UJYA 1D1BA 3M57A 4LDWA 3V7RA 4FW2A 2EQJA 2V1RA 3LX7A 4QQGA 2LQ8A 2L89A 3JCMQ 2EQUA 3M4YA 2FL7A 1NPRA 3MP6A 3RNJA 2QQ9A 3GOXA 3CBMA 4ZGJB 1B7TA 1KQ1A 3VV0A 1YJ9A 2K79A 4Q5WA 1NLOC 4AT1B 5DM7R 3CCQA 1VIEA 1WXUA 1PSFA 1MMGA 2RA2A 1Y96A 1Q82R 2NUPA 1YHQT 1AZGB 2HSEB 1D3BA 4ZTFA 2QGGA 3LGLA 3NHNA 1PG5B 1H92A 2G6FX 3G71A 1YIJT 1VQOT 1WHKA 2RH2A 4PJOE 2CREA 4PJOA 1WYXA 3TEEA 2PVGB 4A54A 2VYTA 3TCJA 4OB1B 3MCAB 1YCSB 3JCMc 1S72T 4C8QC 3GNFB 5GAN8 3RMSA 3OYBA 1YHQA 2RHYA 4ZTJA 3OYMA 3SD4A 3UT1A 3VS7A 1ACMB 3OW2P 1M90C 1BB9A 1VQ6Q 2M02A 5D6XA 1VQ9A 1VQOA 5KCOA 1MGQA 3CCVA 1PD0A 3I55A 1UEBA 4X9CA 1GRIA 3OS0A 2PQWA 4OB2B 2YRDA 4BDYA 3OBYA 4M77A 4E6RA 3EHQA 3MEWA 2CP0A 2ZPGB 3IQLA 3SEMA 3I5RA 4F17A 1W70A 1SG5A 4FCYA 1VQ8A 2JOYA 3MP1A 1G3YA 3PNWC 1CKBA 3CXCP 1Q7YR 1M30A 3FJPA 4NL3A 2JJ9A 2X4XA 1NJIC 4EMKA 4LD6A 2P0PA 2RMOA 2YXYA 2XI9A 4WF2A 2P0QA 3I55T 3F70A 1VUBA 2EKOA 3TVTA 1UG1A 1YJWQ 3RIRA 2VV5A 1RAEB 1NJIR 2RK1A 2VXEA 2XU8A 4DEXA 2ZCFB 2D0NA 3V7SA 3GLXA 4BE2A 1I07A 2KMTA 2CT3A 1QCNA 3HRSA 1LNXA 1WI7A 1HD3A 3QYHB 2AZVA 3CCUA 2LRQA 1PRMC 2YLBA 1K0SA 3HRUA 1KG1A 3PVLA 4XTUA 2E12A 1WX6A 1JJ2A 2OAWA 1KD1U 1TSFA 4BY6B 3OW2A 3CCST 4OGCA 5D7UA 3GPLA 1WGSA 4PJOC 1M90U 4HT8A 3OBWA 4JRIA 2CH4W 4II1A 2DXCA 2KK4A 3LW5E 8AT1B 4LUEA 2LQWA 1KC8R 3D7SB 3A98A 4EMKC 4ANJA 3EGXB 3M9QA 2QA4Q 2V1QA 1VQ4Q 1NM7A 2M16A 1M3CA 4BACA 2DIQA 3L2UA 5GMKj 1JQQA 2CP2A 2COYA 1KIKA 3M58A 1VOMA 1JU5C 4M75F 1TG0A 1X43A 4R56A 2O2OA 2YHTA 2GTJA 1E7OA 2XD0A 4AFZC 3BW1A 2O4XB 1PC0A 4PK4A 2DPPB 2AKKA 4HA8A 5FU6B 3VS3A 1VQPT 1UGVA 3BY7A 2RJFA 3JAME 1K0XA 4C5GA 4JDSA 2H8HA 2XMFA 2RI3A 3INZA 2VB6A 1WZOA 1ZSGA 1D09B 2ED1A 2L5QA 3SB2A 4CC2A 1VQ8T 4LUDA 3FDRA 4FYWB 1Y96B 3NFCA 4IUTA 4C92A 4D6WA 1JO8A 2K7AA 3MKDA 3JV3A 2IIMA 2LQKA 2R58A 2C0OA 4FYVB 4F04B 1Y7XA 2CZ7B 2X51A 3JCMf 1MNEA 1O9SA 3BDLA 1YWPA 2DXUA 2VVKA 1W2BS 2CDTA 2DEQA 4M75G 2KSSA 4RKUE 1PNJA 2QAZA 2QEXT 3VS1A 3EFOA 3AT1B 4TVRA 2LTOA 2WSCE 2A3LA 2VGNA 4J9DA 3UPUA 1UECA 1ZSZC 4QT7A 1LOJA 3AHUA 1VQ7A 2R5MA 4J6WA 1BIBA 2VASA 4JRPA 2J6FA 4E7ZA 2QDLA 4ESRA 1KK7A 4OVAA 3OYHA 3MEVA 3OMGA 4XQ3A 2MMPA 3X25B 1U3OA 4OP0A 2DIGA 4HT9A 2FPDA 1M9SA 1GL5A 1LCKA 1OOTA 3M0UA 2E4HA 2RQRA 4A4EA 2DBKA 4DBHA 4HCZA 2NUPB 1VQ9Q 2L2PA 2NUTB 5AT1B 1K8AU 1UGQB 2K5FA 3MP8A 2M9UA 3C12A 3CMAT 1WJSA 1U5SA 5IXFA 2DL7A 1RLQC 3M5AA 4BE1A 2CP6A 2QQRA 1MMAA 3SWNC 3FB9A 2JT4A 2KROA 5KYXB 1M3AA 1VQMA 2LCLA 5LJ5e 1VYTA 1N8RU 1YJWT 1NYFA 3S3NA 1QCFA 1S72Q 2EGEA 1GFCA 2ECZA 4D8KA 1AWWA 8ATCB 1MV0B 3MHXA 3CMEQ 4PFPA 3OYLA 2RM4A 3CXCA 3QSUA 2O01E 4MMLA 3I5SA 3MO8A 2VGMA 1PSEA 1YJ9Q 1G2BA 1WPYA 4C0DC 4M78D 3RR6A 1GFDA 2D1XA 1W1FA 2VUBA 4DBQA 1CSKA 1K73R 3UDCA 4QQDA 1BU1A 1O75A 2E70A 3QO3A 1OPKA 1KHIA 3S6WA 3C94A 4J83A 4LDYA 4HVWA 5KYUB 2QEXA 4AFQC 3V8JA 3JB9F 3VUZA 1M1KR 2KRNA 4XU2A 2KT1A 1M2VB 2DM1A 3CC4A 2KI7A 3OMCA 3JCMh 1RI0A 3I56Q 1JXOA 1TUGB 1WNLA 2HAXA 2GGRA 1Z9ZA 3JCMb 4EPCA 1T0HA 4HKEA 3SFMA 2M1HA 1IHWA 2RK2A 2GBQA 2LJ1A 4OMLA 2HDAA 1K9AA 2EW3A 4J9GA 4PJOF 1VYUA 3L2QA 1D0XA 4C5HA 1VQLA 2KT8A 4PJJA 4DEYA 2QTVA 3HSBA 2FB7A 2EQKA 1ZLMA 4C0GA 1QVFP 2EBPA 5A2QE 3I35A 2KYBA 2HSPA 4JZ3A 3OYIA 1Q81C 3G1JA 2I0NA 2HCKA 2A08A 2HQHA 3C0CA 1IXDA 3U23A 3J81E 2EYZA 3QXEB 2KVQG 2QK0A 2CS7A 3VU3C 1LPLA 2LX9A 1XTDA 2EKHA 4HXJA 2DLPA 1ZBJA 1QQJA 2XDDA 1YFNA 5AYFA 3HP9A 4J7FA 4C0DB 5GAMd 5GAOl 4F7UG 2CP5A 2X3WD 5IHNA 4MDXA 3RKXA 3DB4A 2DO3A 3C95A 3H0IA 1QVGA 1YHQQ 2Y4YA 3UA7A 2BKDN 4E7JA 2MPXC 3EG0A 1G3WA 1IGQA 2EJGA 3CEYA 5CKBA 3CCUT 4RTUA 2GFUA 5GAN7 3L2VA 4C5EA 2PNIA 2E10A 4C8QA 3EH1A 2RI2A 3VRYA 2DTHA 2D9TA 3LGFA 2KNBB 4BI4A 4QQ6A 2DVJA 2DZ9A 1OX8A 1I0CA 3E1SA 4JRKA 1X27A 1AVZC 3G6EA 4DBFA 3RMQA 3QWXX 2B86A 1N9SA 1S1NA 2MYSA 5KYYA 4XTYA 2KXDA 1VQ7Q 4N4GA 3OYJA 3QJ6A 3E2UA 2GCXA 4BUGA 4M78G 4E7HA 1JJ2P 5FU7B 2FO0A 1UJ0A 3H8ZA 1VYVA 2JMCA 2JNGA 3ZBDA 1PKTA 4AFSC 1M5Q1 3EFOB 1VA7A 5EC7A 4M7DF 1HJDA 4M78A 3OS2A 1ZUKA 2C06A 1ZUUA 4DBRA 3GF5A 2JTEA 3QIIA 1K9MU 1KJWA 2DILA 4KH0B 3LLRA 1M1KC 3JCMe 2DL3A 4N4HA 2KDSA 2RQVA 3NPFA 2DRKA 2LDMA 1Q86U 1C6VX 4ME7A 5GMKm 1GCQC 4PKCC 1WHGA 1AZEA 4M75C 4HCBA 3CMEA 5I2SA 4RTVA 1TH7A 4KUIA 4KT0E 4IUPA 5I21A 4OMOA 2E5KA 1AWXA 3OYYA 4HCCA 2J6KA 4FIBA 3OW2S 2D8JA 1BCOA 2MWOA 3EH2A 2EQMA 3CPFA 2GFAA 4X1VA 2JZ2A 4M7DC 1RADB 3BDUA 2XDPA 1N8RC 1NPPA 2K5LA 3CBPA 4PJOB 1QCOA 3A5ZB 2O9SA 2DYBA 3CMAA 5KYWA 2HEQA 2QDYB 3ZL7C 3VYHB 5LJ5g 4M77D 4CC4B 4KRTA 2DMOA 1UGPB 4RTYA 1UHFA 5GAOq 3ASKA 1F1BB 4ORZA 4BI3A 2RQUA 1RACB 2CT4A 2ZPIB 3LH5A 3RKYA 3MJXA 5CKFA 1U1TA 1UB4A 1SRMA 3CCMQ 2MF2A 3GNGA 3CC2A 2K4YA 3QHSA 2XKOC 1JEGA 4B9WA 4C92F 2R5AA 4XTVA 1MNDA 1MMNA 2ATCB 4R0KA 1V29B 4M7AC 4C92D 1X6OA 5CR2A 4ZN1A 1X2KA 5C6SA 3G6ET 1H8KA 1NZ9A 4JPBW 5L23A 2QI2A 5GAN5 3Q1JA 1TTHB 3C4SA 3MEUA 1RI9A 2F1LA 3EHRA 3CCJQ 3VYGA 5KE3A 1KC8C 2FZKB 4M75A 1UTIA 2VKNA 3TU4K 4Z88A 5KE2A 3E19A 3CCQQ 4LD9K 3A8MB 2RHUA 3SDZA 3OSSC 5CKEA 1JB0E 1MHNA 2F2XA 3E9GA 2CP7A 2ZAEA 2RHIA 5GAMf 1YJNA 4M78C 1Q82U 2QYZA 3JSCA 2GTOA 5ECAA 4J9CA 4F14A 2EJFA 4OB0B 2DXBA 2YUQA 1D1AA 2ED0A 1MV3A 4LDVA 2JVVA 5DLOA 4B6MA 2OTLQ 2KQWA 2QGFB 1FMKA 2RI5A 3V8KA 1BK2A 3EFSA 4QW2A 2MAMA 3HL8A 4M77C 3EG9A 4RMOA 5I2MA 2CSQA 2EYQA 3HFOA 1VQ8Q 5GAOn 1EZZB 1WXBA 4CC7A 2KGTA 2D8HA 4F16A 1QP2A 3M0QA 4JJDA 2CSIA 1B3QA 1M8MA 3ER0A 5HK3A 4HVUA 3H9NA 2DD5A 4P5NA 4XAXB 1PM3A 1WXTA 5KYYB 3FC3A 3ME9A 3LWIA 1YNZA 3M53A 4CRIA 2PVDB 1JRIA 2OJ2A 2CH4A 5CQYA 1SPKA 1WQ7A 3CC4Q 1D0YA 4LDXA 2FVUA 3X20B 1FMVA 2E3HA 4EMKB 4J9EA 4J9HA 3BE3A 4M7AF 5IH2A 1JBMA 2Y4XA 4M7AB 2O4XA 3SWNB 4M75D 4MZPA 4C5IA 3O5ZA 4B9XA 4N4IA 5HK0A 1YI2T 1NJIU 1AD5A 4XTZA 1C1AA 2G3RA 2HL5C 4KH1B 1NEGA 2F2WA 3QZ5B 4FM4B 3VS2A 3JCMW 5IHKA 1QVFA 4FU6A 4AG1C 4M78E 1YJNQ 1Q81U 1OI1A 1W2BP 2OAUA 3HHTB 1HSQA 1YJ9T 4JJBA 3CCJT 2D6FA 2J7IA 2Z0WA 3TREA 5J26A 4E7SA 2L3SA 3JB9D 1WJQA 1OZ2A 4ATOA 3QDFA 3TSZA 1W2BA 3CD6Q 3E9FA 4N0AC 1QWFA 1M90R
