4C0GA

Structure of the not-box domain of human cnot3
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
90
structure length
90
Chain Sequence
TVEFYQRLSTETLFFIFYYLEGTKAQYLAAKALKKQSWRFHTKYMMWFQRHEEPKTITDEFEQGTYIYFDYEKWGQRKKEGFTFEYRYLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure and Assembly of the not Module of the Human Ccr4-not Complex
pubmed doi rcsb
source organism Homo sapiens
molecule tags Gene regulation
molecule keywords CCR4-NOT TRANSCRIPTION COMPLEX SUBUNIT 3
total genus 17
structure length 90
sequence length 90
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2013-08-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.1020 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4c0gA00
4C0DC 5FU7C 4BY6C 5FU6C 4C0FA 5FU7B 4C0GA 5FU6B 4BY6B 4C0DB
chains in the Genus database with same CATH superfamily
3JB9J 4RTTA 2DZCA 3QZ5B 3M53A 2GGRA 1X69A 3CMAT 4KT0E 2ATCB 1M30A 2KEAA 4M7DC 3TREA 4EDUA 3CXCS 2W0ZA 4M78E 2HDAA 2QQBA 5IHKA 1E6HA 2MAMA 3RKYA 3HFNA 5D6WA 3CCQA 3BDUA 2YRCA 3UT1A 2YLBA 3CCLA 1OI1A 3CC4Q 2MMPA 2VUBA 5GAOr 1G2BA 5KYYB 4M7AG 1ZQ1A 2C0TA 3H0IA 3CCSA 2YUPA 1OU9A 4OVAA 5L23A 1KK7A 1EFNA 1SPKA 3PIOA 1VQMQ 4CC7A 2ZPFB 4ZN3A 1VQOQ 3CC7T 4OMPA 1T3SA 2LDMA 1CKBA 4E2FB 3JB9G 1M1KR 4MZPA 4M78G 4E7IA 4C92C 2DRKA 1YJNT 1YIJQ 3MP1A 3JCMX 5D7UA 4EMKA 1Z9ZA 4JRKA 4L6V5 1GBQA 2HBWA 2D8JA 1WZOA 2DVJA 2F2VA 5GAMh 3BDLA 1MMDA 1AWJA 3OYFA 4ME7A 3CD6T 3RERA 2BZ8A 3EGDA 4C0ZA 3G71A 2DILA 1KQSA 2QDLA 3QO3A 3QYHB 4M7AA 2RA2A 1K9AA 1MUZA 1X01A 1K0SA 5KYUA 1VQLA 2KR3A 4PL6A 3CBOA 1BIBA 1BI2A 4XAXB 2OJ2A 2KVQG 3OMGA 1GCQA 2KI7A 2NYSA 4LDXA 3ER0A 4XU0A 3ULRB 2GQIA 2ESWA 1N27A 5GANj 5CCAA 2WSFE 2H3JA 5IHNA 1KHIA 1WA7A 3MEVA 2Y4XA 1WDXA 3SWNA 3KXTA 1R8OB 1M8MA 1C6VX 1H8KA 5DLOA 3RDVA 3UA7A 1SRMA 3VS3A 3CMAQ 2D6FA 2RI5A 2O88A 1AWOA 4EMKC 3SD4A 1IB8A 4IUPA 1VQPA 2GNCA 1YJNA 4A4KA 1BK2A 3EHRA 4O6JA 2A3LA 2CH4A 2J05A 4ATOA 3JCMe 2JZ2A 4A54A 2DIQA 4HT9A 3OYBA 2K7AA 4M7AC 1Y7XA 5LJ3f 3THKA 3QJYA 3IQLA 4Y92A 4D8DA 2X51A 3QSUA 1RAFB 1KQSP 2OTJT 2QQRA 2RQRA 3NMZC 3A8OB 3UDCA 2CUBA 3G4ST 4BE2A 1ZLMA 3CCLT 5KYUB 2YUQA 4PLLA 3CD6Q 2A36A 1R77A 4JS4A 1GCPA 2OTLA 1M1KC 5GAOn 1BIAA 1M2VA 1VQLT 3BW1A 3M5AA 1QWFA 4LUEA 2ZPGB 4AFQC 1YJ9Q 5AYFA 1T3LA 2DNUA 4JJCA 4X34A 3C95A 5LJ3d 3H0FA 3PVLA 3QHSA 2YRVA 4M77A 3A8HB 2FHDA 1OZ2A 2RHZA 2DLPA 2L0AA 2YWWA 1ZA1B 3C4SA 7AT1B 4EIKA 1VQ8Q 1X2KA 2EQKA 3PVQA 4FT2A 1QWEA 2Y4YA 2DFUA 1AVZC 4XTZA 1KD1R 2JUFA 3BY7A 5HCKA 3CCJQ 3M0PA 2FVUA 1M9SA 2PVDB 3PMIA 2DJQA 5GANh 4HXJA 3CCVA 2X4XA 2EQIA 1VOMA 4J6XA 1WLPB 1D0XA 2ZPHB 4N4IA 1WPYA 4C8QF 1Y57A 1G5VA 5GMKi 1LPLA 1FMVA 3GBQA 1XTDA 1WNLA 1M4ZA 2L3RA 1KG1A 5A0GA 2PQWA 5CKEA 2E5QA 4RKUE 1BKBA 4ORZA 3CPWP 4RTVA 1VIEA 3CMEQ 3JCMP 1K1ZA 2DL3A 5A2QE 1VIFA 1U1SA 5GJWB 4IUQA 2KMTA 3CCQT 2EGAA 2DD5A 2RQVA 3UA6A 4C8QD 1EZZB 1KQ2A 2F2WA 5GAN8 2R58A 1Y07A 3JRZA 4UC4A 3HRSA 1RI9A 3MO8A 2GFAA 2CZ7B 4F7UA 4LDWA 4QT7A 3LGFA 1MV0B 1QP3A 3M4YA 3EFRA 3MP8A 2LTOA 1YCSB 5DY9A 1YCYA 1QP2A 3LGLA 2JTEA 1N6AA 5EC7A 2HL5C 1AWWA 1ZSZA 1XQHA 3E9FA 3WVEB 2X35A 4C8QB 1IREB 1U8RA 1VQLQ 5I22A 2OX7A 2FRWA 2E1HA 3L42A 1KHCA 4EMHA 1QW1A 4II1A 4HVUA 1K0XA 3A8MB 3RESA 3I5SA 1KSWA 4J9DA 3GLXA 3PT9A 3FJ5A 2O01E 2X3XD 1TWBA 3OS2A 4RCCA 1D1CA 2B86A 2MPXC 1WFWA 3PIPA 4GLKA 3A8LB 4C0DC 2DK3A 3OSVA 1VQ7A 2E3IA 2E65A 3MHXA 2D0QB 1U3OA 3RKXA 3S3OA 3LH0A 2MI6A 1WGSA 3SHWA 3TVTA 1K73U 3QDRB 2EQUA 4Y28E 1PG5B 2L3QA 4XTYA 2AHJB 1VQPQ 1C1AA 1MMNA 3BFMA 3V7CA 1M2VB 4BE1A 5CKDA 4HVVA 2D9TA 1IRXA 2PU9B 2YLCA 5FRMA 1KQSS 5GANg 2CP3A 2E10A 1I4K1 4M75F 3TEEA 4F7UE 1SG5A 3TCJA 4C8QA 3RR6A 2LNVA 2BE9B 1W6XA 2F69A 3M54A 3I55T 1Q82U 1K4US 3PE0A 5LJ5d 1IO6A 2RQTA 3CCST 2K3YA 3VRYA 3MCAB 2DA9A 1X27A 2YHTA 1UGSB 1ZHIA 5CK9A 2RHYA 2K57A 2F5KA 5KCHA 3PMTA 4M77F 2A0FB 4X9DA 1YN8A 2IIMA 2COYA 3UF4A 4JUVA 1M5Q1 3T9NA 3L1AA 4C5GA 2V8JA 4RTUA 4BI4A 4N4GA 2QTVA 4BY6C 4HCZA 1UGQB 1YP5A 2EQMA 3H0HA 2EQJA 1K76A 3M0SA 1MNDA 2DL5A 2KNBB 3UPUA 2JXBA 1VQ7Q 1UJ0A 4LDVA 4WTOB 2EJFA 2FL7A 2D0NA 1JO8A 1TSFA 1YBYA 1W2BP 1GXIE 1G3YA 2FZKB 1UG1A 4OMQA 8ATCB 1G3TA 2QA4Q 3ZFJA 1XOVA 2YXYA 2AZVA 2NUPA 4C0GA 3OYJA 3MPUB 3X20B 2CH4W 2KXDA 4R55A 1RAEB 1AWXA 2QA4T 1VQ5Q 2QGFB 3HFOA 3OYCA 2EGEA 4KGVB 3MJXA 1WQ7A 1EIFA 4FW2A 2QG9B 1PM3A 1QVPA 4EMKB 1WI7A 4E7KA 4FSSA 2NUZA 1UHCA 2QDYB 4JDSA 4X1VA 1Q86U 3CXCP 4GBQA 3OS1A 3EGDB 2DL4A 1H92A 1K9MU 3RUXA 3TQ7P 3AT1B 3EGUA 1D1BA 1D09B 1B34B 2DAQA 1YJNQ 4LNPA 5M9OA 4PJOE 5IXFA 1MMGA 1VYTA 3KBGA 4O5VA 3VS6A 4BACA 3I56A 4XTXA 4E7SA 1WXBA 4N0AA 1GFCA 4HA8A 