4C0GA

Structure of the not-box domain of human cnot3
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
90
structure length
90
Chain Sequence
b'TVEFYQRLSTETLFFIFYYLEGTKAQYLAAKALKKQSWRFHTKYMMWFQRHEEPKTITDEFEQGTYIYFDYEKWGQRKKEGFTFEYRYLE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords CCR4-NOT TRANSCRIPTION COMPLEX SUBUNIT 3
publication title Structure and Assembly of the not Module of the Human Ccr4-not Complex
pubmed doi rcsb
source organism Homo sapiens
molecule tags Gene regulation
total genus 17
structure length 90
sequence length 90
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2013-08-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.1020 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4c0gA00
4C0DB 4BY6C 5FU6B 4C0FA 4C0GA 5FU7B 4BY6B 4C0DC 5FU6C 5FU7C
chains in the Genus database with same CATH superfamily
1LPLA 4O6JA 2E12A 3GPLA 1W4SA 2KR3A 2L3SA 3EHRA 2QAZA 4M7DD 1BIAA 2P0QA 3QHSA 4OF1A 5FWBA 2YT6A 5CKHA 1WJSA 3CMAT 2K6DA 3CCRA 2FPDA 1WHGA 3LH5A 3EFOB 3EGDB 4RTWA 4OMPA 1PM3A 1ZSZC 3PFSA 4II1A 2MCNA 2VXFA 4ZGDB 1TSFA 3KUFA 4J9HA 4RTYA 1B3QA 3CEYA 1GRIA 1I0CA 2RB6A 4RG8A 2JS2A 2PVOB 2CYZB 2W0ZA 2RNAA 2E4HA 4RKUE 2DTOA 4HKEA 1G3TA 1AWXA 2KYBA 5KYWB 2X4YA 3OYYA 2LX9A 2JOYA 5LJ5j 5I11A 1OYXA 3EFOA 3EGDA 4XU3A 4M78D 4LDYA 3P8BB 2HBWA 2HQHA 1AWJA 3M59A 5HK0A 3CCEA 2LZ6B 3JB9I 4KGVB 3VS3A 4N4IA 2FL7A 4XTUA 4K11A 2DIGA 2RO0A 3OYLA 4FT2A 4ZTJA 4Y91A 2GQIA 1YJNT 1RLQC 1Q81C 2ROTA 4PJLA 5KYWA 1D1BA 1YN8A 3C94A 3QSUA 2E5QA 4B6MA 3OW2P 4M78G 2B86A 1OPLA 1KD1R 3BFMA 2GNCA 2KK4A 5A0DA 1DJ7B 4HCCA 1K73R 1U1TA 2F69A 3CCQT 2D9TA 2OJ2A 4HA8A 4A4GA 1KC8U 1SSHA 2DXTA 2Y90A 2NUPB 2KYMA 1NLOC 2K57A 2DO3A 1UJYA 5FLXE 2O9VA 5LJ3d 1RAFB 1X2QA 3U23A 4JZ4A 5KYXB 2E10A 1VQOQ 2PVGB 5L23A 1RAHB 2GF7A 1VQPA 2KVQG 1UECA 4DBHA 2DBKA 3ER0A 3SHWA 4DOWA 1LCKA 3PIOA 2E41A 1YITQ 2HQXA 2DF6A 1W1FA 2HD0A 2E3IA 3HFNA 1V76A 2NUPA 1RABB 3H0FA 2KT8A 2R5MA 5DLQE 4ZNXA 4J83A 1BYMA 3TSWA 5CR2A 5J3BA 2KNBB 2RQRA 5KYXA 2YUNA 1SRLA 2XDBA 4A54A 1PSEA 4F7UB 1QVFP 3UATA 4PLLA 2OTLQ 4XTVA 3QKJA 3GF5A 1KG1A 2PNIA 3BE3A 3RR6A 4PJOD 2JW4A 1UJ0A 1UHFA 2QEXQ 5I21A 1UG1A 1WHJA 2O2OA 1W2BS 2EYZA 2RHZA 2V8JA 4IUTA 1JB0E 1ZA2B 3G7ZA 3HFOA 1AZGB 5KCHA 4F7UA 2K3YA 2EFIA 5GMKh 1IRXA 1H3ZA 1JRIA 4N0AC 2C0IA 2RH2A 3UWNA 2G3RA 3OQ5A 4FIBA 1BBZA 1VUBA 1ZHIA 1ZSZA 3META 4KH1B 3OB9A 4LXCA 3QUIA 4HXJA 3EFRA 3S3MA 5FRMA 2DEUA 1QVGP 2GCXA 5GANd 3QPHA 2XK0A 1VQNT 1VQ5Q 4OP0A 3SB2A 3G6EA 4Q5WA 5L8RE 3VJPA 1WXBA 1X6OA 4OMNA 1IGQA 2CSQA 2DLPA 2KSSA 2HMAA 1IXDA 1PHTA 3OMGA 3WVEB 4ZTFA 2KEAA 1Z9QA 3JCMd 4LDXA 1WLPB 4PJJA 1YIJA 1T0HA 4D8DA 1JQQA 2M02A 2EW3A 4E7SA 3CC2A 3FB9A 4J9CA 5LJ3j 5KYYB 4A4KA 5GAN3 4JZ3A 1YWOA 4DQ2A 2QQSA 1ZUUA 2GTJA 3FIFA 1ACMB 4ZGJB 1NJIC 1SRMA 1KSWA 2AHJB 2QDYB 2FEIA 2QA4Q 4JJCA 3V7RA 1KD1U 3VS5A 1YJWA 4OB1B 5GAN6 4EDUA 1K8AR 1RAAB 2JTEA 3CCLQ 2DL4A 2NUZA 3DB3A 5KYYA 5CAIA 5KYUB 1PRLC 2CP3A 2NLUA 4BI3A 2X4XA 3GNGA 1UFFA 3JCMJ 1M90C 1FMKA 2EKHA 1FXXA 3UDCA 1M4ZA 4A4FA 4FCYA 1YCSB 2R5AA 5ECAA 1K1ZA 3CCSA 2ZPHB 1OULA 3G4SQ 1WJQA 4M77D 1ARKA 4PLIA 3CBOA 3VU3C 1UGSB 2AT1B 1WQ7A 4C92D 2PU9B 1SHFA 4OMQA 1I1JA 1M30A 5KYUA 3I56A 1M9SA 2D8HA 2X4JA 3BDUA 3CCMT 1W6XA 3LX7A 1YI2A 1P92A 2LCCA 4M7AD 4A4EA 1JJ2S 3CCRT 1ZSGA 2LDMA 2V8IA 4WF2A 1YJ9A 2K5IA 3EG1A 4XU1A 4NS5A 1W2BA 4M77G 3GLXA 5GAMh 5IN1A 1KQSP 1OX9A 1RADB 1YP5A 1S72Q 2EJGA 4C5EA 7AT1B 2R57A 4L6V5 1HYOA 4C92G 2DZCA 3OYBA 4XTZA 3M57A 3CPWP 1UGPB 3R6OA 4M78F 5AT1B 1VQLQ 3LW5E 2EYQA 1M8VA 2AKKA 4KGZB 3H41A 3X20B 5GANj 3C12A 2AK5A 1BB9A 3V7SA 4N0AA 2XDDA 1OQKA 1JBMA 2DIQA 3AHUA 4CC7A 3PVLA 2BE7D 4ZGEB 3EHQA 2R58A 3FRNA 1K9MU 1WYXA 2LNHB 3KBGA 1B7TA 2X3WD 4BDZA 1SHGA 3M54A 3SEMA 1M1GA 3VYGA 3CCET 3ASKA 4E7KA 2AZSA 4ANJA 2BZYA 2M51A 4LD6A 4FU6A 2DILA 1Y96B 1X69A 2QGFB 4XTYA 8AT1B 5GAOl 2DETA 2NYSA 2RHYA 2DPPB 2RK1A 5GAOp 3NTKA 3VS4A 1YBYA 3JCMX 3JB9F 1U1SA 5GAN5 1ZA1B 4A63B 4D8KA 1H92A 5C0MA 1M2VB 1WHKA 3HPWA 2WACA 1Y96A 3ZL7C 9ATCB 3M0PA 3WVDB 2V1QA 4M78C 4M78E 3JCMV 2E6ZA 2FPFA 4Z89A 4LN2A 4OGEA 3CXCP 2F2WA 3M56A 2K7AA 2CH4A 2FB7A 2O31A 2F5KA 3RKXA 1D0ZA 4FYVB 2RA2A 2KXCA 2DM1A 2D6FA 3CC7T 5EG2A 3BDLA 3OW2A 1UTIA 3TREA 1VQPT 2LQNA 3QDFA 2EKOA 2J06A 2XICA 4HCZA 5IHIA 1Q7YU 5CK9A 1M2VA 2DXBA 1PNJA 2ZPEB 5DM7R 4IKFA 2QQRA 1K4US 2CT3A 5GAOm 2JVVA 1BI0A 2RJDA 4IURA 3M0TA 1QKXA 2FVUA 1QKWA 4IUVA 5FU7C 2E1HA 1YITA 1BCOA 5KYNA 4C8QD 1IB8A 1EFNA 2GFUA 3DKMA 3S3NA 1BIBA 1ABQA 3FDRA 3UA6A 2YUQA 3RMSA 1K8AU 1FYNA 2O4XB 5LJ5h 1M8MA 4Y92A 4M75B 2P0PA 3UA7A 3OBWA 3EG9B 2OTLA 2HNIA 2QQ9A 5FROA 4NOYA 4BUGA 4C8QG 1UHCA 3OYEA 1BI3A 1NYGA 1YJWQ 1TU0B 3I35A 2I2LA 2BZXA 5GAN7 1TUCA 5HK3A 4PJMA 3DB4A 1M3CA 2YRCA 2QEXA 1Q81R 2KBTA 1D3BB 1PC0A 4E7IA 4B9WA 4ESRA 2A37A 1QVFA 2O4XA 2RN8A 2RHXA 1WXTA 1VA7A 3JRZA 1T3LA 2DRMA 2HEQA 3EG9A 3ZFJA 1NEBA 2K2VA 3OSSC 2RQVA 2CUDA 3VS6A 2JTMA 3FJ5A 1Q82U 4HVWA 3CD6T 1IO6A 1OZ2A 4JUVA 4VUBA 5AYFA 1JXOA 4RCCA 4PJOE 5CQYA 2QYZA 3X28B 4BE2A 4IUPA 1YHQQ 3CCVA 3ME9A 1D3BA 3G6ET 1KQSS 4IUQA 3NPFA 1ZX6A 1R0CB 2VYTA 2ZPBB 2RF0A 4RG2A 3CPFA 5DY9A 2D0QB 2LJ3A 2VWFA 3NTIA 1OPKA 4A53A 3QZ5B 3EH1A 4J9BA 2O9SA 2ENMA 3JCMW 3ULRB 3QWYA 2ABLA 1YIJT 3LWIA 3H0IA 2FRWA 2FZKB 3GOXA 3H0HA 4MZPA 2DA9A 3J80E 1WX6A 3CC2T 1QVGA 2HL5C 2HBPA 3PVQA 5HY6A 2LX7A 2BZ8A 5D7UA 1X01A 4EMKC 1N8RU 1VQ8T 4M7DG 4Z8AA 1BI2A 1KC8C 2BIVA 3NFCA 4BE0A 3I5SA 4QKUA 3RNJA 1UE9A 4OMMA 4C0FA 3C95A 1M1KU 1OX8A 1OI1A 4M78A 4GLKA 4YTLA 2L3QA 2F2VA 5IAYA 1W70A 3ZEHA 2QA4A 3GBQA 1X6BA 1PRMC 3M55A 4M77F 4KH0B 3VS2A 3O5ZA 4BD3A 1GL5A 1EZZB 1LOJA 2BTTA 3CCLA 4LDVA 4JJDA 2A08A 1R0BG 4C92F 3CCST 3CXCS 5IT9E 1VQMA 2P0KA 1WQWA 3SFMA 2KMTA 4HVUA 2CZ7B 3FC3A 3PNWC 1MMDA 4GY5A 2WSFE 1TUDA 1SKUB 2JUFA 4DOVA 4PL6A 2K4YA 3G4SA 2DL3A 4QQGA 3I56T 3SWNC 1YI2T 2CP0A 3A98A 2FG0A 3HRUA 1QMCA 1PD0A 4M4ZA 5A0LA 4E6RA 1YJ9T 2CDTA 3V8KA 2H3EB 1B34A 2D8JA 3M9QA 2CGHA 4QT7A 1KK7A 4PNOA 1B07A 2CP5A 3MO8A 1PWTA 2ZPFB 1N5ZA 4DEYA 5C6SA 1S72A 4RTXA 4EIKA 1WNLA 2Y4XA 3JB9J 4CC2A 3LGFA 3CBMA 1JJ2P 1AVZC 4M77C 4RMOA 2YXYA 4M77E 1VYUA 5IH2A 3MKDA 3S3OA 1VQLA 3C0CA 1Y07A 5GAOr 4L5GA 3QYHB 4MZMA 5LJ3h 5J26A 2KAFA 