chains in the Genus database with same CATH topology
3C94A 4IUVA 4M77E 3R6OA 3PTAA 4DQ2A 4J83A 4LDYA 4ZGDB 4XK8E 4PNOA 1YJNT 1BI1A 1ZHIA 2HQXA 4PJOG 2QEXA 2PVOB 3QG1A 1ZBXA 2Y90A 4L6V5 3V8JA 4BI8B 1EIFA 3CXCS 1K8AC 1VQMT 1KD1C 4X9DA 3VUZA 2D0QB 5J3BA 3JB9F 2EIFA 4XU2A 2JTMA 4J6YA 2E6ZA 4IUQA 3DKMA 2DTIA 2FHDA 2LC4A 3PMTA 3CC4A 4PLLA 3OMCA 3JCMh 1RI0A 4NOYA 4A4FA 3S3OA 2CKKA 4PJOD 1WNLA 2DJZA 3H6ZA 1Y07A 4Z02A 3P8BB 5LL6S 3V8LA 5CKDA 2HAXA 2P0KA 3JCMb 4EPCA 1U1SA 2PU9B 4XU3A 3OYFA 1GXIE 4R55A 3HRTA 4HKEA 3SFMA 3X24B 1IZ6A 2RHZA 4UC4A 4M77F 4JS4A 3KXTA 2M1HA 3OSVA 4EMHA 2OTJT 3KBGA 3UWNA 1G3SA 2RK2A 4M78B 2ZZDA 4Y28E 3J7AF 3G4ST 3FIFA 3JB9G 3OYAA 3I56T 2HD0A 2BIVA 3ZEHA 2E65A 2X4JA 1I5LA 4PJOF 3M57A 4LDWA 5L8RE 3V7RA 2EQJA 3HKSA 3L2QA 3LX7A 1VQ4A 4QQGA 2HQEA 2LQ8A 1X75C 2PUKB 4C5HA 1VQLA 2L89A 3JCMQ 1WJRA 2EQUA 3M4YA 3QBYA 4E7IA 1YJWA 2FL7A 2ZPEB 1NPRA 3MP6A 1KQSA 3HSBA 2FB7A 2QQ9A 1BI3A 3CBMA 4QVDA 4ZGJB 3GOXA 2EQKA 1KQ1A 3VV0A 5GMKi 4C0GA 3JCMJ 1YJ9A 1Q7YC 1G3TA 2M0OA 3NTIA 5A2QE 2V8IA 4Q5WA 4O5VA 1VQ6T 5DM7R 5GAOp 1K73C 3CCQA 3OYIA 1Q81C 1VIEA 1PSFA 2E64A 5FU7C 5GAN2 2OTLA 2OTJA 4M75B 2QTXA 2RA2A 2JUFA 2XHCA 2QA4A 1UGRB 3DLLA 1Y96A 5IT9E 3J81E 3OYKA 1YHQT 3QXEB 2KVQG 3CPWA 4BY6C 1D3BA 3AHUA 4JLIA 4YTLA 2CS7A 2DXTA 4FL6A 4A4HA 3VU3C 2X4YA 4ZTFA 1DJ7B 1QVPA 2P4TA 5CO7A 2XK0A 1P92A 3LGLA 4MDWA 2LX9A 3VKIA 1XTDA 3S3MA 3OYDA 4V2SA 3G71A 1YIJT 1QVGS 2DTOA 5GANh 4M77G 1VQOT 2RH2A 4ELYC 3PIOA 2XDDA 4E7KA 4JJNK 4PJOE 1BIAA 5AYFA 3V7CA 3HP9A 4PJOA 4J7FA 5CKHA 3TEEA 2PVGB 4C0DB 5GAMd 2HNIA 4A54A 2VYTA 5GAOl 4F7UG 4M75E 4MDXA 4XTWA 3PGGA 4OMFB 3RKXA 3TCJA 3J80E 3DB4A 2L8DA 3MCAB 4MZMA 2DO3A 1LJOA 4OB1B 3JCMc 3CCEA 4C8QC 1S72T 3C95A 3WXMB 1QW1A 3GNFB 2CZ0B 2VC8A 5GAN8 4E7LA 3I56A 3RMSA 3OYBA 1QVGA 2Y4YA 1YHQA 1BI2A 2RHYA 4ZTJA 1JJ2S 2BKDN 4E7JA 3JRZA 3OYMA 3SD4A 1G3WA 4C92C 3UT1A 2EJGA 2L3RA 3QDRB 3JB9I 3CEYA 2X4WA 5CKBA 3CCUT 5EG2A 5FU6C 1VQKT 3CPWS 3CCRA 1M90C 2GFUA 5LJ5h 5GAN7 5D6XA 2BUDA 2PUOB 3L2VA 1VQ9A 5GANj 1G5VA 1VQOA 4M7DE 5KCOA 3CC4T 4C5EA 1MGQA 2JTFA 3QJYA 4CI0C 2E10A 3CCVA 4C8QA 5GANg 3I55A 1UEBA 2RI2A 4X9CA 3MEAA 5GMKh 5GANd 3JCMd 2DTHA 1AHJB 2D9TA 2VXFA 3LGFA 3WVDB 2PQWA 4IUUA 3OS0A 3CCQT 4N0AA 4OB2B 4JS5A 4BI4A 3RERA 4QQ6A 4DOVA 4VUBA 2IG0A 2DZ9A 2R57A 3OBYA 2CZ1B 4BDYA 3NTKA 4M77A 3E1SA 3G7ZA 4JRKA 3X26B 3MEWA 3OS5A 2ZPGB 3LWHA 2LCCA 3G6EA 3L42A 3RMQA 1KHCA 4DA4A 1VQ8A 1KQSS 2JOYA 2YRVA 3MP1A 3A8OB 1N9SA 4MZTA 1G3YA 1OYXA 2LNVA 2MI6A 3PNWC 5CIUA 4XTYA 3FJPA 5GAMg 3GP8A 4NL3A 4J8OA 5GAN3 2X4XA 5LJ3e 5GAMj 1NJIC 4EMKA 4LD6A 1VQPA 5GAMe 5LJ3j 2P0PA 4ZGEB 2XI9A 4N4GA 4WF2A 3OYJA 3QJ6A 2P0QA 2GCXA 4KULA 3PMIA 5LJ3d 3I55T 3F70A 1VUBA 2EKOA 4M78G 4BUGA 5LJ3g 3RIRA 2VV5A 4E7HA 1YITT 3L2WA 5FU7B 4M7AA 4M7AE 2RK1A 5CCAA 2VXEA 2XU8A 2ZCFB 2WACA 3H8ZA 4M7AG 3V7SA 2OTLT 3DLMA 1YBYA 3GLXA 2ZPHB 4BE2A 2JNGA 2KMTA 3ZBDA 3LYIA 4BDZA 1M5Q1 1VQ4T 3HRSA 3G4SA 1B34B 1LNXA 1ZQ1A 2JN0A 3X28B 3CD6T 3QKJA 3QYHB 4NL2A 5C0MA 4M7DF 4F7UE 3CCUA 4JRQA 4M78A 3OS2A 2K3XA 1SSFA 1Q86C 3LH0A 3CBOA 2LRQA 5D6WA 2IVWA 5CK9A 1VQ9T 2YLBA 2C06A 3HRUA 1KG1A 3GF5A 2LT1A 3BFMA 3SWNA 3HFNA 1K73U 3QIIA 2E5QA 4XTUA 4J6XA 1K9MU 2E12A 1JJ2A 3LLRA 1M1KC 3JCMe 1M4ZA 2HBPA 2YLCA 1KD1U 4N4HA 3M56A 5FRNA 3CD6A 2KDSA 4BY6B 3L2ZA 3OW2A 1XQHA 2ZPFB 3CCST 4OGCA 1VQ5A 1FX7A 5D6YA 3CC2T 2LDMA 1BI0A 5CQXA 3GPLA 1WGSA 1Q86U 4PJOC 4ME7A 1M90U 5GMKm 4HT8A 3QUIA 3OBWA 1HK9A 4JRIA 4PKCC 4II1A 4C0ZA 5HKCA 2K2VA 2WSEE 4M75C 5LJ3f 2QA4T 2DXCA 1M1FA 4XTXA 5KCHA 2XIDA 4HCBA 4C8QG 4RG2A 2KK4A 5I2SA 3CMEA 1H641 2B8AA 1KQ2A 3LW5E 1M1KU 1TH7A 3FLGA 4KUIA 1VQKA 4KT0E 3ZFJA 4IUPA 3RESA 5I21A 4C92G 1QVFS 4EMKC 3OYYA 4C92E 4HCCA 3L2RA 2DVEA 3M9QA 1XOVA 4FIBA 3OW2S 4M7DD 2MWOA 3DB3A 2EQMA 3CPFA 2GFAA 1FWZA 2M16A 4IKFA 4L5GA 4BACA 2DIQA 5M9OA 3A8GB 3URGA 2JZ2A 3JCMX 5GMKj 3L2UA 3CCET 4M7DC 1BKBA 3BDUA 2XDPA 5LJ5f 1I4K1 3OS1A 3A8LB 3M59A 4L59A 1N8RC 1NPPA 2K5LA 3CBPA 4FT2A 3OA6A 4PJOB 5KH6A 3A5ZB 3M58A 4RCCA 3CC7A 3CMAA 2DKGA 2MWPA 1YCYA 4M75F 2QDYB 1N9RA 2A7YA 4BB7A 5GANf 4R56A 3VYHB 5LJ5g 4M77D 5FLXE 4GY5A 2YHTA 2ZGWA 2XD0A 1I81A 2F69A 2RB6A 1UGPB 2RJCA 3BW1A 2RO0A 2O4XB 5GAOq 3ASKA 5GAOr 2CYZB 4QVCA 2EJ9A 1HXDA 5GAN6 2E41A 4BI3A 1VIFA 4KUDK 2DPPB 4XU1A 5FU6B 4HA8A 3P8HA 1VQPT 1RL2A 2ZPIB 3BY7A 3CCSA 3RKYA 2RJFA 3JAME 5CKFA 1Y71A 4C5GA 1U1TA 1UB4A 4JDSA 2K57A 2MF2A 3JCMg 3GNGA 3CC2A 2KAFA 2K4YA 2RI3A 3QHSA 4FSXA 2XKOC 3INZA 1YI2A 2CZ6B 2V8KA 4B9WA 4BD3A 4PLIA 3T9NA 4C92F 4EDUA 2R5AA 4NS5A 4XTVA 3PT9A 4ELZC 1V29B 2L5QA 4M7AC 4C92D 1X6OA 3SB2A 4ZN1A 5CR2A 1VQ8T 3JCMP 2QQSA 4OGEA 2RJDA 