5GAN4 2CYZB 1Y71A 3V8LA 5A0DA 1ZA2B 1I5OB 2V1QA 4D6WA 3REAB 1VQ9A 1K73C 4FT4A 3HSBA 5IXBA 5GAOm 3J7AF 4FYWB 4A63B 1MMAA 1RUWA 1K8AC 3S3NA 3OYKA 4QW2A 2CREA 2L8DA 5HY6A 4M77G 4M7DE 1N8RC 1PNJA 2LNHB 1PWTA 2DL7A 2XICA 3LWHA 3CCMA 4PJNA 2HBPA 1EX4A 2NLUA 3I56Q 3GNFB 3JB9I 2XIDA 2KK4A 3OMCA 4M75C 1OV3A 2DERA 4OMFB 2GFUA 1NPRA 1I07A 2FPEA 5GAN6 1N9RA 3OBWA 4J83A 1W2BA 2HKQB 4PJLA 3VRZA 3LWIA 1NG2A 5CKHA 1OYXA 3QUIA 1DJ7B 1QLYA 5CR2A 5LJ5h 1NYFA 3CBPA 3JCMd 1MGQA 2XG8D 4HT8A 2E6NA 1UDLA 5IHIA 2JMAA 1BI0A 2RD1A 2AZSA 3VS4A 2V1RA 4P5NA 3L2WA 4E7HA 2EYXA 4KUIA 1X6BA 2LT4A 5KYXB 2OTJA 1KC8C 5GAOp 3OYIA 1VQ4A 1U1TA 5HK3A 1UGPB 4KGZB 5FWBA 3E9GA 1YITQ 4QQ6A 4QQGA 3CPFA 1ABOA 1VQ4T 3DKMA 1NJIU 3CCMQ 2E70A 1V1CA 1AHJB 3A1PA 4KBMB 2KBTA 1RACB 4CC2A 2E5KA 3M58A 3I56T 2XDBA 3HKSA 5D6YA 2G3RA 2R5AA 2MWPA 2RI3A 3BE3A 3SWNB 1LCKA 3G4SQ 3CCSQ 4M75B 4J9BA 2DETA 4X9CA 3VS1A 1NLOC 4J8OA 2RO0A 1VYUA 1R0BG 1VQMA 1QVGA 1Q95G 3URGA 2DVEA 1NE8A 1SKUB 3NTIA 2EJGA 1X43A 2FPDA 4DEXA 4PJOC 1WYXA 4AG2C 1MHNA 3EFOA 2DPPB 5I21A 2M0YA 1RAHB 1PHTA 3EG3A 3JCMV 1ZBJA 2HSPA 1WQWA 1K8AR 3REBB 3SFMA 2RH2A 2A7YA 2YRDA 4ZTFA 3OBYA 3M9QA 4PJOF 4OB1B 4FM4B 3ZBDA 3M57A 5CQYA 3VV0A 5GAMj 1TUDA 2LCCA 2DMOA 5GANd 2GQVA 3ZEHA 2X4YA 2QGGA 3ME9A 1UGRB 4IIOA 2SRCA 1S72Q 4E7ZA 4C5HA 1TXQA 2RQUA 2PVGB 3CBMA 2JM8A 1ZBXA 1YHQA 3EGXA 1QVGS 2JTMA 3M56A 3JCMQ 2P0PA 4XU1A 5KYYA 4M77D 2OTLT 2CS7A 1VQNA 3CCJA 1K8AU 1ACMB 3HPWA 2L89A 4HCKA 4C8QG 3JCMc 4FSXA 2AKKA 4J7FA 5FW9A 4V2SA 1K9MC 3X28B 1JQQA 1NPPA 4RCBA 1QVFP 1FWZA 1VQ8A 1VQKA 2VGMA 2LJ0A 1QQJA 3GF5A 2OAUA 2HQHA 2DBKA 4E6RA 2CP0A 4PJOA 5GAMd 3WXMB 2H3EB 4PJJA 5C6SA 2XU8A 1M90R 2AK5A 4RMOA 3G6ET 3DLLA 2GF7A 4FYYB 3CC7Q 5CVIA 1RLQC 5GAN5 2O4XB 3S6WA 4L5GA 1QCNA 1G8XA 2LQNA 1QKWA 3META 3CC2A 4XK8E 4M7DG 4DBQA 5KE3A 3HHTB 1H3ZA 2L3SA 1VQNQ 3CCUT 3PGGA 3O8VA 3RBBB 3MKDA 1M90C 4LE9A 3QDFA 3CC4A 2V26A 3NTHA 3I55Q 4FU6A 1YNZA 1VQ9Q 3JCMW 4BB7A 1WJRA 3OS0A 1GFDA 1TH7A 3EFOB 2DE0X 2WSEE 2QK0A 4F16A 3G4SA 3SB2A 4PLIA 2J6KA 2NUPB 3M59A 5FU7B 4QKUA 2LQWA 2E4HA 2G6FX 4DQ2A 4A4FA 3I5RA 1BB9A 1W4SA 4MDXA 3A98A 5A0LA 2VV5A 3C12A 5GAN3 2CP2A 1AZEA 1WX6A 4OMOA 1YWOA 5LJ5e 1IGQA 4FYXB 2O9VA 2D1XA 1QVGP 2LQ8A 4ESRA 2C0OA 3EG9B 1SRLA 5C0MA 4OGEA 1WHMA 2HL3A 3QXEB 1OU8A 3LW5E 1E6GA 1OPKA 2EYYA 3OYEA 3RMSA 2EIFA 2DIGA 3EFSA 5CQXA 2ENMA 3CCVQ 5IT9E 1PC0A 1UECA 4QVDA 2CGHA 4AT1B 1QVFS 5I11A 1UJYA 2FPFA 1KFZA 2RJFA 2QYZA 3MEAA 4R0KA 3SDZA 3LLRA 4M75E 3G6EA 1I5LA 4DOWA 1TOVA 1MV3A 2QEXQ 3JCMh 1JJ2S 1NM7A 4M75D 1OEBA 1BCMA 1NJIC 3N5BB 4AG1C 2VGNA 1H3HA 2CZ1B 4F04B 4E47A 2CP7A 5IH2A 1SSHA 4TVRA 3A5ZB 1JU5C 4NL2A 2HMAA 4IURA 2RB6A 1KIKA 2JOYA 4OB2B 1YHQQ 4J9FA 3TSZA 2QQ9A 4OMLA 1JXMA 4PKCC 2O4XA 2BKDN 2E41A 1GRIA 1JRIA 4C0DB 2X4JA 4M7AD 1ARKA 2VB6A 5IAYA 3CMEA 1YFNA 2R57A 2LX7A 3CCQQ 2K3BA 2LQKA 1P92A 1AT1B 3JCMf 2DF6A 4PJOB 2QXFA 2K3XA 1C0MA 1NJIR 3H6ZA 1LVKA 3HRTA 2ZAEA 3DLMA 1RAGB 4WCIA 3VS7A 4M7DF 2EYQA 2CT4A 2P84A 5KYXA 1M3BA 2VXFA 4PFZA 2P4TA 2PZ1A 2KQWA 1AOJA 2DXBA 2XI9A 4PK4A 1SEMA 4OMMA 2HSEB 2BIVA 5CKBA 3EG1A 8AT1B 3CC7A 1VA7A 2DKGA 2IVWA 1A0NB 4JJNK 5J26A 2CUDA 2HD0A 3QWXX 3M0QA 4JZ4A 3FC3A 2HNIA 2CZ6B 5LJ5f 5LJ3g 5FU7C 4JRIA 2MK5A 1YIJT 1YJWA 1UGVA 2DYIA 1TTHB 2K5FA 2LC4A 2JW4A 2RJCA 3CC2Q 5I2MA 3VS2A 4M75A 3NHNA 2EVRA 1OX8A 2OTLQ 4FYVB 1N8RR 1WXUA 4ANJA 4IIMA 4J7IA 2K4YA 1PSFA 3OA6A 1VQ6Q 4WF2A 4M7DA 4CI0C 3M0TA 3QIIA 4Z88A 2KDSA 1GL5A 3M0RA 3OS5A 3L2UA 2JT4A 2EYWA 4D8KA 2FRYA 1HSQA 2DBMA 3MEWA 4JPBW 2LMJA 2YUOA 2XK0A 1WHJA 4QVCA 1B34A 5KYWA 2EPDA 2LCLA 2M9UA 5IN1A 3E2UA 3P8HA 1YIJA 3WVDB 1HXDA 3OYGA 3QWYA 5LJ5g 5GANe 1Q86R 3KUFA 3E1SA 4M77C 3JCMg 2IG0A 4E7JA 4QQDA 2CKKA 1PRMC 2DRMA 1MNEA 1TU0B 2JM9A 1M8VA 5KYWB 2DZ9A 4BD3A 2BZYA 1ABQA 2PVOB 4PNOA 3MEUA 2XD0A 4BI3A 1QVFA 4M77E 2KT8A 3QJ6A 1NBEB 4DBHA 1BI1A 1QKXA 1LNXA 2DEQA 3OYYA 2MCNA 3EGXB 2ZZDA 5HK0A 3CCET 4MDWA 1QCFA 2KYMA 4RTWA 1X6GA 3CMAA 2L3PA 4J9EA 2QQSA 1ZUKA 4QVZA 4ELYC 3G1JA 1QCOA 4F7UF 5J39A 2GTJA 4Q5WA 1M1GA 4JRPA 5CKFA 1M1FA 1SHFA 2MYSA 4M7DB 1WHHA 1E7OA 4MMLA 1IGUA 1S72A 2C0IA 2E3HA 2L2PA 5FU6B 1WXTA 4J9GA 2LCSA 2ABLA 2ZCFB 4OF1A 1X2QA 2ECZA 5KH6A 2RJEA 1I81A 4IUTA 4ZNXA 4C5EA 2M1HA 1OZ3A 3GIBA 2RPNA 2GBQA 2EBPA 2OTJQ 3G6EQ 1HJDA 1YJWT 4RG2A 3CCEA 1S1NA 4XU3A 1G83A 2WACA 1Y96B 1VQKT 1OOTA 3G7ZA 3DB3A 3H9NA 2YT6A 2E64A 3D7SB 2KRSA 3CCVT 2AT1B 2P0QA 2X4WA 2YSQA 3LX7A 1TS9A 1AEYA 4PFPA 4BUGA 2EFIA 3H8ZA 3ASKA 2H8HA 1PKTA 1PCXA 1WHLA 2KXCA 3GNGA 1RI0A 4RUGA 2KRMA 5L8RE 2J6FA 2JJ9A 1W1FA 1N9SA 2K9GA 2QAZA 3G71Q 2EWNA 4BE0A 4B9WA 1D3BA 5DLQE 