4C0GA

Structure of the not-box domain of human cnot3
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
90
structure length
90
Chain Sequence
TVEFYQRLSTETLFFIFYYLEGTKAQYLAAKALKKQSWRFHTKYMMWFQRHEEPKTITDEFEQGTYIYFDYEKWGQRKKEGFTFEYRYLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure and Assembly of the not Module of the Human Ccr4-not Complex
pubmed doi rcsb
source organism Homo sapiens
molecule tags Gene regulation
molecule keywords CCR4-NOT TRANSCRIPTION COMPLEX SUBUNIT 3
total genus 17
structure length 90
sequence length 90
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2013-08-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.1020 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4c0gA00
4BY6B 4C0FA 5FU6B 5FU7B 4C0DC 5FU7C 4C0DB 4C0GA 5FU6C 4BY6C
chains in the Genus database with same CATH superfamily
2K7AA 5KCHA 1EIFA 2KAFA 2E5KA 2EYZA 3QHSA 3JB9F 2F5TX 2DM1A 2KYBA 2DETA 4AFZC 4JRKA 1UTIA 2DIQA 5I22A 5M9OA 3OW2A 1H92A 4PJOD 1GCQA 5GMKi 4PJJA 4D8KA 3REBB 2OTLA 2EAYA 3PTAA 3JAME 4M7AA 4C8QE 2FRYA 1H3ZA 1FYNA 2NUZA 5CCAA 5LL6S 2NUTB 3G4SA 2G6FX 1VQPQ 4JRIA 2MPXC 1VQMQ 2DBKA 2E4HA 1VQLA 5A2QE 4C0DB 3RR6A 3SWNC 2KI7A 4NL2A 2DLPA 3SFMA 2KY9A 1VQ7T 4XU1A 1VQMA 2JS0A 1QVPA 1T3LA 4RTWA 1U5SA 2CUDA 4M7DF 4OGCA 4M77F 1ZBJA 3L2VA 2LX7A 2AHJB 4JS4A 4QVDA 2FYKA 3CC2A 4A4EA 4GLMA 3ZL7C 5KYWA 1BI2A 1NZ9A 4IIOA 3ME9A 5FU6B 3GNFB 4X1VA 3JCMh 1Y0MA 4F7UG 2KK4A 1FMWA 2C0TA 4F04B 2DK3A 1ZLMA 1UJ0A 3JB9J 4M75G 2QEXQ 4IKFA 2RK1A 2HKNA 3A8GB 4YTLA 5D6YA 1WHMA 2D9TA 4A63B 1VQ7A 4EMGA 1N8RU 1AZGB 5J39A 4LDWA 2DAQA 4CI0C 5FU6C 3EG0A 2QQSA 2RHYA 3OYAA 3TEEA 2V8IA 4QVZA 4E2FB 1VYTA 1SHFA 2LZ6B 4C92C 2GQVA 2FZKB 4OMFB 3REAB 2GQIA 3LH5A 4LD9K 5KYYB 5CAIA 4M78B 4N0AC 5DM7R 3HRTA 5D6XA 2V1QA 1NPPA 1SSHA 2DYBA 3MCAB 4E6RA 4PLIA 4M7DC 2E1HA 3VU3C 4JUVA 4QQGA 1TH7A 3H41A 4ORZA 2VASA 1HYOA 1XOVA 2EKOA 2M0OA 2DL8A 3SHWA 3T9NA 1A0NB 1K0SA 1OV3A 3E19A 4FT2A 2DL7A 2RI5A 2E41A 2DD5A 1W2BS 4A4GA 1ZA1B 2R5AA 3CPFA 3S6WA 3FDRA 1VQ9A 1K9AA 2RJFA 1YWOA 2QGFB 4M78A 3OMGA 3EFRA 1MMGA 2LT4A 2CZ0B 3LX7A 4L59A 2K9GA 2JOYA 2HQEA 2JT4A 2OX7A 5C0MA 5L23A 5I11A 1IB8A 3NPFA 2ZPFB 1VOMA 3OB9A 1RLQC 3VYHB 3PVLA 4KBMB 3RUXA 4C0FA 1M2OA 3MO8A 1IO6A 5DLQE 2ROTA 1M2VA 1UDLA 1VQKQ 2FZCB 4WF2A 3U23A 2CREA 2DVJA 3C0CA 3SDZA 2DEUA 1BB9A 1RLPC 1ZA2B 3M0UA 4QKUA 4IUQA 4PJOG 2XIDA 3V8LA 1AT1B 1VQ8Q 1C0MA 4N0AA 2XICA 2D6FA 5A0LA 3MJXA 5LJ3g 1C1AA 1M90R 4J8OA 2IG0A 4JZ4A 4JLIA 2CP6A 2BZXA 4HCCA 2JM8A 2JN0A 1X2QA 5FLXE 2DL3A 3C12A 3MPUB 2NUTA 3X26B 1WIEA 3CCUA 2ED0A 4M7AB 2A0FB 2P0KA 3M54A 1I5OB 4C92G 2FHDA 3RIRA 5GAN3 4L6V5 3JB9G 1VQNT 3L2UA 3M5AA 2M0YA 2HEQA 4RKUE 2FPEA 2EW3A 3I56T 2WSFE 3OMCA 2PU9B 3TSWA 2RQVA 2DKGA 2VGNA 4PJOF 5GAOr 3EGDA 3M9QA 2DEQA 1YHQA 2A28A 1V1CA 5GANe 1VA7A 5GMKh 4FM4B 3CMAT 1LVKA 4AG1C 2QA4A 1ZQ1A 1N9RA 4AMCA 1I4K1 1Q7YU 5KCOA 2P4TA 2DXBA 4ZNXA 4LNPA 2GFUA 2PUOB 2YDLA 3OQ5A 4FSXA 2FPDA 2VKNA 1Q95G 1NLPC 2DYIA 2O01E 1KQSA 2XDBA 1N9SA 4OMOA 4QVCA 4M77C 2X3XD 1EFNA 1YCSB 1VQOT 1RAEB 1M1KC 1V29B 2M1HA 2PVOB 3JB9I 5GAOq 1QVGA 5DY9A 1SRLA 2FO0A 3C94A 2GTOA 2O4XB 3CC7A 2EQKA 2JMAA 5HKCA 1SRMA 3HFOA 3MKDA 4C5GA 3CQTA 1I07A 1S72Q 2Z0WA 5HCKA 3E1SA 2OJ2A 2ABLA 5IT9E 1M90C 2DNUA 3GF5A 5LJ5h 3S3NA 2L3RA 3JCMc 4AFUC 1TTHB 1B07A 2HBWA 1KG1A 4M75C 5FU7C 4HCKA 1IXDA 2F5KA 2QK0A 4PJOC 2D0NA 1VQPA 1VYUA 3MEVA 1UUEA 3FLGA 1WDXA 3UDCA 4ZGDB 4XK8E 4LXCA 2BIVA 3FRNA 4PLLA 3CCMT 1QCFA 4EMKC 1YHQT 3ER0A 3VS4A 3EH2A 1KQSP 1AWJA 1IHWA 1NG2A 1OX8A 2LCCA 3TQ7P 4RTVA 3L42A 2QXFA 4ZGJB 3CCMA 3PIOA 4DOVA 2F2WA 4XTZA 4C92F 1PSEA 2LQ8A 1FWZA 2VB6A 1WPYA 2K2VA 3NHNA 1QP3A 1CKAA 2EQMA 5IHKA 4C8QA 3V7RA 4JDSA 4M7AE 3LH0A 3JCMe 2LNHB 1VQ5Q 1WFWA 1FX7A 4EPCA 1S1NA 3HPWA 3O5ZA 3X24B 3CCRQ 1VQ5A 4ELYC 1BU1A 3I55A 3CCQT 3UPUA 4O5VA 3JCMb 1VIFA 4M77G 1RI0A 1Z9QA 5KH6A 4PNOA 3VJPA 3HFNA 1ARKA 1H3HA 1SSFA 5CKBA 1RL2A 1YJWA 2QASA 2CZ7B 4J9IA 1U3OA 2DXTA 2X4JA 3VS0A 3G7ZA 4KUDK 2K2MA 1OYXA 4DBFA 1PKTA 3CCVA 1UHFA 3ZBDA 3OA6A 2BZ8A 4E7HA 5KYNA 1WYXA 1KQ2A 5GAN8 3I9QA 2I2LA 4M78C 1U1TA 2FEIA 3EFOA 2IVWA 2CZ6B 4IUVA 2WACA 1Q81C 1Q82C 4EMKB 4R56A 2L89A 4QQ6A 3L2WA 3GP8A 1YI2Q 1QVFS 2ED1A 2HMAA 4MZTA 4OF1A 3E9GA 2FZGB 4M75E 4RG2A 3RBBB 3EHQA 2YXYA 1KD1C 2LP5A 1Q82R 4XAXB 1OEBA 2K79A 5IHNA 3ZEHA 2O9SA 3JCMX 1PD0A 1RAHB 1TUCA 5ECAA 3OS2A 3EG1A 1PNJA 2J6FA 3NGPA 1JRIA 5LJ3d 2JTEA 1VQ4A 1OZ3A 2QTVA 1YI2T 1WHJA 5A0GA 1G83A 4BY6B 1CKBA 3HKSA 4RTUA 1G8XA 5GMKm 3SWNB 2RPNA 1DJ7B 4BUGA 5GAMe 4XU3A 3VS1A 5LJ5j 1M9SA 1UHCA 1EX4A 4M7AC 1VQOQ 3N5BB 1TG0A 2NWMA 1VQ7Q 2K5LA 2KSSA 3CC2Q 3PMTA 3M4YA 1WJQA 3I5SA 3QJYA 4P5NA 1QP2A 1TUDA 3H6ZA 1NEGA 2RD1A 2P4RA 4DEXA 2G3RA 2LNVA 2HKQB 2KEAA 3LGFA 2KE9A 2DTOA 2KNBB 3M55A 1KJWA 3KFVA 3J81E 1OU8A 5D7UA 1JB0E 4CC7A 2EGCA 2CGHA 4TVRA 2O88A 5GAN5 2W0ZA 2LCLA 3NTHA 4DBRA 3GNGA 1I8FA 2KMTA 3TSZA 3OYLA 2HSEB 4NL3A 2V8KA 4M78E 2DVEA 3J80E 1M1KU 4JS5A 1RAAB 4J5YA 8ATCB 4ZN3A 3OSSC 1W1FA 3JCMd 1GCQC 2VUBA 4A53A 2GF7A 4EMHA 1ZHIA 4M75A 4RCBA 3OS1A 3M0PA 2AKKA 1T3SA 2MMPA 4XTXA 3CXCA 3CPWA 1N6AA 3OYEA 2RK2A 3Q1JA 2RJCA 4C5HA 1I0CA 5FRMA 5A0DA 2O2OA 3EG9A 2DA9A 4RTTA 1QQJA 1VQ9Q 2RM4A 3NFCA 3BFMA 4KUIA 4VUBA 2ECZA 4M4ZA 2XHCA 1YJNT 1UGRB 2FPFA 1O9SA 3QYGB 1K0XA 1ABQA 4C92E 4D6WA 2GNCA 3H0IA 5HK3A 3A8OB 5LJ5f 2C0OA 4QQDA 1HJDA 2LVMA 2R57A 1YIJT 1F1BB 2QDLA 2MF2A 2MYSA 3EGUA 1HD3A 1AWXA 3CCJQ 4M7DE 1PG5B 3FJ5A 1TUGB 4J6XA 1NJIC 1ZSZB 1IHVA 1K9MC 2ZPEB 3OW2P 4DA4A 3BE3A 2A37A 4L5GA 4M78F 2VYTA 1TU0B 4GLKA 1FXXA 1K73R 3M0RA 3OBYA 1OQKA 2BTTA 1BYMA 2QQ9A 4C8QG 2CT4A 5GMKl 3E9FA 3PVQA 3M4GA 1FMVA 4M75D 3CCRA 2K6DA 2DZ9A 2KYMA 2KT8A 2CYZB 1TS9A 2XU8A 1N5ZA 2MAMA 2AZSA 2RH2A 2RJEA 4MMKA 2LCSA 3EHRA 5EG2A 4BE1A 1RUWA 1VQ5T 2LQWA 4OMPA 1K76A 1R0BG 1YIJA 1Y07A 2D1XA 2VXEA 4AFQC 2ZGWA 4M77A 3OYDA 2EWNA 1VQ8A 2L3SA 3BY7A 4GBQA 3UATA 1YCYA 2MI6A 5CKEA 1D1BA 5J3BA 3UA6A 2EFIA 1UB4A 1KC8U 2CH4A 1ZUUA 3G71A 4KGVB 1KFZA 4LUDA 1KHCA 4PJNA 1YITA 3OYGA 3VS2A 3RMQA 3I55T 3CCQA 3A1PA 3CCSA 4FSSA 4J83A 5GAMj 3O8VA 3CCRT 3G71T 1JXOA 4OMLA 3CCQQ 4E7JA 1M3AA 5LJ5e 2JTMA 1MNEA 2QA4Q 2RQWA 1WA7A 4HCBA 5CKDA 8AT1B 2EYXA 1HSQA 5KYWB 2M9UA 