3KUFA 3FDRA 3NTHA 5C6SA 3G6ET 1NZ9A 1Y96B 2NLUA 3NFCA 2QI2A 4IUTA 4PL6A 4F7UA 3Q1JA 5GAN5 3C4SA 4C92A 2QXFA 3MEUA 5FROA 4D6WA 3VYGA 1H3ZA 5KE3A 3CCJA 2K3YA 1KC8C 4M75A 2LQKA 3TU4K 5KE2A 3E19A 4LD9K 4QVZA 4RG8A 3A8MB 2E1HA 4J7IA 4XU0A 5CVIA 4E47A 5GMKe 2R58A 1Y7XA 1YITA 2CZ7B 3JCMf 5IAYA 2XG8D 2EWNA 1O9SA 2RHUA 3OSSC 3SDZA 4EMGA 3BDLA 5CKEA 5CAIA 1JB0E 1MHNA 2KY9A 3E9GA 2DXUA 2QQBA 2EAYA 2ZPBB 2RHIA 5GAMf 3CCLT 1YJNA 3QZ9B 4M78C 1VQNT 1WQWA 1W2BS 1Q82U 1M8VA 2DAQA 1QP3A 2FYKA 3JSCA 3CMET 2DEQA 3FRNA 1BYMA 4M75G 4A4GA 3OYCA 2KSSA 4RKUE 2QEXT 2EJFA 4OB0B 2DXBA 2RJEA 5J39A 3EAEA 4TVRA 5LJ3h 2LTOA 2WSCE 2A3LA 5DY9A 2VGNA 4LDVA 3UPUA 2JVVA 1VQ5T 5DLOA 4OF1A 3FEOA 2KQWA 1LOJA 2RI5A 1X01A 3RKWA 1UGSB 2DK3A 3V8KA 1Q82C 1VQ7A 2I2LA 2R5MA 3EFSA 4MMKA 4QW2A 2XICA 1NE8A 3QPHA 4J6WA 1BIBA 4IURA 4JRPA 2MAMA 3HL8A 4M77C 4C8QB 5GAN4 4RMOA 5I2MA 2EYQA 3HFOA 4OVAA 2E6NA 5GAOn 3PIPA 3META 3WVEB 1U8RA 3OYHA 1QP2A 3MEVA 3RUXA 3OMGA 4XQ3A 4C8QF 4ZN3A 2MMPA 2DZCA 3X25B 5A0GA 1Q7YU 5LJ5j 2LVMA 4OP0A 4Y91A 4M7DA 2DIGA 3N5BB 4HT9A 3JB9H 3ER0A 3M54A 5HK3A 5GAOm 3CCMT 4P5NA 2DD5A 1M9SA 5GANe 1W4SA 2EFIA 4XAXB 4A4EA 2LT4A 3L1AA 4X34A 2F5TX 3FC3A 3OYNA 1VQ6A 2GQVA 4HCZA 3ME9A 3OY9A 3LWIA 2RD1A 1FXXA 3VUBA 1K8AU 1R8OB 4O6JA 1D3BB 4C8QD 1UGQB 2AHJB 3CC7T 2K5FA 3M53A 3MP8A 2RHXA 2M9UA 2PVDB 1JRIA 4CRIA 4M7DB 1XNIA 3OQ5A 5CQYA 5A0DA 1WQ7A 3EFRA 1N27A 3C12A 1VQNA 3CMAT 1WJSA 3M4GA 3M5AA 4BE1A 4LDXA 2FVUA 3X20B 3HPWA 4JLGA 5LJ5d 2QQRA 4C0FA 4M7DG 3SWNC 4FT4A 3FB9A 4EMKB 2GF7A 1OZ3A 1VQLT 4M7AD 4LDUA 2LCLA 1VQMA 3OB9A 5LJ5e 4JUVA 1YJWT 1N8RU 2K5IA 4KBMB 4M7AF 3P8DA 4F7UF 1JBMA 2Y4XA 3S3NA 3A8HB 4M7AB 4M78F 4OB3B 2O4XA 2H3JA 3SWNB 3OYGA 1VQ7T 4M75D 3OYEA 4A53A 4MZPA 4C5IA 2X35A 1B34A 4B9XA 3MHXA 4N4IA 5HK0A 5HY6A 3OYLA 2RM4A 3CXCA 1YI2T 1NJIU 3QSUA 2O01E 3GIBA 2G3RA 4MMLA 4XTZA 3MO8A 2VGMA 1PSEA 3CCLA 2QQAA 2DD4A 3QZ5B 4FM4B 1IREB 1WPYA 4M78D 4C0DC 1KC8U 5DLQE 3CCMA 5GMKl 5A0LA 3JCMV 3JCMW 1QVFA 4FU6A 3PFSA 2VUBA 4M78E 1Q81U 1OI1A 3M55A 3G71T 1YIJA 2OAUA 3CCVT 1I8FA 3CCRT 3HHTB 3UDCA 4J5YA 5GAMh 4QQDA 1YJ9T 3CCJT 1M1GA 4A4KA 4DOWA 1O75A 2D6FA 4F7UB 3TREA 2E70A 5J26A 4C92B 4C8QE 2V8JA 3JB9J 3JB9D 1WJQA 1OZ2A 4M77B 1K9MC 4ATOA 3VJPA 2WSFE 3O8VA 3QO3A 4GLKA 4BE0A 1W2BA 4RCBA 3QYGB 2F5KA 1S72A 3E9FA 1KHIA 4N0AC 3S6WA 5IN1A 5FRMA 1N6AA 2CGHA 2XDBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FU6 C;  4C0D B;  4BY6 C;  5FU7 B;  4C0G A;  4BY6 B;  4C0F A;  5FU6 B;  4C0D C;  5FU7 C; 
#chains in the Genus database with same CATH topology
 2FRY A;  4IUV A;  1YP5 A;  4M77 E;  2QG9 B;  1YJN T;  2HQX A;  1ZHI A;  2ROL A;  3QG1 A;  2QEX Q;  2Y90 A;  1EIF A;  5KYW B;  1KD1 C;  1OUL A;  2E6Z A;  4IUQ A;  3DKM A;  2FHD A;  3PMT A;  4J9I A;  1VQP Q;  4A4F A;  4NOY A;  3CMA Q;  4Z02 A;  2DJZ A;  3V8L A;  3P8B B;  5LL6 S;  2OTJ Q;  2DE0 X;  2PU9 B;  4XU3 A;  2HBW A;  1MMD A;  2KR3 A;  1RAG B;  1SHG A;  4UC4 A;  4M77 F;  4EMH A;  2OTJ T;  3KBG A;  2KE9 A;  3J7A F;  3G4S T;  2DX1 A;  4QKU A;  2HD0 A;  2BIV A;  2X4J A;  2HQE A;  5IXB A;  3M0P A;  1WJR A;  2FEI A;  1YJW A;  1T3L A;  2ZPE B;  1BI3 A;  5GMK i;  1Q7Y C;  2M0O A;  3NTI A;  1R0C B;  2V8I A;  4Z89 A;  2JW4 A;  4O5V A;  1VQ6 T;  5GAO p;  1K73 C;  5FU7 C;  2E64 A;  2OTL A;  2OTJ A;  4M75 B;  2KXC A;  2JUF A;  2XHC A;  1UGR B;  2NUT A;  4BY6 C;  1LVK A;  4A63 B;  2DXT A;  1ZUY A;  4FL6 A;  4A4H A;  2X4Y A;  1DJ7 B;  2K2M A;  2P4T A;  5CO7 A;  2XK0 A;  3VKI A;  3S3M A;  1MUZ A;  4V2S A;  1QVG S;  4RTW A;  1PWT A;  4Y92 A;  4ELY C;  3PIO A;  2BZ8 A;  5KYX A;  4JJN K;  1BIA A;  1YI2 Q;  5CKH A;  3NMZ C;  1YIJ Q;  3GBQ A;  2RN8 A;  4XTW A;  3H41 A;  1TS9 A;  2JM9 A;  4MZM A;  3CCE A;  3WXM B;  2CZ0 B;  2VC8 A;  4E7L A;  3I56 A;  1BI2 A;  2L0A A;  3EG9 B;  1JJ2 S;  3JRZ A;  2DA9 A;  2W0Z A;  4C92 C;  4IIO A;  3TQ7 P;  2L3R A;  3JB9 I;  1VQK T;  5EG2 A;  5FU6 C;  1E6H A;  3CPW S;  2PUO B;  1G5V A;  1IGU A;  3CC4 T;  4CI0 C;  3QJY A;  4AG2 C;  1Z9Q A;  2OI3 A;  3QWY A;  1X69 A;  3CC7 Q;  3G71 Q;  3MEA A;  1X6B A;  5GAN d;  3CC2 T;  3WVD B;  3CCQ T;  1IB8 A;  4VUB A;  2CZ1 B;  3EG3 A;  1X6G A;  3G7Z A;  4PFZ A;  3X26 B;  1IRX A;  1ZA2 B;  3LWH A;  2LCC A;  4CC3 A;  3L42 A;  1KQS S;  1Y0M A;  2DER A;  2YRV A;  2K9G A;  5GAM g;  2LNV A;  3GP8 A;  2NUZ A;  4J8O A;  5GAN 3;  1TOV A;  4RTX A;  5LJ3 e;  1SEM A;  5GAM j;  2EQI A;  1WA7 A;  4KUL A;  4M7D A;  2K6D A;  1YIT T;  3L2W A;  3REB B;  2H3E B;  2WAC A;  1K8A R;  3DLM A;  1NBE B;  3I55 Q;  7AT1 B;  2LZ6 B;  2JS0 A;  3G4S A;  1B34 B;  2JN0 A;  3X28 B;  2YWW A;  5C0M A;  4NL2 A;  4JRQ A;  5KYN A;  4JZ4 A;  1Q86 C;  3CBO A;  3FJ5 A;  4KGX B;  3BFM A;  2LP5 A;  4LE9 A;  2E5Q A;  4J6X A;  1N8R R;  3PVQ A;  1VQO Q;  1M4Z A;  2HBP A;  2YLC A;  3CCV Q;  1XQH A;  2ZPF B;  1SHF A;  1VQ5 A;  2FG0 A;  3CPW P;  5D6Y A;  1BI0 A;  2BZY A;  2HZY A;  1HK9 A;  4C0Z A;  2K2V A;  2WSE E;  1RUW A;  1ZSZ B;  4XTX A;  4C8Q G;  4RG2 A;  1KQ2 A;  2DRM A;  3EG2 A;  4C92 G;  1OU9 A;  1B07 A;  4C92 E;  2IPO B;  3L2R A;  2DVE A;  2A28 A;  1XOV A;  3EGD B;  1CKA A;  1YWO A;  4IKF A;  4L5G A;  5M9O A;  3A8G B;  3SHW A;  3URG A;  3JCM X;  3CCE T;  1WHJ A;  1BKB A;  2YDL A;  5LJ5 f;  3OS1 A;  4L59 