3EHQA 3SEMA 1D0ZA 4RTZA 2P0KA 3V8JA 3JCMJ 2K2MA 1Q7YU 2KROA 2YUNA 4KH1B 4XU2A 2W10A 1UUEA 4ZGJB 2DXCA 1OPLA 1IHVA 2DEUA 1M3AA 4MZMA 1Y0MA 4LDYA 5I2SA 1OQKA 2KYBA 1WJQA 1AZGB 3CCUQ 3CPWS 1I1JA 5KYNA 2SEMA 4LXCA 2LZ6B 3EH2A 5GAMe 2RHUA 2FG0A 2V8KA 3OW2S 1R0CB 1SSFA 2MWOA 5FROA 2HAXA 2WSCE 1OULA 1QMCA 3X25B 1V29B 1NEGA 1KC8R 1Q81R 4OMNA 4DA4A 3L2RA 3E19A 2PNIA 1AD5A 2EKOA 3GPLA 1LOJA 2HKNA 2VVKA 1IHWA 1D1AA 2DD4A 3VJPA 1NZ9A 4OB3B 4A53A 1V76A 1N5ZA 4JZ3A 4KH0B 3QPHA 3QBYA 4C8QE 2JN0A 3A8GB 1B07A 1WJSA 2J6OA 4XQ3A 3RKWA 1CSKA 1VQ9T 2O31A 3OYLA 4C5IA 1U06A 2BUDA 2RN8A 5DM7R 1YI2Q 1VQ5T 3CEYA 4FL6A 4KUDK 1LJOA 3CCMT 4M78F 2IPOB 1Q7YC 3O5ZA 1RAIB 3C94A 3X26B 2FO0A 2Z0WA 2X3WD 1ZX6A 4M77B 3FB9A 4F14A 1RL2A 1OX9A 1PD1A 4DEYA 1G3SA 3NTKA 3PFSA 3OYNA 2VC8A 4M75G 1K73R 1T0JA 4K11A 2DTHA 2ZPBB 2M0OA 2X9HA 4M7DD 3VKIA 4EPCA 2KE9A 2FYKA 2GTOA 4C0FA 1ZSZC 2DTOA 3OYMA 1WHGA 2L5QA 2F5TX 1M27C 2C06A 4F7UG 5GAN2 3CCJT 1S72T 3U23A 4J9HA 1XNIA 4JRQA 3PTAA 4J9CA 3DB4A 1J3TA 2DM1A 4J9IA 4KRTA 4J6WA 2NUTB 1M90U 4JS5A 2CDTA 3V7RA 1Q82C 4EMGA 4ZGDB 3TSWA 2A28A 1YHQT 1YJWQ 4PJMA 1VQOT 3LH5A 1JXOA 2MF2A 3FEOA 3QZ9B 2NUTA 2PTKA 3H41A 4JLGA 1B7TA 3I55A 3VS5A 1HK9A 2MIOA 3L2ZA 2QI2A 1PSEA 4F7UB 3OYAA 3RIRA 4F17A 3OYHA 1RLPC 1ZUUA 3RMQA 2K5LA 3LYIA 1JJ2P 3GP8A 4IUUA 5KCOA 4LD9K 3I9QA 1M2OA 3GOXA 3PNWC 2OI3A 3CCRA 5FRNA 2RHXA 3G71T 3EG2A 2KSSA 4ELZC 2RHIA 2XKOC 5CO7A 2FZCB 3P8BB 4PFOA 4R56A 4PJOG 2JS2A 1Y96A 3V8KA 4BI8B 2KGTA 3EAEA 1XJWB 4RG8A 4RTYA 2ZGWA 2RMOA 2EW3A 3NFCA 1I0CA 2LT1A 1BI3A 1UB4A 4HKEA 1Q7YR 1BBZA 2HQXA 5GAMg 2XHCA 4NOYA 3J81E 1T0HA 2BE7D 2A37A 1WIEA 1YJ9A 2XDPA 1UTIA 3EG0A 1VQ5A 2DYBA 2DXTA 5GMKl 2RM4A 1PD0A 4OGCA 4JLIA 2LX9A 1TUGB 1YJ9T 3OW2P 2RI2A 4FCYA 2VYTA 2QEXA 4J5YA 4HVWA 4DBFA 2AKLA 2DXUA 1GCQC 2I2LA 3VYHB 4DOVA 5ECAA 3M55A 4BY6B 2DO3A 4XTWA 4PJOD 2O9SA 1FMWA 4XTUA 2CSQA 5LJ3h 4M78B 2AIRB 1VQ6T 3INZA 3EG9A 3CPWA 1VQ7T 1RADB 4LN2A 3EH1A 1RAAB 1VQ4Q 2VKNA 1KD1C 1NEBA 4M78C 3JCMb 2RF0A 3R6NA 4B6MA 3CD6A 1UE9A 1W70A 5GMKh 1YI2A 1KQ1A 4N4HA 5GANf 3FIFA 1W2BS 2J06A 3VUZA 5LL6S 3P8DA 1VYVA 4M7AB 2M51A 1SHGA 2CP5A 2F2XA 2PUKB 1UFFA 5GAOl 1PKSA 4MZTA 1U5SA 4LUDA 2LJ3A 4L59A 1FMKA 4YTLA 2RK2A 2LJ1A 2LVMA 3HRUA 5EG2A 3JSCA 2K79A 4GY5A 1NLPC 1IZ6A 4MMKA 2Y90A 2COWA 1VQMT 5CAIA 1RABB 4CRIA 1Q81U 3FJPA 3C0CA 2M16A 2V8IA 1WHKA 3QKJA 5LJ3e 2JMCA 4BDZA 1VQPT 4M78A 1UEBA 1M1KU 1YI2T 2B8AA 1ZSZB 1O9SA 1VQ8T 2FZGB 3CC4T 1BU1A 1Q81C 1Q86C 1GBRA 3FRNA 5FU6C 4N0AC 2P4RA 4FW1A 2JVVA 2RJDA 4OB0B 1D0YA 4AMCA 3L2QA 2E6ZA 4Z02A 2LP5A 2D8HA 5GJVB 1KC8U 2KY9A 2M02A 1PRLC 3R6OA 4AFUC 3CC2T 2ED0A 6AT1B 1VQNT 4NL3A 2EJ9A 3MP6A 2KAFA 1YWPA 3CQTA 4HCCA 2E12A 4C8QC 1CKAA 4ZTJA 1VQKQ 2ROLA 2VWFA 4KULA 3S3MA 1YITT 3NPFA 2R5MA 2EKHA 2HZYA 3VUBA 4A4HA 2QA4A 2YDLA 3JV3A 4HCBA 2K5IA 2A08A 4J6YA 4ZN1A 4VUBA 5GAOq 1KJWA 2OAWA 1HYOA 2K2VA 1I8FA 2ZPIB 5LJ5j 5GMKm 2VASA 3NGPA 1N8RU 1K9MR 1D3BB 3UATA 2CSIA 1Q82R 3UWNA 1TG0A 3HP9A 1SF9A 2CT3A 3OW2A 1FX7A 2RQWA 3FDRA 4CC3A 1JJ2A 3CCRQ 2O2OA 4OP0A 5J3BA 3CXCA 3HL8A 3HTRA 2K6DA 4IUVA 3SWNC 3JB9H 4E7LA 3V7SA 3OQ5A 2FB7A 2RNAA 4JJBA 2NWMA 2QASA 1X75C 2BZXA 2HEQA 3VYGA 4C92D 3QG1A 4KGXB 4Z89A 2CZ0B 3OYDA 4B9XA 4M78D 5CIUA 4AFZC 1G3WA 2DJZA 2EGCA 1JEGA 4XTVA 4Z8AA 4C92E 5KE2A 4M7AF 1FYNA 5HKCA 4DBRA 3VS0A 1ZSGA 2QEXT 1NYGA 2JTFA 4LDUA 3OY9A 2F1LA 4BDYA 3ZL7C 2DX1A 1JB0E 2PUOB 2LRQA 4C92B 3M0UA 3F70A 4A4GA 3AHUA 1UHFA 1VUBA 1HD3A 3X24B 2DL8A 2QQAA 1Z9QA 2J7IA 4FIBA 1H641 1X6OA 5GMKe 1TUCA 2CP6A 2JS0A 1IXDA 3JB9D 3JB9F 2QTXA 3VU3C 2EYZA 1O75A 2HQEA 5D6XA 1KD1U 3M4GA 3J80E 1M3CA 2BTTA 3TU4K 2ROTA 3QYGB 4C92G 3I35A 3KFVA 5LJ3j 2KT1A 3JAME 2JNGA 2COZA 3CCRT 4AFSC 4ZGEB 2MOXA 1JBMA 4CC4B 4A4EA 2DTIA 3CCLQ 2VXEA 2GCXA 1VQOA 1ZUYA 3OB9A 1VQ6A 1B3QA 4M4ZA 4IKFA 4Y91A 2RK1A 2XDDA 4NS5A 3OSSC 4LD6A 5GMKj 2FEIA 3FLGA 1F1BB 5GAN7 1YITA 1BCOA 3RNJA 2KRNA 4GLMA 3L2VA 2XMFA 5AT1B 4M7AE 1FXXA 5FWCA 4JJDA 4C92F 3CCEQ 5FLXE 4RTXA 3Q1JA 2I0NA 3CMET 3CCUA 9ATCB 2HCKA 5GAMf 2EAYA 2ZPEB 4C92A 1BYMA 2ED1A
chains in the Genus database with same CATH topology