2PQWA 1Q7YC 1OPLA 2A36A 4DEYA 3OYFA 3SD4A 1VQKT 1MHNA 1KSWA 3PFSA 2B8AA 4KT0E 4Z02A 2QQBA 2JVVA 1XTDA 1X43A 2KT1A 1G3TA 2LJ1A 2VWFA 4XU2A 3SEMA 2F1LA 4BB7A 5GAN2 1X01A 2DTHA 3G1JA 1MGQA 1Y57A 1GRIA 4C0ZA 1WGSA 4NOYA 1K9MR 1OU9A 3CCVT 2DXUA 4PJLA 2QAZA 4J7IA 3BW1A 2BE7D 3KUFA 1WXBA 3G4ST 4BDZA 2DBMA 4Y92A 4M77E 3CC4Q 1QLYA 2I0NA 1KHIA 1RACB 3CCJA 2DL5A 1O75A 2YUPA 3JRZA 4IUTA 3V7CA 2ZPBB 1RI9A 2E3HA 2ESWA 3WVEB 1ZSZA 2V8JA 1BI3A 4ZTJA 2RHZA 4X34A 3OS0A 4BE0A 1AOJA 1WLPB 1UFFA 3QDRB 1ACMB 3CBMA 2J06A 3ZFJA 3NTIA 5GJVB 2DZCA 5GMKe 1BIBA 1GFCA 1UG1A 1MV0B 3PE0A 5KE3A 3GIBA 5HY6A 2LT1A 4XTVA 3UA7A 1SF9A 1SEMA 1W4SA 3ASKA 4MZPA 3OY9A 2KRSA 4OMMA 2CKKA 2M51A 2XMFA 4N4IA 2MK5A 1GBQA 2HNIA 4KULA 2VVKA 2K3XA 4PJOE 1WZOA 4FL6A 2KDSA 1JBMA 4RUGA 1K4US 4CRIA 4M7AD 2LRQA 3M0TA 3EG9B 1U06A 4LE9A 2PVGB 2YUNA 3VKIA 1UJYA 4RTXA 3CC4T 3LLRA 4QW2A 3PIPA 5GAOm 2RQUA 5GAMg 5CVIA 4CC3A 1AEYA 3HP9A 2EQIA 1NYGA 4C92A 3CCVQ 4E7LA 3ULRB 3QSUA 4HVUA 2JXBA 1PWTA 1Q7YR 5KYXB 3E2UA 1QCOA 1B3QA 1VQ6Q 3CCET 3MP8A 1T0HA 1YJNA 2Y90A 2CUBA 4R55A 2X51A 3A5ZB 1AD5A 1M1GA 4FT4A 1JJ2A 2X4XA 3DKMA 4HKEA 2O9VA 2IIMA 3PT9A 5IAYA 4XTUA 4ESRA 3CXCP 3CPWP 2J7IA 1W70A 2CZ1B 3OYIA 1W2BA 2EQUA 1ABOA 1QMCA 3QWXX 3JB9D 1D0XA 3V8KA 2XKOC 1NJIU 5FRNA 3I35A 4X9CA 1E7OA 1HXDA 4M7DB 2F69A 3OYNA 3GOXA 1BCOA 1QVFA 2X4WA 3VRYA 5FW9A 1JJ2P 3EGXA 3G71Q 1BCMA 1WHHA 3HRUA 1T0JA 3LWHA 2RB6A 2J6OA 4IIMA 2X9HA 3A8LB 4A4KA 1FMKA 4J9CA 4C8QF 2KXDA 2RI3A 4RTYA 5FU7B 2EGAA 5CKFA 3FJPA 2QYZA 4QT7A 5GJWB 3TCJA 5L8RE 4HXJA 5IH2A 4JPBW 5GAN4 1PCXA 1S72T 1H641 3SWNA 3RDVA 2X35A 2E10A 1JXMA 2EYYA 2CP7A 5GAOp 4F14A 1Q86U 4A4HA 1NPRA 2X4YA 1YIJQ 1YJ9Q 1E6HA 2KGTA 2LJ0A 2XI9A 4E7ZA 2L2PA 1UGPB 1WQ7A 2PNIA 3CMEA 2NUPA 1S72A 4JLGA 3THKA 4JRPA 5IHIA 3PGGA 2M16A 5CR2A 2CP5A 2VXFA 1Y96B 4DBHA 2PZ1A 1UECA 2PUKB 4V2SA 3LWIA 3JCMW 3CBOA 1KK7A 3C4SA 3MP1A 1WHKA 5GAMf 1GFDA 4FYXB 1G3YA 1J3TA 1NLOC 2FG0A 5GAOl 3NTKA 1M5Q1 3EFOB 2YT6A 3QPHA 1VQOA 1QVFP 1WXUA 2E65A 3CC2T 1M3BA 1X6BA 3FC3A 2K3YA 5KE2A 4PFPA 3L1AA 5CQXA 4IUPA 1RAFB 1VYVA 3JB9H 1KIKA 1D0YA 1K1ZA 3TREA 5D6WA 1NYFA 3CEYA 2KR3A 3CBPA 3H0HA 2RQRA 1OZ2A 1IRXA 1KQ1A 3JCMg 2CSQA 5AYFA 4EDUA 1R77A 1JO8A 1YJ9T 4KRTA 1WNLA 2K5FA 2J6KA 3BDLA 1WI7A 1MUZA 5FWCA 2EYQA 2YLCA 2CDTA 4RG8A 4M7AG 4Z88A 2EIFA 3FEOA 2BZYA 2DTIA 3OYBA 3CCST 2FVUA 1G2BA 5KYUB 4JZ3A 4XU0A 3QKJA 4J9BA 3VV0A 1VQ8T 4BACA 2QEXT 4C8QB 3EAEA 1IGUA 4C8QD 5GAMh 3JV3A 1QW1A 4FIBA 2ATCB 1Y7XA 1BI1A 2DXCA 4M75F 3VS7A 2L3PA 4KH0B 2LTOA 2ENMA 3JCMJ 1NE8A 3CCJT 2KVQG 5GANd 2SRCA 4JJBA 2HDAA 1G3SA 4XTWA 2AK5A 3JSCA 2ZPIB 4KH1B 2A7YA 4Y28E 1X6GA 2ZPGB 4WCIA 1WJSA 2L8DA 1R8OB 3JCMf 2EQJA 2JTFA 4J6YA 4F7UE 3VRZA 3CD6T 2P0QA 5FWBA 4M7AF 1NBEB 3WVDB 5GANg 2O4XA 1Q86C 4X9DA 4LDXA 2ZCFB 1VQPT 1B7TA 1AHJB 1X2KA 1ZUKA 4FYVB 2QGGA 4UC4A 2MIOA 1M1KR 4WTOB 4PJOB 3VYGA 6AT1B 4LDUA 3L2RA 4HVVA 2RQTA 2C06A 3OYJA 3A98A 5IXFA 1ZBXA 2VV5A 1XNIA 4ANJA 4J7FA 1H8KA 4OVAA 2BE9B 3URGA 3EH1A 2ZZDA 5CKHA 4FYYB 1YJWT 1I5LA 1TOVA 1D1CA 1ZSZC 3I56A 1K8AR 1KC8R 4FU6A 4DBQA 2KBTA 1SPKA 1WJRA 1Q86R 2LQNA 2DIGA 5DLOA 3G6EA 5EC7A 1YWPA 2KRNA 1KD1R 3MP6A 2IPOB 2HSPA 3M59A 1JU5C 4OB0B 4J9EA 2D0QB 1YBYA 4D8DA 2QA4T 4HT8A 3X25B 3EG3A 1D3BB 2JM9A 3TVTA 2RJDA 5I21A 5IXBA 2CSIA 4ELZC 3FB9A 4FCYA 1KC8C 2P0PA 1QVGP 1N8RC 1YNZA 2E64A 3QXEB 3DLLA 1SHGA 3DLMA 3OS5A 1VQ6A 3CCSQ 3EGDB 2QI2A 1AVZC 1PRLC 3QZ5B 4C5EA 2DD4A 2CH4W 2NYSA 3RMSA 2F2XA 2LQKA 1VUBA 4E7SA 3KBGA 3R6NA 3CCUT 3MEWA 3HL8A 3X20B 3D7SB 3G6EQ 3CC4A 1VQNQ 2EVRA 2CS7A 2QG9B 3RKYA 4PFOA 2YUQA 1UGSB 2COZA 1K9MU 3LYIA 4M75B 2AIRB 4B9WA 3OSVA 1I81A 2XK0A 2YUOA 5J26A 2DMOA 2RF0A 3EFSA 4JRQA 2OI3A 1XJWB 1PRMC 1D1AA 1KQSS 4DQ2A 2OTJQ 2LC4A 1M8VA 3FIFA 1Y71A 2EPDA 3GPLA 3NMZC 1C6VX 2VC8A 4EIKA 4PL6A 3WXMB 1M2VB 3M57A 1IZ6A 1VQ4T 2KRMA 7AT1B 4LN2A 4J9GA 2COWA 2MCNA 4M77B 2VGMA 2PVDB 4CC2A 1M8MA 2YRDA 3AHUA 3BDUA 3CMEQ 4RMOA 2JJ9A 2GGRA 3CMET 1VQLQ 4OB3B 1MV3A 1N27A 2R58A 1TXQA 1ZUYA 3UF4A 1MNDA 4HT9A 1UEBA 2HQXA 2F2VA 3CC7T 2Y4XA 5CO7A 2L3QA 3QBYA 1OOTA 1VQ6T 2HD0A 2MWPA 2RN8A 1RAGB 2WSCE 2QDYB 1WXTA 5AT1B 5GANh 4ZGEB 5LJ5g 2HL3A 2EJGA 1YJNQ 4C0GA 3LW5E 2QQAA 2EBPA 1GXIE 2SEMA 4MMLA 1Q81R 3P8DA 4LUEA 4J9HA 3EG2A 1BBZA 4J6WA 4F17A 2OTJT 1OPKA 2ZAEA 4HCZA 3M56A 1X69A 1M1FA 3KXTA 3INZA 5GAN7 3TU4K 4BY6C 3CD6Q 2JS2A 3S3OA 2RO0A 3OYHA 1YN8A 1N8RR 3OYKA 5KYYA 4E7KA 3CC7Q 3MEUA 2ZPHB 3C95A 1G3WA 2COYA 2DRMA 4NS5A 1B34B 4Y91A 3A8HB 2RHUA 1YJWQ 2OTLT 1PHTA 3DB3A 4RTZA 3OYYA 1VQLT 2CP0A 3OYCA 4PFZA 4M78D 4FYWB 3RERA 4F7UA 4PJMA 2JZ2A 4PJOA 2CT3A 1TSFA 2JUFA 3R6OA 4BD3A 2NUPB 4OGEA 4ZN1A 1M3CA 4C92D 1YFNA 1VQMT 4ZTFA 3I5RA 3CCLA 4AT1B 2V26A 2CP2A 3QIIA 4ME7A 3QJ6A 1W6XA 1GBRA 5CK9A 5LJ3f 2EYWA 3J7AF 3S3MA 4R0KA 2YWWA 1M27C 2EKHA 4MZMA 3RESA 3V8JA 1G5VA 2L0AA 3META 2E6ZA 2LJ3A 1YJ9A 5LJ3j 4AG2C 3G4SQ 2DL4A 1U8RA 3CCLT 4F16A 4A4FA 1QWFA 2O31A 1X27A 2MOXA 5KYUA 1IGQA 1WHLA 1CSKA 2YRVA 1TWBA 2B86A 3L2QA 1QKWA 1V76A 2DX1A 2YHTA 4E7IA 3QG1A 2A08A 2KQWA 1ZX6A 3QWYA 1AWOA 3RKXA 2RI2A 4XQ3A 2HCKA 2OTLQ 3CCUQ 1MMNA 4BI4A 1YITT 2HZYA 2OTJA 1OI1A 3M58A 3MEAA 1M90U 3PNWC 1VQ4Q 1M30A 2E70A 1RAIB 4C5IA 4Z89A 3CCLQ 1ZSGA 3QUIA 2GTJA 1SG5A 2QTXA 3VS6A 4IUUA 2DO3A 4BE2A 4RCCA 4DOWA 1D3BA 4LDVA 1LJOA 4LDYA 2EJFA 4AFSC 4FW1A 2K57A 5GMKj 1R0CB 3QO3A 1K8AC 2R5MA 1VQKA 2J05A 2JMCA 4BDYA 2HAXA 2AT1B 2BUDA 3VS3A 2X3WD 2YLBA 3MHXA 2KXCA 5IN1A 4C92B 2E6NA 2RHIA 2Y4YA 4C0DC 4E47A 3V7SA 4J9DA 5GAOn 2C0IA 2DJZA 3L2ZA 3M0QA 1NM7A 4LD6A 1YITQ 1AWWA 1JQQA 2E5QA 4KGZB 1AZEA 4CC4B 4BI3A 1LNXA 2H8HA 1K73C 2RHXA 4M7DD 2DFUA 3OW2S 2K4YA 2KROA 4IURA 1BKBA 3CCEQ 4J9FA 1Y96A 3RNJA 1YI2A 5GANj 1WX6A 4MDWA 2CP3A 3AT1B 3H8ZA 1E6GA 4PK4A 3VS5A 1PD1A 1K8AU 2NLUA 2QQRA 2GFAA 4Z8AA 5C6SA 1NJIR 1I1JA 4JJNK 3HHTB 3LGLA 2D8HA 1UGVA 1W2BP 1IREB 2RMOA 1KD1U 4ATOA 2FB7A 2YRCA 2OAWA 1HK9A 2HQHA 3UWNA 1Z9ZA 5LJ5d 1UGQB 2JW4A 2RA2A 1UE9A 2D8JA 4PKCC 2XDDA 4OB2B 3OYMA 3X28B 1M4ZA 4OP0A 2MWOA 3SB2A 4OMQA 3CMAQ 3IQLA 1EZZB 1WQWA 2YSQA 2L5QA 2XD0A 2GCXA 1SKUB 1D0ZA 4II1A 2HBPA 3RKWA 2LX9A 2H3JA 3EGXB 2V1RA 1P92A 3F70A 2W10A 4HVWA 1U1SA 3QZ9B 2P84A 4M77D 1OULA 3CD6A 1LPLA 1D09B 3PMIA 1Q82U 2M02A 2XG8D 3GBQA 5I2MA 2DF6A 2E3IA 1VQ9T 3CCMQ 1QVGS 4M7DA 3HSBA 4JJCA 1GL5A 5LJ3h 4N4GA 4N4HA 3M53A 1LCKA 3H0FA 3VUZA 3JCMQ 5HK0A 4K11A 3QDFA 4C8QC 1JJ2S 1MMDA 3VUBA 4F7UF 1JEGA 2DJQA 2K5IA 2AZVA 1PC0A 3CMAA 1GCPA 5GANf 1YP5A 2WSEE 2A3LA 2QEXA 9ATCB 2DRKA 3P8BB 3DB4A 3HTRA 4OB1B 3I56Q 4JJDA 2DILA 2AKLA 4GY5A 4M78G 5GAN6 3G6ET 3QYHB 1BK2A 3P8HA 3GLXA 5CIUA 5KYXA 2EJ9A 4FW2A 1X75C 2XDPA 1PKSA 2FRWA 2FL7A 2PTKA 1PSFA 4B9XA 2GBQA 4MDXA 1B34A 4BI8B 2LMJA 4KGXB 1YHQQ 1QCNA 1X6OA 2E12A 4F7UB 1QKXA 1NEBA 3A8MB 1LOJA 1QWEA 1OX9A 2OAUA 1XQHA 4EMKA 5I2SA 1RABB 2RNAA 3JCMV 1VIEA 4OMNA 5LJ3e 3I55Q 2DERA 1K73U 5GAMd 2LDMA 4HA8A 1VQNA 1RADB 1Q81U 3HRSA 1MMAA 3OBWA 3H9NA 3CCEA 2ROLA 5FROA 2DE0X 3CXCS 3CPWS 2DPPB 1BIAA 2H3EB 4Q5WA 3M0SA 3UT1A 3JCMP 4A54A 5CQYA 4XTYA 1BI0A 2K3BA 4O6JA 1WHGA 1PM3A 2BKDN 4B6MA 2HL5C 2JNGA 4M7DG 2EGEA