4C92C 4C92E 5LJ5f 4AT1B 4JRPA 1UUEA 4B9XA 1N9SA 1V29B 3QXEB 3MEAA 4OMLA 1KQSA 1FWZA 1VQ6Q 1NJIR 3HSBA 5J39A 5D6YA 3EH2A 1D1AA 2O01E 1VQ4A 3M5AA 1XTDA 3J81E 2RJEA 3CPWA 3A1PA 2D0NA 2MAMA 2RM4A 1ZSZB 1QP3A 1NM7A 5FWCA 2DTHA 1U06A 4FW2A 4JPBW 2CH4W 4OB0B 5GJVB 4FSXA 1Q86R 4MZTA 2CP7A 4EMKB 2DBMA 4MMKA 3GNFB 4OVAA 2EBPA 1IREB 2DXCA 4PJOG 3E1SA 2DXUA 4QQ6A 3OYKA 1GBRA 2E3HA 1Q95G 1KQ2A 3RKYA 2HCKA 3CMEQ 1U8RA 4KUDK 3L2VA 2K2MA 2CZ1B 4E2FB 3UT1A 2XG8D 3VUBA 1MHNA 3I9QA 3TEEA 2NUTB 2FZCB 3CCVQ 4E7ZA 1O9SA 1M27C 4EMKA 4OB3B 3GP8A 3JCMb 2H3JA 2LQ8A 1WPYA 2F1LA 3CQTA 1U5SA 3RDVA 1KD1C 1VQOT 4ME7A 4XTXA 1AWOA 4PJNA 2MPXC 2P84A 1TH7A 2V8KA 1E6HA 2KRNA 2KXDA 1G3WA 5CO7A 2VGNA 2C0TA 3OYHA 2MIOA 4IIOA 1WI7A 3PTAA 1YITT 3MHXA 1G83A 3OS2A 2NUTA 4JS5A 1PD1A 1I5LA 2ZCFB 4XQ3A 4PFOA 4X9DA 3CXCA 3PGGA 4HT8A 1VQ9Q 1F1BB 3OYMA 2YLBA 5GANh 1RACB 3CCUQ 2KT1A 1ABOA 3MJXA 4CRIA 2EJFA 2DKGA 2EGEA 2BUDA 2W10A 1TOVA 5CKBA 3JCMc 1QCOA 2JTFA 1N27A 1Y57A 2OTLT 1YFNA 1VQ7Q 3QWXX 5CKFA 1BKBA 2RPNA 3CC4Q 3MP6A 5LJ5g 2A0FB 3JCMh 2DD5A 1RAIB 1ZQ1A 3URGA 2LTOA 2RQUA 3X24B 2QEXT 2OTJQ 3SWNA 2LQKA 2ZGWA 2LQWA 5A2QE 2ZPIB 4MMLA 3LLRA 3TSZA 1KHIA 1K73U 1RAEB 2J6FA 4JLIA 1GCPA 5FW9A 3I55Q 3KXTA 5GMKe 3SD4A 2V1RA 5IXBA 4C8QE 5I2SA 1VQMQ 1Y7XA 1GCQC 2YDLA 3I5RA 1G3SA 5HCKA 1OOTA 2DL7A 2Z0WA 3E9FA 2RHIA 3G1JA 2RQTA 4M7DF 1K9MC 3CCVT 4BDYA 2EGAA 3R6NA 1M3AA 4M77A 3AT1B 4BY6C 3MPUB 4BACA 3THKA 1VQ5T 3MEUA 4C92A 4KRTA 5KCOA 1YHQA 2EIFA 2DNUA 2F2XA 3QJ6A 4ZN3A 2V26A 2L0AA 4CC4B 1VOMA 3IQLA 2VC8A 1VQKQ 2EPDA 2L89A 5GMKl 1QP2A 1D0XA 1OV3A 2JS0A 4FYXB 1MUZA 1R8OB 1NEGA 1TXQA 4GBQA 4F17A 1QVPA 2CUBA 2XDPA 4LUDA 5LJ3f 5CQXA 4XU2A 4M7AG 1QLYA 2CZ6B 4AMCA 3EGUA 2C06A 3INZA 2ZPGB 1Q86U 2KROA 4J7IA 3JCMe 3QYGB 1OEBA 1VQ4Q 1XQHA 5EC7A 2EJ9A 4M7DC 2QA4T 4M7DE 4WTOB 4JRQA 1Q7YC 2DX1A 2MI6A 2MWOA 1BI1A 2GGRA 3CCLT 1R77A 1RAGB 2E65A 3RUXA 2EQUA 3MCAB 4J9IA 1VQMT 3E2UA 4X9CA 4IIMA 1IGUA 2ZZDA 3EG3A 4JRKA 5GMKm 1G8XA 1RL2A 3FJPA 2DVEA 4C0DC 2LRQA 1WDXA 4R55A 1HD3A 3G4ST 4RUGA 2HAXA 5CKEA 1GFDA 1K8AC 4FM4B 3EAEA 2CT4A 2ECZA 4QVZA 3G71Q 2RI5A 2EYWA 1JEGA 4C5HA 2D1XA 2QG9B 4J8OA 3CCJA 4BE1A 1G2BA 1PCXA 2K5FA 2DZ9A 1D1CA 1K0SA 2DYBA 2LMJA 4PFPA 4J6XA 5GAMe 1S72T 4E47A 1PG5B 2QQAA 3WXMB 3MEWA 2XD0A 2MK5A 3LWHA 1VQLT 5GANf 4BY6B 2I0NA 2DD4A 3SDZA 2C0OA 4PJOF 1J3TA 2VUBA 4PKCC 1Q82C 4J9GA 1AT1B 4RTZA 2XU8A 3F70A 2OX7A 2GTOA 1D0YA 1QQJA 1KC8R 2J6OA 4OGCA 2RJFA 5LJ3g 1GCQA 3CMAQ 3JCMf 1GFCA 3TQ7P 2EQMA 2KRMA 1VQ6A 3JV3A 2LP5A 1G3YA 1LNXA 1X2KA 3M0UA 1WGSA 2K5LA 4JRIA 3L2QA 1JJ2A 1X43A 4CI0C 2B8AA 1JO8A 2X9HA 2IG0A 3MEVA 4F04B 2JNGA 1C1AA 2HQEA 1IHWA 1SF9A 1C6VX 3OYGA 3OYDA 4LDUA 1TTHB 1UDLA 5IHNA 3OA6A 2OAWA 1N8RC 2DJZA 1NBEB 2J7IA 4M7DB 4QVDA 5GAN8 2BE9B 3CMEA 2K9GA 1BK2A 4PJOC 1X75C 2COYA 4FW1A 3OSVA 1M1KC 1YJNQ 4M75D 3L2UA 3QBYA 3P8HA 2HSEB 5KH6A 1CKAA 4XK8E 3OS0A 1M2OA 4C5GA 4MDXA 1TUGB 1LJOA 3NTHA 3FEOA 2RQWA 4KT0E 1XOVA 5GAMf 4C0DB 3Q1JA 4M7DA 1UB4A 2WSCE 1TG0A 2CS7A 3PIPA 1WHHA 4M75G 1KIKA 1PKSA 4M78B 3OYCA 1IZ6A 2PVDB 2YRDA 3CCMA 4F7UE 1VQ9A 4LNPA 3CCUA 5GANg 2M9UA 1I8FA 3C4SA 3X25B 2ESWA 2JJ9A 2YUOA 5LJ5e 1VIEA 2DAQA 3BW1A 4HCKA 3L1AA 1SEMA 1VQ7A 2F5TX 1NE8A 4DBQA 3CC4A 3OS1A 2EWNA 3LYIA 2ZAEA 1I07A 3P8DA 1MNDA 3JCMg 1YJWT 2M1HA 2QASA 5GJWB 1N6AA 2HSPA 3VKIA 2AKLA 2LJ0A 3UF4A 5FU7B 2OTJA 1NPRA 2FZGB 2KGTA 1YCYA 5CCAA 1HJDA 1BU1A 1WA7A 4QVCA 2VXEA 1RI0A 5DLOA 3I55A 4NL3A 1NYFA 4C5IA 4OB2B 1B34B 2DE0X 2M16A 4E7LA 1X27A 2EQKA 1EIFA 3EGXB 3HL8A 4M7AF 2QGGA 3D7SB 4FT4A 4MDWA 2ED1A 1KHCA 1YHQT 3LGLA 1KFZA 2EYYA 2K3XA 3FLGA 1RI9A 4ZN1A 2MWPA 3JAME 3OYFA 1RUWA 2LT1A 3CCJQ 5HKCA 2LC4A 2PUOB 3M4GA 3V8LA 2CKKA 3M53A 4A4HA 3GIBA 3H8ZA 5GAN4 1TWBA 1K9AA 4RCBA 3EGXA 1H3HA 5I22A 1CSKA 1VQKA 1LVKA 2A28A 1AWWA 3V8JA 3JB9D 5GAMg 2RMOA 2RK2A 1OZ3A 4PJOB 1JU5C 2E5KA 2NWMA 1VQNQ 1YWPA 2E70A 2GBQA 4HCBA 1A0NB 3CC7A 3UPUA 4X34A 2L3RA 1QCFA 4X1VA 4ELZC 1UGQB 3EFSA 2LVMA 4AFSC 4DBFA 5IHKA 5KE3A 4JJNK 5D6WA 2CREA 1OU8A 3JB9G 2FO0A 4M7AC 4L59A 3OYJA 1Q81U 4FL6A 5D6XA 4M7AE 2GQVA 2A7YA 2CZ0B 1S1NA 2X3XD 4PJOA 1IHVA 4J6YA 2RHUA 3VUZA 3HHTB 8ATCB 4WCIA 2O88A 2RI3A 3T9NA 1Z9ZA 4ATOA 2XMFA 2DMOA 1VYVA 3OBYA 1YNZA 4EPCA 3A5ZB 1I4K1 1QCNA 1M90R 2CSIA 3VS1A 5GAOn 3RESA 4F14A 3QDRB 1SSFA 2K3BA 4ELYC 1K9MR 3VYHB 2J05A 4TVRA 4KGXB 3BY7A 3OMCA 2AIRB 4DEXA 4RTTA 4O5VA 3G71A 3CCJT 2QDLA 2LJ1A 3M4YA 1NZ9A 1K0XA 3MP1A 3L2RA 4FYYB 1XJWB 3EG0A 4C8QF 2L5QA 1K73C 2YSQA 2JMCA 3A8LB 1SG5A 2EVRA 2DK3A 4C0ZA 3CD6A 2DEQA 4F7UG 4XTWA 1WHLA 2PTKA 2EQIA 2XIDA 1MMAA 3X26B 3PMIA 3CCMQ 1AHJB 1GBQA 2FRYA 3SWNB 1WIEA 4J6WA 3PE0A 2OAUA 5LJ3e 2KQWA 2X35A 2L8DA 4EMHA 3CCRQ 1MV3A 5CIUA 5CVIA 4Z02A 3L2ZA 1VQ6T 2EYXA 1MV0B 2YUPA 4AG1C 3CMAA 3TCJA 4IUUA 4J9DA 3OS5A 4QQDA 2ROLA 1Q7YR 2Y4YA 1NPPA 1VYTA 2MYSA 3OYIA 5M9OA 2HL3A 3A8MB 4LDWA 4M77B 1VQ8A 2MOXA 4BB7A 1V1CA 3L2WA 2X4WA 2VASA 4Y28E 1WJRA 4JLGA 4F16A 3O8VA 4C92B 3EG2A 4M75F 4C8QC 3NGPA 1G5VA 1U3OA 2E64A 2PZ1A 3V7CA 1ZLMA 2DVJA 5GAOq 3OW2S 3VRZA 3CCEQ 4M7AB 3CMET 3L42A 2PUKB 4PFZA 1Q86C 4BI4A 3OYNA 2YLCA 1C0MA 1HXDA 1MMGA 5FU6C 2DFUA 5GMKj 3A8GB 1UEBA 1Y0MA 4AFZC 4PK4A 2MF2A 1YJNA 2WSEE 2E6NA 2DL8A 2SEMA 1AD5A 2H8HA 2LT4A 4JS4A 3RIRA 3QZ9B 4Z88A 4R56A 3VRYA 4EMGA 3QIIA 1GXIE 4M7AA 1AOJA 5GAMd 1X6GA 2QTXA 2KY9A 5GAN2 1MMNA 1CKBA 1ZBJA 2FHDA 4J9FA 2HKNA 3CCQA 3KFVA 1AZEA 3RBBB 2GFAA 2VVKA 1E7OA 2RI2A 1VQ9T 3J7AF 1Q82R 5GANe 3CCUT 1QWEA 1NJIU 2AZVA 2YRVA 3A8HB 4LD9K 3CC7Q 1T3SA 3PT9A 1VQPQ 2DYIA 4LUEA 2K79A 4M75C 3HTRA 2IVWA 4M75E 2CP2A 3VS7A 2G6FX 1KJWA 1VQ7T 1WFWA 1MNEA 2JXBA 4KBMB 3CC4T 2P4TA 1QVFS 1NG2A 2JN0A 4GLMA 1H8KA 1SPKA 1FMWA 2XI9A 1K76A 2HDAA 2OTJT 1FMVA 1XNIA 1M90U 2EQJA 2M0OA 2KI7A 3QO3A 1HK9A 4ORZA 2DJQA 2LNVA 5FRNA 4XU0A 4UC4A 3I55T 4NL2A 3VS0A 2XHCA 1KQ1A 3M0QA 3REBB 4D6WA 2EGCA 5IXFA 4R0KA 1M1FA 2RJCA 1Y71A 1AEYA 4AG2C 3JB9H 2FPEA 2KDSA 2OI3A 1N8RR 4V2SA 1WXUA 3TVTA 2SRCA 4J5YA 4N4GA 3HRSA 4J9EA 2DL5A 4CC3A 5A0GA 1PKTA 1M1KR 6AT1B 3MP8A 3M0RA 1UGRB 3OYAA 3A8OB 1QVGS 1MGQA 5CKDA 4C8QB 3RKWA 2QI2A 1I5OB 2RD1A 1QWFA 2DERA 1VQKT 4QW2A 2ED0A 3CD6Q 2VKNA 5KE2A 1HSQA 1M5Q1 2L3PA 1ZUYA 4E7JA 3HRTA 1NLPC 1OU9A 4OMFB 4JDSA 3N5BB 1H641 2JM8A 3S6WA 3OY9A 3G6EQ 2VB6A 5FU6B 2L2PA 1VIFA 2P4RA 1VQNA 5I2MA 4C8QA 3HP9A 1FX7A 2BKDN 3NMZC 4RTVA 5GMKi 1VQOA 1JXMA 5LJ5d 2X51A 4DA4A 1I81A 5GAMj 2LCSA 2HZYA 4KULA 1M3BA 4BI8B 3TU4K 1VQ4T 3JCMP 3H9NA 1YIJQ 4J7FA 1UGVA 3CBPA 1E6GA 3DLMA 3M58A 3NHNA 2FYKA 2QQBA 4FYWB 4FSSA 2COZA 2JZ2A 2YWWA 4HVVA 4AFQC 1BCMA 1PSFA 3CC2Q 2MMPA 2QXFA 2A3LA 1TS9A 2LCLA 1VQ8Q 3LH0A 2DTIA 4KUIA 4N4HA 3VV0A 2IPOB 1ZUKA 4F7UF 4C0GA 3JCMQ 4DBRA 1N9RA 3PMTA 2A36A 5LL6S 1D09B 4E7HA 1RLPC 2M0YA 2JM9A 3RMQA 3G71T 2J6KA 2KRSA 4JJBA 1WHMA 2IIMA 2QTVA 4XAXB 4RTUA 3RERA 4HT9A 2JT4A 2VV5A 2CP6A 3DLLA 4M75A 2HKQB 2DRKA 3QJYA 4OMOA 1WZOA 4LE9A 3E9GA 3H6ZA 3CCSQ 3E19A 3JSCA 2QK0A 1W2BP 2EAYA 1O75A 1QW1A 1EX4A 3CCQQ 2COWA 2ATCB 3M0SA 4AFUC 3ZBDA 1T0JA 2JMAA 3HKSA 2XKOC 2KE9A 3I56Q 3REAB 3QG1A 4P5NA 1ZBXA 1YI2Q 2YHTA 2VGMA 2PQWA 3CPWS 1VQ5A 1YJ9Q