A;  5KH6 A;  5IHI A;  3CC7 A;  2DKG A;  1YCY A;  2L3Q A;  2A7Y A;  1PCX A;  1U06 A;  5FLX E;  2ZGW A;  2V26 A;  1I81 A;  1FMW A;  2F69 A;  2RB6 A;  2RJC A;  2YUO A;  4QVC A;  2EJ9 A;  1HXD A;  2E41 A;  4KUD K;  4XU1 A;  1RL2 A;  1PHT A;  2DL4 A;  1VQL Q;  3JCM g;  4PJN A;  2KAF A;  1YI2 A;  2CZ6 B;  2V8K A;  5FW9 A;  4BD3 A;  4PLI A;  1C0M A;  3T9N A;  4EDU A;  4NS5 A;  3PT9 A;  1TU0 B;  4ELZ C;  2EYW A;  2RNA A;  4OGE A;  2RJD A;  1T3S A;  2LJ0 A;  4PL6 A;  1EX4 A;  4PJM A;  1OU8 A;  2QXF A;  2EGA A;  1H3Z A;  3CCJ A;  4JJC A;  2YSQ A;  1TXQ A;  2KRM A;  2PZ1 A;  1FYN A;  4E47 A;  4J7I A;  4XU0 A;  5CVI A;  1YIT A;  5IAY A;  2EWN A;  4EMG A;  2AKL A;  4LN2 A;  2QQB A;  3CCL T;  2DJQ A;  3QZ9 B;  1WQW A;  2EYY A;  2GQI A;  2DAQ A;  2FYK A;  3CME T;  1M8V A;  1BYM A;  2X3X D;  4A4G A;  1VQM Q;  3NGP A;  3OYC A;  1IO6 A;  2RJE A;  1HYO A;  5LJ3 h;  1ARK A;  1VQ5 T;  1UFF A;  3RKW A;  1X01 A;  1Q82 C;  1UGS B;  2DK3 A;  1QVG P;  1OPL A;  2LJ3 A;  2AK5 A;  5GAN 4;  4AMC A;  2E6N A;  3MET A;  1U8R A;  2SEM A;  4M4Z A;  3RUX A;  1RAF B;  4J9F A;  4C8Q F;  1GBR A;  1WDX A;  2DZC A;  1Q7Y U;  5LJ5 j;  3PE0 A;  3JB9 H;  3M54 A;  2LQN A;  5GAN e;  1W4S A;  2F2V A;  4RTT A;  2LT4 A;  4EIK A;  2DF6 A;  1QKX A;  1VQ6 A;  2K3B A;  3OY9 A;  3VUB A;  1R8O B;  1D3B B;  3CC7 T;  2AHJ B;  4M7D B;  3OQ5 A;  1VQN A;  1A0N B;  2RQW A;  2CP3 A;  4JLG A;  4C0F A;  1UE9 A;  3CCU Q;  1RAB B;  2GF7 A;  3R6N A;  3CCE Q;  3OB9 A;  4JUV A;  3I9Q A;  1KD1 R;  2EVR A;  2AIR B;  4F7U F;  1G8X A;  1VQ7 T;  5HY6 A;  3EGU A;  2W10 A;  1J3T A;  2E3I A;  2QQA A;  1QWE A;  2DD4 A;  3HTR A;  1IRE B;  1KC8 U;  5DLQ E;  3CCM A;  5GMK l;  5A0L A;  2LX7 A;  3JCM V;  3CC2 Q;  1ZSZ A;  1AT1 B;  3M55 A;  3G71 T;  1YIJ A;  2A0F B;  1I8F A;  2M51 A;  3CCR T;  3VS6 A;  1AOJ A;  4J5Y A;  5GAM h;  3M0T A;  1V1C A;  4LXC A;  1K9M R;  1XJW B;  1D0Z A;  4F7U B;  3JB9 J;  1PD1 A;  4M77 B;  2WSF E;  1VQK Q;  4GLK A;  2COW A;  4RCB A;  4D8D A;  1S72 A;  1Q86 R;  2DL8 A;  1N6A A;  4Z8A A;  1OX9 A;  2XDB A;  2O31 A;  3R6O A;  6AT1 B;  3TSW A;  4ZGD B;  1BI1 A;  2NWM A;  4PJO G;  1RAI B;  2QAS A;  1ZBX A;  4L6V 5;  3CXC S;  1K8A C;  1VQM T;  1YIT Q;  5J3B A;  2EIF A;  2JTM A;  2DTI A;  4PLL A;  3S3O A;  1ZX6 A;  3G4S Q;  2CKK A;  4FYY B;  4OMM A;  2P0K A;  3OYF A;  2C0T A;  1GCQ A;  3HRT A;  3M0R A;  3X24 B;  2RHZ A;  4JS4 A;  1G3S A;  1NYG A;  2ZZD A;  4Y28 E;  3FIF A;  3JB9 G;  1ABO A;  2E65 A;  1I5L A;  3UAT A;  2VWF A;  2ESW A;  5L8R E;  2SRC A;  1NLP C;  3HKS A;  1JXM A;  1VQ4 A;  2YRC A;  2PUK B;  1X75 C;  1UDL A;  1IHV A;  2C0I A;  3QBY A;  4E7I A;  2HKQ B;  1KQS A;  4QVD A;  3JCM J;  1G3T A;  1OEB A;  3VS5 A;  1SF9 A;  3VS4 A;  1AWJ A;  2DL5 A;  1KQS P;  2KEA A;  5GAN 2;  1PKS A;  2QTX A;  2QA4 A;  1K4U S;  3DLL A;  1E6G A;  5IT9 E;  3OYK A;  4KGZ B;  3CPW A;  4JLI A;  2J6O A;  4YTL A;  3EGX A;  1QVP A;  4RUG A;  1P92 A;  3EGD A;  4MDW A;  2EGC A;  3CCS Q;  2BTT A;  3OYD A;  2DTO A;  5GAN h;  4M77 G;  1VQN Q;  1RLP C;  3H0F A;  1QLY A;  4E7K A;  3V7C A;  4HVV A;  1PRL C;  2A36 A;  2HNI A;  2CUB A;  4M75 E;  2HKN A;  3UA6 A;  3PGG A;  4OMF B;  3J80 E;  4M7A A;  2L8D A;  1LJO A;  2DFU A;  1QW1 A;  4K11 A;  1AEY A;  2FPE A;  1OQK A;  3QDR B;  2X4W A;  3CCR A;  2FZC B;  5LJ5 h;  4OMN A;  2BUD A;  2JM8 A;  4FSS A;  5GAN j;  4M7D E;  2JTF A;  1NG2 A;  1D1C A;  5GAN g;  5FWB A;  5GMK h;  3JCM d;  3RBB B;  2VXF A;  1AHJ B;  4JS5 A;  2NYS A;  4IUU A;  4N0A A;  3RER A;  1M27 C;  2YUP A;  4DOV A;  2IG0 A;  2R57 A;  3M0S A;  3NTK A;  3OS5 A;  2RQT A;  2FZG B;  4ZNX A;  1KHC A;  2RPN A;  3RDV A;  4DA4 A;  5CIU A;  4MZT A;  3A8O B;  1OYX A;  2MI6 A;  1BBZ A;  3REA B;  1VQP A;  5GAM e;  5LJ3 j;  4ZGE B;  1RAH B;  5LJ3 d;  3PMI A;  5LJ3 g;  4M7A E;  5CCA A;  1YN8 A;  2J06 A;  4M7A G;  2OTL T;  1YBY A;  2ZPH B;  3LYI A;  4BDZ A;  2ROT A;  1VQ4 T;  1ZQ1 A;  3QKJ A;  1V76 A;  4F7U E;  2K3X A;  1SSF A;  1SSH A;  4RTZ A;  3LH0 A;  5D6W A;  5CK9 A;  2IVW A;  1VQ9 T;  2LT1 A;  1K73 U;  3SWN A;  3HFN A;  5FWC A;  1RAA B;  4LNP A;  2P84 A;  5FRN A;  3CD6 A;  3M56 A;  3L2Z A;  1X2Q A;  1UUE A;  1FX7 A;  3EG1 A;  5CQX A;  3QUI A;  5HKC A;  1WIE A;  5LJ3 f;  2QA4 T;  1KFZ A;  1M1F A;  1BCM A;  2PTK A;  5KCH A;  2XID A;  4HCK A;  1H64 1;  2B8A A;  1M1K U;  3FLG A;  2LMJ A;  1VQK A;  1ZA1 B;  3ZFJ A;  3RES A;  4FYX B;  1QVF S;  3MPU B;  5KYU A;  1Q81 R;  4M7D D;  3DB3 A;  2KRS A;  1FWZ A;  1WLP B;  9ATC B;  1WHL A;  1TWB A;  1I4K 1;  3A8L B;  3M59 A;  3OA6 A;  1GCP A;  4FT2 A;  3KFV A;  4RCC A;  2MWP A;  2DET A;  2FRW A;  1N9R A;  4BB7 A;  5GAN f;  2JMA A;  4GY5 A;  2MOX A;  1G83 A;  1UHC A;  1N5Z A;  2RO0 A;  5GAO r;  2CYZ B;  5GAN 6;  1VIF A;  3P8H A;  2MCN A;  3CCS A;  1Y71 A;  1M2O A;  2OX7 A;  4GLM A;  1EFN A;  2K57 A;  1Q95 G;  2GNC A;  4FSX A;  3A1P A;  3G6E Q;  2JXB A;  4FW1 A;  2J05 A;  1TUD A;  3JCM P;  2QQS A;  1H3H A;  3KUF A;  3NTH A;  3THK A;  2NLU A;  2YT6 A;  4F7U A;  4J9B A;  2LNH B;  5FRO A;  1NEB A;  2K3Y A;  1I5O B;  4QVZ A;  4RG8 A;  2A37 A;  2E1H A;  5GMK e;  2DEU A;  1WHH A;  5I11 A;  2BE9 B;  2XG8 D;  5CAI A;  2KY9 A;  1M3B A;  2ZPB B;  2EAY A;  4OMQ A;  1VQN