3JB9J 1S72T 2DZCA 4BI4A 3EFSA 5CQXA 1XNIA 4N4GA 4JRQA 3QZ5B 5IT9E 4BY6C 3PTAA 3M53A 3DB4A 1UGQB 2CGHA 2EQMA 4HCZA 4QVDA 2EQJA 1QVFS 3CMAT 4KT0E 3UPUA 2RJFA 4J6WA 4LDVA 1M90U 2EJFA 4JS5A 3V7RA 1Q82C 4M7DC 3MEAA 3TREA 4EDUA 3SDZA 4EMGA 3LLRA 2FL7A 4ZGDB 3CXCS 4M75E 3G6EA 1I5LA 1YHQT 4M78E 1YBYA 4DOWA 1GXIE 1G3YA 3JCMh 1JJ2S 2QQBA 1VQOT 2MAMA 4M75D 3RKYA 3HFNA 5D6WA 3CCQA 3BDUA 1NJIC 3UT1A 2MF2A 3N5BB 2YLBA 3CCLA 2VGNA 1OI1A 1G3TA 2CZ1B 3FEOA 3ZFJA 3QZ9B 1XOVA 2MMPA 4E47A 2VUBA 4JLGA 4C0GA 5GAOr 3OYJA 3X20B 3I55A 1HK9A 3L2ZA 4TVRA 3A5ZB 2QI2A 4R55A 1PSEA 4F7UB 3OYAA 4M7AG 1ZQ1A 2QA4T 3RIRA 4NL2A 3HFOA 3CCSA 3OYCA 5A0GA 4IURA 1WQ7A 1EIFA 4OVAA 2RB6A 1QVPA 4EMKB 3OYHA 2JOYA 4OB2B 3RMQA 4E7KA 2K5LA 2QQ9A 3PIOA 4PKCC 3LYIA 3GP8A 2O4XA 2BKDN 2E41A 1JRIA 2QDYB 2ZPFB 4IUUA 4JDSA 4C0DB 4ZN3A 5KCOA 2X4JA 1Q86U 3CC7T 4LD9K 4M7AD 3GOXA 3PNWC 3OS1A 5IAYA 3CMEA 2LDMA 3CCRA 3JB9G 5FRNA 4MZPA 2RHXA 4M78G 2R57A 1K9MU 3G71T 4E7IA 2LQKA 3RUXA 4C92C 1P92A 2KSSA 4ELZC 1YJNT 2RHIA 3MP1A 2XKOC 3JCMf 3JCMX 5CO7A 3P8BB 4R56A 4PJOG 4EMKA 1Y96A 4JRKA 2QXFA 2K3XA 4L6V5 3V8KA 4PJOB 4BI8B 3H6ZA 1B34B 2DAQA 3HRTA 3EAEA 3DLMA 4RG8A 5GAMh 3BDLA 5M9OA 4M7DF 2EYQA 3OYFA 4ME7A 3CD6T 3RERA 4PJOE 2ZGWA 4C0ZA 3G71A 3NFCA 2LT1A 1BI3A 1UB4A 1KQSA 4HKEA 2VXFA 3QO3A 3KBGA 3QYHB 4O5VA 2P4TA 4M7AA 4BACA 2RA2A 2KQWA 2DXBA 2HQXA 5GAMg 1X01A 2XI9A 2XHCA 3I56A 4NOYA 3J81E 4XTXA 1VQLA 4N0AA 4HA8A 5GAN4 4PL6A 3CBOA 1YJ9A 2XDPA 1BIBA 1Y71A 2CYZB 1BI2A 3V8LA 2BIVA 4XAXB 2KVQG 5CKBA 1VQ5A 5A0DA 3CC7A 3OMGA 2DKGA 2IVWA 2DXTA 5GMKl 4D6WA 2RM4A 5J26A 4JJNK 1VQ9A 1K73C 4FT4A 2HD0A 4JLIA 4OGCA 2LX9A 4LDXA 3ER0A 5GAOm 1YJ9T 3HSBA 3J7AF 2RI2A 4XU0A 3FC3A 2VYTA 2QEXA 2HNIA 2CZ6B 4J5YA 5LJ5f 1K8AC 5LJ3g 3S3NA 5FU7C 3OYKA 1N27A 4JRIA 5GANj 4QW2A 5CCAA 1YIJT 2WSFE 1YJWA 2H3JA 2K5FA 2LC4A 1KHIA 2L8DA 3MEVA 2DXUA 2RJCA 4M77G 5HY6A 5I2MA 2I2LA 2Y4XA 4M75A 4M7DE 3VYHB 1N8RC 4DOVA 2XICA 3SWNA 3LWHA 3M55A 3KXTA 4BY6B 3CCMA 2DO3A 1R8OB 4XTWA 4PJOD 4XTUA 5LJ3h 4M78B 2HBPA 1VQ6T 3INZA 2NLUA 5DLOA 2DIGA 3CPWA 3GNFB 3JB9I 4J7IA 1VQ7T 2K4YA 1PSFA 3OA6A 2XIDA 2D6FA 4WF2A 2KK4A 3OMCA 2RI5A 4M7DA 4M75C 3QIIA 4CI0C 1KD1C 4EMKC 4F7UG 4M78C 4OMFB 3SD4A 2GFUA 1NPRA 2KDSA 4IUPA 3JCMb 5GAN6 1N9RA 3OBWA 3OS5A 1VQPA 1YJNA 4J83A 4A4KA 1W2BA 3CD6A 3L2UA 4O6JA 2A3LA 4ATOA 3JCMe 3LWIA 2JZ2A 5GMKh 5CKHA 1YI2A 1OYXA 3QUIA 4A54A 1DJ7B 3MEWA 2DIQA 1KQ1A 4N4HA 5CR2A 5GANf 5LJ5h 3OYBA 2XK0A 4HT9A 4M7AC 1Y7XA 3CBPA 3FIFA 5LJ3f 1W2BS 4QVCA 3QJYA 3JCMd 1B34A 1MGQA 5LL6S 3VUZA 2XG8D 4HT8A 2LCLA 2E6NA 2M9UA 5IN1A 3P8HA 3P8DA 1YIJA 4M7AB 1BI0A 2RD1A 3WVDB 1HXDA 3OYGA 2PUKB 4P5NA 3L2WA 5LJ5g 5GANe 5GAOl 4E7HA 3KUFA 4KUIA 3E1SA 4M77C 2LT4A 4MZTA 3QSUA 3JCMg 2IG0A 4E7JA 2OTJA 4QQDA 2OTJT 2QQRA 2CKKA 1KC8C 5GAOp 3OYIA 3A8OB 4L59A 1VQ4A 1U1TA 3UDCA 1M8VA 4YTLA 5HK3A 3G4ST 1UGPB 2DZ9A 2RK2A 4BD3A 2PVOB 4PNOA 4BE2A 3E9GA 2LVMA 3MEUA 3HRUA 2XD0A 4BI3A 4QQ6A 4QQGA 3CPFA 3JSCA 4M77E 5EG2A 3CCLT 1QVFA 4PLLA 3AHUA 3QJ6A 4GY5A 1VQ4T 1IZ6A 4JS4A 3DKMA 4MMKA 1NJIU 2OTLA 1BI1A 2E70A 2Y90A 1M1KC 1VQMT 1AHJB 5CAIA 5GAOn 1BIAA 1LNXA 4CRIA 1Q81U 1VQLT 3FJPA 2DEQA 3OYYA 3BW1A 4KBMB 3M5AA 2ZPGB 5HK0A 2M16A 2ZZDA 3CCET 2V8IA 3QKJA 3M58A 5LJ3e 3I56T 4MDWA 3HKSA 2XDBA 5AYFA 5D6YA 4BDZA 2G3RA 3CMAA 1VQPT 4M78A 2QQSA 4X34A 2R5AA 1UEBA 2MWPA 2RI3A 3C95A 5LJ3d 1M1KU 3SWNB 3QHSA 4QVZA 4ELYC 2YRVA 4M77A 3A8HB 1YI2T 2FHDA 2B8AA 4M75B 1O9SA 4F7UF 1VQ8T 2RHZA 1OZ2A 3CC4T 4X9CA 1Q81C 5J39A 4Q5WA 1M1GA 3C4SA 4JRPA 5CKFA 1Q86C 2EQKA 4FT2A 4J8OA 2Y4YA 3FRNA 1M1FA 2RO0A 4N0AC 5FU6C 2JVVA 2RJDA 4M7DB 4OB0B 4XTZA 1VQMA 3L2QA 2E6ZA 2JUFA 1QVGA 3BY7A 4Z02A 2DVEA 3URGA 1NE8A 1KC8U 3NTIA 4MMLA 2EJGA 1S72A 2KY9A 2FVUA 1M9SA 5FU6B 2PVDB 3PMIA 3R6OA 4PJOC 3CC2T 5GANh 2ZCFB 4OF1A 1MHNA 5KH6A 3CCVA 2X4XA 1VQNT 2RJEA 4NL3A 1I81A 2DPPB 4IUTA 5I21A 2EJ9A 4C5EA 3MP6A 4J6XA 2KAFA 2M1HA 2ZPHB 4N4IA 1OZ3A 1WPYA 3GIBA 4HCCA 4C8QF 2E12A 4C8QC 1G5VA 3JCMV 5GMKi 4ZTJA 1WQWA 1YJWT 4RG2A 3SFMA 3CCEA 4XU3A 2RH2A 2A7YA 4KULA 3S3MA 2WACA 4ZTFA 3OBYA 1YITT 1Y96B 1VQKT 2R5MA 1XTDA 1WNLA 3M9QA 3VUBA 1M4ZA 2L3RA 4PJOF 4A4HA 2QA4A 4OB1B 2PQWA 4FM4B 5CKEA 3ZBDA 3M57A 2E5QA 5CQYA 4RKUE 2K5IA 3G7ZA 3VV0A 5GAMj 4HCBA 1BKBA 2LCCA 3DB3A 4J6YA 4ZN1A 1VIEA 5GANd 2E64A 3JCMP 2GQVA 4VUBA 3ZEHA 5GAOq 5A2QE 2X4YA 3CCVT 2P0QA 2X4WA 3LX7A 3ME9A 1UGRB 1VIFA 1U1SA 4BUGA 2EFIA 2K2VA 4C5HA 4IUQA 2ZPIB 1I8FA 2KMTA 3ASKA 2DD5A 2PVGB 3H8ZA 5LJ5j 3CCQT 3CBMA 5GMKm 1ZBXA 1YHQA 1N8RU 4C8QD 1KQ2A 1D3BB 2JTMA 5GAN8 3GNGA 1RI0A 2R58A 1QVGS 3M56A 1Y07A 3JRZA 4UC4A 2P0PA 5L8RE 4XU1A 3HP9A 3UWNA 3JCMQ 3HRSA 3MO8A 2GFAA 2CZ7B 4F7UA 3OW2A 1N9SA 4LDWA 1FX7A 3LGFA 4M77D 3FDRA 1QP3A 2EWNA 1JJ2A 2OTLT 2CS7A 3M4YA 3EFRA 3MP8A 4OP0A 4BE0A 1VQNA 2LTOA 3CCJA 5DY9A 1YCYA 1QP2A 3LGLA 5J3BA 4B9WA 3CXCA 1N6AA 1D3BA 3HL8A 5DLQE 1K8AU 3HPWA 1XQHA 2L89A 3E9FA 4IUVA 4C8QG 3JCMc 3WVEB 2X35A 4C8QB 1IREB 2P0KA 1U8RA 3SWNC 3V8JA 3JCMJ 3JB9H 4E7LA 3V7SA 4FSXA 4J7FA 4V2SA 3OQ5A 1Q7YU 2FB7A 2E1HA 1K9MC 3X28B 3L42A 1NPPA 4RCBA 1KHCA 1FWZA 1VQ8A 1VQKA 