chains in the Genus database with same CATH topology
3KXTA 5GMKe 3HPWA 2WACA 2GQVA 1Y96A 2E12A 2A7YA 4O6JA 2CZ0B 3WVDB 3GPLA 1W4SA 4M78C 3SD4A 4C8QE 4M7DD 4PJOA 4M78E 1BIAA 2P0QA 2E6ZA 3JCMV 5I2SA 4J6YA 2RHUA 3QHSA 3VUZA 4OF1A 3HHTB 4OGEA 1Y7XA 3M56A 5CKHA 1WJSA 2FB7A 3CMAT 3CCRA 2F5KA 3RKXA 2RI3A 3T9NA 1G3SA 4ATOA 2RA2A 3E9FA 2RHIA 3PFSA 4II1A 3OBYA 5EG2A 3CC7T 2D6FA 2VXFA 3BDLA 3OW2A 3TREA 4M7DF 1VQPT 1K9MC 4ZGDB 3CCVT 4BDYA 3KUFA 4EPCA 4M77A 3A5ZB 2EKOA 1I4K1 4BY6C 3CEYA 2XICA 2RB6A 4HCZA 1Q7YU 5CK9A 2DXBA 4RG8A 4BACA 2PVOB 2CYZB 2ZPEB 5DM7R 5GAOn 1VQ5T 4IKFA 4RKUE 3MEUA 2DTOA 2QQRA 3RESA 4C92A 1GXIE 3QDRB 5KCOA 1YHQA 4HKEA 1SSFA 2EIFA 4ELYC 1G3TA 3VYHB 5GAOm 2X4YA 3OYYA 2JVVA 3QJ6A 4TVRA 1BI0A 2RJDA 4IURA 4ZN3A 2FVUA 2LX9A 5FU7C 4IUVA 2JOYA 2E1HA 5LJ5j 1YITA 1OYXA 3BY7A 2VC8A 4XU3A 4C8QD 3OMCA 4M78D 2L89A 2GFUA 3DKMA 5GMKl 3S3NA 4LDYA 4O5VA 1QP2A 3P8BB 1BIBA 3G71A 3CCJT 3M4YA 1NZ9A 3FDRA 3MP1A 3M59A 3L2RA 3RMSA 5HK0A 3CCEA 1R8OB 3JB9I 1K8AU 1QVPA 2O4XB 4N4IA 5LJ5h 2FL7A 4XTUA 2DIGA 2RO0A 4M75B 2P0PA 2XDPA 4C8QF 2L5QA 3OYLA 3OBWA 4FT2A 5LJ3f 4ZTJA 1K73C 4Y91A 2OTLA 5CQXA 1YJNT 3A8LB 4XU2A 4M7AG 2CZ6B 1Q81C 2HNIA 2QQ9A 5FROA 5LJ5e 2DK3A 4NOYA 4C0ZA 3CD6A 2DEQA 4BUGA 3C94A 4F7UG 3QSUA 2E5QA 4C8QG 4M78G 3OYEA 1BI3A 4XTWA 2I2LA 2C06A 5GAN7 3INZA 5HK3A 3DB4A 2ZPGB 1Q86U 3BFMA 2KK4A 2XIDA 4J7IA 5A0DA 1DJ7B 4HCCA 3X26B 3QYGB 3JCMe 2QEXA 1U1TA 2F69A 3PMIA 3CCQT 1AHJB 1D3BB 1XQHA 3SWNB 2D9TA 4J6WA 5LJ3e 2OAUA 2EJ9A 4E7IA 4M7DC 4HA8A 4B9WA 4A4GA 2QA4T 4M7DE 1QVFA 2KQWA 2O4XA 1KC8U 2X35A 2L8DA 4EMHA 4JRQA 2RHXA 3JRZA 5CIUA 4Z02A 5CVIA 3ZFJA 1Q7YC 2DXTA 2Y90A 2K2VA 3OSSC 2MI6A 2K57A 2MWOA 1BI1A 2JTMA 2DO3A 3L2ZA 1VQ6T 3CCLT 1Q82U 2E65A 5FLXE 3CMAA 3RUXA 3CD6T 5LJ3d 3TCJA 4IUUA 2EQUA 3MCAB 1OZ2A 4JUVA 4VUBA 4X9CA 2E10A 5AYFA 1VQMT 2PVGB 2ZZDA 4RCCA 4PJOE 4JRKA 5GMKm 3OS5A 4QQDA 5CQYA 2GF7A 3X28B 1VQPA 1RL2A 2KVQG 2Y4YA 4BE2A 1NPPA 3FJPA 4IUPA 2DVEA 3ME9A 1D3BA 3G6ET 3ER0A 4C0DC 3CCVA 1KQSS 4IUQA 4DOWA 2LRQA 3OYIA 5M9OA 3A8MB 4LDWA 2VYTA 4M77B 4R55A 3PIOA 3G4ST 2ZPBB 1VQ8A 4RG2A 2E41A 2HAXA 3CPFA 4BB7A 2HQXA 2D0QB 5DY9A 2HD0A 3HFNA 5CKEA 3L2WA 2X4WA 4Y28E 1WJRA 4JLGA 1K8AC 3O8VA 4FM4B 3EAEA 3NTIA 4C92B 4M75F 4C8QC 4QVZA 2R5MA 5DLQE 4A53A 2RI5A 4J83A 1G5VA 2E64A 3QZ5B 3V7CA 1BYMA 5CR2A 5J3BA 5GAOq 3OW2S 4C5HA 3JCMW 4M7AB 3CMET 1YIJT 2XDBA 3LWIA 3L42A 4A54A 1PSEA 4F7UB 3GOXA 2PUKB 4J8OA 3CCJA 4PLLA 4BE1A 4MZPA 2K5FA 2DZ9A 3J80E 4XTVA 1Q86C 3QKJA 4BI4A 3CC2T 3GF5A 1QVGA 3OYNA 1KG1A 4J6XA 5GAMe 4PJOD 2HBPA 2YLCA 1S72T 5HY6A 1HXDA 5FU6C 4E47A 1X01A 1YJ9A 4EMKC 5GMKj 1N8RU 3A8GB 1VQ8T 4M7DG 1UEBA 2MF2A 1BI2A 2QQAA 1YJNA 2WSEE 3WXMB 2E6NA 1KC8C 3MEWA 2BIVA 2XD0A 2LT4A 4JS4A 3RIRA 3NFCA 3QZ9B 5I21A 3LWHA 1VQLT 5GANf 4BE0A 4R56A 4BY6B 1W2BS 4EMGA 2DD4A 3SDZA 3QIIA 4PJOF 2RHZA 2V8JA 4M7AA 4IUTA 2VUBA 4PKCC 5GAMd 4C0FA 1Q82C 3C95A 1M1KU 1JB0E 2QTXA 3G7ZA 3HFOA 2KY9A 5GAN2 1OI1A 5KCHA 4F7UA 2K3YA 2EFIA 2FHDA 4M78A 5GMKh 4GLKA 2XU8A 3F70A 4YTLA 3CCQA 1JRIA 4N0AC 1H3ZA 2RH2A 5IAYA 4OGCA 3UWNA 2G3RA 3OQ5A 2RJFA 5LJ3g 2GFAA 3ZEHA 2QA4A 3I55A 4FIBA 2RI2A 1VQ9T 3J7AF 3JCMf 1VUBA 1ZHIA 3M55A 5GANe 4M77F 3CCUT 4BD3A 1NJIU 3META 1LOJA 2EQMA 2YRVA 3A8HB 3OB9A 4LD9K 1VQ6A 3QUIA 1G3YA 3CCLA 3EFRA 1LNXA 4LDVA 3PT9A 3S3MA 5FRMA 4M75C 4C92F 3CCST 1WGSA 2IVWA 4M75E 2K5LA 4JRIA 3CXCS 5IT9E 3L2QA 1VQMA 1JJ2A 1VQ7T 2P0KA 4CI0C 1WQWA 4KBMB 2B8AA 2GCXA 5GANd 3CC4T 3QPHA 2XK0A 2P4TA 3SFMA 1VQNT 1QVFS 2KMTA 2IG0A 4OP0A 3MEVA 2JN0A 3SB2A 2CZ7B 3FC3A 3PNWC 3G6EA 4GY5A 2WSFE 2JNGA 4Q5WA 5L8RE 3VJPA 2JUFA 2HQEA 2XI9A 4DOVA 1X6OA 4PL6A 2K4YA 3G4SA 2OTJT 1XNIA 1M90U 4QQGA 2EQJA 3OYGA 3OYDA 3I56T 4LDUA 3SWNC 2M0OA 3QO3A 2KSSA 1YI2T 3HRUA 1HK9A 3OMGA 3OA6A 3WVEB 2LNVA 5FRNA 1N8RC 4ZTFA 4XU0A 2DJZA 5A0LA 3JCMd 1YJ9T 4UC4A 3I55T 4NL2A 3V8KA 4M7DB 2XHCA 1B34A 1KQ1A 4D6WA 4QVDA 5GAN8 4LDXA 3M9QA 3CMEA 2CGHA 1YIJA 1M1FA 2RJCA 4PJOC 4PNOA 1X75C 1Y71A 3OSVA 3JB9H 3MO8A 1M1KC 2KDSA 4M75D 3L2UA 2ZPFB 3CC2A 3FB9A 4V2SA 5LJ3j 3QBYA 3P8HA 5KH6A 4A4KA 4XK8E 5C6SA 3OS0A 5GAN3 1S72A 4J5YA 4N4GA 1WNLA 3HRSA 4C5GA 2Y4XA 4DQ2A 3JB9J 4MDXA 2QQSA 5A0GA 3LGFA 1LJOA 3CBMA 3FEOA 3NTHA 4M77C 3FIFA 4RMOA 4KT0E 1XOVA 4M77E 5GAMf 4C0DB 4ZGJB 3MP8A 3S3OA 1VQLA 3Q1JA 1Y07A 5GAOr 1NJIC 1UGRB 4M7DA 1UB4A 2WSCE 4L5GA 3QYHB 4MZMA 2AHJB 5J26A 5LJ3h 2QDYB 2CS7A 3OYAA 3PIPA 2KAFA 4C92C 3V7RA 4C92E 5LJ5f 3A8OB 4M75G 1QVGS 1KD1U 4JRPA 1MGQA 1YJWA 4OB1B 5GAN6 5CKDA 4C8QB 3RKWA 2QI2A 4M78B 4B9XA 4EDUA 1N9SA 3OYCA 2RD1A 1V29B 3QXEB 1IZ6A 2PVDB 3MEAA 1FWZA 1KQSA 3DB3A 1VQKT 4QW2A 3HSBA 5J39A 5D6YA 3CCMA 4F7UE 1VQ9A 2O01E 5CAIA 1VQ4A 3M5AA 1XTDA 3J81E 3CCUA 5GANg 2M9UA 1I8FA 3C4SA 2RJEA 1M5Q1 3X25B 5KE2A 3CPWA 2NLUA 2MAMA 2X4XA 4BI3A 3GNGA 2RM4A 4E7JA 1QP3A 3HRTA 3JCMJ 1M90C 4OMFB 1FXXA 2DTHA 1VIEA 1H641 1M4ZA 3N5BB 2DAQA 3BW1A 2R5AA 4JDSA 4OB0B 3S6WA 4A4FA 3OY9A 4FSXA 3CCSA 2ZPHB 4MZTA 3L1AA 5FU6B 1VQ7A 2F5TX 4EMKB 1NE8A 1VIFA 3CC4A 3OS1A 1WJQA 2EWNA 3LYIA 4M77D 4MMKA 3P8DA 5I2MA 1VQNA 3GNFB 4C8QA 3HP9A 4OVAA 4PLIA 3CBOA 1FX7A 1IREB 3JCMg 2BKDN 3VU3C 2M1HA 2DXCA 5GMKi 1VQOA 1YJWT 4PJOG 1UGSB 1N6AA 3E1SA 2DXUA 3VKIA 5LJ5d 4QQ6A 4DA4A 1WQ7A 4C92D 2PU9B 1I81A 5GAMj 3OYKA 5FU7B 2OTJA 1NPRA 1KQ2A 3I56A 4KULA 3RKYA 1M9SA 4BI8B 2X4JA 3BDUA 3CCMT 