chains in the Genus database with same CATH topology
1Y71A 5KCHA 1SSFA 3ASKA 1EIFA 2KAFA 4MZPA 3OY9A 5CKBA 1RL2A 3QHSA 1YJWA 3JB9F 4PNOA 3GPLA 2F5TX 2VC8A 2CZ7B 2CKKA 4N4IA 2DXTA 2X4JA 4PL6A 3G7ZA 3WXMB 2HNIA 4JRKA 4KULA 3M57A 4KUDK 1IZ6A 2DIQA 5M9OA 1VQ4T 2K3XA 4PJOE 3OW2A 4FL6A 2KDSA 1JBMA 1OYXA 4CRIA 4PJOD 4M7AD 2LRQA 3CCVA 3ZBDA 3OA6A 5GMKi 4E7HA 4M77B 2VGMA 2PVGB 2EAYA 2PVDB 3JAME 5GAN8 3PTAA 2OTLA 1KQ2A 4C8QE 4M7AA 2I2LA 3VKIA 4M78C 1H3ZA 5CCAA 3AHUA 5LL6S 1U1TA 3BDUA 3CC4T 3G4SA 4RMOA 3CMET 3LLRA 2IVWA 2CZ6B 4QW2A 3PIPA 4JRIA 4IUVA 4OB3B 2WACA 1N27A 2R58A 5GAMg 5CVIA 5GAOm 4C0DB 5A2QE 1Q81C 3HP9A 1Q82C 1VQLA 4HT9A 4EMKB 3SWNC 4R56A 4C92A 1UEBA 2HQXA 4NL2A 4E7LA 2L89A 3SFMA 2Y4XA 2KY9A 4QQ6A 3CC7T 3QSUA 5CO7A 4XU1A 3L2WA 1VQMA 1VQ7T 3QBYA 1QVPA 3GP8A 1QVFS 4MZTA 1VQ6T 4OF1A 2HD0A 2MWPA 3CCET 2WSCE 3E9GA 2QDYB 4M75E 4RG2A 3MP8A 4M7DF 5GANh 1YJNA 4OGCA 4M77F 4ZGEB 2Y90A 4R55A 3L2VA 5LJ5g 3A5ZB 2AHJB 1M1GA 4JS4A 2EJGA 1KD1C 4C0GA 4QVDA 3LW5E 2QQAA 4XAXB 1GXIE 2FYKA 3CC2A 4A4EA 4MMLA 3P8DA 4FT4A 1JJ2A 4J6WA 2OTJT 1BI2A 2X4XA 3DKMA 4HKEA 1NZ9A 3PT9A 3ZEHA 5IAYA 4HCZA 4XTUA 3JCMX 3M56A 3ME9A 5FU6B 3GNFB 1M1FA 3KXTA 3JCMh 2CZ1B 3OS2A 3INZA 3OYIA 2EQUA 4F7UG 5GAN7 3TU4K 1W2BA 4BY6C 2KK4A 3JB9D 3S3OA 2RO0A 3OYHA 1JRIA 3V8KA 3OYKA 2XKOC 1NJIU 5LJ3d 4E7KA 1VQ4A 5FRNA 3MEUA 1OZ3A 2DK3A 2ZPHB 3C95A 4X9CA 3JB9J 4M7DG 1G3WA 4M75G 4NS5A 1YI2T 1HXDA 5A0GA 4M7DB 2F69A 4BY6B 3OYNA 3GOXA 3HKSA 1QVFA 1B34B 4Y91A 5GMKm 3A8HB 2X4WA 4IKFA 2RHUA 2RK1A 3A8GB 3SWNB 2OTLT 1DJ7B 4BUGA 3DB3A 4YTLA 3HRUA 3OYYA 4XU3A 5D6YA 5GAMe 3LWHA 1VQLT 2RB6A 5LJ5j 3OYCA 4M78D 3RERA 4F7UA 2D9TA 1M9SA 2JZ2A 3A8LB 4PJOA 1VQ7A 4EMGA 1N8RU 4M7AC 4A4KA 2JUFA 3N5BB 3R6OA 5J39A 4BD3A 4C8QF 4LDWA 5FU7B 2RI3A 4OGEA 4ZN1A 2DAQA 2K5LA 4C92D 5FU6C 4CI0C 5CKFA 3FJPA 1VQMT 4ZTFA 2QQSA 2KSSA 2RHYA 5L8RE 3TCJA 5GAN4 3OYAA 1S72T 3TEEA 3CCLA 3PMTA 2V8IA 3M4YA 1H641 1WJQA 3SWNA 2X35A 2E10A 3QIIA 3QJYA 4ME7A 4P5NA 4QVZA 1QP2A 3QJ6A 4C92C 3H6ZA 5CK9A 5LJ3f 2GQVA 3J7AF 2RD1A 4OMFB 5GAOp 2G3RA 2LNVA 3LGFA 4A4HA 3S3MA 1Q86U 1NPRA 2X4YA 2XI9A 2DTOA 4LD9K 4MZMA 3RESA 3V8JA 1G5VA 1UGPB 1WQ7A 2E6ZA 3META 3M55A 4M78B 4N0AC 5CAIA 5LJ3j 5DM7R 3CMEA 1YJ9A 1U8RA 3CCLT 3HRTA 1S72A 4JLGA 5D6XA 4A4FA 4JRPA 3MCAB 1NPPA 3J81E 4PLIA 4M7DC 2E1HA 3VU3C 4JUVA 1JB0E 3PGGA 2M16A 2YRVA 4QQGA 5CR2A 1TH7A 2VXFA 1Y96B 2CGHA 4TVRA 2PUKB 3L2QA 5GAN5 4V2SA 2LCLA 3NTHA 3LWIA 3JCMW 3CBOA 3GNGA 3C4SA 2YHTA 1I8FA 1XOVA 2KMTA 3MP1A 3OYLA 4NL3A 4E7IA 3QG1A 2V8KA 5GAMf 2KQWA 4M78E 2DVEA 2EKOA 1G3YA 2M0OA 3J80E 1M1KU 4JS5A 4J5YA 3RKXA 3T9NA 5GAOl 2RI2A 3NTKA 1M5Q1 4XQ3A 4ZN3A 3OSSC 4BI4A 3E19A 3QPHA 4FT2A 1VQOA 1YITT 3JCMd 2RI5A 2E41A 2VUBA 4A53A 2DD5A 1W2BS 4A4GA 2GF7A 4EMHA 2OTJA 1OI1A 3M58A 3MEAA 2E65A 1M90U 3CC2T 2R5AA 3PNWC 3CPFA 3S6WA 1ZHIA 3FDRA 4M75A 1VQ9A 2E70A 2RJFA 4RCBA 4M78A 3FC3A 4C5IA 2K3YA 3OMGA 3EFRA 5KE2A 3OS1A 2LT4A 2CZ0B 3L1AA 3LX7A 4L59A 4IUPA 5CQXA 2MMPA 4XTXA 2JOYA 3QUIA 3JB9H 3CXCA 3CPWA 1N6AA 2HQEA 5D6WA 3TREA 3OYEA 3CEYA 2QTXA 5C0MA 4IUUA 2DO3A 2RK2A 3Q1JA 4BE2A 3CBPA 4RCCA 2RJCA 4DOWA 1D3BA 4LDVA 4C5HA 1LJOA 2ZPFB 5FRMA 5A0DA 1OZ2A 4LDYA 1KQ1A 2EJFA 3OB9A 3JCMg 5AYFA 3VYHB 4EDUA 2K57A 4KBMB 3RUXA 5GMKj 4C0FA 1YJ9T 3QO3A 1K8AC 2R5MA 2RM4A 1VQKA 1WNLA 3MO8A 3NFCA 5DLQE 2K5FA 4BDYA 3BFMA 4KUIA 4VUBA 2HAXA 3BDLA 2BUDA 4WF2A 2YLBA 3MHXA 2XHCA 5IN1A 3SDZA 1YJNT 2EYQA 2JNGA 2YLCA 4C92B 2E6NA 1UGRB 4RG8A 2RHIA 4M7AG 1O9SA 3QYGB 4C92E 4IUQA 2EIFA 2Y4YA 3FEOA 4C0DC 4D6WA 3V7SA 4E47A 2DTIA 4PJOG 5HK3A 5GAOn 3OYBA 2XIDA 3V8LA 3CCST 2FVUA 3A8OB 2DJZA 3L2ZA 5LJ5f 4N0AA 4LD6A 2XICA 2D6FA 4QQDA 5A0LA 2LVMA 5LJ3g 2R57A 1YIJT 2E5QA 4J8OA 2IG0A 4XU0A 2MF2A 3QKJA 4JLIA 4M7DE 4BI3A 1LNXA 3VV0A 1VQ8T 1K73C 4HCCA 2RHXA 4M7DD 3OW2S 2JN0A 4J6XA 4BACA 1NJIC 5FLXE 2QEXT 2K4YA 3C12A 3EAEA 4C8QB 4IURA 1K9MC 2ZPEB 1BKBA 3X26B 1Y96A 4C8QD 3CCUA 5GAMh 1YI2A 5GANj 4MDWA 4DA4A 1QW1A 4FIBA 4M7AB 3H8ZA 2P0KA 3M54A 1K8AU 4C92G 2FHDA 2NLUA 2QQRA 2GFAA 4L5GA 2VYTA 4M78F 1Y7XA 3RIRA 1BI1A 2DXCA 4GLKA 4L6V5 5C6SA 4M75F 5GAN3 3JB9G 1FXXA 2LTOA 4JJNK 1VQNT 3HHTB 3LGLA 3JCMJ 1IREB 1KD1U 3OBYA 1NE8A 4ATOA 1BYMA 3CCJT 2KVQG 5GANd 3L2UA 3M5AA 2QQ9A 2FB7A 4C8QG 5GMKl 4RKUE 1HK9A 1G3SA 3E9FA 4XTWA 3UWNA 3I56T 3JSCA 2WSFE 3OMCA 2ZPIB 2PU9B 5LJ5d 3M4GA 2DKGA 4M75D 2VGNA 1UGQB 3CCRA 2RA2A 2A7YA 2DZ9A 2CYZB 4Y28E 2XU8A 4PJOF 2ZPGB 4PKCC 2XDDA 5GAOr 2MAMA 4OB2B 2RH2A 3M9QA 2RJEA 2DEQA 1WJSA 3X28B 4MMKA 3OYMA 1YHQA 1M4ZA 2L8DA 4OP0A 5EG2A 1R8OB 3JCMf 2EQJA 2JTFA 2MWOA 4J6YA 3SB2A 4F7UE 4BE1A 3CD6T 2P0QA 5GANe 1VQ5T 5GMKh 4FM4B 3CMAT 4M7AF 1WQWA 2L5QA 3WVDB 2O4XA 5GANg 1ZQ1A 2QA4A 2GCXA 1N9RA 1Q86C 2XD0A 4X9DA 4II1A 2HBPA 4M7AE 1YIJA 1Y07A 2VXEA 4LDXA 1I4K1 3RKWA 2LX9A 2ZGWA 2H3JA 2ZCFB 4M77A 1VQPT 1Q7YU 3OYDA 5KCOA 2P4TA 1P92A 2DXBA 2EWNA 3F70A 1VQ8A 1AHJB 2GFUA 2PUOB 3BY7A 1U1SA 1YCYA 3QZ9B 4M77D 2MI6A 3OQ5A 4FSXA 3CD6A 5CKEA 4UC4A 3PMIA 5J3BA 1Q82U 2EFIA 1UB4A 1KC8U 2XG8D 4PJOB 3VYGA 2O01E 1KQSA 2XDBA 3G71A 1N9SA 4LDUA 3L2RA 4QVCA 4M77C 2C06A 3OYJA 1KHCA 1VQOT 1YITA 3OYGA 1ZBXA 2VV5A 1M1KC 1XNIA 1V29B 2M1HA 2PVOB 3JB9I 5I2MA 5GAOq 3RMQA 1QVGA 4J7FA 1VQ9T 3I55T 4OVAA 5DY9A 3CCQA 3C94A 3CC7A 2O4XB 4J83A 3URGA 5GAMj 3CCSA 1QVGS 4M7DA 2ZZDA 2EQKA 3HSBA 5CKHA 5HKCA 5LJ3h 4N4GA 