2VGMA 4EMHA 3GF5A 1X75C 4XU2A 2OAUA 3VYGA 1QW1A 2DXCA 3QG1A 4C92D 4ZGJB 2CZ0B 3OYDA 4II1A 4B9XA 3A8MB 4MZMA 3RESA 4M78D 5CIUA 2DJZA 1G3WA 4PJOA 4LDYA 5GAMd 4XTVA 3WXMB 5I2SA 4C92E 5C6SA 1WJQA 5KE2A 2XU8A 4M7AF 3GLXA 3CPWS 3PT9A 5HKCA 4RMOA 2O01E 3OS2A 5GAMe 4RCCA 2RHUA 3G6ET 2QEXT 2JTFA 4LDUA 3OY9A 2V8KA 3DLLA 4BDYA 2GF7A 3PIPA 1JB0E 5CVIA 2PUOB 4GLKA 3OW2S 1SSFA 2MWOA 2LRQA 4C92B 3F70A 5FROA 4A4GA 5GAN5 2HAXA 2O4XB 3S6WA 2WSCE 4L5GA 3X25B 1VUBA 1V29B 3A8LB 4C0DC 4DA4A 2DK3A 3X24B 3L2RA 3META 3E19A 3OSVA 3CC2A 2EKOA 2QQAA 4XK8E 3GPLA 4M7DG 1LOJA 1VQ7A 4FIBA 1H641 5KE3A 3HHTB 1H3ZA 2DD4A 2E65A 3VJPA 3MHXA 1X6OA 2D0QB 5GAN2 1NZ9A 3RKXA 4OB3B 4A53A 3S3OA 3LH0A 5GMKe 3PGGA 3O8VA 2MI6A 1WGSA 3CCUT 1M90C 1K73U 3QDRB 2EQUA 3QPHA 3QBYA 4Y28E 4C8QE 3CC4A 2JN0A 3A8GB 4XTYA 1KG1A 2AHJB 3JB9D 3NTHA 4FU6A 3JB9F 2QTXA 3VU3C 3JCMW 1O75A 2HQEA 5D6XA 1KD1U 1WJSA 3M4GA 4XQ3A 3RKWA 4BB7A 3BFMA 3J80E 1VQ9T 3OYLA 1WJRA 4C5IA 3OS0A 3TU4K 3V7CA 1TH7A 2BUDA 4BE1A 3QYGB 5DM7R 5CKDA 2WSEE 1VQ5T 2D9TA 4C92G 3CEYA 4FL6A 2PU9B 2YLCA 5FRMA 4KUDK 1LJOA 1KQSS 5LJ3j 3JAME 5GANg 2E10A 3CCMT 3G4SA 2JNGA 3SB2A 3CCRT 4PLIA 4M78F 4ZGEB 1I4K1 4M75F 3TEEA 1JBMA 2V8JA 4F7UE 1Q7YC 3M59A 5FU7B 2DTIA 3TCJA 2LNVA 4A4EA 4C8QA 2VXEA 2F69A 2GCXA 3C94A 1VQOA 3M54A 4DQ2A 3OB9A 4A4FA 3X26B 1VQ6A 3I55T 4M77B 1Q82U 1W4SA 3FB9A 4IKFA 4Y91A 2RK1A 2XDDA 4MDXA 4NS5A 1RL2A 3OSSC 5LJ5d 5A0LA 4LD6A 5GMKj 3FLGA 2VV5A 3CCST 2K3YA 3C12A 3MCAB 1G3SA 2YHTA 3NTKA 1UGSB 1ZHIA 3PFSA 5GAN7 2VC8A 5GAN3 5CK9A 3OYNA 1YITA 2RHYA 4M75G 2K57A 5LJ5e 2DTHA 2ZPBB 2M0OA 4M7DD 3L2VA 2F5KA 3VKIA 4EPCA 2FYKA 4M7AE 1FXXA 5KCHA 4C0FA 3CCJT 3PMTA 2LQ8A 4C92F 4M77F 5FLXE 2DTOA 5C0MA 4OGEA 3Q1JA 4X9DA 3OYMA 3CMET 2L5QA 3CCUA 3QXEB 4JUVA 1M5Q1 2F5TX 3T9NA 5GAMf 2EAYA 2ZPEB 3L1AA 4C92A 3LW5E 2C06A 4C5GA 1BYMA 3OYEA 3RMSA 2EIFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4C0D C;  5FU7 C;  4BY6 C;  5FU6 C;  4C0F A;  5FU7 B;  4C0G A;  5FU6 B;  4BY6 B;  4C0D B; 
#chains in the Genus database with same CATH topology
 3JB9 J;  4RTT A;  2DZC A;  3QZ5 B;  3M53 A;  2GGR A;  1X69 A;  3CMA T;  4KT0 E;  2ATC B;  1M30 A;  2KEA A;  4M7D C;  3TRE A;  4EDU A;  3CXC S;  2W0Z A;  4M78 E;  2HDA A;  2QQB A;  5IHK A;  1E6H A;  2MAM A;  3RKY A;  3HFN A;  5D6W A;  3CCQ A;  3BDU A;  2YRC A;  3UT1 A;  2YLB A;  3CCL A;  1OI1 A;  3CC4 Q;  2MMP A;  2VUB A;  5GAO r;  1G2B A;  5KYY B;  4M7A G;  1ZQ1 A;  2C0T A;  3H0I A;  3CCS A;  2YUP A;  1OU9 A;  4OVA A;  5L23 A;  1KK7 A;  1EFN A;  1SPK A;  3PIO A;  1VQM Q;  4CC7 A;  2ZPF B;  4ZN3 A;  1VQO Q;  3CC7 T;  4OMP A;  1T3S A;  2LDM A;  1CKB A;  4E2F B;  3JB9 G;  1M1K R;  4MZP A;  4M78 G;  4E7I A;  4C92 C;  2DRK A;  1YJN T;  1YIJ Q;  3MP1 A;  3JCM X;  5D7U A;  4EMK A;  1Z9Z A;  4JRK A;  4L6V 5;  1GBQ A;  2HBW A;  2D8J A;  1WZO A;  2DVJ A;  2F2V A;  5GAM h;  3BDL A;  1MMD A;  1AWJ A;  3OYF A;  4ME7 A;  3CD6 T;  3RER A;  2BZ8 A;  3EGD A;  4C0Z A;  3G71 A;  2DIL A;  1KQS A;  2QDL A;  3QO3 A;  3QYH B;  4M7A A;  2RA2 A;  1K9A A;  1MUZ A;  1X01 A;  1K0S A;  5KYU A;  1VQL A;  2KR3 A;  4PL6 A;  3CBO A;  1BIB A;  1BI2 A;  4XAX B;  2OJ2 A;  2KVQ G;  3OMG A;  1GCQ A;  2KI7 A;  2NYS A;  4LDX A;  3ER0 A;  4XU0 A;  3ULR B;  2GQI A;  2ESW A;  1N27 A;  5GAN j;  5CCA A;  2WSF E;  2H3J A;  5IHN A;  1KHI A;  1WA7 A;  3MEV A;  2Y4X A;  1WDX A;  3SWN A;  3KXT A;  1R8O B;  1M8M A;  1C6V X;  1H8K A;  5DLO A;  3RDV A;  3UA7 A;  1SRM A;  3VS3 A;  3CMA Q;  2D6F A;  2RI5 A;  2O88 A;  1AWO A;  4EMK C;  3SD4 A;  1IB8 A;  4IUP A;  1VQP A;  2GNC A;  1YJN A;  4A4K A;  1BK2 A;  3EHR A;  4O6J A;  2A3L A;  2CH4 A;  2J05 A;  4ATO A;  3JCM e;  2JZ2 A;  4A54 A;  2DIQ A;  4HT9 A;  3OYB A;  2K7A A;  4M7A C;  1Y7X A;  5LJ3 f;  3THK A;  3QJY A;  3IQL A;  4Y92 A;  4D8D A;  2X51 A;  3QSU A;  1RAF B;  1KQS P;  2OTJ T;  2QQR A;  2RQR A;  3NMZ C;  3A8O B;  3UDC A;  2CUB A;  3G4S T;  4BE2 A;  1ZLM A;  3CCL T;  5KYU B;  2YUQ A;  4PLL A;  3CD6 Q;  2A36 A;  1R77 A;  4JS4 A;  1GCP A;  2OTL A;  1M1K C;  5GAO n;  1BIA A;  1M2V A;  1VQL T;  3BW1 A;  3M5A A;  1QWF A;  4LUE A;  2ZPG B;  4AFQ C;  1YJ9 Q;  5AYF A;  1T3L A;  2DNU A;  4JJC A;  4X34 A;  3C95 A;  5LJ3 d;  3H0F A;  3PVL A;  3QHS A;  2YRV A;  4M77 A;  3A8H B;  2FHD A;  1OZ2 A;  2RHZ A;  2DLP A;  2L0A A;  2YWW A;  1ZA1 B;  3C4S A;  7AT1 B;  4EIK A;  1VQ8 Q;  1X2K A;  2EQK A;  3PVQ A;  4FT2 A;  1QWE A;  2Y4Y A;  2DFU A;  1AVZ C;  4XTZ A;  1KD1 R;  2JUF A;  3BY7 A;  5HCK A;  3CCJ Q;  3M0P A;  2FVU A;  1M9S A;  2PVD B;  3PMI A;  2DJQ A;  5GAN