3TU4K 3JCMP 1VQ4T 1U8RA 4J7FA 3CBPA 3LX7A 3DLMA 3M58A 1YI2A 1P92A 4KUDK 2FYKA 2LCCA 3L2VA 4M7AD 2CZ1B 2QQBA 1YCYA 4A4EA 5CCAA 1JJ2S 3CCRT 2JZ2A 2LDMA 2V8IA 1MHNA 2XG8D 2VXEA 4WF2A 3UT1A 1RI0A 3VUBA 4QVCA 5DLOA 2K5IA 4NL3A 1PSFA 4XU1A 4NS5A 3TEEA 4C5IA 4OB2B 1W2BA 2MMPA 1B34B 4M77G 3GLXA 1O9SA 5GAMh 5IN1A 2M16A 4EMKA 2EJGA 2A3LA 2QXFA 4OB3B 4C5EA 3GP8A 4E7LA 2LCLA 2R57A 2H3JA 4L6V5 2EQKA 3JCMb 1EIFA 1WPYA 2LQ8A 3LH0A 2DTIA 3HL8A 4M7AF 4KUIA 4N4HA 4C92G 2DZCA 3OYBA 4XTZA 3VV0A 3M57A 1UGPB 4FT4A 1KD1C 1VQOT 4F7UF 4M7AE 3R6OA 4MDWA 4ME7A 4M78F 4XTXA 4C0GA 3LW5E 2EYQA 1M8VA 3JCMQ 1TH7A 2V8KA 1KHCA 1N9RA 3PMTA 1G3WA 3LGLA 5CO7A 2VGNA 2K3XA 3C12A 3X20B 5GANj 1YHQT 5LL6S 3FLGA 3V7SA 3OYHA 4N0AA 4E7HA 2XDDA 3AHUA 1JBMA 2DIQA 2MWPA 4ZN1A 3JAME 4ZGEB 3OYFA 2LT1A 3PTAA 2R58A 3MHXA 3FRNA 2LC4A 2PUOB 5HKCA 3OS2A 1YITT 1K9MU 3M4GA 3V8LA 4JS5A 2CKKA 3M53A 4A4HA 3GIBA 3H8ZA 5GAN4 2ZCFB 4XQ3A 1I5LA 3KBGA 4X9DA 3CXCA 3PGGA 3RMQA 3G71T 4HT8A 4RCBA 3OYMA 2YLBA 5GANh 4BDZA 3M54A 4XAXB 3RERA 4CRIA 1M1GA 2EJFA 3VYGA 3CCET 4HT9A 3ASKA 2DKGA 4E7KA 2VV5A 2BUDA 3DLLA 4M75A 1VQKA 3QJYA 3E9GA 4LD6A 3H6ZA 4FU6A 5CKBA 3JCMc 1Y96B 3E19A 3V8JA 3JB9D 2JTFA 5GAMg 1N27A 2RK2A 3JSCA 2OTLT 1OZ3A 4PJOB 4XTYA 5CKFA 2EAYA 1BKBA 5GAOl 1O75A 2RHYA 1QW1A 3MP6A 2E70A 2DPPB 2RK1A 5GAOp 5LJ5g 3JCMh 2DD5A 3NTKA 4HCBA 1ZQ1A 3URGA 2LTOA 3CC7A 3UPUA 5D6XA 1YBYA 3JCMX 3ZBDA 3JB9F 4X34A 3X24B 2L3RA 2QEXT 3HKSA 1U1SA 2XKOC 4ELZC 1UGQB 3EFSA 2LVMA 3SWNA 5KE3A 5GAN5 4JJNK 2LQKA 2ZGWA 5D6WA 5A2QE 2ZPIB 3QG1A 4P5NA 1ZBXA 4MMLA 3LLRA 1KHIA 1K73U 2YHTA 2VGMA 3UDCA 3JB9G 2PQWA 4JLIA 5C0MA 4L59A 3OYJA 3CPWS 4M7AC 1Q81U 1VQ5A 4FL6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4C0D B;  4BY6 C;  5FU6 B;  4C0F A;  4C0G A;  5FU7 B;  4BY6 B;  4C0D C;  5FU6 C;  5FU7 C; 
#chains in the Genus database with same CATH topology
 1LPL A;  4O6J A;  2E12 A;  3GPL A;  1W4S A;  2KR3 A;  2L3S A;  3EHR A;  2QAZ A;  4M7D D;  1BIA A;  2P0Q A;  3QHS A;  4OF1 A;  5FWB A;  2YT6 A;  5CKH A;  1WJS A;  3CMA T;  2K6D A;  3CCR A;  2FPD A;  1WHG A;  3LH5 A;  3EFO B;  3EGD B;  4RTW A;  4OMP A;  1PM3 A;  1ZSZ C;  3PFS A;  4II1 A;  2MCN A;  2VXF A;  4ZGD B;  1TSF A;  3KUF A;  4J9H A;  4RTY A;  1B3Q A;  3CEY A;  1GRI A;  1I0C A;  2RB6 A;  4RG8 A;  2JS2 A;  2PVO B;  2CYZ B;  2W0Z A;  2RNA A;  2E4H A;  4RKU E;  2DTO A;  4HKE A;  1G3T A;  1AWX A;  2KYB A;  5KYW B;  2X4Y A;  3OYY A;  2LX9 A;  2JOY A;  5LJ5 j;  5I11 A;  1OYX A;  3EFO A;  3EGD A;  4XU3 A;  4M78 D;  4LDY A;  3P8B B;  2HBW A;  2HQH A;  1AWJ A;  3M59 A;  5HK0 A;  3CCE A;  2LZ6 B;  3JB9 I;  4KGV B;  3VS3 A;  4N4I A;  2FL7 A;  4XTU A;  4K11 A;  2DIG A;  2RO0 A;  3OYL A;  4FT2 A;  4ZTJ A;  4Y91 A;  2GQI A;  1YJN T;  1RLQ C;  1Q81 C;  2ROT A;  4PJL A;  5KYW A;  1D1B A;  1YN8 A;  3C94 A;  3QSU A;  2E5Q A;  4B6M A;  3OW2 P;  4M78 G;  2B86 A;  1OPL A;  1KD1 R;  3BFM A;  2GNC A;  2KK4 A;  5A0D A;  1DJ7 B;  4HCC A;  1K73 R;  1U1T A;  2F69 A;  3CCQ T;  2D9T A;  2OJ2 A;  4HA8 A;  4A4G A;  1KC8 U;  1SSH A;  2DXT A;  2Y90 A;  2NUP B;  2KYM A;  1NLO C;  2K57 A;  2DO3 A;  1UJY A;  5FLX E;  2O9V A;  5LJ3 d;  1RAF B;  1X2Q A;  3U23 A;  4JZ4 A;  5KYX B;  2E10 A;  1VQO Q;  2PVG B;  5L23 A;  1RAH B;  2GF7 A;  1VQP A;  2KVQ G;  1UEC A;  4DBH A;  2DBK A;  3ER0 A;  3SHW A;  4DOW A;  1LCK A;  3PIO A;  2E41 A;  1YIT Q;  2HQX A;  2DF6 A;  1W1F A;  2HD0 A;  2E3I A;  3HFN A;  1V76 A;  2NUP A;  1RAB B;  3H0F A;  2KT8 A;  2R5M A;  5DLQ E;  4ZNX A;  4J83 A;  1BYM A;  3TSW A;  5CR2 A;  5J3B A;  2KNB B;  2RQR A;  5KYX A;  2YUN A;  1SRL A;  2XDB A;  4A54 A;  1PSE A;  4F7U B;  1QVF P;  3UAT A;  4PLL A;  2OTL Q;  4XTV A;  3QKJ A;  3GF5 A;  1KG1 A;  2PNI A;  3BE3 A;  3RR6 A;  4PJO D;  2JW4 A;  1UJ0 A;  1UHF A;  2QEX Q;  5I21 A;  1UG1 A;  1WHJ A;  2O2O A;  1W2B S;  2EYZ A;  2RHZ A;  2V8J A;  4IUT A;  1JB0 E;  1ZA2 B;  3G7Z A;  3HFO A;  1AZG B;  5KCH A;  4F7U A;  2K3Y A;  2EFI A;  5GMK h;  1IRX A;  1H3Z A;  1JRI A;  4N0A C;  2C0I A;  2RH2 A;  3UWN A;  2G3R A;  3OQ5 A;  4FIB A;  1BBZ A;  1VUB A;  1ZHI A;  1ZSZ A;  3MET A;  4KH1 B;  3OB9 A;  4LXC A;  3QUI A;  4HXJ A;  3EFR A;  3S3M A;  5FRM A;  2DEU A;  1QVG P;  2GCX A;  5GAN d;  3QPH A;  2XK0 A;  1VQN T;  1VQ5 Q;  4OP0 A;  3SB2 A;  3G6E A;  4Q5W A;  5L8R E;  3VJP A;  1WXB A;  1X6O A;  4OMN A;  1IGQ A;  2CSQ A;  2DLP A;  2KSS A;  2HMA A;  1IXD A;  1PHT A;  3OMG A;  3WVE B;  4ZTF A;  2KEA A;  1Z9Q A;  3JCM d;  4LDX A;  1WLP B;  4PJJ A;  1YIJ A;  1T0H A;  4D8D A;  1JQQ A;  2M02 A;  2EW3 A;  4E7S A;  3CC2 A;  3FB9 A;  4J9C A;  5LJ3 j;  5KYY B;  4A4K A;  5GAN 3;  4JZ3 A;  1YWO A;  4DQ2 A;  2QQS A;  1ZUU A;  2GTJ A;  3FIF A;  1ACM B;  4ZGJ B;  1NJI C;  1SRM A;  1KSW A;  2AHJ B;  2QDY B;  2FEI A;  2QA4 Q;  4JJC A;  3V7R A;  1KD1 U;  3VS5 A;  1YJW A;  4OB1 B;  5GAN 6;  4EDU A;  1K8A R;  1RAA B;  2JTE A;  3CCL Q;  2DL4 A;  2NUZ A;  3DB3 A;  5KYY A;  5CAI A;  5KYU B;  1PRL C;  2CP3 A;  2NLU A;  4BI3 A;  2X4X A;  3GNG A;  1UFF A;  3JCM J;  1M90 C;  1FMK A;  2EKH A;  1FXX A;  3UDC A;  1M4Z A;  4A4F A;  4FCY A;  1YCS B;  2R5A A;  5ECA A;  1K1Z A;  3CCS A;  2ZPH B;  1OUL A;  3G4S Q;  1WJQ A;  4M77 D;  1ARK A;  4PLI A;  3CBO A;  3VU3 C;  1UGS B;  2AT1 B;  1WQ7 A;  4C92 D;  2PU9 B;  1SHF A;  4OMQ A;  1I1J A;  1M30 A;  5KYU A;  3I56 A;  1M9S A;  2D8H A;  2X4J A;  3BDU A;  3CCM T;  1W6X A;  3LX7 A;  1YI2 A;  1P92 A;  2LCC A;  4M7A D;  4A4E A;  1JJ2 S;  3CCR T;  1ZSG A;  2LDM A;  2V8I A;  4WF2 A;  1YJ9 A;  2K5I A;  3EG1 A;  4XU1 A;  4NS5 A;  1W2B A;  4M77 G;  3GLX A;  5GAM h;  5IN1 A;  1KQS P;  1OX9 A;  1RAD B;  1YP5 A;  1S72 Q;  2EJG A;  4C5E A;  7AT1 B;  2R57 A;  4L6V 5;  1HYO A;  4C92 G;  2DZC A;  3OYB A;  4XTZ A;  3M57 A;  3CPW P;  1UGP B;  3R6O A;  4M78 F;  5AT1 B;  1VQL Q;  3LW5 E;  2EYQ A;  1M8V A;  2AKK A;  4KGZ B;  3H41 A;  3X20 B;  5GAN j;  3C12 A;  2AK5 A;  1BB9 A;  3V7S A;  4N0A A;  2XDD A;  1OQK A;  1JBM A;  2DIQ A;  3AHU A;  4CC7 A;  3PVL A;  2BE7 D;  4ZGE B;  3EHQ A;  2R58 A;  3FRN A;  1K9M U;  1WYX A;  2LNH B;  3KBG A;  1B7T A;  2X3W D;  4BDZ A;  1SHG A;  3M54 A;  3SEM A;  1M1G A;  