T;  1M2V A;  1QP3 A;  2EYX A;  3FRN A;  2ENM A;  2HL3 A;  1QKW A;  5J39 A;  3EAE A;  1SRL A;  4E2F B;  5DY9 A;  1Y57 A;  4OF1 A;  3FEO A;  2RF0 A;  3CD6 T;  2I2L A;  4MMK A;  1NE8 A;  2XIC A;  3QPH A;  4IUR A;  2JS2 A;  4C8Q B;  2MIO A;  1OV3 A;  3PIP A;  3CCL Q;  3WVE B;  4AFU C;  2LCS A;  1ABQ A;  2AZS A;  2YUN A;  4ZN3 A;  5A0G A;  2LVM A;  4Y91 A;  3N5B B;  1AWO A;  2KYM A;  3H0H A;  4OMP A;  3CCM T;  5GAO m;  2EFI A;  3L1A A;  2MK5 A;  4X34 A;  1K1Z A;  2F5T X;  3OYN A;  2GQV A;  1W6X A;  1WHM A;  2RD1 A;  1FXX A;  5GJV B;  4O6J A;  4C8Q D;  2RHX A;  1SKU B;  1XNI A;  5A0D A;  3EFR A;  2X9H A;  1N27 A;  4WTO B;  2AT1 B;  3M4G A;  5HCK A;  2O88 A;  1I1J A;  3HPW A;  4M7D G;  5LJ5 d;  4PFO A;  3VRZ A;  4FT4 A;  1OZ3 A;  1VQL T;  4M7A D;  4IIM A;  4LDU A;  2K5I A;  1VQ5 Q;  4KBM B;  3P8D A;  1WFW A;  2M0Y A;  1GBQ A;  3A8H B;  3UF4 A;  4M78 F;  4OB3 B;  2H3J A;  3OYG A;  3OYE A;  2ABL A;  2O9V A;  4A53 A;  1R77 A;  2DBM A;  2X35 A;  1B34 A;  2L3P A;  2FPF A;  3GIB A;  1T0J A;  3CQT A;  3CCL A;  4WCI A;  2BE7 D;  5I22 A;  3PFS A;  2COZ A;  3CCV T;  1K76 A;  1M1G A;  4A4K A;  2DNU A;  4DOW A;  4C92 B;  4C8Q E;  2V8J A;  1K9M C;  2KBT A;  2P4R A;  3VJP A;  3VS0 A;  3O8V A;  1KSW A;  4BE0 A;  3QYG B;  2F5K A;  5IN1 A;  5FRM A;  2CGH A;  3CCR Q;  2CUD A;  3PTA A;  4DQ2 A;  4XK8 E;  4PNO A;  2PVO B;  4BI8 B;  4X9D A;  2D0Q B;  2EPD A;  4J6Y A;  2LC4 A;  1QMC A;  4PJL A;  4PJO D;  3ULR B;  2HMA A;  3H6Z A;  1Y07 A;  2BZX A;  5CKD A;  1R0B G;  1U1S A;  1GXI E;  4R55 A;  4GBQ A;  1IZ6 A;  3KXT A;  2DYI A;  3OSV A;  1TUC A;  4KGV B;  3UWN A;  4M78 B;  3OYA A;  3I56 T;  5GJW B;  3ZEH A;  1UJY A;  1D1B A;  3M57 A;  4LDW A;  3V7R A;  4FW2 A;  2EQJ A;  2V1R A;  3LX7 A;  4QQG A;  2LQ8 A;  2L89 A;  3JCM Q;  2EQU A;  3M4Y A;  2FL7 A;  1NPR A;  3MP6 A;  3RNJ A;  2QQ9 A;  3GOX A;  3CBM A;  4ZGJ B;  1B7T A;  1KQ1 A;  3VV0 A;  1YJ9 A;  2K79 A;  4Q5W A;  1NLO C;  4AT1 B;  5DM7 R;  3CCQ A;  1VIE A;  1WXU A;  1PSF A;  1MMG A;  2RA2 A;  1Y96 A;  1Q82 R;  2NUP A;  1YHQ T;  1AZG B;  2HSE B;  1D3B A;  4ZTF A;  2QGG A;  3LGL A;  3NHN A;  1PG5 B;  1H92 A;  2G6F X;  3G71 A;  1YIJ T;  1VQO T;  1WHK A;  2RH2 A;  4PJO E;  2CRE A;  4PJO A;  1WYX A;  3TEE A;  2PVG B;  4A54 A;  2VYT A;  3TCJ A;  4OB1 B;  3MCA B;  1YCS B;  3JCM c;  1S72 T;  4C8Q C;  3GNF B;  5GAN 8;  3RMS A;  3OYB A;  1YHQ A;  2RHY A;  4ZTJ A;  3OYM A;  3SD4 A;  3UT1 A;  3VS7 A;  1ACM B;  3OW2 P;  1M90 C;  1BB9 A;  1VQ6 Q;  2M02 A;  5D6X A;  1VQ9 A;  1VQO A;  5KCO A;  1MGQ A;  3CCV A;  1PD0 A;  3I55 A;  1UEB A;  4X9C A;  1GRI A;  3OS0 A;  2PQW A;  4OB2 B;  2YRD A;  4BDY A;  3OBY A;  4M77 A;  4E6R A;  3EHQ A;  3MEW A;  2CP0 A;  2ZPG B;  3IQL A;  3SEM A;  3I5R A;  4F17 A;  1W70 A;  1SG5 A;  4FCY A;  1VQ8 A;  2JOY A;  3MP1 A;  1G3Y A;  3PNW C;  1CKB A;  3CXC P;  1Q7Y R;  1M30 A;  3FJP A;  4NL3 A;  2JJ9 A;  2X4X A;  1NJI C;  4EMK A;  4LD6 A;  2P0P A;  2RMO A;  2YXY A;  2XI9 A;  4WF2 A;  2P0Q A;  3I55 T;  3F70 A;  1VUB A;  2EKO A;  3TVT A;  1UG1 A;  1YJW Q;  3RIR A;  2VV5 A;  1RAE B;  1NJI R;  2RK1 A;  2VXE A;  2XU8 A;  4DEX A;  2ZCF B;  2D0N A;  3V7S A;  3GLX A;  4BE2 A;  1I07 A;  2KMT A;  2CT3 A;  1QCN A;  3HRS A;  1LNX A;  1WI7 A;  1HD3 A;  3QYH B;  2AZV A;  3CCU A;  2LRQ A;  1PRM C;  2YLB A;  1K0S A;  3HRU A;  1KG1 A;  3PVL A;  4XTU A;  2E12 A;  1WX6 A;  1JJ2 A;  2OAW A;  1KD1 U;  1TSF A;  4BY6 B;  3OW2 A;  3CCS T;  4OGC A;  5D7U A;  3GPL A;  1WGS A;  4PJO C;  1M90 U;  4HT8 A;  3OBW A;  4JRI A;  2CH4 W;  4II1 A;  2DXC A;  2KK4 A;  3LW5 E;  8AT1 B;  4LUE A;  2LQW A;  1KC8 R;  3D7S B;  3A98 A;  4EMK C;  4ANJ A;  3EGX B;  3M9Q A;  2QA4 Q;  2V1Q A;  1VQ4 Q;  1NM7 A;  2M16 A;  1M3C A;  4BAC A;  2DIQ A;  3L2U A;  5GMK j;  1JQQ A;  2CP2 A;  2COY A;  1KIK A;  3M58 A;  1VOM A;  1JU5 C;  4M75 F;  1TG0 A;  1X43 A;  4R56 A;  2O2O A;  2YHT A;  2GTJ A;  1E7O A;  2XD0 A;  4AFZ C;  3BW1 A;  2O4X B;  1PC0 A;  4PK4 A;  2DPP B;  2AKK A;  4HA8 A;  5FU6 B;  3VS3 A;  1VQP T;  1UGV A;  3BY7 A;  2RJF A;  3JAM E;  1K0X A;  4C5G A;  4JDS A;  2H8H A;  2XMF A;  2RI3 A;  3INZ A;  2VB6 A;  1WZO A;  1ZSG A;  1D09 B;  2ED1 A;  2L5Q A;  3SB2 A;  4CC2 A;  1VQ8 T;  4LUD A;  3FDR A;  4FYW B;  1Y96 B;  3NFC A;  4IUT A;  4C92 A;  4D6W A;  1JO8 A;  2K7A A;  3MKD A;  3JV3 A;  2IIM A;  2LQK A;  2R58 A;  2C0O A;  4FYV B;  4F04 B;  1Y7X A;  2CZ7 B;  2X51 A;  3JCM f;  1MNE A;  1O9S A;  3BDL A;  1YWP A;  2DXU A;  2VVK A;  1W2B S;  2CDT A;  2DEQ A;  4M75 G;  2KSS A;  4RKU E;  1PNJ A;  2QAZ A;  2QEX T;  3VS1 A;  3EFO A;  3AT1 B;  4TVR A;  2LTO A;  2WSC E;  2A3L A;  2VGN A;  4J9D A;  3UPU A;  1UEC A;  1ZSZ C;  4QT7 A;  1LOJ A;  3AHU A;  1VQ7 A;  2R5M A;  4J6W A;  1BIB A;  2VAS A;  4JRP A;  2J6F A;  4E7Z A;  2QDL A;  4ESR A;  1KK7 A;  4OVA A;  3OYH A;  3MEV A;  3OMG A;  4XQ3 A;  2MMP A;  3X25 B;  1U3O A;  4OP0 A;  2DIG A;  4HT9 A;  2FPD A;  1M9S A;  1GL5 A;  1LCK A;  1OOT A;  3M0U A;  2E4H A;  2RQR A;  4A4E A;  2DBK A;  4DBH A;  4HCZ A;  2NUP B;  1VQ9 Q;  2L2P A;  2NUT B;  5AT1 B;  1K8A U;  1UGQ B;  2K5F A;  3MP8 A;  2M9U A;  3C12 A;  3CMA T;  1WJS A;  1U5S A;  5IXF A;  2DL7 A;  1RLQ C;  3M5A A;  4BE1 A;  2CP6 A;  2QQR A;  