h;  4HXJ A;  3CCV A;  2X4X A;  2EQI A;  1VOM A;  4J6X A;  1WLP B;  1D0X A;  2ZPH B;  4N4I A;  1WPY A;  4C8Q F;  1Y57 A;  1G5V A;  5GMK i;  1LPL A;  1FMV A;  3GBQ A;  1XTD A;  1WNL A;  1M4Z A;  2L3R A;  1KG1 A;  5A0G A;  2PQW A;  5CKE A;  2E5Q A;  4RKU E;  1BKB A;  4ORZ A;  3CPW P;  4RTV A;  1VIE A;  3CME Q;  3JCM P;  1K1Z A;  2DL3 A;  5A2Q E;  1VIF A;  1U1S A;  5GJW B;  4IUQ A;  2KMT A;  3CCQ T;  2EGA A;  2DD5 A;  2RQV A;  3UA6 A;  4C8Q D;  1EZZ B;  1KQ2 A;  2F2W A;  5GAN 8;  2R58 A;  1Y07 A;  3JRZ A;  4UC4 A;  3HRS A;  1RI9 A;  3MO8 A;  2GFA A;  2CZ7 B;  4F7U A;  4LDW A;  4QT7 A;  3LGF A;  1MV0 B;  1QP3 A;  3M4Y A;  3EFR A;  3MP8 A;  2LTO A;  1YCS B;  5DY9 A;  1YCY A;  1QP2 A;  3LGL A;  2JTE A;  1N6A A;  5EC7 A;  2HL5 C;  1AWW A;  1ZSZ A;  1XQH A;  3E9F A;  3WVE B;  2X35 A;  4C8Q B;  1IRE B;  1U8R A;  1VQL Q;  5I22 A;  2OX7 A;  2FRW A;  2E1H A;  3L42 A;  1KHC A;  4EMH A;  1QW1 A;  4II1 A;  4HVU A;  1K0X A;  3A8M B;  3RES A;  3I5S A;  1KSW A;  4J9D A;  3GLX A;  3PT9 A;  3FJ5 A;  2O01 E;  2X3X D;  1TWB A;  3OS2 A;  4RCC A;  1D1C A;  2B86 A;  2MPX C;  1WFW A;  3PIP A;  4GLK A;  3A8L B;  4C0D C;  2DK3 A;  3OSV A;  1VQ7 A;  2E3I A;  2E65 A;  3MHX A;  2D0Q B;  1U3O A;  3RKX A;  3S3O A;  3LH0 A;  2MI6 A;  1WGS A;  3SHW A;  3TVT A;  1K73 U;  3QDR B;  2EQU A;  4Y28 E;  1PG5 B;  2L3Q A;  4XTY A;  2AHJ B;  1VQP Q;  1C1A A;  1MMN A;  3BFM A;  3V7C A;  1M2V B;  4BE1 A;  5CKD A;  4HVV A;  2D9T A;  1IRX A;  2PU9 B;  2YLC A;  5FRM A;  1KQS S;  5GAN g;  2CP3 A;  2E10 A;  1I4K 1;  4M75 F;  3TEE A;  4F7U E;  1SG5 A;  3TCJ A;  4C8Q A;  3RR6 A;  2LNV A;  2BE9 B;  1W6X A;  2F69 A;  3M54 A;  3I55 T;  1Q82 U;  1K4U S;  3PE0 A;  5LJ5 d;  1IO6 A;  2RQT A;  3CCS T;  2K3Y A;  3VRY A;  3MCA B;  2DA9 A;  1X27 A;  2YHT A;  1UGS B;  1ZHI A;  5CK9 A;  2RHY A;  2K57 A;  2F5K A;  5KCH A;  3PMT A;  4M77 F;  2A0F B;  4X9D A;  1YN8 A;  2IIM A;  2COY A;  3UF4 A;  4JUV A;  1M5Q 1;  3T9N A;  3L1A A;  4C5G A;  2V8J A;  4RTU A;  4BI4 A;  4N4G A;  2QTV A;  4BY6 C;  4HCZ A;  1UGQ B;  1YP5 A;  2EQM A;  3H0H A;  2EQJ A;  1K76 A;  3M0S A;  1MND A;  2DL5 A;  2KNB B;  3UPU A;  2JXB A;  1VQ7 Q;  1UJ0 A;  4LDV A;  4WTO B;  2EJF A;  2FL7 A;  2D0N A;  1JO8 A;  1TSF A;  1YBY A;  1W2B P;  1GXI E;  1G3Y A;  2FZK B;  1UG1 A;  4OMQ A;  8ATC B;  1G3T A;  2QA4 Q;  3ZFJ A;  1XOV A;  2YXY A;  2AZV A;  2NUP A;  4C0G A;  3OYJ A;  3MPU B;  3X20 B;  2CH4 W;  2KXD A;  4R55 A;  1RAE B;  1AWX A;  2QA4 T;  1VQ5 Q;  2QGF B;  3HFO A;  3OYC A;  2EGE A;  4KGV B;  3MJX A;  1WQ7 A;  1EIF A;  4FW2 A;  2QG9 B;  1PM3 A;  1QVP A;  4EMK B;  1WI7 A;  4E7K A;  4FSS A;  2NUZ A;  1UHC A;  2QDY B;  4JDS A;  4X1V A;  1Q86 U;  3CXC P;  4GBQ A;  3OS1 A;  3EGD B;  2DL4 A;  1H92 A;  1K9M U;  3RUX A;  3TQ7 P;  3AT1 B;  3EGU A;  1D1B A;  1D09 B;  1B34 B;  2DAQ A;  1YJN Q;  4LNP A;  5M9O A;  4PJO E;  5IXF A;  1MMG A;  1VYT A;  3KBG A;  4O5V A;  3VS6 A;  4BAC A;  3I56 A;  4XTX A;  4E7S A;  1WXB A;  4N0A A;  1GFC A;  4HA8 A;  5GAN 4;  2CYZ B;  1Y71 A;  3V8L A;  5A0D A;  1ZA2 B;  1I5O B;  2V1Q A;  4D6W A;  3REA B;  1VQ9 A;  1K73 C;  4FT4 A;  3HSB A;  5IXB A;  5GAO m;  3J7A F;  4FYW B;  4A63 B;  1MMA A;  1RUW A;  1K8A C;  3S3N A;  3OYK A;  4QW2 A;  2CRE A;  2L8D A;  5HY6 A;  4M77 G;  4M7D E;  1N8R C;  1PNJ A;  2LNH B;  1PWT A;  2DL7 A;  2XIC A;  3LWH A;  3CCM A;  4PJN A;  2HBP A;  1EX4 A;  2NLU A;  3I56 Q;  3GNF B;  3JB9 I;  2XID A;  2KK4 A;  3OMC A;  4M75 C;  1OV3 A;  2DER A;  4OMF B;  2GFU A;  1NPR A;  1I07 A;  2FPE A;  5GAN 6;  1N9R A;  3OBW A;  4J83 A;  1W2B A;  2HKQ B;  4PJL A;  3VRZ A;  3LWI A;  1NG2 A;  5CKH A;  1OYX A;  3QUI A;  1DJ7 B;  1QLY A;  5CR2 A;  5LJ5 h;  1NYF A;  3CBP A;  3JCM d;  1MGQ A;  2XG8 D;  4HT8 A;  2E6N A;  1UDL A;  5IHI A;  2JMA A;  1BI0 A;  2RD1 A;  2AZS A;  3VS4 A;  2V1R A;  4P5N A;  3L2W A;  4E7H A;  2EYX A;  4KUI A;  1X6B A;  2LT4 A;  5KYX B;  2OTJ A;  1KC8 C;  5GAO p;  3OYI A;  1VQ4 A;  1U1T A;  5HK3 A;  1UGP B;  4KGZ B;  5FWB A;  3E9G A;  1YIT Q;  4QQ6 A;  4QQG A;  3CPF A;  1ABO A;  1VQ4 T;  3DKM A;  1NJI U;  3CCM Q;  2E70 A;  1V1C A;  1AHJ B;  3A1P A;  4KBM B;  2KBT A;  1RAC B;  4CC2 A;  2E5K A;  3M58 A;  3I56 T;  2XDB A;  3HKS A;  5D6Y A;  2G3R A;  2R5A A;  2MWP A;  2RI3 A;  3BE3 A;  3SWN B;  1LCK A;  3G4S Q;  3CCS Q;  4M75 B;  4J9B A;  2DET A;  4X9C A;  3VS1 A;  1NLO C;  4J8O A;  2RO0 A;  1VYU A;  1R0B G;  1VQM A;  1QVG A;  1Q95 G;  3URG A;  2DVE A;  1NE8 A;  1SKU B;  3NTI A;  2EJG A;  1X43 A;  2FPD A;  4DEX A;  4PJO C;  1WYX A;  4AG2 