3VYG A;  3CCE T;  3ASK A;  4E7K A;  2AZS A;  4ANJ A;  2BZY A;  2M51 A;  4LD6 A;  4FU6 A;  2DIL A;  1Y96 B;  1X69 A;  2QGF B;  4XTY A;  8AT1 B;  5GAO l;  2DET A;  2NYS A;  2RHY A;  2DPP B;  2RK1 A;  5GAO p;  3NTK A;  3VS4 A;  1YBY A;  3JCM X;  3JB9 F;  1U1S A;  5GAN 5;  1ZA1 B;  4A63 B;  4D8K A;  1H92 A;  5C0M A;  1M2V B;  1WHK A;  3HPW A;  2WAC A;  1Y96 A;  3ZL7 C;  9ATC B;  3M0P A;  3WVD B;  2V1Q A;  4M78 C;  4M78 E;  3JCM V;  2E6Z A;  2FPF A;  4Z89 A;  4LN2 A;  4OGE A;  3CXC P;  2F2W A;  3M56 A;  2K7A A;  2CH4 A;  2FB7 A;  2O31 A;  2F5K A;  3RKX A;  1D0Z A;  4FYV B;  2RA2 A;  2KXC A;  2DM1 A;  2D6F A;  3CC7 T;  5EG2 A;  3BDL A;  3OW2 A;  1UTI A;  3TRE A;  1VQP T;  2LQN A;  3QDF A;  2EKO A;  2J06 A;  2XIC A;  4HCZ A;  5IHI A;  1Q7Y U;  5CK9 A;  1M2V A;  2DXB A;  1PNJ A;  2ZPE B;  5DM7 R;  4IKF A;  2QQR A;  1K4U S;  2CT3 A;  5GAO m;  2JVV A;  1BI0 A;  2RJD A;  4IUR A;  3M0T A;  1QKX A;  2FVU A;  1QKW A;  4IUV A;  5FU7 C;  2E1H A;  1YIT A;  1BCO A;  5KYN A;  4C8Q D;  1IB8 A;  1EFN A;  2GFU A;  3DKM A;  3S3N A;  1BIB A;  1ABQ A;  3FDR A;  3UA6 A;  2YUQ A;  3RMS A;  1K8A U;  1FYN A;  2O4X B;  5LJ5 h;  1M8M A;  4Y92 A;  4M75 B;  2P0P A;  3UA7 A;  3OBW A;  3EG9 B;  2OTL A;  2HNI A;  2QQ9 A;  5FRO A;  4NOY A;  4BUG A;  4C8Q G;  1UHC A;  3OYE A;  1BI3 A;  1NYG A;  1YJW Q;  1TU0 B;  3I35 A;  2I2L A;  2BZX A;  5GAN 7;  1TUC A;  5HK3 A;  4PJM A;  3DB4 A;  1M3C A;  2YRC A;  2QEX A;  1Q81 R;  2KBT A;  1D3B B;  1PC0 A;  4E7I A;  4B9W A;  4ESR A;  2A37 A;  1QVF A;  2O4X A;  2RN8 A;  2RHX A;  1WXT A;  1VA7 A;  3JRZ A;  1T3L A;  2DRM A;  2HEQ A;  3EG9 A;  3ZFJ A;  1NEB A;  2K2V A;  3OSS C;  2RQV A;  2CUD A;  3VS6 A;  2JTM A;  3FJ5 A;  1Q82 U;  4HVW A;  3CD6 T;  1IO6 A;  1OZ2 A;  4JUV A;  4VUB A;  5AYF A;  1JXO A;  4RCC A;  4PJO E;  5CQY A;  2QYZ A;  3X28 B;  4BE2 A;  4IUP A;  1YHQ Q;  3CCV A;  3ME9 A;  1D3B A;  3G6E T;  1KQS S;  4IUQ A;  3NPF A;  1ZX6 A;  1R0C B;  2VYT A;  2ZPB B;  2RF0 A;  4RG2 A;  3CPF A;  5DY9 A;  2D0Q B;  2LJ3 A;  2VWF A;  3NTI A;  1OPK A;  4A53 A;  3QZ5 B;  3EH1 A;  4J9B A;  2O9S A;  2ENM A;  3JCM W;  3ULR B;  3QWY A;  2ABL A;  1YIJ T;  3LWI A;  3H0I A;  2FRW A;  2FZK B;  3GOX A;  3H0H A;  4MZP A;  2DA9 A;  3J80 E;  1WX6 A;  3CC2 T;  1QVG A;  2HL5 C;  2HBP A;  3PVQ A;  5HY6 A;  2LX7 A;  2BZ8 A;  5D7U A;  1X01 A;  4EMK C;  1N8R U;  1VQ8 T;  4M7D G;  4Z8A A;  1BI2 A;  1KC8 C;  2BIV A;  3NFC A;  4BE0 A;  3I5S A;  4QKU A;  3RNJ A;  1UE9 A;  4OMM A;  4C0F A;  3C95 A;  1M1K U;  1OX8 A;  1OI1 A;  4M78 A;  4GLK A;  4YTL A;  2L3Q A;  2F2V A;  5IAY A;  1W70 A;  3ZEH A;  2QA4 A;  3GBQ A;  1X6B A;  1PRM C;  3M55 A;  4M77 F;  4KH0 B;  3VS2 A;  3O5Z A;  4BD3 A;  1GL5 A;  1EZZ B;  1LOJ A;  2BTT A;  3CCL A;  4LDV A;  4JJD A;  2A08 A;  1R0B G;  4C92 F;  3CCS T;  3CXC S;  5IT9 E;  1VQM A;  2P0K A;  1WQW A;  3SFM A;  2KMT A;  4HVU A;  2CZ7 B;  3FC3 A;  3PNW C;  1MMD A;  4GY5 A;  2WSF E;  1TUD A;  1SKU B;  2JUF A;  4DOV A;  4PL6 A;  2K4Y A;  3G4S A;  2DL3 A;  4QQG A;  3I56 T;  3SWN C;  1YI2 T;  2CP0 A;  3A98 A;  2FG0 A;  3HRU A;  1QMC A;  1PD0 A;  4M4Z A;  5A0L A;  4E6R A;  1YJ9 T;  2CDT A;  3V8K A;  2H3E B;  1B34 A;  2D8J A;  3M9Q A;  2CGH A;  4QT7 A;  1KK7 A;  4PNO A;  1B07 A;  2CP5 A;  3MO8 A;  1PWT A;  2ZPF B;  1N5Z A;  4DEY A;  5C6S A;  1S72 A;  4RTX A;  4EIK A;  1WNL A;  2Y4X A;  3JB9 J;  4CC2 A;  3LGF A;  3CBM A;  1JJ2 P;  1AVZ C;  4M77 C;  4RMO A;  2YXY A;  4M77 E;  1VYU A;  5IH2 A;  3MKD A;  3S3O A;  1VQL A;  3C0C A;  1Y07 A;  5GAO r;  4L5G A;  3QYH B;  4MZM A;  5LJ3 h;  5J26 A;  2KAF A;  4C92 C;  4C92 E;  5LJ5 f;  4AT1 B;  4JRP A;  1UUE A;  4B9X A;  1N9S A;  1V29 B;  3QXE B;  3MEA A;  4OML A;  1KQS A;  1FWZ A;  1VQ6 Q;  1NJI R;  3HSB A;  5J39 A;  5D6Y A;  3EH2 A;  1D1A A;  2O01 E;  1VQ4 A;  3M5A A;  1XTD A;  3J81 E;  2RJE A;  3CPW A;  3A1P A;  2D0N A;  2MAM A;  2RM4 A;  1ZSZ B;  1QP3 A;  1NM7 A;  5FWC A;  2DTH A;  1U06 A;  4FW2 A;  4JPB W;  2CH4 W;  4OB0 B;  5GJV B;  4FSX A;  1Q86 R;  4MZT A;  2CP7 A;  4EMK B;  2DBM A;  4MMK A;  3GNF B;  4OVA A;  2EBP A;  1IRE B;  2DXC A;  4PJO G;  3E1S A;  2DXU A;  4QQ6 A;  3OYK A;  1GBR A;  2E3H A;  1Q95 G;  1KQ2 A;  3RKY A;  2HCK A;  3CME Q;  1U8R A;  4KUD K;  3L2V A;  2K2M A;  2CZ1 B;  4E2F B;  3UT1 A;  2XG8 D;  3VUB A;  1MHN A;  3I9Q A;  3TEE A;  2NUT B;  2FZC B;  3CCV Q;  4E7Z A;  1O9S A;  1M27 C;  4EMK A;  4OB3 B;  3GP8 A;  3JCM b;  2H3J A;  2LQ8 A;  1WPY A;  2F1L A;  3CQT A;  1U5S A;  3RDV A;  1KD1 C;  1VQO T;  4ME7 A;  4XTX A;  1AWO A;  4PJN A;  2MPX C;  2P84 A;  1TH7 A;  2V8K A;  1E6H A;  2KRN A;  2KXD A;  1G3W A;  5CO7 A;  2VGN A;  2C0T A;  3OYH A;  2MIO A;  4IIO A;  1WI7 A;  3PTA A;  1YIT T;  3MHX A;  1G83 A;  3OS2 A;  2NUT A;  4JS5 A;  1PD1 A;  1I5L A;  2ZCF B;  4XQ3 A;  4PFO A;  4X9D A;  3CXC A;  3PGG A;  4HT8 A;  1VQ9 Q;  1F1B B;  3OYM A;  2YLB A;  5GAN h;  1RAC B;  3CCU Q;  2KT1 A;  1ABO A;  3MJX A;  4CRI A;  2EJF A;  2DKG A;  2EGE A;  2BUD A;  2W10 A;  1TOV A;  5CKB A;  3JCM c;  1QCO A;  2JTF A;  1N27 A;  1Y57 A;  2OTL T;  1YFN A;  1VQ7 Q;  3QWX X;  5CKF A;  1BKB A;  2RPN A;  3CC4 Q;  3MP6 A;  5LJ5 g;  2A0F B;  3JCM h;  2DD5 A;  1RAI B;  1ZQ1 A;  3URG A;  2LTO A;  2RQU A;  3X24 B;  2QEX T;  2OTJ Q;  3SWN A;  2LQK A;  2ZGW A;  2LQW A;  5A2Q E;  2ZPI B;  4MML A;  3LLR A;  3TSZ A;  1KHI A;  1K73 U;  1RAE B;  2J6F A;  4JLI A;  1GCP A;  5FW9 A;  3I55 Q;  3KXT A;  5GMK e;  3SD4 A;  2V1R A;  5IXB A;  4C8Q E;  5I2S A;  1VQM Q;  1Y7X A;  1GCQ C;  2YDL A;  3I5R A;  1G3S A;  5HCK A;  1OOT A;  2DL7 A;  2Z0W A;  3E9F A;  2RHI A;  3G1J A;  2RQT A;  4M7D F;  1K9M C;  3CCV T;  4BDY A;  2EGA A;  3R6N A;  1M3A A;  4M77 A;  3AT1 B;  4BY6 C;  3MPU B;  4BAC A;  3THK A;  1VQ5 T;  3MEU A;  4C92 A;  4KRT A;  5KCO A;  1YHQ A;  2EIF A;  2DNU A;  2F2X A;  3QJ6 A;  4ZN3 A;  2V26 A;  2L0A A;  4CC4 B;  1VOM A;  3IQL A;  2VC8 A;  1VQK Q;  2EPD A;  2L89 A;  5GMK l;  1QP2 A;  1D0X A;  1OV3 A;  2JS0 A;  4FYX B;  1MUZ A;  1R8O B;  1NEG A;  1TXQ A;  4GBQ A;  4F17 A;  1QVP A;  2CUB A;  2XDP A;  4LUD A;  5LJ3 f;  5CQX A;  4XU2 A;  4M7A G;  1QLY A;  