4N4HA 3HFOA 3M53A 3O8VA 3VUZA 4C5GA 3JCMQ 3CCRT 5HK0A 1YJWT 3G71T 1I5LA 4C8QC 3I56A 4FU6A 1WJRA 4E7JA 1JJ2S 3VUBA 4F7UF 5LJ5e 2DIGA 2JTMA 3E1SA 5DLOA 2K5IA 3G6EA 5IT9E 3MP6A 3CMAA 1M90C 4HCBA 3GF5A 5GANf 5LJ5h 3S3NA 2L3RA 5CKDA 2WSEE 3M59A 4OB0B 2A3LA 3JCMc 2QEXA 2D0QB 4ZTJA 2M9UA 2PQWA 1YBYA 1Q7YC 3P8BB 3OYFA 2QA4T 3DB4A 4HT8A 3SD4A 4OB1B 1MHNA 3X25B 1VQKT 1KG1A 4M75C 5FU7C 2F5KA 1D3BB 4PJOC 4M78G 4GY5A 3PFSA 5GAN6 2B8AA 2RJDA 4KT0E 4Z02A 5I21A 3QYHB 2QQBA 2JVVA 3G6ET 1VQPA 1XTDA 3MEVA 3P8HA 3GLXA 5CIUA 2EJ9A 4ELZC 3FB9A 1G3TA 3FLGA 1X75C 2XDPA 1KC8C 4XU2A 3UDCA 4ZGDB 2FL7A 4BB7A 5GAN2 4XK8E 2P0PA 1PSFA 1N8RC 4B9XA 2BIVA 3FRNA 1X01A 2DTHA 4MDXA 1B34A 2E64A 1MGQA 3QXEB 3DLLA 3DLMA 3OS5A 4PLLA 1VQ6A 3CCMT 4BI8B 4C0ZA 1WGSA 2QI2A 4NOYA 4EMKC 1YHQT 1X6OA 3CCVT 3QZ5B 2E12A 4F7UB 3ER0A 2DXUA 3A8MB 4J7IA 3BW1A 4C5EA 3KUFA 2DD4A 1LOJA 3RMSA 2LCCA 2OAUA 1XQHA 4EMKA 2LQKA 1VUBA 3G4ST 5I2SA 4BDZA 3KBGA 3CCUT 3MEWA 4M77E 3L42A 2QXFA 3JCMV 3HL8A 4ZGJB 1VIEA 3CCMA 3PIOA 4DOVA 3X20B 4XTZA 4C92F 5LJ3e 1KHIA 3CC4A 1PSEA 2LQ8A 3CCJA 2CS7A 1K73U 3RKYA 5GAMd 1O75A 3JRZA 1FWZA 4IUTA 2LDMA 3V7CA 1WPYA 4HA8A 2ZPBB 1VQNA 2K2VA 1QP3A 1UGSB 1K9MU 1Q81U 3HRSA 3LYIA 4M75B 2EQMA 3OBWA 3WVEB 4C8QA 2V8JA 3V7RA 1BI3A 3CCEA 4JDSA 4B9WA 5FROA 2RHZA 3OSVA 1I81A 3LH0A 4X34A 3JCMe 3OS0A 4BE0A 2XK0A 3CXCS 1FX7A 3QDRB 2DPPB 3CPWS 4EPCA 1BIAA 3CBMA 3ZFJA 4Q5WA 5J26A 3NTIA 5GMKe 2DZCA 3HPWA 1BIBA 3UT1A 3EFSA 4JRQA 3JCMP 3X24B 4A54A 1VQ5A 5KE3A 4ELYC 3GIBA 5CQYA 4XTYA 3I55A 1BI0A 3CCQT 5HY6A 2LT1A 4O6JA 1KQSS 4XTVA 4DQ2A 3UPUA 2BKDN 4O5VA 3JCMb 1VIFA 4M77G 1RI0A 5KH6A 2LC4A 3VJPA 1M8VA 1W4SA 3HFNA 3FIFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BY6 B;  4C0F A;  5FU6 B;  5FU7 B;  4C0D C;  5FU7 C;  4C0D B;  4C0G A;  5FU6 C;  4BY6 C; 
#chains in the Genus database with same CATH topology
 2K7A A;  5KCH A;  1EIF A;  2KAF A;  2E5K A;  2EYZ A;  3QHS A;  3JB9 F;  2F5T X;  2DM1 A;  2KYB A;  2DET A;  4AFZ C;  4JRK A;  1UTI A;  2DIQ A;  5I22 A;  5M9O A;  3OW2 A;  1H92 A;  4PJO D;  1GCQ A;  5GMK i;  4PJJ A;  4D8K A;  3REB B;  2OTL A;  2EAY A;  3PTA A;  3JAM E;  4M7A A;  4C8Q E;  2FRY A;  1H3Z A;  1FYN A;  2NUZ A;  5CCA A;  5LL6 S;  2NUT B;  3G4S A;  2G6F X;  1VQP Q;  4JRI A;  2MPX C;  1VQM Q;  2DBK A;  2E4H A;  1VQL A;  5A2Q E;  4C0D B;  3RR6 A;  3SWN C;  2KI7 A;  4NL2 A;  2DLP A;  3SFM A;  2KY9 A;  1VQ7 T;  4XU1 A;  1VQM A;  2JS0 A;  1QVP A;  1T3L A;  4RTW A;  1U5S A;  2CUD A;  4M7D F;  4OGC A;  4M77 F;  1ZBJ A;  3L2V A;  2LX7 A;  2AHJ B;  4JS4 A;  4QVD A;  2FYK A;  3CC2 A;  4A4E A;  4GLM A;  3ZL7 C;  5KYW A;  1BI2 A;  1NZ9 A;  4IIO A;  3ME9 A;  5FU6 B;  3GNF B;  4X1V A;  3JCM h;  1Y0M A;  4F7U G;  2KK4 A;  1FMW A;  2C0T A;  4F04 B;  2DK3 A;  1ZLM A;  1UJ0 A;  3JB9 J;  4M75 G;  2QEX Q;  4IKF A;  2RK1 A;  2HKN A;  3A8G B;  4YTL A;  5D6Y A;  1WHM A;  2D9T A;  4A63 B;  1VQ7 A;  4EMG A;  1N8R U;  1AZG B;  5J39 A;  4LDW A;  2DAQ A;  4CI0 C;  5FU6 C;  3EG0 A;  2QQS A;  2RHY A;  3OYA A;  3TEE A;  2V8I A;  4QVZ A;  4E2F B;  1VYT A;  1SHF A;  2LZ6 B;  4C92 C;  2GQV A;  2FZK B;  4OMF B;  3REA B;  2GQI A;  3LH5 A;  4LD9 K;  5KYY B;  5CAI A;  4M78 B;  4N0A C;  5DM7 R;  3HRT A;  5D6X A;  2V1Q A;  1NPP A;  1SSH A;  2DYB A;  3MCA B;  4E6R A;  4PLI A;  4M7D C;  2E1H A;  3VU3 C;  4JUV A;  4QQG A;  1TH7 A;  3H41 A;  4ORZ A;  2VAS A;  1HYO A;  1XOV A;  2EKO A;  2M0O A;  2DL8 A;  3SHW A;  3T9N A;  1A0N B;  1K0S A;  1OV3 A;  3E19 A;  4FT2 A;  2DL7 A;  2RI5 A;  2E41 A;  2DD5 A;  1W2B S;  4A4G A;  1ZA1 B;  2R5A A;  3CPF A;  3S6W A;  3FDR A;  1VQ9 A;  1K9A A;  2RJF A;  1YWO A;  2QGF B;  4M78 A;  3OMG A;  3EFR A;  1MMG A;  2LT4 A;  2CZ0 B;  3LX7 A;  4L59 A;  2K9G A;  2JOY A;  2HQE A;  2JT4 A;  2OX7 A;  5C0M A;  5L23 A;  5I11 A;  1IB8 A;  3NPF A;  2ZPF B;  1VOM A;  3OB9 A;  1RLQ C;  3VYH B;  3PVL A;  4KBM B;  3RUX A;  4C0F A;  1M2O A;  3MO8 A;  1IO6 A;  5DLQ E;  2ROT A;  1M2V A;  1UDL A;  1VQK Q;  2FZC B;  4WF2 A;  3U23 A;  2CRE A;  2DVJ A;  3C0C A;  3SDZ A;  2DEU A;  1BB9 A;  1RLP C;  1ZA2 B;  3M0U A;  4QKU A;  4IUQ A;  4PJO G;  2XID A;  3V8L A;  1AT1 B;  1VQ8 Q;  1C0M A;  4N0A A;  2XIC A;  2D6F A;  5A0L A;  3MJX A;  5LJ3 g;  1C1A A;  1M90 R;  4J8O A;  2IG0 A;  4JZ4 A;  4JLI A;  2CP6 A;  2BZX A;  4HCC A;  2JM8 A;  2JN0 A;  1X2Q A;  5FLX E;  2DL3 A;  3C12 A;  3MPU B;  2NUT A;  3X26 B;  1WIE A;  3CCU A;  2ED0 A;  4M7A B;  2A0F B;  2P0K A;  3M54 A;  1I5O B;  4C92 G;  2FHD A;  3RIR A;  5GAN 3;  4L6V 5;  3JB9 G;  1VQN T;  3L2U A;  3M5A A;  2M0Y A;  2HEQ A;  4RKU E;  2FPE A;  2EW3 A;  3I56 T;  2WSF E;  3OMC A;  2PU9 B;  3TSW A;  2RQV A;  2DKG A;  2VGN A;  4PJO F;  5GAO r;  3EGD A;  3M9Q A;  2DEQ A;  1YHQ A;  2A28 A;  1V1C A;  5GAN e;  1VA7 A;  5GMK h;  4FM4 B;  3CMA T;  1LVK A;  4AG1 C;  2QA4 A;  1ZQ1 A;  1N9R A;  4AMC A;  1I4K 1;  1Q7Y U;  5KCO A;  2P4T A;  2DXB A;  4ZNX A;  4LNP A;  2GFU A;  2PUO B;  2YDL A;  3OQ5 A;  4FSX A;  2FPD A;  2VKN A;  1Q95 G;  1NLP C;  2DYI A;  2O01 E;  1KQS A;  2XDB A;  1N9S A;  4OMO A;  4QVC A;  4M77 C;  2X3X D;  1EFN A;  1YCS B;  1VQO T;  1RAE B;  1M1K C;  1V29 B;  2M1H A;  2PVO B;  3JB9 I;  5GAO q;  1QVG A;  5DY9 A;  1SRL A;  2FO0 A;  3C94 A;  2GTO A;  2O4X B;  3CC7 A;  2EQK A;  2JMA A;  5HKC A;  1SRM A;  3HFO A;  3MKD A;  4C5G A;  3CQT A;  1I07 A;  1S72 Q;  2Z0W A;  5HCK A;  3E1S A;  2OJ2 A;  2ABL A;  5IT9 E;  1M90 C;  2DNU A;  3GF5 A;  5LJ5 h;  3S3N A;  2L3R A;  3JCM c;  4AFU C;  1TTH B;  1B07 A;  2HBW A;  1KG1 A;  4M75 C;  5FU7 C;  4HCK A;  1IXD A;  2F5K A;  2QK0 A;  4PJO C;  2D0N A;  1VQP A;  1VYU A;  3MEV A;  1UUE A;  3FLG A;  1WDX A;  3UDC A;  4ZGD B;  4XK8 E;  4LXC A;  2BIV A;  3FRN A;  4PLL A;  3CCM T;  1QCF A;  4EMK C;  1YHQ T;  3ER0 A;  3VS4 A;  3EH2 A;  1KQS P;  1AWJ A;  1IHW A;  1NG2 A;  1OX8 A;  2LCC A;  3TQ7 P;  4RTV A;  3L42 A;  2QXF A;  4ZGJ B;  3CCM A;  3PIO A;  4DOV A;  2F2W A;  4XTZ A;  4C92 F;  1PSE A;  2LQ8 A;  1FWZ A;  2VB6 A;  1WPY A;  2K2V A;  3NHN A;  1QP3 A;  1CKA A;  2EQM A;  5IHK A;  4C8Q A;  3V7R A;  4JDS A;  4M7A E;  3LH0 A;  3JCM e;  2LNH B;  1VQ5 Q;  1WFW A;  1FX7 