1MMA A;  3SWN C;  3FB9 A;  2JT4 A;  2KRO A;  5KYX B;  1M3A A;  1VQM A;  2LCL A;  5LJ5 e;  1VYT A;  1N8R U;  1YJW T;  1NYF A;  3S3N A;  1QCF A;  1S72 Q;  2EGE A;  1GFC A;  2ECZ A;  4D8K A;  1AWW A;  8ATC B;  1MV0 B;  3MHX A;  3CME Q;  4PFP A;  3OYL A;  2RM4 A;  3CXC A;  3QSU A;  2O01 E;  4MML A;  3I5S A;  3MO8 A;  2VGM A;  1PSE A;  1YJ9 Q;  1G2B A;  1WPY A;  4C0D C;  4M78 D;  3RR6 A;  1GFD A;  2D1X A;  1W1F A;  2VUB A;  4DBQ A;  1CSK A;  1K73 R;  3UDC A;  4QQD A;  1BU1 A;  1O75 A;  2E70 A;  3QO3 A;  1OPK A;  1KHI A;  3S6W A;  3C94 A;  4J83 A;  4LDY A;  4HVW A;  5KYU B;  2QEX A;  4AFQ C;  3V8J A;  3JB9 F;  3VUZ A;  1M1K R;  2KRN A;  4XU2 A;  2KT1 A;  1M2V B;  2DM1 A;  3CC4 A;  2KI7 A;  3OMC A;  3JCM h;  1RI0 A;  3I56 Q;  1JXO A;  1TUG B;  1WNL A;  2HAX A;  2GGR A;  1Z9Z A;  3JCM b;  4EPC A;  1T0H A;  4HKE A;  3SFM A;  2M1H A;  1IHW A;  2RK2 A;  2GBQ A;  2LJ1 A;  4OML A;  2HDA A;  1K9A A;  2EW3 A;  4J9G A;  4PJO F;  1VYU A;  3L2Q A;  1D0X A;  4C5H A;  1VQL A;  2KT8 A;  4PJJ A;  4DEY A;  2QTV A;  3HSB A;  2FB7 A;  2EQK A;  1ZLM A;  4C0G A;  1QVF P;  2EBP A;  5A2Q E;  3I35 A;  2KYB A;  2HSP A;  4JZ3 A;  3OYI A;  1Q81 C;  3G1J A;  2I0N A;  2HCK A;  2A08 A;  2HQH A;  3C0C A;  1IXD A;  3U23 A;  3J81 E;  2EYZ A;  3QXE B;  2KVQ G;  2QK0 A;  2CS7 A;  3VU3 C;  1LPL A;  2LX9 A;  1XTD A;  2EKH A;  4HXJ A;  2DLP A;  1ZBJ A;  1QQJ A;  2XDD A;  1YFN A;  5AYF A;  3HP9 A;  4J7F A;  4C0D B;  5GAM d;  5GAO l;  4F7U G;  2CP5 A;  2X3W D;  5IHN A;  4MDX A;  3RKX A;  3DB4 A;  2DO3 A;  3C95 A;  3H0I A;  1QVG A;  1YHQ Q;  2Y4Y A;  3UA7 A;  2BKD N;  4E7J A;  2MPX C;  3EG0 A;  1G3W A;  1IGQ A;  2EJG A;  3CEY A;  5CKB A;  3CCU T;  4RTU A;  2GFU A;  5GAN 7;  3L2V A;  4C5E A;  2PNI A;  2E10 A;  4C8Q A;  3EH1 A;  2RI2 A;  3VRY A;  2DTH A;  2D9T A;  3LGF A;  2KNB B;  4BI4 A;  4QQ6 A;  2DVJ A;  2DZ9 A;  1OX8 A;  1I0C A;  3E1S A;  4JRK A;  1X27 A;  1AVZ C;  3G6E A;  4DBF A;  3RMQ A;  3QWX X;  2B86 A;  1N9S A;  1S1N A;  2MYS A;  5KYY A;  4XTY A;  2KXD A;  1VQ7 Q;  4N4G A;  3OYJ A;  3QJ6 A;  3E2U A;  2GCX A;  4BUG A;  4M78 G;  4E7H A;  1JJ2 P;  5FU7 B;  2FO0 A;  1UJ0 A;  3H8Z A;  1VYV A;  2JMC A;  2JNG A;  3ZBD A;  1PKT A;  4AFS C;  1M5Q 1;  3EFO B;  1VA7 A;  5EC7 A;  4M7D F;  1HJD A;  4M78 A;  3OS2 A;  1ZUK A;  2C06 A;  1ZUU A;  4DBR A;  3GF5 A;  2JTE A;  3QII A;  1K9M U;  1KJW A;  2DIL A;  4KH0 B;  3LLR A;  1M1K C;  3JCM e;  2DL3 A;  4N4H A;  2KDS A;  2RQV A;  3NPF A;  2DRK A;  2LDM A;  1Q86 U;  1C6V X;  4ME7 A;  5GMK m;  1GCQ C;  4PKC C;  1WHG A;  1AZE A;  4M75 C;  4HCB A;  3CME A;  5I2S A;  4RTV A;  1TH7 A;  4KUI A;  4KT0 E;  4IUP A;  5I21 A;  4OMO A;  2E5K A;  1AWX A;  3OYY A;  4HCC A;  2J6K A;  4FIB A;  3OW2 S;  2D8J A;  1BCO A;  2MWO A;  3EH2 A;  2EQM A;  3CPF A;  2GFA A;  4X1V A;  2JZ2 A;  4M7D C;  1RAD B;  3BDU A;  2XDP A;  1N8R C;  1NPP A;  2K5L A;  3CBP A;  4PJO B;  1QCO A;  3A5Z B;  2O9S A;  2DYB A;  3CMA A;  5KYW A;  2HEQ A;  2QDY B;  3ZL7 C;  3VYH B;  5LJ5 g;  4M77 D;  4CC4 B;  4KRT A;  2DMO A;  1UGP B;  4RTY A;  1UHF A;  5GAO q;  3ASK A;  1F1B B;  4ORZ A;  4BI3 A;  2RQU A;  1RAC B;  2CT4 A;  2ZPI B;  3LH5 A;  3RKY A;  3MJX A;  5CKF A;  1U1T A;  1UB4 A;  1SRM A;  3CCM Q;  2MF2 A;  3GNG A;  3CC2 A;  2K4Y A;  3QHS A;  2XKO C;  1JEG A;  4B9W A;  4C92 F;  2R5A A;  4XTV A;  1MND A;  1MMN A;  2ATC B;  4R0K A;  1V29 B;  4M7A C;  4C92 D;  1X6O A;  5CR2 A;  4ZN1 A;  1X2K A;  5C6S A;  3G6E T;  1H8K A;  1NZ9 A;  4JPB W;  5L23 A;  2QI2 A;  5GAN 5;  3Q1J A;  1TTH B;  3C4S A;  3MEU A;  1RI9 A;  2F1L A;  3EHR A;  3CCJ Q;  3VYG A;  5KE3 A;  1KC8 C;  2FZK B;  4M75 A;  1UTI A;  2VKN A;  3TU4 K;  4Z88 A;  5KE2 A;  3E19 A;  3CCQ Q;  4LD9 K;  3A8M B;  2RHU A;  3SDZ A;  3OSS C;  5CKE A;  1JB0 E;  1MHN A;  2F2X A;  3E9G A;  2CP7 A;  2ZAE A;  2RHI A;  5GAM f;  1YJN A;  4M78 C;  1Q82 U;  2QYZ A;  3JSC A;  2GTO A;  5ECA A;  4J9C A;  4F14 A;  2EJF A;  4OB0 B;  2DXB A;  2YUQ A;  1D1A A;  2ED0 A;  1MV3 A;  4LDV A;  2JVV A;  5DLO A;  4B6M A;  2OTL Q;  2KQW A;  2QGF B;  1FMK A;  2RI5 A;  3V8K A;  1BK2 A;  3EFS A;  4QW2 A;  2MAM A;  3HL8 A;  4M77 C;  3EG9 A;  4RMO A;  5I2M A;  2CSQ A;  2EYQ A;  3HFO A;  1VQ8 Q;  5GAO n;  1EZZ B;  1WXB A;  4CC7 A;  2KGT A;  2D8H A;  4F16 A;  1QP2 A;  3M0Q A;  4JJD A;  2CSI A;  1B3Q A;  1M8M A;  3ER0 A;  5HK3 A;  4HVU A;  3H9N A;  2DD5 A;  4P5N A;  4XAX B;  1PM3 A;  1WXT A;  5KYY B;  3FC3 A;  3ME9 A;  3LWI A;  1YNZ A;  3M53 A;  4CRI A;  2PVD B;  1JRI A;  2OJ2 A;  2CH4 A;  5CQY A;  1SPK A;  1WQ7 A;  3CC4 Q;  1D0Y A;  4LDX A;  2FVU A;  3X20 B;  1FMV A;  2E3H A;  4EMK B;  4J9E A;  4J9H A;  3BE3 A;  4M7A F;  5IH2 A;  1JBM A;  2Y4X A;  4M7A B;  2O4X A;  3SWN B;  4M75 D;  4MZP A;  4C5I A;  3O5Z A;  4B9X A;  4N4I A;  5HK0 A;  1YI2 T;  1NJI U;  1AD5 A;  4XTZ A;  1C1A A;  2G3R A;  2HL5 C;  4KH1 B;  1NEG A;  2F2W A;  3QZ5 B;  4FM4 B;  3VS2 A;  3JCM W;  5IHK A;  1QVF A;  4FU6 A;  4AG1 C;  4M78 E;  1YJN Q;  1Q81 U;  1OI1 A;  1W2B P;  2OAU A;  3HHT B;  1HSQ A;  1YJ9 T;  4JJB A;  3CCJ T;  2D6F A;  2J7I A;  2Z0W A;  3TRE A;  5J26 A;  4E7S A;  2L3S A;  3JB9 D;  1WJQ A;  1OZ2 A;  4ATO A;  3QDF A;  3TSZ A;  1W2B A;  3CD6 Q;  3E9F A;  4N0A C;  1QWF A;  1M90 R; 