2CZ6 B;  4AMC A;  3EGU A;  2C06 A;  3INZ A;  2ZPG B;  1Q86 U;  2KRO A;  4J7I A;  3JCM e;  3QYG B;  1OEB A;  1VQ4 Q;  1XQH A;  5EC7 A;  2EJ9 A;  4M7D C;  2QA4 T;  4M7D E;  4WTO B;  4JRQ A;  1Q7Y C;  2DX1 A;  2MI6 A;  2MWO A;  1BI1 A;  2GGR A;  3CCL T;  1R77 A;  1RAG B;  2E65 A;  3RUX A;  2EQU A;  3MCA B;  4J9I A;  1VQM T;  3E2U A;  4X9C A;  4IIM A;  1IGU A;  2ZZD A;  3EG3 A;  4JRK A;  5GMK m;  1G8X A;  1RL2 A;  3FJP A;  2DVE A;  4C0D C;  2LRQ A;  1WDX A;  4R55 A;  1HD3 A;  3G4S T;  4RUG A;  2HAX A;  5CKE A;  1GFD A;  1K8A C;  4FM4 B;  3EAE A;  2CT4 A;  2ECZ A;  4QVZ A;  3G71 Q;  2RI5 A;  2EYW A;  1JEG A;  4C5H A;  2D1X A;  2QG9 B;  4J8O A;  3CCJ A;  4BE1 A;  1G2B A;  1PCX A;  2K5F A;  2DZ9 A;  1D1C A;  1K0S A;  2DYB A;  2LMJ A;  4PFP A;  4J6X A;  5GAM e;  1S72 T;  4E47 A;  1PG5 B;  2QQA A;  3WXM B;  3MEW A;  2XD0 A;  2MK5 A;  3LWH A;  1VQL T;  5GAN f;  4BY6 B;  2I0N A;  2DD4 A;  3SDZ A;  2C0O A;  4PJO F;  1J3T A;  2VUB A;  4PKC C;  1Q82 C;  4J9G A;  1AT1 B;  4RTZ A;  2XU8 A;  3F70 A;  2OX7 A;  2GTO A;  1D0Y A;  1QQJ A;  1KC8 R;  2J6O A;  4OGC A;  2RJF A;  5LJ3 g;  1GCQ A;  3CMA Q;  3JCM f;  1GFC A;  3TQ7 P;  2EQM A;  2KRM A;  1VQ6 A;  3JV3 A;  2LP5 A;  1G3Y A;  1LNX A;  1X2K A;  3M0U A;  1WGS A;  2K5L A;  4JRI A;  3L2Q A;  1JJ2 A;  1X43 A;  4CI0 C;  2B8A A;  1JO8 A;  2X9H A;  2IG0 A;  3MEV A;  4F04 B;  2JNG A;  1C1A A;  2HQE A;  1IHW A;  1SF9 A;  1C6V X;  3OYG A;  3OYD A;  4LDU A;  1TTH B;  1UDL A;  5IHN A;  3OA6 A;  2OAW A;  1N8R C;  2DJZ A;  1NBE B;  2J7I A;  4M7D B;  4QVD A;  5GAN 8;  2BE9 B;  3CME A;  2K9G A;  1BK2 A;  4PJO C;  1X75 C;  2COY A;  4FW1 A;  3OSV A;  1M1K C;  1YJN Q;  4M75 D;  3L2U A;  3QBY A;  3P8H A;  2HSE B;  5KH6 A;  1CKA A;  4XK8 E;  3OS0 A;  1M2O A;  4C5G A;  4MDX A;  1TUG B;  1LJO A;  3NTH A;  3FEO A;  2RQW A;  4KT0 E;  1XOV A;  5GAM f;  4C0D B;  3Q1J A;  4M7D A;  1UB4 A;  2WSC E;  1TG0 A;  2CS7 A;  3PIP A;  1WHH A;  4M75 G;  1KIK A;  1PKS A;  4M78 B;  3OYC A;  1IZ6 A;  2PVD B;  2YRD A;  3CCM A;  4F7U E;  1VQ9 A;  4LNP A;  3CCU A;  5GAN g;  2M9U A;  1I8F A;  3C4S A;  3X25 B;  2ESW A;  2JJ9 A;  2YUO A;  5LJ5 e;  1VIE A;  2DAQ A;  3BW1 A;  4HCK A;  3L1A A;  1SEM A;  1VQ7 A;  2F5T X;  1NE8 A;  4DBQ A;  3CC4 A;  3OS1 A;  2EWN A;  3LYI A;  2ZAE A;  1I07 A;  3P8D A;  1MND A;  3JCM g;  1YJW T;  2M1H A;  2QAS A;  5GJW B;  1N6A A;  2HSP A;  3VKI A;  2AKL A;  2LJ0 A;  3UF4 A;  5FU7 B;  2OTJ A;  1NPR A;  2FZG B;  2KGT A;  1YCY A;  5CCA A;  1HJD A;  1BU1 A;  1WA7 A;  4QVC A;  2VXE A;  1RI0 A;  5DLO A;  3I55 A;  4NL3 A;  1NYF A;  4C5I A;  4OB2 B;  1B34 B;  2DE0 X;  2M16 A;  4E7L A;  1X27 A;  2EQK A;  1EIF A;  3EGX B;  3HL8 A;  4M7A F;  2QGG A;  3D7S B;  4FT4 A;  4MDW A;  2ED1 A;  1KHC A;  1YHQ T;  3LGL A;  1KFZ A;  2EYY A;  2K3X A;  3FLG A;  1RI9 A;  4ZN1 A;  2MWP A;  3JAM E;  3OYF A;  1RUW A;  2LT1 A;  3CCJ Q;  5HKC A;  2LC4 A;  2PUO B;  3M4G A;  3V8L A;  2CKK A;  3M53 A;  4A4H A;  3GIB A;  3H8Z A;  5GAN 4;  1TWB A;  1K9A A;  4RCB A;  3EGX A;  1H3H A;  5I22 A;  1CSK A;  1VQK A;  1LVK A;  2A28 A;  1AWW A;  3V8J A;  3JB9 D;  5GAM g;  2RMO A;  2RK2 A;  1OZ3 A;  4PJO B;  1JU5 C;  2E5K A;  2NWM A;  1VQN Q;  1YWP A;  2E70 A;  2GBQ A;  4HCB A;  1A0N B;  3CC7 A;  3UPU A;  4X34 A;  2L3R A;  1QCF A;  4X1V A;  4ELZ C;  1UGQ B;  3EFS A;  2LVM A;  4AFS C;  4DBF A;  5IHK A;  5KE3 A;  4JJN K;  5D6W A;  2CRE A;  1OU8 A;  3JB9 G;  2FO0 A;  4M7A C;  4L59 A;  3OYJ A;  1Q81 U;  4FL6 A;  5D6X A;  4M7A E;  2GQV A;  2A7Y A;  2CZ0 B;  1S1N A;  2X3X D;  4PJO A;  1IHV A;  4J6Y A;  2RHU A;  3VUZ A;  3HHT B;  8ATC B;  4WCI A;  2O88 A;  2RI3 A;  3T9N A;  1Z9Z A;  4ATO A;  2XMF A;  2DMO A;  1VYV A;  3OBY A;  1YNZ A;  4EPC A;  3A5Z B;  1I4K 1;  1QCN A;  1M90 R;  2CSI A;  3VS1 A;  5GAO n;  3RES A;  4F14 A;  3QDR B;  1SSF A;  2K3B A;  4ELY C;  1K9M R;  3VYH B;  2J05 A;  4TVR A;  4KGX B;  3BY7 A;  3OMC A;  2AIR B;  4DEX A;  4RTT A;  4O5V A;  3G71 A;  3CCJ T;  2QDL A;  2LJ1 A;  3M4Y A;  1NZ9 A;  1K0X A;  3MP1 A;  3L2R A;  4FYY B;  1XJW B;  3EG0 A;  4C8Q F;  2L5Q A;  1K73 C;  2YSQ A;  2JMC A;  3A8L B;  1SG5 A;  2EVR A;  2DK3 A;  4C0Z A;  3CD6 A;  2DEQ A;  4F7U G;  4XTW A;  1WHL A;  2PTK A;  2EQI A;  2XID A;  1MMA A;  3X26 B;  3PMI A;  3CCM Q;  1AHJ B;  1GBQ A;  2FRY A;  3SWN B;  1WIE A;  4J6W A;  3PE0 A;  2OAU A;  5LJ3 e;  2KQW A;  2X35 A;  2L8D A;  4EMH A;  3CCR Q;  1MV3 A;  5CIU A;  5CVI A;  4Z02 A;  3L2Z A;  1VQ6 T;  2EYX A;  1MV0 B;  2YUP A;  4AG1 C;  3CMA A;  3TCJ A;  4IUU A;  4J9D A;  3OS5 A;  4QQD A;  2ROL A;  1Q7Y R;  2Y4Y A;  1NPP A;  1VYT A;  2MYS A;  3OYI A;  5M9O A;  2HL3 A;  3A8M B;  4LDW A;  4M77 B;  1VQ8 A;  2MOX A;  4BB7 A;  1V1C A;  3L2W A;  2X4W A;  2VAS A;  4Y28 E;  1WJR A;  4JLG A;  4F16 A;  3O8V A;  4C92 B;  3EG2 A;  4M75 F;  4C8Q C;  3NGP A;  1G5V A;  1U3O A;  2E64 A;  2PZ1 A;  3V7C A;  1ZLM A;  2DVJ A;  5GAO q;  3OW2 S;  3VRZ A;  3CCE Q;  4M7A B;  3CME T;  3L42 A;  2PUK B;  4PFZ A;  1Q86 C;  4BI4 A;  3OYN A;  2YLC A;  1C0M A;  1HXD A;  1MMG A;  5FU6 C;  2DFU A;  5GMK j;  3A8G B;  1UEB A;  1Y0M A;  4AFZ C;  4PK4 A;  2MF2 A;  1YJN A;  2WSE E;  2E6N A;  2DL8 A;  2SEM A;  1AD5 A;  2H8H A;  2LT4 A;  4JS4 A;  3RIR A;  3QZ9 B;  4Z88 A;  4R56 A;  3VRY A;  4EMG A;  3QII A;  1GXI E;  4M7A A;  1AOJ A;  5GAM d;  1X6G A;  2QTX A;  2KY9 A;  5GAN 2;  1MMN A;  1CKB A;  1ZBJ A;  2FHD A;  4J9F A;  2HKN A;  3CCQ A;  3KFV A;  1AZE A;  3RBB B;  2GFA A;  2VVK A;  1E7O A;  2RI2 A;  1VQ9 T;  3J7A F;  1Q82 R;  5GAN e;  3CCU T;  1QWE A;  1NJI U;  2AZV A;  2YRV A;  3A8H B;  4LD9 K;  3CC7 Q;  1T3S A;  3PT9 A;  1VQP Q;  2DYI A;  4LUE A;  2K79 A;  4M75 C;  3HTR A;  2IVW A;  4M75 E;  2CP2 A;  3VS7 A;  2G6F X;  1KJW A;  1VQ7 T;  1WFW A;  1MNE A;  2JXB A;  4KBM B;  3CC4 T;  2P4T A;  1QVF S;  1NG2 A;  2JN0 A;  4GLM A;  1H8K A;  1SPK A;  1FMW A;  2XI9 A;  1K76 A;  2HDA A;  2OTJ T;  1FMV A;  1XNI A;  1M90 U;  2EQJ A;  2M0O A;  2KI7 A;  3QO3 A;  1HK9 A;  4ORZ A;  2DJQ A;  2LNV A;  5FRN A;  4XU0 A;  4UC4 A;  3I55 T;  4NL2 A;  3VS0 A;  2XHC A;  1KQ1 A;  3M0Q A;  3REB B;  4D6W A;  2EGC A;  5IXF A;  