A;  4EPC A;  1S1N A;  3HPW A;  3O5Z A;  3X24 B;  3CCR Q;  1VQ5 A;  4ELY C;  1BU1 A;  3I55 A;  3CCQ T;  3UPU A;  4O5V A;  3JCM b;  1VIF A;  4M77 G;  1RI0 A;  1Z9Q A;  5KH6 A;  4PNO A;  3VJP A;  3HFN A;  1ARK A;  1H3H A;  1SSF A;  5CKB A;  1RL2 A;  1YJW A;  2QAS A;  2CZ7 B;  4J9I A;  1U3O A;  2DXT A;  2X4J A;  3VS0 A;  3G7Z A;  4KUD K;  2K2M A;  1OYX A;  4DBF A;  1PKT A;  3CCV A;  1UHF A;  3ZBD A;  3OA6 A;  2BZ8 A;  4E7H A;  5KYN A;  1WYX A;  1KQ2 A;  5GAN 8;  3I9Q A;  2I2L A;  4M78 C;  1U1T A;  2FEI A;  3EFO A;  2IVW A;  2CZ6 B;  4IUV A;  2WAC A;  1Q81 C;  1Q82 C;  4EMK B;  4R56 A;  2L89 A;  4QQ6 A;  3L2W A;  3GP8 A;  1YI2 Q;  1QVF S;  2ED1 A;  2HMA A;  4MZT A;  4OF1 A;  3E9G A;  2FZG B;  4M75 E;  4RG2 A;  3RBB B;  3EHQ A;  2YXY A;  1KD1 C;  2LP5 A;  1Q82 R;  4XAX B;  1OEB A;  2K79 A;  5IHN A;  3ZEH A;  2O9S A;  3JCM X;  1PD0 A;  1RAH B;  1TUC A;  5ECA A;  3OS2 A;  3EG1 A;  1PNJ A;  2J6F A;  3NGP A;  1JRI A;  5LJ3 d;  2JTE A;  1VQ4 A;  1OZ3 A;  2QTV A;  1YI2 T;  1WHJ A;  5A0G A;  1G83 A;  4BY6 B;  1CKB A;  3HKS A;  4RTU A;  1G8X A;  5GMK m;  3SWN B;  2RPN A;  1DJ7 B;  4BUG A;  5GAM e;  4XU3 A;  3VS1 A;  5LJ5 j;  1M9S A;  1UHC A;  1EX4 A;  4M7A C;  1VQO Q;  3N5B B;  1TG0 A;  2NWM A;  1VQ7 Q;  2K5L A;  2KSS A;  3CC2 Q;  3PMT A;  3M4Y A;  1WJQ A;  3I5S A;  3QJY A;  4P5N A;  1QP2 A;  1TUD A;  3H6Z A;  1NEG A;  2RD1 A;  2P4R A;  4DEX A;  2G3R A;  2LNV A;  2HKQ B;  2KEA A;  3LGF A;  2KE9 A;  2DTO A;  2KNB B;  3M55 A;  1KJW A;  3KFV A;  3J81 E;  1OU8 A;  5D7U A;  1JB0 E;  4CC7 A;  2EGC A;  2CGH A;  4TVR A;  2O88 A;  5GAN 5;  2W0Z A;  2LCL A;  3NTH A;  4DBR A;  3GNG A;  1I8F A;  2KMT A;  3TSZ A;  3OYL A;  2HSE B;  4NL3 A;  2V8K A;  4M78 E;  2DVE A;  3J80 E;  1M1K U;  4JS5 A;  1RAA B;  4J5Y A;  8ATC B;  4ZN3 A;  3OSS C;  1W1F A;  3JCM d;  1GCQ C;  2VUB A;  4A53 A;  2GF7 A;  4EMH A;  1ZHI A;  4M75 A;  4RCB A;  3OS1 A;  3M0P A;  2AKK A;  1T3S A;  2MMP A;  4XTX A;  3CXC A;  3CPW A;  1N6A A;  3OYE A;  2RK2 A;  3Q1J A;  2RJC A;  4C5H A;  1I0C A;  5FRM A;  5A0D A;  2O2O A;  3EG9 A;  2DA9 A;  4RTT A;  1QQJ A;  1VQ9 Q;  2RM4 A;  3NFC A;  3BFM A;  4KUI A;  4VUB A;  2ECZ A;  4M4Z A;  2XHC A;  1YJN T;  1UGR B;  2FPF A;  1O9S A;  3QYG B;  1K0X A;  1ABQ A;  4C92 E;  4D6W A;  2GNC A;  3H0I A;  5HK3 A;  3A8O B;  5LJ5 f;  2C0O A;  4QQD A;  1HJD A;  2LVM A;  2R57 A;  1YIJ T;  1F1B B;  2QDL A;  2MF2 A;  2MYS A;  3EGU A;  1HD3 A;  1AWX A;  3CCJ Q;  4M7D E;  1PG5 B;  3FJ5 A;  1TUG B;  4J6X A;  1NJI C;  1ZSZ B;  1IHV A;  1K9M C;  2ZPE B;  3OW2 P;  4DA4 A;  3BE3 A;  2A37 A;  4L5G A;  4M78 F;  2VYT A;  1TU0 B;  4GLK A;  1FXX A;  1K73 R;  3M0R A;  3OBY A;  1OQK A;  2BTT A;  1BYM A;  2QQ9 A;  4C8Q G;  2CT4 A;  5GMK l;  3E9F A;  3PVQ A;  3M4G A;  1FMV A;  4M75 D;  3CCR A;  2K6D A;  2DZ9 A;  2KYM A;  2KT8 A;  2CYZ B;  1TS9 A;  2XU8 A;  1N5Z A;  2MAM A;  2AZS A;  2RH2 A;  2RJE A;  4MMK A;  2LCS A;  3EHR A;  5EG2 A;  4BE1 A;  1RUW A;  1VQ5 T;  2LQW A;  4OMP A;  1K76 A;  1R0B G;  1YIJ A;  1Y07 A;  2D1X A;  2VXE A;  4AFQ C;  2ZGW A;  4M77 A;  3OYD A;  2EWN A;  1VQ8 A;  2L3S A;  3BY7 A;  4GBQ A;  3UAT A;  1YCY A;  2MI6 A;  5CKE A;  1D1B A;  5J3B A;  3UA6 A;  2EFI A;  1UB4 A;  1KC8 U;  2CH4 A;  1ZUU A;  3G71 A;  4KGV B;  1KFZ A;  4LUD A;  1KHC A;  4PJN A;  1YIT A;  3OYG A;  3VS2 A;  3RMQ A;  3I55 T;  3CCQ A;  3A1P A;  3CCS A;  4FSS A;  4J83 A;  5GAM j;  3O8V A;  3CCR T;  3G71 T;  1JXO A;  4OML A;  3CCQ Q;  4E7J A;  1M3A A;  5LJ5 e;  2JTM A;  1MNE A;  2QA4 Q;  2RQW A;  1WA7 A;  4HCB A;  5CKD A;  8AT1 B;  2EYX A;  1HSQ A;  5KYW B;  2M9U A;  2PQW A;  1Q7Y C;  1OPL A;  2A36 A;  4DEY A;  3OYF A;  3SD4 A;  1VQK T;  1MHN A;  1KSW A;  3PFS A;  2B8A A;  4KT0 E;  4Z02 A;  2QQB A;  2JVV A;  1XTD A;  1X43 A;  2KT1 A;  1G3T A;  2LJ1 A;  2VWF A;  4XU2 A;  3SEM A;  2F1L A;  4BB7 A;  5GAN 2;  1X01 A;  2DTH A;  3G1J A;  1MGQ A;  1Y57 A;  1GRI A;  4C0Z A;  1WGS A;  4NOY A;  1K9M R;  1OU9 A;  3CCV T;  2DXU A;  4PJL A;  2QAZ A;  4J7I A;  3BW1 A;  2BE7 D;  3KUF A;  1WXB A;  3G4S T;  4BDZ A;  2DBM A;  4Y92 A;  4M77 E;  3CC4 Q;  1QLY A;  2I0N A;  1KHI A;  1RAC B;  3CCJ A;  2DL5 A;  1O75 A;  2YUP A;  3JRZ A;  4IUT A;  3V7C A;  2ZPB B;  1RI9 A;  2E3H A;  2ESW A;  3WVE B;  1ZSZ A;  2V8J A;  1BI3 A;  4ZTJ A;  2RHZ A;  4X34 A;  3OS0 A;  4BE0 A;  1AOJ A;  1WLP B;  1UFF A;  3QDR B;  1ACM B;  3CBM A;  2J06 A;  3ZFJ A;  3NTI A;  5GJV B;  2DZC A;  5GMK e;  1BIB A;  1GFC A;  1UG1 A;  1MV0 B;  3PE0 A;  5KE3 A;  3GIB A;  5HY6 A;  2LT1 A;  4XTV A;  3UA7 A;  1SF9 A;  1SEM A;  1W4S A;  3ASK A;  4MZP A;  3OY9 A;  2KRS A;  4OMM A;  2CKK A;  2M51 A;  2XMF A;  4N4I A;  2MK5 A;  1GBQ A;  2HNI A;  4KUL A;  2VVK A;  2K3X A;  4PJO E;  1WZO A;  4FL6 A;  2KDS A;  1JBM A;  4RUG A;  1K4U S;  4CRI A;  4M7A D;  2LRQ A;  3M0T A;  3EG9 B;  1U06 A;  4LE9 A;  2PVG B;  2YUN A;  3VKI A;  1UJY A;  4RTX A;  3CC4 T;  3LLR A;  4QW2 A;  3PIP A;  5GAO m;  2RQU A;  5GAM g;  5CVI A;  4CC3 A;  1AEY A;  3HP9 A;  2EQI A;  1NYG A;  4C92 A;  3CCV Q;  4E7L A;  3ULR B;  3QSU A;  4HVU A;  2JXB A;  1PWT A;  1Q7Y R;  5KYX B;  3E2U A;  1QCO A;  1B3Q A;  1VQ6 Q;  3CCE T;  3MP8 A;  1T0H A;  1YJN A;  2Y90 A;  2CUB A;  4R55 A;  2X51 A;  3A5Z B;  1AD5 A;  1M1G A;  4FT4 A;  1JJ2 A;  2X4X A;  3DKM A;  4HKE A;  2O9V A;  2IIM A;  3PT9 A;  5IAY A;  4XTU A;  4ESR A;  3CXC P;  3CPW P;  2J7I A;  1W70 A;  2CZ1 B;  3OYI A;  1W2B A;  2EQU A;  1ABO A;  1QMC A;  3QWX X;  3JB9 D;  1D0X A;  3V8K A;  2XKO C;  1NJI U;  5FRN A;  3I35 A;  4X9C A;  1E7O A;  1HXD A;  4M7D B;  2F69 A;  3OYN A;  3GOX A;  1BCO A;  1QVF A;  2X4W A;  3VRY A;  5FW9 A;  1JJ2 P;  3EGX A;  3G71 Q;  1BCM A;  1WHH A;  3HRU A;  1T0J A;  3LWH A;  2RB6 A;  2J6O A;  4IIM A;  2X9H A;  3A8L B;  4A4K A;  1FMK A;  4J9C A;  4C8Q F;  2KXD A;  2RI3 A;  4RTY A;  5FU7 B;  2EGA A;  5CKF A;  3FJP A;  2QYZ A;  4QT7 A;  5GJW B;  3TCJ A;  5L8R E;  4HXJ A;  5IH2 A;  4JPB W;  5GAN 4;  1PCX A;  1S72 T;  1H64 1;  3SWN A;  3RDV A;  2X35 A;  2E10 A;  1JXM A;  2EYY A;  2CP7 A;  5GAO p;  4F14 A;  1Q86 U;  4A4H A;  1NPR A;  2X4Y A;  1YIJ Q;  1YJ9 Q;  1E6H