C;  1MHN A;  3EFO A;  2DPP B;  5I21 A;  2M0Y A;  1RAH B;  1PHT A;  3EG3 A;  3JCM V;  1ZBJ A;  2HSP A;  1WQW A;  1K8A R;  3REB B;  3SFM A;  2RH2 A;  2A7Y A;  2YRD A;  4ZTF A;  3OBY A;  3M9Q A;  4PJO F;  4OB1 B;  4FM4 B;  3ZBD A;  3M57 A;  5CQY A;  3VV0 A;  5GAM j;  1TUD A;  2LCC A;  2DMO A;  5GAN d;  2GQV A;  3ZEH A;  2X4Y A;  2QGG A;  3ME9 A;  1UGR B;  4IIO A;  2SRC A;  1S72 Q;  4E7Z A;  4C5H A;  1TXQ A;  2RQU A;  2PVG B;  3CBM A;  2JM8 A;  1ZBX A;  1YHQ A;  3EGX A;  1QVG S;  2JTM A;  3M56 A;  3JCM Q;  2P0P A;  4XU1 A;  5KYY A;  4M77 D;  2OTL T;  2CS7 A;  1VQN A;  3CCJ A;  1K8A U;  1ACM B;  3HPW A;  2L89 A;  4HCK A;  4C8Q G;  3JCM c;  4FSX A;  2AKK A;  4J7F A;  5FW9 A;  4V2S A;  1K9M C;  3X28 B;  1JQQ A;  1NPP A;  4RCB A;  1QVF P;  1FWZ A;  1VQ8 A;  1VQK A;  2VGM A;  2LJ0 A;  1QQJ A;  3GF5 A;  2OAU A;  2HQH A;  2DBK A;  4E6R A;  2CP0 A;  4PJO A;  5GAM d;  3WXM B;  2H3E B;  4PJJ A;  5C6S A;  2XU8 A;  1M90 R;  2AK5 A;  4RMO A;  3G6E T;  3DLL A;  2GF7 A;  4FYY B;  3CC7 Q;  5CVI A;  1RLQ C;  5GAN 5;  2O4X B;  3S6W A;  4L5G A;  1QCN A;  1G8X A;  2LQN A;  1QKW A;  3MET A;  3CC2 A;  4XK8 E;  4M7D G;  4DBQ A;  5KE3 A;  3HHT B;  1H3Z A;  2L3S A;  1VQN Q;  3CCU T;  3PGG A;  3O8V A;  3RBB B;  3MKD A;  1M90 C;  4LE9 A;  3QDF A;  3CC4 A;  2V26 A;  3NTH A;  3I55 Q;  4FU6 A;  1YNZ A;  1VQ9 Q;  3JCM W;  4BB7 A;  1WJR A;  3OS0 A;  1GFD A;  1TH7 A;  3EFO B;  2DE0 X;  2WSE E;  2QK0 A;  4F16 A;  3G4S A;  3SB2 A;  4PLI A;  2J6K A;  2NUP B;  3M59 A;  5FU7 B;  4QKU A;  2LQW A;  2E4H A;  2G6F X;  4DQ2 A;  4A4F A;  3I5R A;  1BB9 A;  1W4S A;  4MDX A;  3A98 A;  5A0L A;  2VV5 A;  3C12 A;  5GAN 3;  2CP2 A;  1AZE A;  1WX6 A;  4OMO A;  1YWO A;  5LJ5 e;  1IGQ A;  4FYX B;  2O9V A;  2D1X A;  1QVG P;  2LQ8 A;  4ESR A;  2C0O A;  3EG9 B;  1SRL A;  5C0M A;  4OGE A;  1WHM A;  2HL3 A;  3QXE B;  1OU8 A;  3LW5 E;  1E6G A;  1OPK A;  2EYY A;  3OYE A;  3RMS A;  2EIF A;  2DIG A;  3EFS A;  5CQX A;  2ENM A;  3CCV Q;  5IT9 E;  1PC0 A;  1UEC A;  4QVD A;  2CGH A;  4AT1 B;  1QVF S;  5I11 A;  1UJY A;  2FPF A;  1KFZ A;  2RJF A;  2QYZ A;  3MEA A;  4R0K A;  3SDZ A;  3LLR A;  4M75 E;  3G6E A;  1I5L A;  4DOW A;  1TOV A;  1MV3 A;  2QEX Q;  3JCM h;  1JJ2 S;  1NM7 A;  4M75 D;  1OEB A;  1BCM A;  1NJI C;  3N5B B;  4AG1 C;  2VGN A;  1H3H A;  2CZ1 B;  4F04 B;  4E47 A;  2CP7 A;  5IH2 A;  1SSH A;  4TVR A;  3A5Z B;  1JU5 C;  4NL2 A;  2HMA A;  4IUR A;  2RB6 A;  1KIK A;  2JOY A;  4OB2 B;  1YHQ Q;  4J9F A;  3TSZ A;  2QQ9 A;  4OML A;  1JXM A;  4PKC C;  2O4X A;  2BKD N;  2E41 A;  1GRI A;  1JRI A;  4C0D B;  2X4J A;  4M7A D;  1ARK A;  2VB6 A;  5IAY A;  3CME A;  1YFN A;  2R57 A;  2LX7 A;  3CCQ Q;  2K3B A;  2LQK A;  1P92 A;  1AT1 B;  3JCM f;  2DF6 A;  4PJO B;  2QXF A;  2K3X A;  1C0M A;  1NJI R;  3H6Z A;  1LVK A;  3HRT A;  2ZAE A;  3DLM A;  1RAG B;  4WCI A;  3VS7 A;  4M7D F;  2EYQ A;  2CT4 A;  2P84 A;  5KYX A;  1M3B A;  2VXF A;  4PFZ A;  2P4T A;  2PZ1 A;  2KQW A;  1AOJ A;  2DXB A;  2XI9 A;  4PK4 A;  1SEM A;  4OMM A;  2HSE B;  2BIV A;  5CKB A;  3EG1 A;  8AT1 B;  3CC7 A;  1VA7 A;  2DKG A;  2IVW A;  1A0N B;  4JJN K;  5J26 A;  2CUD A;  2HD0 A;  3QWX X;  3M0Q A;  4JZ4 A;  3FC3 A;  2HNI A;  2CZ6 B;  5LJ5 f;  5LJ3 g;  5FU7 C;  4JRI A;  2MK5 A;  1YIJ T;  1YJW A;  1UGV A;  2DYI A;  1TTH B;  2K5F A;  2LC4 A;  2JW4 A;  2RJC A;  3CC2 Q;  5I2M A;  3VS2 A;  4M75 A;  3NHN A;  2EVR A;  1OX8 A;  2OTL Q;  4FYV B;  1N8R R;  1WXU A;  4ANJ A;  4IIM A;  4J7I A;  2K4Y A;  1PSF A;  3OA6 A;  1VQ6 Q;  4WF2 A;  4M7D A;  4CI0 C;  3M0T A;  3QII A;  4Z88 A;  2KDS A;  1GL5 A;  3M0R A;  3OS5 A;  3L2U A;  2JT4 A;  2EYW A;  4D8K A;  2FRY A;  1HSQ A;  2DBM A;  3MEW A;  4JPB W;  2LMJ A;  2YUO A;  2XK0 A;  1WHJ A;  4QVC A;  1B34 A;  5KYW A;  2EPD A;  2LCL A;  2M9U A;  5IN1 A;  3E2U A;  3P8H A;  1YIJ A;  3WVD B;  1HXD A;  3OYG A;  3QWY A;  5LJ5 g;  5GAN e;  1Q86 R;  3KUF A;  3E1S A;  4M77 C;  3JCM g;  2IG0 A;  4E7J A;  4QQD A;  2CKK A;  1PRM C;  2DRM A;  1MNE A;  1TU0 B;  2JM9 A;  1M8V A;  5KYW B;  2DZ9 A;  4BD3 A;  2BZY A;  1ABQ A;  2PVO B;  4PNO A;  3MEU A;  2XD0 A;  4BI3 A;  1QVF A;  4M77 E;  2KT8 A;  3QJ6 A;  1NBE B;  4DBH A;  1BI1 A;  1QKX A;  1LNX A;  2DEQ A;  3OYY A;  2MCN A;  3EGX B;  2ZZD A;  5HK0 A;  3CCE T;  4MDW A;  1QCF A;  2KYM A;  4RTW A;  1X6G A;  3CMA A;  2L3P A;  4J9E A;  2QQS A;  1ZUK A;  4QVZ A;  4ELY C;  3G1J A;  1QCO A;  4F7U F;  5J39 A;  2GTJ A;  4Q5W A;  1M1G A;  4JRP A;  5CKF A;  1M1F A;  1SHF A;  2MYS A;  4M7D B;  1WHH A;  1E7O A;  4MML A;  1IGU A;  1S72 A;  2C0I