4R0K A;  1M1F A;  2RJC A;  1Y71 A;  1AEY A;  4AG2 C;  3JB9 H;  2FPE A;  2KDS A;  2OI3 A;  1N8R R;  4V2S A;  1WXU A;  3TVT A;  2SRC A;  4J5Y A;  4N4G A;  3HRS A;  4J9E A;  2DL5 A;  4CC3 A;  5A0G A;  1PKT A;  1M1K R;  6AT1 B;  3MP8 A;  3M0R A;  1UGR B;  3OYA A;  3A8O B;  1QVG S;  1MGQ A;  5CKD A;  4C8Q B;  3RKW A;  2QI2 A;  1I5O B;  2RD1 A;  1QWF A;  2DER A;  1VQK T;  4QW2 A;  2ED0 A;  3CD6 Q;  2VKN A;  5KE2 A;  1HSQ A;  1M5Q 1;  2L3P A;  1ZUY A;  4E7J A;  3HRT A;  1NLP C;  1OU9 A;  4OMF B;  4JDS A;  3N5B B;  1H64 1;  2JM8 A;  3S6W A;  3OY9 A;  3G6E Q;  2VB6 A;  5FU6 B;  2L2P A;  1VIF A;  2P4R A;  1VQN A;  5I2M A;  4C8Q A;  3HP9 A;  1FX7 A;  2BKD N;  3NMZ C;  4RTV A;  5GMK i;  1VQO A;  1JXM A;  5LJ5 d;  2X51 A;  4DA4 A;  1I81 A;  5GAM j;  2LCS A;  2HZY A;  4KUL A;  1M3B A;  4BI8 B;  3TU4 K;  1VQ4 T;  3JCM P;  3H9N A;  1YIJ Q;  4J7F A;  1UGV A;  3CBP A;  1E6G A;  3DLM A;  3M58 A;  3NHN A;  2FYK A;  2QQB A;  4FYW B;  4FSS A;  2COZ A;  2JZ2 A;  2YWW A;  4HVV A;  4AFQ C;  1BCM A;  1PSF A;  3CC2 Q;  2MMP A;  2QXF A;  2A3L A;  1TS9 A;  2LCL A;  1VQ8 Q;  3LH0 A;  2DTI A;  4KUI A;  4N4H A;  3VV0 A;  2IPO B;  1ZUK A;  4F7U F;  4C0G A;  3JCM Q;  4DBR A;  1N9R A;  3PMT A;  2A36 A;  5LL6 S;  1D09 B;  4E7H A;  1RLP C;  2M0Y A;  2JM9 A;  3RMQ A;  3G71 T;  2J6K A;  2KRS A;  4JJB A;  1WHM A;  2IIM A;  2QTV A;  4XAX B;  4RTU A;  3RER A;  4HT9 A;  2JT4 A;  2VV5 A;  2CP6 A;  3DLL A;  4M75 A;  2HKQ B;  2DRK A;  3QJY A;  4OMO A;  1WZO A;  4LE9 A;  3E9G A;  3H6Z A;  3CCS Q;  3E19 A;  3JSC A;  2QK0 A;  1W2B P;  2EAY A;  1O75 A;  1QW1 A;  1EX4 A;  3CCQ Q;  2COW A;  2ATC B;  3M0S A;  4AFU C;  3ZBD A;  1T0J A;  2JMA A;  3HKS A;  2XKO C;  2KE9 A;  3I56 Q;  3REA B;  3QG1 A;  4P5N A;  1ZBX A;  1YI2 Q;  2YHT A;  2VGM A;  2PQW A;  3CPW S;  1VQ5 A;  1YJ9 Q; 
#chains in the Genus database with same CATH homology
 3KXT A;  5GMK e;  3HPW A;  2WAC A;  2GQV A;  1Y96 A;  2E12 A;  2A7Y A;  4O6J A;  2CZ0 B;  3WVD B;  3GPL A;  1W4S A;  4M78 C;  3SD4 A;  4C8Q E;  4M7D D;  4PJO A;  4M78 E;  1BIA A;  2P0Q A;  2E6Z A;  3JCM V;  5I2S A;  4J6Y A;  2RHU A;  3QHS A;  3VUZ A;  4OF1 A;  3HHT B;  4OGE A;  1Y7X A;  3M56 A;  5CKH A;  1WJS A;  2FB7 A;  3CMA T;  3CCR A;  2F5K A;  3RKX A;  2RI3 A;  3T9N A;  1G3S A;  4ATO A;  2RA2 A;  3E9F A;  2RHI A;  3PFS A;  4II1 A;  3OBY A;  5EG2 A;  3CC7 T;  2D6F A;  2VXF A;  3BDL A;  3OW2 A;  3TRE A;  4M7D F;  1VQP T;  1K9M C;  4ZGD B;  3CCV T;  4BDY A;  3KUF A;  4EPC A;  4M77 A;  3A5Z B;  2EKO A;  1I4K 1;  4BY6 C;  3CEY A;  2XIC A;  2RB6 A;  4HCZ A;  1Q7Y U;  5CK9 A;  2DXB A;  4RG8 A;  4BAC A;  2PVO B;  2CYZ B;  2ZPE B;  5DM7 R;  5GAO n;  1VQ5 T;  4IKF A;  4RKU E;  3MEU A;  2DTO A;  2QQR A;  3RES A;  4C92 A;  1GXI E;  3QDR B;  5KCO A;  1YHQ A;  4HKE A;  1SSF A;  2EIF A;  4ELY C;  1G3T A;  3VYH B;  5GAO m;  2X4Y A;  3OYY A;  2JVV A;  3QJ6 A;  4TVR A;  1BI0 A;  2RJD A;  4IUR A;  4ZN3 A;  2FVU A;  2LX9 A;  5FU7 C;  4IUV A;  2JOY A;  2E1H A;  5LJ5 j;  1YIT A;  1OYX A;  3BY7 A;  2VC8 A;  4XU3 A;  4C8Q D;  3OMC A;  4M78 D;  2L89 A;  2GFU A;  3DKM A;  5GMK l;  3S3N A;  4LDY A;  4O5V A;  1QP2 A;  3P8B B;  1BIB A;  3G71 A;  3CCJ T;  3M4Y A;  1NZ9 A;  3FDR A;  3MP1 A;  3M59 A;  3L2R A;  3RMS A;  5HK0 A;  3CCE A;  1R8O B;  3JB9 I;  1K8A U;  1QVP A;  2O4X B;  4N4I A;  5LJ5 h;  2FL7 A;  4XTU A;  2DIG A;  2RO0 A;  4M75 B;  2P0P A;  2XDP A;  4C8Q F;  2L5Q A;  3OYL A;  3OBW A;  4FT2 A;  5LJ3 f;  4ZTJ A;  1K73 C;  4Y91 A;  2OTL A;  5CQX A;  1YJN T;  3A8L B;  4XU2 A;  4M7A G;  2CZ6 B;  1Q81 C;  2HNI A;  2QQ9 A;  5FRO A;  5LJ5 e;  2DK3 A;  4NOY A;  4C0Z A;  3CD6 A;  2DEQ A;  4BUG A;  3C94 A;  4F7U G;  3QSU A;  2E5Q A;  4C8Q G;  4M78 G;  3OYE A;  1BI3 A;  4XTW A;  2I2L A;  2C06 A;  5GAN 7;  3INZ A;  5HK3 A;  3DB4 A;  2ZPG B;  1Q86 U;  3BFM A;  2KK4 A;  2XID A;  4J7I A;  5A0D A;  1DJ7 B;  4HCC A;  3X26 B;  3QYG B;  3JCM e;  2QEX A;  1U1T A;  2F69 A;  3PMI A;  3CCQ T;  1AHJ B;  1D3B B;  1XQH A;  3SWN B;  2D9T A;  4J6W A;  5LJ3 e;  2OAU A;  2EJ9 A;  4E7I A;  4M7D C;  4HA8 A;  4B9W A;  4A4G A;  2QA4 T;  4M7D E;  1QVF A;  2KQW A;  2O4X A;  1KC8 U;  2X35 A;  2L8D A;  4EMH A;  4JRQ A;  2RHX A;  3JRZ A;  5CIU A;  4Z02 A;  5CVI A;  3ZFJ A;  1Q7Y C;  2DXT A;  2Y90 A;  2K2V A;  3OSS C;  2MI6 A;  2K57 A;  2MWO A;  1BI1 A;  2JTM A;  2DO3 A;  3L2Z A;  1VQ6 T;  3CCL T;  1Q82 U;  2E65 A;  5FLX E;  3CMA A;  3RUX A;  3CD6 T;  5LJ3 d;  3TCJ A;  4IUU A;  2EQU A;  3MCA B;  1OZ2 A;  4JUV A;  4VUB A;  4X9C A;  2E10 A;  5AYF A;  1VQM T;  2PVG B;  2ZZD A;  4RCC A;  4PJO E;  4JRK A;  5GMK m;  3OS5 A;  4QQD A;  5CQY A;  2GF7 A;  3X28 B;  1VQP A;  1RL2 A;  2KVQ G;  2Y4Y A;  4BE2 A;  1NPP A;  3FJP A;  4IUP A;  2DVE A;  3ME9 A;  1D3B A;  3G6E T;  3ER0 A;  4C0D C;  3CCV A;  1KQS S;  4IUQ A;  4DOW A;  2LRQ A;  3OYI A;  5M9O A;  3A8M B;  4LDW A;  2VYT A;  4M77 B;  4R55 A;  3PIO A;  3G4S T;  2ZPB B;  1VQ8 A;  4RG2 A;  2E41 A;  2HAX A;  3CPF A;  4BB7 A;  2HQX A;  2D0Q B;  5DY9 A;  2HD0 A;  3HFN A;  5CKE A;  3L2W A;  2X4W A;  4Y28 E;  1WJR A;  4JLG A;  1K8A C;  3O8V A;  4FM4 B;  3EAE A;  3NTI A;  4C92 B;  4M75 F;  4C8Q C;  4QVZ A;  2R5M A;  5DLQ E;  4A53 A;  2RI5 A;  4J83 A;  1G5V A;  2E64 A;  3QZ5 B;  3V7C A;  1BYM A;  5CR2 A;  5J3B A;  5GAO q;  3OW2 S;  4C5H A;  3JCM W;  4M7A B;  3CME T;  1YIJ T;  2XDB A;  3LWI A;  3L42 A;  4A54 A;  1PSE A;  4F7U B;  3GOX A;  2PUK B;  4J8O A;  3CCJ A;  4PLL A;  4BE1 A;  4MZP A;  2K5F A;  2DZ9 A;  3J80 E;  4XTV A;  1Q86 C;  3QKJ A;  4BI4 A;  3CC2 T;  3GF5 A;  1QVG A;  3OYN A;  1KG1 A;  4J6X A;  5GAM e;  4PJO D;  2HBP A;  2YLC A;  1S72 T;  5HY6 A;  1HXD A;  5FU6 C;  4E47 A;  1X01 A;  1YJ9 A;  4EMK C;  5GMK j;  1N8R U;  3A8G B;  1VQ8 T;  4M7D G;  1UEB A;  2MF2 A;  1BI2 A;  2QQA A;  1YJN A;  2WSE E;  3WXM B;  2E6N A;  1KC8 C;  3MEW A;  2BIV A;  2XD0 A;  2LT4 A;  4JS4 A;  3RIR A;  3NFC A;  3QZ9 B;  5I21 A;  3LWH A;  1VQL T;  5GAN f;  4BE0 A;  4R56 A;  4BY6 B;  1W2B S;  4EMG A;  2DD4 A;  3SDZ A;  3QII A;  4PJO F;  2RHZ A;  2V8J A;  4M7A A;  4IUT A;  2VUB A;  4PKC C;  5GAM d;  4C0F A;  1Q82 C;  3C95 