A;  2KGT A;  2LJ0 A;  2XI9 A;  4E7Z A;  2L2P A;  1UGP B;  1WQ7 A;  2PNI A;  3CME A;  2NUP A;  1S72 A;  4JLG A;  3THK A;  4JRP A;  5IHI A;  3PGG A;  2M16 A;  5CR2 A;  2CP5 A;  2VXF A;  1Y96 B;  4DBH A;  2PZ1 A;  1UEC A;  2PUK B;  4V2S A;  3LWI A;  3JCM W;  3CBO A;  1KK7 A;  3C4S A;  3MP1 A;  1WHK A;  5GAM f;  1GFD A;  4FYX B;  1G3Y A;  1J3T A;  1NLO C;  2FG0 A;  5GAO l;  3NTK A;  1M5Q 1;  3EFO B;  2YT6 A;  3QPH A;  1VQO A;  1QVF P;  1WXU A;  2E65 A;  3CC2 T;  1M3B A;  1X6B A;  3FC3 A;  2K3Y A;  5KE2 A;  4PFP A;  3L1A A;  5CQX A;  4IUP A;  1RAF B;  1VYV A;  3JB9 H;  1KIK A;  1D0Y A;  1K1Z A;  3TRE A;  5D6W A;  1NYF A;  3CEY A;  2KR3 A;  3CBP A;  3H0H A;  2RQR A;  1OZ2 A;  1IRX A;  1KQ1 A;  3JCM g;  2CSQ A;  5AYF A;  4EDU A;  1R77 A;  1JO8 A;  1YJ9 T;  4KRT A;  1WNL A;  2K5F A;  2J6K A;  3BDL A;  1WI7 A;  1MUZ A;  5FWC A;  2EYQ A;  2YLC A;  2CDT A;  4RG8 A;  4M7A G;  4Z88 A;  2EIF A;  3FEO A;  2BZY A;  2DTI A;  3OYB A;  3CCS T;  2FVU A;  1G2B A;  5KYU B;  4JZ3 A;  4XU0 A;  3QKJ A;  4J9B A;  3VV0 A;  1VQ8 T;  4BAC A;  2QEX T;  4C8Q B;  3EAE A;  1IGU A;  4C8Q D;  5GAM h;  3JV3 A;  1QW1 A;  4FIB A;  2ATC B;  1Y7X A;  1BI1 A;  2DXC A;  4M75 F;  3VS7 A;  2L3P A;  4KH0 B;  2LTO A;  2ENM A;  3JCM J;  1NE8 A;  3CCJ T;  2KVQ G;  5GAN d;  2SRC A;  4JJB A;  2HDA A;  1G3S A;  4XTW A;  2AK5 A;  3JSC A;  2ZPI B;  4KH1 B;  2A7Y A;  4Y28 E;  1X6G A;  2ZPG B;  4WCI A;  1WJS A;  2L8D A;  1R8O B;  3JCM f;  2EQJ A;  2JTF A;  4J6Y A;  4F7U E;  3VRZ A;  3CD6 T;  2P0Q A;  5FWB A;  4M7A F;  1NBE B;  3WVD B;  5GAN g;  2O4X A;  1Q86 C;  4X9D A;  4LDX A;  2ZCF B;  1VQP T;  1B7T A;  1AHJ B;  1X2K A;  1ZUK A;  4FYV B;  2QGG A;  4UC4 A;  2MIO A;  1M1K R;  4WTO B;  4PJO B;  3VYG A;  6AT1 B;  4LDU A;  3L2R A;  4HVV A;  2RQT A;  2C06 A;  3OYJ A;  3A98 A;  5IXF A;  1ZBX A;  2VV5 A;  1XNI A;  4ANJ A;  4J7F A;  1H8K A;  4OVA A;  2BE9 B;  3URG A;  3EH1 A;  2ZZD A;  5CKH A;  4FYY B;  1YJW T;  1I5L A;  1TOV A;  1D1C A;  1ZSZ C;  3I56 A;  1K8A R;  1KC8 R;  4FU6 A;  4DBQ A;  2KBT A;  1SPK A;  1WJR A;  1Q86 R;  2LQN A;  2DIG A;  5DLO A;  3G6E A;  5EC7 A;  1YWP A;  2KRN A;  1KD1 R;  3MP6 A;  2IPO B;  2HSP A;  3M59 A;  1JU5 C;  4OB0 B;  4J9E A;  2D0Q B;  1YBY A;  4D8D A;  2QA4 T;  4HT8 A;  3X25 B;  3EG3 A;  1D3B B;  2JM9 A;  3TVT A;  2RJD A;  5I21 A;  5IXB A;  2CSI A;  4ELZ C;  3FB9 A;  4FCY A;  1KC8 C;  2P0P A;  1QVG P;  1N8R C;  1YNZ A;  2E64 A;  3QXE B;  3DLL A;  1SHG A;  3DLM A;  3OS5 A;  1VQ6 A;  3CCS Q;  3EGD B;  2QI2 A;  1AVZ C;  1PRL C;  3QZ5 B;  4C5E A;  2DD4 A;  2CH4 W;  2NYS A;  3RMS A;  2F2X A;  2LQK A;  1VUB A;  4E7S A;  3KBG A;  3R6N A;  3CCU T;  3MEW A;  3HL8 A;  3X20 B;  3D7S B;  3G6E Q;  3CC4 A;  1VQN Q;  2EVR A;  2CS7 A;  2QG9 B;  3RKY A;  4PFO A;  2YUQ A;  1UGS B;  2COZ A;  1K9M U;  3LYI A;  4M75 B;  2AIR B;  4B9W A;  3OSV A;  1I81 A;  2XK0 A;  2YUO A;  5J26 A;  2DMO A;  2RF0 A;  3EFS A;  4JRQ A;  2OI3 A;  1XJW B;  1PRM C;  1D1A A;  1KQS S;  4DQ2 A;  2OTJ Q;  2LC4 A;  1M8V A;  3FIF A;  1Y71 A;  2EPD A;  3GPL A;  3NMZ C;  1C6V X;  2VC8 A;  4EIK A;  4PL6 A;  3WXM B;  1M2V B;  3M57 A;  1IZ6 A;  1VQ4 T;  2KRM A;  7AT1 B;  4LN2 A;  4J9G A;  2COW A;  2MCN A;  4M77 B;  2VGM A;  2PVD B;  4CC2 A;  1M8M A;  2YRD A;  3AHU A;  3BDU A;  3CME Q;  4RMO A;  2JJ9 A;  2GGR A;  3CME T;  1VQL Q;  4OB3 B;  1MV3 A;  1N27 A;  2R58 A;  1TXQ A;  1ZUY A;  3UF4 A;  1MND A;  4HT9 A;  1UEB A;  2HQX A;  2F2V A;  3CC7 T;  2Y4X A;  5CO7 A;  2L3Q A;  3QBY A;  1OOT A;  1VQ6 T;  2HD0 A;  2MWP A;  2RN8 A;  1RAG B;  2WSC E;  2QDY B;  1WXT A;  5AT1 B;  5GAN h;  4ZGE B;  5LJ5 g;  2HL3 A;  2EJG A;  1YJN Q;  4C0G A;  3LW5 E;  2QQA A;  2EBP A;  1GXI E;  2SEM A;  4MML A;  1Q81 R;  3P8D A;  4LUE A;  4J9H A;  3EG2 A;  1BBZ A;  4J6W A;  4F17 A;  2OTJ T;  1OPK A;  2ZAE A;  4HCZ A;  3M56 A;  1X69 A;  1M1F A;  3KXT A;  3INZ A;  5GAN 7;  3TU4 K;  4BY6 C;  3CD6 Q;  2JS2 A;  3S3O A;  2RO0 A;  3OYH A;  1YN8 A;  1N8R R;  3OYK A;  5KYY A;  4E7K A;  3CC7 Q;  3MEU A;  2ZPH B;  3C95 A;  1G3W A;  2COY A;  2DRM A;  4NS5 A;  1B34 B;  4Y91 A;  3A8H B;  2RHU A;  1YJW Q;  2OTL T;  1PHT A;  3DB3 A;  4RTZ A;  3OYY A;  1VQL T;  2CP0 A;  3OYC A;  4PFZ A;  4M78 D;  4FYW B;  3RER A;  4F7U A;  4PJM A;  2JZ2 A;  4PJO A;  2CT3 A;  1TSF A;  2JUF A;  3R6O A;  4BD3 A;  2NUP B;  4OGE A;  4ZN1 A;  1M3C A;  4C92 D;  1YFN A;  1VQM T;  4ZTF A;  3I5R A;  3CCL A;  4AT1 B;  2V26 A;  2CP2 A;  3QII A;  4ME7 A;  3QJ6 A;  1W6X A;  1GBR A;  5CK9 A;  5LJ3 f;  2EYW A;  3J7A F;  3S3M A;  4R0K A;  2YWW A;  1M27 C;  2EKH A;  4MZM A;  3RES A;  3V8J A;  1G5V A;  2L0A A;  3MET A;  2E6Z A;  2LJ3 A;  1YJ9 A;  5LJ3 j;  4AG2 C;  3G4S Q;  2DL4 A;  1U8R A;  3CCL T;  4F16 A;  4A4F A;  1QWF A;  2O31 A;  1X27 A;  2MOX A;  5KYU A;  1IGQ A;  1WHL A;  1CSK A;  2YRV A;  1TWB A;  2B86 A;  3L2Q A;  1QKW A;  1V76 A;  2DX1 A;  2YHT A;  4E7I A;  3QG1 A;  2A08 A;  2KQW A;  1ZX6 A;  3QWY A;  1AWO A;  3RKX A;  2RI2 A;  4XQ3 A;  2HCK A;  2OTL Q;  3CCU Q;  1MMN A;  4BI4 A;  1YIT T;  2HZY A;  2OTJ A;  1OI1 A;  3M58 A;  3MEA A;  1M90 U;  3PNW C;  1VQ4 Q;  1M30 A;  2E70 A;  1RAI B;  4C5I A;  4Z89 A;  3CCL Q;  1ZSG A;  3QUI A;  2GTJ A;  1SG5 A;  2QTX A;  3VS6 A;  4IUU A;  2DO3 A;  4BE2 A;  4RCC A;  4DOW A;  1D3B A;  4LDV A;  1LJO A;  4LDY A;  2EJF A;  4AFS C;  4FW1 A;  2K57 A;  5GMK j;  1R0C B;  3QO3 A;  1K8A C;  2R5M A;  1VQK A;  2J05 A;  2JMC A;  4BDY A;  2HAX A;  2AT1 B;  2BUD A;  3VS3 A;  2X3W D;  2YLB A;  3MHX A;  2KXC A;  5IN1 A;  4C92 B;  2E6N A;  2RHI A;  2Y4Y A;  4C0D C;  4E47 A;  3V7S A;  4J9D A;  5GAO n;  2C0I A;  2DJZ A;  3L2Z A;  3M0Q A;  1NM7 A;  4LD6 A;  1YIT Q;  1AWW A;  1JQQ A;  2E5Q A;  4KGZ B;  1AZE A;  4CC4 B;  4BI3 A;  1LNX A;  2H8H A;  1K73 C;  2RHX A;  4M7D D;  2DFU A;  3OW2 S;  2K4Y A;  2KRO A;  4IUR A;  1BKB A;  3CCE Q;  4J9F A;  1Y96 A;  3RNJ A;  1YI2 A;  5GAN j;  1WX6 A;  4MDW A;  2CP3 A;  3AT1 B;  3H8Z A;  1E6G A;  4PK4 A;  3VS5 A;  1PD1 A;  1K8A U;  2NLU A;  2QQR A;  2GFA A;  4Z8A A;  5C6S A;  1NJI R;  1I1J A;  4JJN K;  3HHT B;  3LGL A;  2D8H A;  1UGV A;  1W2B P;  1IRE B;  