#chains in the Genus database with same CATH homology
 3C94 A;  4IUV A;  4M77 E;  3R6O A;  3PTA A;  4DQ2 A;  4J83 A;  4LDY A;  4ZGD B;  4XK8 E;  4PNO A;  1YJN T;  1BI1 A;  1ZHI A;  2HQX A;  4PJO G;  2QEX A;  2PVO B;  3QG1 A;  1ZBX A;  2Y90 A;  4L6V 5;  3V8J A;  4BI8 B;  1EIF A;  3CXC S;  1K8A C;  1VQM T;  1KD1 C;  4X9D A;  3VUZ A;  2D0Q B;  5J3B A;  3JB9 F;  2EIF A;  4XU2 A;  2JTM A;  4J6Y A;  2E6Z A;  4IUQ A;  3DKM A;  2DTI A;  2FHD A;  2LC4 A;  3PMT A;  3CC4 A;  4PLL A;  3OMC A;  3JCM h;  1RI0 A;  4NOY A;  4A4F A;  3S3O A;  2CKK A;  4PJO D;  1WNL A;  2DJZ A;  3H6Z A;  1Y07 A;  4Z02 A;  3P8B B;  5LL6 S;  3V8L A;  5CKD A;  2HAX A;  2P0K A;  3JCM b;  4EPC A;  1U1S A;  2PU9 B;  4XU3 A;  3OYF A;  1GXI E;  4R55 A;  3HRT A;  4HKE A;  3SFM A;  3X24 B;  1IZ6 A;  2RHZ A;  4UC4 A;  4M77 F;  4JS4 A;  3KXT A;  2M1H A;  3OSV A;  4EMH A;  2OTJ T;  3KBG A;  3UWN A;  1G3S A;  2RK2 A;  4M78 B;  2ZZD A;  4Y28 E;  3J7A F;  3G4S T;  3FIF A;  3JB9 G;  3OYA A;  3I56 T;  2HD0 A;  2BIV A;  3ZEH A;  2E65 A;  2X4J A;  1I5L A;  4PJO F;  3M57 A;  4LDW A;  5L8R E;  3V7R A;  2EQJ A;  3HKS A;  3L2Q A;  3LX7 A;  1VQ4 A;  4QQG A;  2HQE A;  2LQ8 A;  1X75 C;  2PUK B;  4C5H A;  1VQL A;  2L89 A;  3JCM Q;  1WJR A;  2EQU A;  3M4Y A;  3QBY A;  4E7I A;  1YJW A;  2FL7 A;  2ZPE B;  1NPR A;  3MP6 A;  1KQS A;  3HSB A;  2FB7 A;  2QQ9 A;  1BI3 A;  3CBM A;  4QVD A;  4ZGJ B;  3GOX A;  2EQK A;  1KQ1 A;  3VV0 A;  5GMK i;  4C0G A;  3JCM J;  1YJ9 A;  1Q7Y C;  1G3T A;  2M0O A;  3NTI A;  5A2Q E;  2V8I A;  4Q5W A;  4O5V A;  1VQ6 T;  5DM7 R;  5GAO p;  1K73 C;  3CCQ A;  3OYI A;  1Q81 C;  1VIE A;  1PSF A;  2E64 A;  5FU7 C;  5GAN 2;  2OTL A;  2OTJ A;  4M75 B;  2QTX A;  2RA2 A;  2JUF A;  2XHC A;  2QA4 A;  1UGR B;  3DLL A;  1Y96 A;  5IT9 E;  3J81 E;  3OYK A;  1YHQ T;  3QXE B;  2KVQ G;  3CPW A;  4BY6 C;  1D3B A;  3AHU A;  4JLI A;  4YTL A;  2CS7 A;  2DXT A;  4FL6 A;  4A4H A;  3VU3 C;  2X4Y A;  4ZTF A;  1DJ7 B;  1QVP A;  2P4T A;  5CO7 A;  2XK0 A;  1P92 A;  3LGL A;  4MDW A;  2LX9 A;  3VKI A;  1XTD A;  3S3M A;  3OYD A;  4V2S A;  3G71 A;  1YIJ T;  1QVG S;  2DTO A;  5GAN h;  4M77 G;  1VQO T;  2RH2 A;  4ELY C;  3PIO A;  2XDD A;  4E7K A;  4JJN K;  4PJO E;  1BIA A;  5AYF A;  3V7C A;  3HP9 A;  4PJO A;  4J7F A;  5CKH A;  3TEE A;  2PVG B;  4C0D B;  5GAM d;  2HNI A;  4A54 A;  2VYT A;  5GAO l;  4F7U G;  4M75 E;  4MDX A;  4XTW A;  3PGG A;  4OMF B;  3RKX A;  3TCJ A;  3J80 E;  3DB4 A;  2L8D A;  3MCA B;  4MZM A;  2DO3 A;  1LJO A;  4OB1 B;  3JCM c;  3CCE A;  4C8Q C;  1S72 T;  3C95 A;  3WXM B;  1QW1 A;  3GNF B;  2CZ0 B;  2VC8 A;  5GAN 8;  4E7L A;  3I56 A;  3RMS A;  3OYB A;  1QVG A;  2Y4Y A;  1YHQ A;  1BI2 A;  2RHY A;  4ZTJ A;  1JJ2 S;  2BKD N;  4E7J A;  3JRZ A;  3OYM A;  3SD4 A;  1G3W A;  4C92 C;  3UT1 A;  2EJG A;  2L3R A;  3QDR B;  3JB9 I;  3CEY A;  2X4W A;  5CKB A;  3CCU T;  5EG2 A;  5FU6 C;  1VQK T;  3CPW S;  3CCR A;  1M90 C;  2GFU A;  5LJ5 h;  5GAN 7;  5D6X A;  2BUD A;  2PUO B;  3L2V A;  1VQ9 A;  5GAN j;  1G5V A;  1VQO A;  4M7D E;  5KCO A;  3CC4 T;  4C5E A;  1MGQ A;  2JTF A;  3QJY A;  4CI0 C;  2E10 A;  3CCV A;  4C8Q A;  5GAN g;  3I55 A;  1UEB A;  2RI2 A;  4X9C A;  3MEA A;  5GMK h;  5GAN d;  3JCM d;  2DTH A;  1AHJ B;  2D9T A;  2VXF A;  3LGF A;  3WVD B;  2PQW A;  4IUU A;  3OS0 A;  3CCQ T;  4N0A A;  4OB2 B;  4JS5 A;  4BI4 A;  3RER A;  4QQ6 A;  4DOV A;  4VUB A;  2IG0 A;  2DZ9 A;  2R57 A;  3OBY A;  2CZ1 B;  4BDY A;  3NTK A;  4M77 A;  3E1S A;  3G7Z A;  4JRK A;  3X26 B;  3MEW A;  3OS5 A;  2ZPG B;  3LWH A;  2LCC A;  3G6E A;  3L42 A;  3RMQ A;  1KHC A;  4DA4 A;  1VQ8 A;  1KQS S;  2JOY A;  2YRV A;  3MP1 A;  3A8O B;  1N9S A;  4MZT A;  1G3Y A;  1OYX A;  2LNV A;  2MI6 A;  3PNW C;  5CIU A;  4XTY A;  3FJP A;  5GAM g;  3GP8 A;  4NL3 A;  4J8O A;  5GAN 3;  2X4X A;  5LJ3 e;  5GAM j;  1NJI C;  4EMK A;  4LD6 A;  1VQP A;  5GAM e;  5LJ3 j;  2P0P A;  4ZGE B;  2XI9 A;  4N4G A;  4WF2 A;  3OYJ A;  3QJ6 A;  2P0Q A;  2GCX A;  4KUL A;  3PMI A;  5LJ3 d;  3I55 T;  3F70 A;  1VUB A;  2EKO A;  4M78 G;  4BUG A;  5LJ3 g;  3RIR A;  2VV5 A;  4E7H A;  1YIT T;  3L2W A;  5FU7 B;  4M7A A;  4M7A E;  2RK1 A;  5CCA A;  2VXE A;  2XU8 A;  2ZCF B;  2WAC A;  3H8Z A;  4M7A G;  3V7S A;  2OTL T;  3DLM A;  1YBY A;  3GLX A;  2ZPH B;  4BE2 A;  2JNG A;  2KMT A;  3ZBD A;  3LYI A;  4BDZ A;  1M5Q 1;  1VQ4 T;  3HRS A;  3G4S A;  1B34 B;  1LNX A;  1ZQ1 A;  2JN0 A;  3X28 B;  3CD6 T;  3QKJ A;  3QYH B;  4NL2 A;  5C0M A;  4M7D F;  4F7U E;  3CCU A;  4JRQ A;  4M78 A;  3OS2 A;  2K3X A;  1SSF A;  1Q86 C;  3LH0 A;  3CBO A;  2LRQ A;  5D6W A;  2IVW A;  5CK9 A;  1VQ9 T;  2YLB A;  2C06 A;  3HRU A;  1KG1 A;  3GF5 A;  2LT1 A;  3BFM A;  3SWN A;  3HFN A;  1K73 U;  3QII A;  2E5Q A;  4XTU A;  4J6X A;  1K9M U;  2E12 A;  1JJ2 A;  3LLR A;  1M1K C;  3JCM e;  1M4Z A;  2HBP A;  2YLC A;  1KD1 U;  4N4H A;  3M56 A;  5FRN A;  3CD6 A;  2KDS A;  4BY6 B;  3L2Z A;  3OW2 A;  1XQH A;  2ZPF B;  3CCS T;  4OGC A;  1VQ5 A;  1FX7 A;  5D6Y A;  3CC2 T;  2LDM A;  1BI0 A;  5CQX A;  3GPL A;  1WGS A;  1Q86 U;  4PJO C;  4ME7 A;  1M90 U;  5GMK m;  4HT8 A;  3QUI A;  3OBW A;  1HK9 A;  4JRI A;  4PKC C;  4II1 A;  4C0Z A;  5HKC A;  2K2V A;  2WSE E;  4M75 C;  5LJ3 f;  2QA4 T;  2DXC