A;  1M1K U;  1JB0 E;  2QTX A;  3G7Z A;  3HFO A;  2KY9 A;  5GAN 2;  1OI1 A;  5KCH A;  4F7U A;  2K3Y A;  2EFI A;  2FHD A;  4M78 A;  5GMK h;  4GLK A;  2XU8 A;  3F70 A;  4YTL A;  3CCQ A;  1JRI A;  4N0A C;  1H3Z A;  2RH2 A;  5IAY A;  4OGC A;  3UWN A;  2G3R A;  3OQ5 A;  2RJF A;  5LJ3 g;  2GFA A;  3ZEH A;  2QA4 A;  3I55 A;  4FIB A;  2RI2 A;  1VQ9 T;  3J7A F;  3JCM f;  1VUB A;  1ZHI A;  3M55 A;  5GAN e;  4M77 F;  3CCU T;  4BD3 A;  1NJI U;  3MET A;  1LOJ A;  2EQM A;  2YRV A;  3A8H B;  3OB9 A;  4LD9 K;  1VQ6 A;  3QUI A;  1G3Y A;  3CCL A;  3EFR A;  1LNX A;  4LDV A;  3PT9 A;  3S3M A;  5FRM A;  4M75 C;  4C92 F;  3CCS T;  1WGS A;  2IVW A;  4M75 E;  2K5L A;  4JRI A;  3CXC S;  5IT9 E;  3L2Q A;  1VQM A;  1JJ2 A;  1VQ7 T;  2P0K A;  4CI0 C;  1WQW A;  4KBM B;  2B8A A;  2GCX A;  5GAN d;  3CC4 T;  3QPH A;  2XK0 A;  2P4T A;  3SFM A;  1VQN T;  1QVF S;  2KMT A;  2IG0 A;  4OP0 A;  3MEV A;  2JN0 A;  3SB2 A;  2CZ7 B;  3FC3 A;  3PNW C;  3G6E A;  4GY5 A;  2WSF E;  2JNG A;  4Q5W A;  5L8R E;  3VJP A;  2JUF A;  2HQE A;  2XI9 A;  4DOV A;  1X6O A;  4PL6 A;  2K4Y A;  3G4S A;  2OTJ T;  1XNI A;  1M90 U;  4QQG A;  2EQJ A;  3OYG A;  3OYD A;  3I56 T;  4LDU A;  3SWN C;  2M0O A;  3QO3 A;  2KSS A;  1YI2 T;  3HRU A;  1HK9 A;  3OMG A;  3OA6 A;  3WVE B;  2LNV A;  5FRN A;  1N8R C;  4ZTF A;  4XU0 A;  2DJZ A;  5A0L A;  3JCM d;  1YJ9 T;  4UC4 A;  3I55 T;  4NL2 A;  3V8K A;  4M7D B;  2XHC A;  1B34 A;  1KQ1 A;  4D6W A;  4QVD A;  5GAN 8;  4LDX A;  3M9Q A;  3CME A;  2CGH A;  1YIJ A;  1M1F A;  2RJC A;  4PJO C;  4PNO A;  1X75 C;  1Y71 A;  3OSV A;  3JB9 H;  3MO8 A;  1M1K C;  2KDS A;  4M75 D;  3L2U A;  2ZPF B;  3CC2 A;  3FB9 A;  4V2S A;  5LJ3 j;  3QBY A;  3P8H A;  5KH6 A;  4A4K A;  4XK8 E;  5C6S A;  3OS0 A;  5GAN 3;  1S72 A;  4J5Y A;  4N4G A;  1WNL A;  3HRS A;  4C5G A;  2Y4X A;  4DQ2 A;  3JB9 J;  4MDX A;  2QQS A;  5A0G A;  3LGF A;  1LJO A;  3CBM A;  3FEO A;  3NTH A;  4M77 C;  3FIF A;  4RMO A;  4KT0 E;  1XOV A;  4M77 E;  5GAM f;  4C0D B;  4ZGJ B;  3MP8 A;  3S3O A;  1VQL A;  3Q1J A;  1Y07 A;  5GAO r;  1NJI C;  1UGR B;  4M7D A;  1UB4 A;  2WSC E;  4L5G A;  3QYH B;  4MZM A;  2AHJ B;  5J26 A;  5LJ3 h;  2QDY B;  2CS7 A;  3OYA A;  3PIP A;  2KAF A;  4C92 C;  3V7R A;  4C92 E;  5LJ5 f;  3A8O B;  4M75 G;  1QVG S;  1KD1 U;  4JRP A;  1MGQ A;  1YJW A;  4OB1 B;  5GAN 6;  5CKD A;  4C8Q B;  3RKW A;  2QI2 A;  4M78 B;  4B9X A;  4EDU A;  1N9S A;  3OYC A;  2RD1 A;  1V29 B;  3QXE B;  1IZ6 A;  2PVD B;  3MEA A;  1FWZ A;  1KQS A;  3DB3 A;  1VQK T;  4QW2 A;  3HSB A;  5J39 A;  5D6Y A;  3CCM A;  4F7U E;  1VQ9 A;  2O01 E;  5CAI A;  1VQ4 A;  3M5A A;  1XTD A;  3J81 E;  3CCU A;  5GAN g;  2M9U A;  1I8F A;  3C4S A;  2RJE A;  1M5Q 1;  3X25 B;  5KE2 A;  3CPW A;  2NLU A;  2MAM A;  2X4X A;  4BI3 A;  3GNG A;  2RM4 A;  4E7J A;  1QP3 A;  3HRT A;  3JCM J;  1M90 C;  4OMF B;  1FXX A;  2DTH A;  1VIE A;  1H64 1;  1M4Z A;  3N5B B;  2DAQ A;  3BW1 A;  2R5A A;  4JDS A;  4OB0 B;  3S6W A;  4A4F A;  3OY9 A;  4FSX A;  3CCS A;  2ZPH B;  4MZT A;  3L1A A;  5FU6 B;  1VQ7 A;  2F5T X;  4EMK B;  1NE8 A;  1VIF A;  3CC4 A;  3OS1 A;  1WJQ A;  2EWN A;  3LYI A;  4M77 D;  4MMK A;  3P8D A;  5I2M A;  1VQN A;  3GNF B;  4C8Q A;  3HP9 A;  4OVA A;  4PLI A;  3CBO A;  1FX7 A;  1IRE B;  3JCM g;  2BKD N;  3VU3 C;  2M1H A;  2DXC A;  5GMK i;  1VQO A;  1YJW T;  4PJO G;  1UGS B;  1N6A A;  3E1S A;  2DXU A;  3VKI A;  5LJ5 d;  4QQ6 A;  4DA4 A;  1WQ7 A;  4C92 D;  2PU9 B;  1I81 A;  5GAM j;  3OYK A;  5FU7 B;  2OTJ A;  1NPR A;  1KQ2 A;  3I56 A;  4KUL A;  3RKY A;  1M9S A;  4BI8 B;  2X4J A;  3BDU A;  3CCM T;  3TU4 K;  3JCM P;  1VQ4 T;  1U8R A;  4J7F A;  3CBP A;  3LX7 A;  3DLM A;  3M58 A;  1YI2 A;  1P92 A;  4KUD K;  2FYK A;  2LCC A;  3L2V A;  4M7A D;  2CZ1 B;  2QQB A;  1YCY A;  4A4E A;  5CCA A;  1JJ2 S;  3CCR T;  2JZ2 A;  2LDM A;  2V8I A;  1MHN A;  2XG8 D;  2VXE A;  4WF2 A;  3UT1 A;  1RI0 A;  3VUB A;  4QVC A;  5DLO A;  2K5I A;  4NL3 A;  1PSF A;  4XU1 A;  4NS5 A;  3TEE A;  4C5I A;  4OB2 B;  1W2B A;  2MMP A;  1B34 B;  4M77 G;  3GLX A;  1O9S A;  5GAM h;  5IN1 A;  2M16 A;  4EMK A;  2EJG A;  2A3L A;  2QXF A;  4OB3 B;  4C5E A;  3GP8 A;  4E7L A;  2LCL A;  2R57 A;  2H3J A;  4L6V 5;  2EQK A;  3JCM b;  1EIF A;  1WPY A;  2LQ8 A;  3LH0 A;  2DTI A;  3HL8 A;  4M7A F;  4KUI A;  4N4H A;  4C92 G;  2DZC A;  3OYB A;  4XTZ A;  3VV0 A;  3M57 A;  1UGP B;  4FT4 A;  1KD1 C;  1VQO T;  4F7U F;  4M7A E;  3R6O A;  4MDW A;  4ME7 A;  4M78 F;  4XTX A;  4C0G A;  3LW5 E;  2EYQ A;  1M8V A;  3JCM Q;  1TH7 A;  2V8K A;  1KHC A;  1N9R A;  3PMT A;  1G3W A;  3LGL A;  5CO7 A;  2VGN A;  2K3X A;  3C12 A;  3X20 B;  5GAN j;  1YHQ T;  5LL6 S;  3FLG A;  3V7S A;  3OYH A;  4N0A A;  4E7H A;  2XDD A;  3AHU A;  1JBM A;  2DIQ A;  2MWP A;  4ZN1 A;  3JAM E;  4ZGE B;  3OYF A;  2LT1 A;  3PTA A;  2R58 A;  3MHX A;  3FRN A;  2LC4 A;  2PUO B;  5HKC A;  3OS2 A;  1YIT T;  1K9M U;  3M4G A;  3V8L A;  4JS5 A;  2CKK A;  3M53 A;  4A4H A;  3GIB A;  3H8Z A;  5GAN 4;  2ZCF B;  4XQ3 A;  1I5L A;  3KBG A;  4X9D A;  3CXC A;  3PGG A;  3RMQ A;  3G71 T;  4HT8 A;  4RCB A;  3OYM A;  2YLB A;  5GAN h;  4BDZ A;  3M54 A;  4XAX B;  3RER A;  4CRI A;  1M1G A;  2EJF A;  3VYG A;  3CCE T;  4HT9 A;  3ASK A;  2DKG A;  4E7K A;  2VV5 A;  2BUD A;  3DLL A;  4M75 A;  1VQK A;  3QJY A;  3E9G A;  4LD6 A;  3H6Z A;  4FU6 A;  5CKB A;  3JCM c;  1Y96 B;  3E19 A;  3V8J A;  3JB9 D;  2JTF A;  5GAM g;  1N27 A;  2RK2 A;  3JSC A;  2OTL T;  1OZ3 A;  4PJO B;  4XTY A;  5CKF A;  2EAY A;  1BKB A;  5GAO l;  1O75 A;  2RHY A;  1QW1 A;  3MP6 A;  2E70 A;  2DPP B;  2RK1 A;  5GAO p;  5LJ5 g;  3JCM h;  2DD5 A;  3NTK A;  4HCB A;  1ZQ1 A;  3URG A;  2LTO A;  3CC7 A;  3UPU A;  5D6X A;  1YBY A;  3JCM X;  3ZBD A;  3JB9 F;  4X34 A;  3X24 B;  2L3R A;  2QEX T;  3HKS A;  1U1S A;  2XKO C;  4ELZ C;  1UGQ B;  3EFS A;  2LVM A;  3SWN A;  5KE3 A;  5GAN 5;  4JJN K;  2LQK A;  2ZGW A;  5D6W A;  5A2Q E;  2ZPI B;  3QG1 A;  4P5N A;  1ZBX A;  4MML A;  3LLR A;  1KHI A;  1K73 U;  2YHT A;  2VGM A;  3UDC A;  3JB9 G;  2PQW A;  4JLI A;  5C0M A;  4L59 A;  3OYJ A;  3CPW S;  4M7A C;  1Q81 U;  1VQ5 A;  4FL6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...