2RMO A;  1KD1 U;  4ATO A;  2FB7 A;  2YRC A;  2OAW A;  1HK9 A;  2HQH A;  3UWN A;  1Z9Z A;  5LJ5 d;  1UGQ B;  2JW4 A;  2RA2 A;  1UE9 A;  2D8J A;  4PKC C;  2XDD A;  4OB2 B;  3OYM A;  3X28 B;  1M4Z A;  4OP0 A;  2MWO A;  3SB2 A;  4OMQ A;  3CMA Q;  3IQL A;  1EZZ B;  1WQW A;  2YSQ A;  2L5Q A;  2XD0 A;  2GCX A;  1SKU B;  1D0Z A;  4II1 A;  2HBP A;  3RKW A;  2LX9 A;  2H3J A;  3EGX B;  2V1R A;  1P92 A;  3F70 A;  2W10 A;  4HVW A;  1U1S A;  3QZ9 B;  2P84 A;  4M77 D;  1OUL A;  3CD6 A;  1LPL A;  1D09 B;  3PMI A;  1Q82 U;  2M02 A;  2XG8 D;  3GBQ A;  5I2M A;  2DF6 A;  2E3I A;  1VQ9 T;  3CCM Q;  1QVG S;  4M7D A;  3HSB A;  4JJC A;  1GL5 A;  5LJ3 h;  4N4G A;  4N4H A;  3M53 A;  1LCK A;  3H0F A;  3VUZ A;  3JCM Q;  5HK0 A;  4K11 A;  3QDF A;  4C8Q C;  1JJ2 S;  1MMD A;  3VUB A;  4F7U F;  1JEG A;  2DJQ A;  2K5I A;  2AZV A;  1PC0 A;  3CMA A;  1GCP A;  5GAN f;  1YP5 A;  2WSE E;  2A3L A;  2QEX A;  9ATC B;  2DRK A;  3P8B B;  3DB4 A;  3HTR A;  4OB1 B;  3I56 Q;  4JJD A;  2DIL A;  2AKL A;  4GY5 A;  4M78 G;  5GAN 6;  3G6E T;  3QYH B;  1BK2 A;  3P8H A;  3GLX A;  5CIU A;  5KYX A;  2EJ9 A;  4FW2 A;  1X75 C;  2XDP A;  1PKS A;  2FRW A;  2FL7 A;  2PTK A;  1PSF A;  4B9X A;  2GBQ A;  4MDX A;  1B34 A;  4BI8 B;  2LMJ A;  4KGX B;  1YHQ Q;  1QCN A;  1X6O A;  2E12 A;  4F7U B;  1QKX A;  1NEB A;  3A8M B;  1LOJ A;  1QWE A;  1OX9 A;  2OAU A;  1XQH A;  4EMK A;  5I2S A;  1RAB B;  2RNA A;  3JCM V;  1VIE A;  4OMN A;  5LJ3 e;  3I55 Q;  2DER A;  1K73 U;  5GAM d;  2LDM A;  4HA8 A;  1VQN A;  1RAD B;  1Q81 U;  3HRS A;  1MMA A;  3OBW A;  3H9N A;  3CCE A;  2ROL A;  5FRO A;  2DE0 X;  3CXC S;  3CPW S;  2DPP B;  1BIA A;  2H3E B;  4Q5W A;  3M0S A;  3UT1 A;  3JCM P;  4A54 A;  5CQY A;  4XTY A;  1BI0 A;  2K3B A;  4O6J A;  1WHG A;  1PM3 A;  2BKD N;  4B6M A;  2HL5 C;  2JNG A;  4M7D G;  2EGE A; 
#chains in the Genus database with same CATH homology
 1Y71 A;  5KCH A;  1SSF A;  3ASK A;  1EIF A;  2KAF A;  4MZP A;  3OY9 A;  5CKB A;  1RL2 A;  3QHS A;  1YJW A;  3JB9 F;  4PNO A;  3GPL A;  2F5T X;  2VC8 A;  2CZ7 B;  2CKK A;  4N4I A;  2DXT A;  2X4J A;  4PL6 A;  3G7Z A;  3WXM B;  2HNI A;  4JRK A;  4KUL A;  3M57 A;  4KUD K;  1IZ6 A;  2DIQ A;  5M9O A;  1VQ4 T;  2K3X A;  4PJO E;  3OW2 A;  4FL6 A;  2KDS A;  1JBM A;  1OYX A;  4CRI A;  4PJO D;  4M7A D;  2LRQ A;  3CCV A;  3ZBD A;  3OA6 A;  5GMK i;  4E7H A;  4M77 B;  2VGM A;  2PVG B;  2EAY A;  2PVD B;  3JAM E;  5GAN 8;  3PTA A;  2OTL A;  1KQ2 A;  4C8Q E;  4M7A A;  2I2L A;  3VKI A;  4M78 C;  1H3Z A;  5CCA A;  3AHU A;  5LL6 S;  1U1T A;  3BDU A;  3CC4 T;  3G4S A;  4RMO A;  3CME T;  3LLR A;  2IVW A;  2CZ6 B;  4QW2 A;  3PIP A;  4JRI A;  4IUV A;  4OB3 B;  2WAC A;  1N27 A;  2R58 A;  5GAM g;  5CVI A;  5GAO m;  4C0D B;  5A2Q E;  1Q81 C;  3HP9 A;  1Q82 C;  1VQL A;  4HT9 A;  4EMK B;  3SWN C;  4R56 A;  4C92 A;  1UEB A;  2HQX A;  4NL2 A;  4E7L A;  2L89 A;  3SFM A;  2Y4X A;  2KY9 A;  4QQ6 A;  3CC7 T;  3QSU A;  5CO7 A;  4XU1 A;  3L2W A;  1VQM A;  1VQ7 T;  3QBY A;  1QVP A;  3GP8 A;  1QVF S;  4MZT A;  1VQ6 T;  4OF1 A;  2HD0 A;  2MWP A;  3CCE T;  2WSC E;  3E9G A;  2QDY B;  4M75 E;  4RG2 A;  3MP8 A;  4M7D F;  5GAN h;  1YJN A;  4OGC A;  4M77 F;  4ZGE B;  2Y90 A;  4R55 A;  3L2V A;  5LJ5 g;  3A5Z B;  2AHJ B;  1M1G A;  4JS4 A;  2EJG A;  1KD1 C;  4C0G A;  4QVD A;  3LW5 E;  2QQA A;  4XAX B;  1GXI E;  2FYK A;  3CC2 A;  4A4E A;  4MML A;  3P8D A;  4FT4 A;  1JJ2 A;  4J6W A;  2OTJ T;  1BI2 A;  2X4X A;  3DKM A;  4HKE A;  1NZ9 A;  3PT9 A;  3ZEH A;  5IAY A;  4HCZ A;  4XTU A;  3JCM X;  3M56 A;  3ME9 A;  5FU6 B;  3GNF B;  1M1F A;  3KXT A;  3JCM h;  2CZ1 B;  3OS2 A;  3INZ A;  3OYI A;  2EQU A;  4F7U G;  5GAN 7;  3TU4 K;  1W2B A;  4BY6 C;  2KK4 A;  3JB9 D;  3S3O A;  2RO0 A;  3OYH A;  1JRI A;  3V8K A;  3OYK A;  2XKO C;  1NJI U;  5LJ3 d;  4E7K A;  1VQ4 A;  5FRN A;  3MEU A;  1OZ3 A;  2DK3 A;  2ZPH B;  3C95 A;  4X9C A;  3JB9 J;  4M7D G;  1G3W A;  4M75 G;  4NS5 A;  1YI2 T;  1HXD A;  5A0G A;  4M7D B;  2F69 A;  4BY6 B;  3OYN A;  3GOX A;  3HKS A;  1QVF A;  1B34 B;  4Y91 A;  5GMK m;  3A8H B;  2X4W A;  4IKF A;  2RHU A;  2RK1 A;  3A8G B;  3SWN B;  2OTL T;  1DJ7 B;  4BUG A;  3DB3 A;  4YTL A;  3HRU A;  3OYY A;  4XU3 A;  5D6Y A;  5GAM e;  3LWH A;  1VQL T;  2RB6 A;  5LJ5 j;  3OYC A;  4M78 D;  3RER A;  4F7U A;  2D9T A;  1M9S A;  2JZ2 A;  3A8L B;  4PJO A;  1VQ7 A;  4EMG A;  1N8R U;  4M7A C;  4A4K A;  2JUF A;  3N5B B;  3R6O A;  5J39 A;  4BD3 A;  4C8Q F;  4LDW A;  5FU7 B;  2RI3 A;  4OGE A;  4ZN1 A;  2DAQ A;  2K5L A;  4C92 D;  5FU6 C;  4CI0 C;  5CKF A;  3FJP A;  1VQM T;  4ZTF A;  2QQS A;  2KSS A;  2RHY A;  5L8R E;  3TCJ A;  5GAN 4;  3OYA A;  1S72 T;  3TEE A;  3CCL A;  3PMT A;  2V8I A;  3M4Y A;  1H64 1;  1WJQ A;  3SWN A;  2X35 A;  2E10 A;  3QII A;  3QJY A;  4ME7 A;  4P5N A;  4QVZ A;  1QP2 A;  3QJ6 A;  4C92 C;  3H6Z A;  5CK9 A;  5LJ3 f;  2GQV A;  3J7A F;  2RD1 A;  4OMF B;  5GAO p;  2G3R A;  2LNV A;  3LGF A;  4A4H A;  3S3M A;  1Q86 U;  1NPR A;  2X4Y A;  2XI9 A;  2DTO A;  4LD9 K;  4MZM A;  3RES A;  3V8J A;  1G5V A;  1UGP B;  1WQ7 A;  2E6Z A;  3MET A;  3M55 A;  4M78 B;  4N0A C;  5CAI A;  5LJ3 j;  5DM7 R;  3CME A;  1YJ9 A;  1U8R A;  3CCL T;  3HRT A;  1S72 A;  4JLG A;  5D6X A;  4A4F A;  4JRP A;  3MCA B;  1NPP A;  3J81 E;  4PLI A;  4M7D C;  2E1H A;  3VU3 C;  4JUV A;  1JB0 E;  3PGG A;  2M16 A;  2YRV A;  4QQG A;  5CR2 A;  1TH7 A;  2VXF A;  1Y96 B;  2CGH A;  4TVR A;  2PUK B;  3L2Q A;  5GAN 5;  4V2S A;  2LCL A;  3NTH A;  3LWI A;  3JCM W;  3CBO A;  3GNG A;  3C4S A;  2YHT A;  1I8F A;  1XOV A;  2KMT A;  3MP1 A;  3OYL A;  4NL3 A;  4E7I A;  3QG1 A;  2V8K A;  5GAM f;  2KQW A;  4M78 E;  2DVE A;  2EKO A;  1G3Y A;  2M0O A;  3J80 E;  1M1K U;  4JS5 A;  4J5Y A;  3RKX A;  3T9N A;  5GAO l;  2RI2 A;  3NTK A;  1M5Q 1;  4XQ3 A;  4ZN3 A;  3OSS C;  4BI4 A;  3E19 A;  3QPH A;  4FT2 A;  1VQO A;  1YIT T;  3JCM d;  2RI5 A;  2E41 A;  2VUB A;  4A53 A;  2DD5 A;  1W2B S;  4A4G A;  2GF7 A;  4EMH A;  2OTJ A;  1OI1 A;  3M58 A;  3MEA A;  2E65 A;  1M90 U;  3CC2 T;  2R5A A;  3PNW C;  3CPF A;  3S6W A;  1ZHI A;  3FDR A;  4M75 A;  1VQ9 A;  2E70 A;  2RJF A;  4RCB A;  4M78 A;  3FC3 A;  4C5I A;  2K3Y A;  