A;  1M1F A;  4XTX A;  5KCH A;  2XID A;  4HCB A;  4C8Q G;  4RG2 A;  2KK4 A;  5I2S A;  3CME A;  1H64 1;  2B8A A;  1KQ2 A;  3LW5 E;  1M1K U;  1TH7 A;  3FLG A;  4KUI A;  1VQK A;  4KT0 E;  3ZFJ A;  4IUP A;  3RES A;  5I21 A;  4C92 G;  1QVF S;  4EMK C;  3OYY A;  4C92 E;  4HCC A;  3L2R A;  2DVE A;  3M9Q A;  1XOV A;  4FIB A;  3OW2 S;  4M7D D;  2MWO A;  3DB3 A;  2EQM A;  3CPF A;  2GFA A;  1FWZ A;  2M16 A;  4IKF A;  4L5G A;  4BAC A;  2DIQ A;  5M9O A;  3A8G B;  3URG A;  2JZ2 A;  3JCM X;  5GMK j;  3L2U A;  3CCE T;  4M7D C;  1BKB A;  3BDU A;  2XDP A;  5LJ5 f;  1I4K 1;  3OS1 A;  3A8L B;  3M59 A;  4L59 A;  1N8R C;  1NPP A;  2K5L A;  3CBP A;  4FT2 A;  3OA6 A;  4PJO B;  5KH6 A;  3A5Z B;  3M58 A;  4RCC A;  3CC7 A;  3CMA A;  2DKG A;  2MWP A;  1YCY A;  4M75 F;  2QDY B;  1N9R A;  2A7Y A;  4BB7 A;  5GAN f;  4R56 A;  3VYH B;  5LJ5 g;  4M77 D;  5FLX E;  4GY5 A;  2YHT A;  2ZGW A;  2XD0 A;  1I81 A;  2F69 A;  2RB6 A;  1UGP B;  2RJC A;  3BW1 A;  2RO0 A;  2O4X B;  5GAO q;  3ASK A;  5GAO r;  2CYZ B;  4QVC A;  2EJ9 A;  1HXD A;  5GAN 6;  2E41 A;  4BI3 A;  1VIF A;  4KUD K;  2DPP B;  4XU1 A;  5FU6 B;  4HA8 A;  3P8H A;  1VQP T;  1RL2 A;  2ZPI B;  3BY7 A;  3CCS A;  3RKY A;  2RJF A;  3JAM E;  5CKF A;  1Y71 A;  4C5G A;  1U1T A;  1UB4 A;  4JDS A;  2K57 A;  2MF2 A;  3JCM g;  3GNG A;  3CC2 A;  2KAF A;  2K4Y A;  2RI3 A;  3QHS A;  4FSX A;  2XKO C;  3INZ A;  1YI2 A;  2CZ6 B;  2V8K A;  4B9W A;  4BD3 A;  4PLI A;  3T9N A;  4C92 F;  4EDU A;  2R5A A;  4NS5 A;  4XTV A;  3PT9 A;  4ELZ C;  1V29 B;  2L5Q A;  4M7A C;  4C92 D;  1X6O A;  3SB2 A;  4ZN1 A;  5CR2 A;  1VQ8 T;  3JCM P;  2QQS A;  4OGE A;  2RJD A;  3KUF A;  3FDR A;  3NTH A;  5C6S A;  3G6E T;  1NZ9 A;  1Y96 B;  2NLU A;  3NFC A;  2QI2 A;  4IUT A;  4PL6 A;  4F7U A;  3Q1J A;  5GAN 5;  3C4S A;  4C92 A;  2QXF A;  3MEU A;  5FRO A;  4D6W A;  3VYG A;  1H3Z A;  5KE3 A;  3CCJ A;  2K3Y A;  1KC8 C;  4M75 A;  2LQK A;  3TU4 K;  5KE2 A;  3E19 A;  4LD9 K;  4QVZ A;  4RG8 A;  3A8M B;  2E1H A;  4J7I A;  4XU0 A;  5CVI A;  4E47 A;  5GMK e;  2R58 A;  1Y7X A;  1YIT A;  2CZ7 B;  3JCM f;  5IAY A;  2XG8 D;  2EWN A;  1O9S A;  2RHU A;  3OSS C;  3SDZ A;  4EMG A;  3BDL A;  5CKE A;  5CAI A;  1JB0 E;  1MHN A;  2KY9 A;  3E9G A;  2DXU A;  2QQB A;  2EAY A;  2ZPB B;  2RHI A;  5GAM f;  3CCL T;  1YJN A;  3QZ9 B;  4M78 C;  1VQN T;  1WQW A;  1W2B S;  1Q82 U;  1M8V A;  2DAQ A;  1QP3 A;  2FYK A;  3JSC A;  3CME T;  2DEQ A;  3FRN A;  1BYM A;  4M75 G;  4A4G A;  3OYC A;  2KSS A;  4RKU E;  2QEX T;  2EJF A;  4OB0 B;  2DXB A;  2RJE A;  5J39 A;  3EAE A;  4TVR A;  5LJ3 h;  2LTO A;  2WSC E;  2A3L A;  5DY9 A;  2VGN A;  4LDV A;  3UPU A;  2JVV A;  1VQ5 T;  5DLO A;  4OF1 A;  3FEO A;  2KQW A;  1LOJ A;  2RI5 A;  1X01 A;  3RKW A;  1UGS B;  2DK3 A;  3V8K A;  1Q82 C;  1VQ7 A;  2I2L A;  2R5M A;  3EFS A;  4MMK A;  4QW2 A;  2XIC A;  1NE8 A;  3QPH A;  4J6W A;  1BIB A;  4IUR A;  4JRP A;  2MAM A;  3HL8 A;  4M77 C;  4C8Q B;  5GAN 4;  4RMO A;  5I2M A;  2EYQ A;  3HFO A;  4OVA A;  2E6N A;  5GAO n;  3PIP A;  3MET A;  3WVE B;  1U8R A;  3OYH A;  1QP2 A;  3MEV A;  3RUX A;  3OMG A;  4XQ3 A;  4C8Q F;  4ZN3 A;  2MMP A;  2DZC A;  3X25 B;  5A0G A;  1Q7Y U;  5LJ5 j;  2LVM A;  4OP0 A;  4Y91 A;  4M7D A;  2DIG A;  3N5B B;  4HT9 A;  3JB9 H;  3ER0 A;  3M54 A;  5HK3 A;  5GAO m;  3CCM T;  4P5N A;  2DD5 A;  1M9S A;  5GAN e;  1W4S A;  2EFI A;  4XAX B;  4A4E A;  2LT4 A;  3L1A A;  4X34 A;  2F5T X;  3FC3 A;  3OYN A;  1VQ6 A;  2GQV A;  4HCZ A;  3ME9 A;  3OY9 A;  3LWI A;  2RD1 A;  1FXX A;  3VUB A;  1K8A U;  1R8O B;  4O6J A;  1D3B B;  4C8Q D;  1UGQ B;  2AHJ B;  3CC7 T;  2K5F A;  3M53 A;  3MP8 A;  2RHX A;  2M9U A;  2PVD B;  1JRI A;  4CRI A;  4M7D B;  1XNI A;  3OQ5 A;  5CQY A;  5A0D A;  1WQ7 A;  3EFR A;  1N27 A;  3C12 A;  1VQN A;  3CMA T;  1WJS A;  3M4G A;  3M5A A;  4BE1 A;  4LDX A;  2FVU A;  3X20 B;  3HPW A;  4JLG A;  5LJ5 d;  2QQR A;  4C0F A;  4M7D G;  3SWN C;  4FT4 A;  3FB9 A;  4EMK B;  2GF7 A;  1OZ3 A;  1VQL T;  4M7A D;  4LDU A;  2LCL A;  1VQM A;  3OB9 A;  5LJ5 e;  4JUV A;  1YJW T;  1N8R U;  2K5I A;  4KBM B;  4M7A F;  3P8D A;  4F7U F;  1JBM A;  2Y4X A;  3S3N A;  3A8H B;  4M7A B;  4M78 F;  4OB3 B;  2O4X A;  2H3J A;  3SWN B;  3OYG A;  1VQ7 T;  4M75 D;  3OYE A;  4A53 A;  4MZP A;  4C5I A;  2X35 A;  1B34 A;  4B9X A;  3MHX A;  4N4I A;  5HK0 A;  5HY6 A;  3OYL A;  2RM4 A;  3CXC A;  1YI2 T;  1NJI U;  3QSU A;  2O01 E;  3GIB A;  2G3R A;  4MML A;  4XTZ A;  3MO8 A;  2VGM A;  1PSE A;  3CCL A;  2QQA A;  2DD4 A;  3QZ5 B;  4FM4 B;  1IRE B;  1WPY A;  4M78 D;  4C0D C;  1KC8 U;  5DLQ E;  3CCM A;  5GMK l;  5A0L A;  3JCM V;  3JCM W;  1QVF A;  4FU6 A;  3PFS A;  2VUB A;  4M78 E;  1Q81 U;  1OI1 A;  3M55 A;  3G71 T;  1YIJ A;  2OAU A;  3CCV T;  1I8F A;  3CCR T;  3HHT B;  3UDC A;  4J5Y A;  5GAM h;  4QQD A;  1YJ9 T;  3CCJ T;  1M1G A;  4A4K A;  4DOW A;  1O75 A;  2D6F A;  4F7U B;  3TRE A;  2E70 A;  5J26 A;  4C92 B;  4C8Q E;  2V8J A;  3JB9 J;  3JB9 D;  1WJQ A;  1OZ2 A;  4M77 B;  1K9M C;  4ATO A;  3VJP A;  2WSF E;  3O8V A;  3QO3 A;  4GLK A;  4BE0 A;  1W2B A;  4RCB A;  3QYG B;  2F5K A;  1S72 A;  3E9F A;  1KHI A;  4N0A C;  3S6W A;  5IN1 A;  5FRM A;  1N6A A;  2CGH A;  2XDB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...