3OMG A;  3EFR A;  5KE2 A;  3OS1 A;  2LT4 A;  2CZ0 B;  3L1A A;  3LX7 A;  4L59 A;  4IUP A;  5CQX A;  2MMP A;  4XTX A;  2JOY A;  3QUI A;  3JB9 H;  3CXC A;  3CPW A;  1N6A A;  2HQE A;  5D6W A;  3TRE A;  3OYE A;  3CEY A;  2QTX A;  5C0M A;  4IUU A;  2DO3 A;  2RK2 A;  3Q1J A;  4BE2 A;  3CBP A;  4RCC A;  2RJC A;  4DOW A;  1D3B A;  4LDV A;  4C5H A;  1LJO A;  2ZPF B;  5FRM A;  5A0D A;  1OZ2 A;  4LDY A;  1KQ1 A;  2EJF A;  3OB9 A;  3JCM g;  5AYF A;  3VYH B;  4EDU A;  2K57 A;  4KBM B;  3RUX A;  5GMK j;  4C0F A;  1YJ9 T;  3QO3 A;  1K8A C;  2R5M A;  2RM4 A;  1VQK A;  1WNL A;  3MO8 A;  3NFC A;  5DLQ E;  2K5F A;  4BDY A;  3BFM A;  4KUI A;  4VUB A;  2HAX A;  3BDL A;  2BUD A;  4WF2 A;  2YLB A;  3MHX A;  2XHC A;  5IN1 A;  3SDZ A;  1YJN T;  2EYQ A;  2JNG A;  2YLC A;  4C92 B;  2E6N A;  1UGR B;  4RG8 A;  2RHI A;  4M7A G;  1O9S A;  3QYG B;  4C92 E;  4IUQ A;  2EIF A;  2Y4Y A;  3FEO A;  4C0D C;  4D6W A;  3V7S A;  4E47 A;  2DTI A;  4PJO G;  5HK3 A;  5GAO n;  3OYB A;  2XID A;  3V8L A;  3CCS T;  2FVU A;  3A8O B;  2DJZ A;  3L2Z A;  5LJ5 f;  4N0A A;  4LD6 A;  2XIC A;  2D6F A;  4QQD A;  5A0L A;  2LVM A;  5LJ3 g;  2R57 A;  1YIJ T;  2E5Q A;  4J8O A;  2IG0 A;  4XU0 A;  2MF2 A;  3QKJ A;  4JLI A;  4M7D E;  4BI3 A;  1LNX A;  3VV0 A;  1VQ8 T;  1K73 C;  4HCC A;  2RHX A;  4M7D D;  3OW2 S;  2JN0 A;  4J6X A;  4BAC A;  1NJI C;  5FLX E;  2QEX T;  2K4Y A;  3C12 A;  3EAE A;  4C8Q B;  4IUR A;  1K9M C;  2ZPE B;  1BKB A;  3X26 B;  1Y96 A;  4C8Q D;  3CCU A;  5GAM h;  1YI2 A;  5GAN j;  4MDW A;  4DA4 A;  1QW1 A;  4FIB A;  4M7A B;  3H8Z A;  2P0K A;  3M54 A;  1K8A U;  4C92 G;  2FHD A;  2NLU A;  2QQR A;  2GFA A;  4L5G A;  2VYT A;  4M78 F;  1Y7X A;  3RIR A;  1BI1 A;  2DXC A;  4GLK A;  4L6V 5;  5C6S A;  4M75 F;  5GAN 3;  3JB9 G;  1FXX A;  2LTO A;  4JJN K;  1VQN T;  3HHT B;  3LGL A;  3JCM J;  1IRE B;  1KD1 U;  3OBY A;  1NE8 A;  4ATO A;  1BYM A;  3CCJ T;  2KVQ G;  5GAN d;  3L2U A;  3M5A A;  2QQ9 A;  2FB7 A;  4C8Q G;  5GMK l;  4RKU E;  1HK9 A;  1G3S A;  3E9F A;  4XTW A;  3UWN A;  3I56 T;  3JSC A;  2WSF E;  3OMC A;  2ZPI B;  2PU9 B;  5LJ5 d;  3M4G A;  2DKG A;  4M75 D;  2VGN A;  1UGQ B;  3CCR A;  2RA2 A;  2A7Y A;  2DZ9 A;  2CYZ B;  4Y28 E;  2XU8 A;  4PJO F;  2ZPG B;  4PKC C;  2XDD A;  5GAO r;  2MAM A;  4OB2 B;  2RH2 A;  3M9Q A;  2RJE A;  2DEQ A;  1WJS A;  3X28 B;  4MMK A;  3OYM A;  1YHQ A;  1M4Z A;  2L8D A;  4OP0 A;  5EG2 A;  1R8O B;  3JCM f;  2EQJ A;  2JTF A;  2MWO A;  4J6Y A;  3SB2 A;  4F7U E;  4BE1 A;  3CD6 T;  2P0Q A;  5GAN e;  1VQ5 T;  5GMK h;  4FM4 B;  3CMA T;  4M7A F;  1WQW A;  2L5Q A;  3WVD B;  2O4X A;  5GAN g;  1ZQ1 A;  2QA4 A;  2GCX A;  1N9R A;  1Q86 C;  2XD0 A;  4X9D A;  4II1 A;  2HBP A;  4M7A E;  1YIJ A;  1Y07 A;  2VXE A;  4LDX A;  1I4K 1;  3RKW A;  2LX9 A;  2ZGW A;  2H3J A;  2ZCF B;  4M77 A;  1VQP T;  1Q7Y U;  3OYD A;  5KCO A;  2P4T A;  1P92 A;  2DXB A;  2EWN A;  3F70 A;  1VQ8 A;  1AHJ B;  2GFU A;  2PUO B;  3BY7 A;  1U1S A;  1YCY A;  3QZ9 B;  4M77 D;  2MI6 A;  3OQ5 A;  4FSX A;  3CD6 A;  5CKE A;  4UC4 A;  3PMI A;  5J3B A;  1Q82 U;  2EFI A;  1UB4 A;  1KC8 U;  2XG8 D;  4PJO B;  3VYG A;  2O01 E;  1KQS A;  2XDB A;  3G71 A;  1N9S A;  4LDU A;  3L2R A;  4QVC A;  4M77 C;  2C06 A;  3OYJ A;  1KHC A;  1VQO T;  1YIT A;  3OYG A;  1ZBX A;  2VV5 A;  1M1K C;  1XNI A;  1V29 B;  2M1H A;  2PVO B;  3JB9 I;  5I2M A;  5GAO q;  3RMQ A;  1QVG A;  4J7F A;  1VQ9 T;  3I55 T;  4OVA A;  5DY9 A;  3CCQ A;  3C94 A;  3CC7 A;  2O4X B;  4J83 A;  3URG A;  5GAM j;  3CCS A;  1QVG S;  4M7D A;  2ZZD A;  2EQK A;  3HSB A;  5CKH A;  5HKC A;  5LJ3 h;  4N4G A;  4N4H A;  3HFO A;  3M53 A;  3O8V A;  3VUZ A;  4C5G A;  3JCM Q;  3CCR T;  5HK0 A;  1YJW T;  3G71 T;  1I5L A;  4C8Q C;  3I56 A;  4FU6 A;  1WJR A;  4E7J A;  1JJ2 S;  3VUB A;  4F7U F;  5LJ5 e;  2DIG A;  2JTM A;  3E1S A;  5DLO A;  2K5I A;  3G6E A;  5IT9 E;  3MP6 A;  3CMA A;  1M90 C;  4HCB A;  3GF5 A;  5GAN f;  5LJ5 h;  3S3N A;  2L3R A;  5CKD A;  2WSE E;  3M59 A;  4OB0 B;  2A3L A;  3JCM c;  2QEX A;  2D0Q B;  4ZTJ A;  2M9U A;  2PQW A;  1YBY A;  1Q7Y C;  3P8B B;  3OYF A;  2QA4 T;  3DB4 A;  4HT8 A;  3SD4 A;  4OB1 B;  1MHN A;  3X25 B;  1VQK T;  1KG1 A;  4M75 C;  5FU7 C;  2F5K A;  1D3B B;  4PJO C;  4M78 G;  4GY5 A;  3PFS A;  5GAN 6;  2B8A A;  2RJD A;  4KT0 E;  4Z02 A;  5I21 A;  3QYH B;  2QQB A;  2JVV A;  3G6E T;  1VQP A;  1XTD A;  3MEV A;  3P8H A;  3GLX A;  5CIU A;  2EJ9 A;  4ELZ C;  3FB9 A;  1G3T A;  3FLG A;  1X75 C;  2XDP A;  1KC8 C;  4XU2 A;  3UDC A;  4ZGD B;  2FL7 A;  4BB7 A;  5GAN 2;  4XK8 E;  2P0P A;  1PSF A;  1N8R C;  4B9X A;  2BIV A;  3FRN A;  1X01 A;  2DTH A;  4MDX A;  1B34 A;  2E64 A;  1MGQ A;  3QXE B;  3DLL A;  3DLM A;  3OS5 A;  4PLL A;  1VQ6 A;  3CCM T;  4BI8 B;  4C0Z A;  1WGS A;  2QI2 A;  4NOY A;  4EMK C;  1YHQ T;  1X6O A;  3CCV T;  3QZ5 B;  2E12 A;  4F7U B;  3ER0 A;  2DXU A;  3A8M B;  4J7I A;  3BW1 A;  4C5E A;  3KUF A;  2DD4 A;  1LOJ A;  3RMS A;  2LCC A;  2OAU A;  1XQH A;  4EMK A;  2LQK A;  1VUB A;  3G4S T;  5I2S A;  4BDZ A;  3KBG A;  3CCU T;  3MEW A;  4M77 E;  3L42 A;  2QXF A;  3JCM V;  3HL8 A;  4ZGJ B;  1VIE A;  3CCM A;  3PIO A;  4DOV A;  3X20 B;  4XTZ A;  4C92 F;  5LJ3 e;  1KHI A;  3CC4 A;  1PSE A;  2LQ8 A;  3CCJ A;  2CS7 A;  1K73 U;  3RKY A;  5GAM d;  1O75 A;  3JRZ A;  1FWZ A;  4IUT A;  2LDM A;  3V7C A;  1WPY A;  4HA8 A;  2ZPB B;  1VQN A;  2K2V A;  1QP3 A;  1UGS B;  1K9M U;  1Q81 U;  3HRS A;  3LYI A;  4M75 B;  2EQM A;  3OBW A;  3WVE B;  4C8Q A;  2V8J A;  3V7R A;  1BI3 A;  3CCE A;  4JDS A;  4B9W A;  5FRO A;  2RHZ A;  3OSV A;  1I81 A;  3LH0 A;  4X34 A;  3JCM e;  3OS0 A;  4BE0 A;  2XK0 A;  3CXC S;  1FX7 A;  3QDR B;  2DPP B;  3CPW S;  4EPC A;  1BIA A;  3CBM A;  3ZFJ A;  4Q5W A;  5J26 A;  3NTI A;  5GMK e;  2DZC A;  3HPW A;  1BIB A;  3UT1 A;  3EFS A;  4JRQ A;  3JCM P;  3X24 B;  4A54 A;  1VQ5 A;  5KE3 A;  4ELY C;  3GIB A;  5CQY A;  4XTY A;  3I55 A;  1BI0 A;  3CCQ T;  5HY6 A;  2LT1 A;  4O6J A;  1KQS S;  4XTV A;  4DQ2 A;  3UPU A;  2BKD N;  4O5V A;  3JCM b;  1VIF A;  4M77 G;  1RI0 A;  5KH6 A;  2LC4 A;  3VJP A;  1M8V A;  1W4S A;  3HFN A;  3FIF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...