A;  2E3H A;  2L2P A;  5FU6 B;  1WXT A;  4J9G A;  2LCS A;  2ABL A;  2ZCF B;  4OF1 A;  1X2Q A;  2ECZ A;  5KH6 A;  2RJE A;  1I81 A;  4IUT A;  4ZNX A;  4C5E A;  2M1H A;  1OZ3 A;  3GIB A;  2RPN A;  2GBQ A;  2EBP A;  2OTJ Q;  3G6E Q;  1HJD A;  1YJW T;  4RG2 A;  3CCE A;  1S1N A;  4XU3 A;  1G83 A;  2WAC A;  1Y96 B;  1VQK T;  1OOT A;  3G7Z A;  3DB3 A;  3H9N A;  2YT6 A;  2E64 A;  3D7S B;  2KRS A;  3CCV T;  2AT1 B;  2P0Q A;  2X4W A;  2YSQ A;  3LX7 A;  1TS9 A;  1AEY A;  4PFP A;  4BUG A;  2EFI A;  3H8Z A;  3ASK A;  2H8H A;  1PKT A;  1PCX A;  1WHL A;  2KXC A;  3GNG A;  1RI0 A;  4RUG A;  2KRM A;  5L8R E;  2J6F A;  2JJ9 A;  1W1F A;  1N9S A;  2K9G A;  2QAZ A;  3G71 Q;  2EWN A;  4BE0 A;  4B9W A;  1D3B A;  5DLQ E;  3EHQ A;  3SEM A;  1D0Z A;  4RTZ A;  2P0K A;  3V8J A;  3JCM J;  2K2M A;  1Q7Y U;  2KRO A;  2YUN A;  4KH1 B;  4XU2 A;  2W10 A;  1UUE A;  4ZGJ B;  2DXC A;  1OPL A;  1IHV A;  2DEU A;  1M3A A;  4MZM A;  1Y0M A;  4LDY A;  5I2S A;  1OQK A;  2KYB A;  1WJQ A;  1AZG B;  3CCU Q;  3CPW S;  1I1J A;  5KYN A;  2SEM A;  4LXC A;  2LZ6 B;  3EH2 A;  5GAM e;  2RHU A;  2FG0 A;  2V8K A;  3OW2 S;  1R0C B;  1SSF A;  2MWO A;  5FRO A;  2HAX A;  2WSC E;  1OUL A;  1QMC A;  3X25 B;  1V29 B;  1NEG A;  1KC8 R;  1Q81 R;  4OMN A;  4DA4 A;  3L2R A;  3E19 A;  2PNI A;  1AD5 A;  2EKO A;  3GPL A;  1LOJ A;  2HKN A;  2VVK A;  1IHW A;  1D1A A;  2DD4 A;  3VJP A;  1NZ9 A;  4OB3 B;  4A53 A;  1V76 A;  1N5Z A;  4JZ3 A;  4KH0 B;  3QPH A;  3QBY A;  4C8Q E;  2JN0 A;  3A8G B;  1B07 A;  1WJS A;  2J6O A;  4XQ3 A;  3RKW A;  1CSK A;  1VQ9 T;  2O31 A;  3OYL A;  4C5I A;  1U06 A;  2BUD A;  2RN8 A;  5DM7 R;  1YI2 Q;  1VQ5 T;  3CEY A;  4FL6 A;  4KUD K;  1LJO A;  3CCM T;  4M78 F;  2IPO B;  1Q7Y C;  3O5Z A;  1RAI B;  3C94 A;  3X26 B;  2FO0 A;  2Z0W A;  2X3W D;  1ZX6 A;  4M77 B;  3FB9 A;  4F14 A;  1RL2 A;  1OX9 A;  1PD1 A;  4DEY A;  1G3S A;  3NTK A;  3PFS A;  3OYN A;  2VC8 A;  4M75 G;  1K73 R;  1T0J A;  4K11 A;  2DTH A;  2ZPB B;  2M0O A;  2X9H A;  4M7D D;  3VKI A;  4EPC A;  2KE9 A;  2FYK A;  2GTO A;  4C0F A;  1ZSZ C;  2DTO A;  3OYM A;  1WHG A;  2L5Q A;  2F5T X;  1M27 C;  2C06 A;  4F7U G;  5GAN 2;  3CCJ T;  1S72 T;  3U23 A;  4J9H A;  1XNI A;  4JRQ A;  3PTA A;  4J9C A;  3DB4 A;  1J3T A;  2DM1 A;  4J9I A;  4KRT A;  4J6W A;  2NUT B;  1M90 U;  4JS5 A;  2CDT A;  3V7R A;  1Q82 C;  4EMG A;  4ZGD B;  3TSW A;  2A28 A;  1YHQ T;  1YJW Q;  4PJM A;  1VQO T;  3LH5 A;  1JXO A;  2MF2 A;  3FEO A;  3QZ9 B;  2NUT A;  2PTK A;  3H41 A;  4JLG A;  1B7T A;  3I55 A;  3VS5 A;  1HK9 A;  2MIO A;  3L2Z A;  2QI2 A;  1PSE A;  4F7U B;  3OYA A;  3RIR A;  4F17 A;  3OYH A;  1RLP C;  1ZUU A;  3RMQ A;  2K5L A;  3LYI A;  1JJ2 P;  3GP8 A;  4IUU A;  5KCO A;  4LD9 K;  3I9Q A;  1M2O A;  3GOX A;  3PNW C;  2OI3 A;  3CCR A;  5FRN A;  2RHX A;  3G71 T;  3EG2 A;  2KSS A;  4ELZ C;  2RHI A;  2XKO C;  5CO7 A;  2FZC B;  3P8B B;  4PFO A;  4R56 A;  4PJO G;  2JS2 A;  1Y96 A;  3V8K A;  4BI8 B;  2KGT A;  3EAE A;  1XJW B;  4RG8 A;  4RTY A;  2ZGW A;  2RMO A;  2EW3 A;  3NFC A;  1I0C A;  2LT1 A;  1BI3 A;  1UB4 A;  4HKE A;  1Q7Y R;  1BBZ A;  2HQX A;  5GAM g;  2XHC A;  4NOY A;  3J81 E;  1T0H A;  2BE7 D;  2A37 A;  1WIE A;  1YJ9 A;  2XDP A;  1UTI A;  3EG0 A;  1VQ5 A;  2DYB A;  2DXT A;  5GMK l;  2RM4 A;  1PD0 A;  4OGC A;  4JLI A;  2LX9 A;  1TUG B;  1YJ9 T;  3OW2 P;  2RI2 A;  4FCY A;  2VYT A;  2QEX A;  4J5Y A;  4HVW A;  4DBF A;  2AKL A;  2DXU A;  1GCQ C;  2I2L A;  3VYH B;  4DOV A;  5ECA A;  3M55 A;  4BY6 B;  2DO3 A;  4XTW A;  4PJO D;  2O9S A;  1FMW A;  4XTU A;  2CSQ A;  5LJ3 h;  4M78 B;  2AIR B;  1VQ6 T;  3INZ A;  3EG9 A;  3CPW A;  1VQ7 T;  1RAD B;  4LN2 A;  3EH1 A;  1RAA B;  1VQ4 Q;  2VKN A;  1KD1 C;  1NEB A;  4M78 C;  3JCM b;  2RF0 A;  3R6N A;  4B6M A;  3CD6 A;  1UE9 A;  1W70 A;  5GMK h;  1YI2 A;  1KQ1 A;  4N4H A;  5GAN f;  3FIF A;  1W2B S;  2J06 A;  3VUZ A;  5LL6 S;  3P8D A;  1VYV A;  4M7A B;  2M51 A;  1SHG A;  2CP5 A;  2F2X A;  2PUK B;  1UFF A;  5GAO l;  1PKS A;  4MZT A;  1U5S A;  4LUD A;  2LJ3 A;  4L59 A;  1FMK A;  4YTL A;  2RK2 A;  2LJ1 A;  2LVM A;  3HRU A;  5EG2 A;  3JSC A;  2K79 A;  4GY5 A;  1NLP C;  1IZ6 A;  4MMK A;  2Y90 A;  2COW A;  1VQM T;  5CAI A;  1RAB B;  4CRI A;  1Q81 U;  3FJP A;  3C0C A;  2M16 A;  2V8I A;  1WHK A;  3QKJ A;  5LJ3 e;  2JMC A;  4BDZ A;  1VQP T;  4M78 A;  1UEB A;  1M1K U;  1YI2 T;  2B8A A;  1ZSZ B;  1O9S A;  1VQ8 T;  2FZG B;  3CC4 T;  1BU1 A;  1Q81 C;  1Q86 C;  1GBR A;  3FRN A;  5FU6 C;  4N0A C;  2P4R A;  4FW1 A;  2JVV A;  2RJD A;  4OB0 B;  1D0Y A;  4AMC A;  3L2Q A;  2E6Z A;  4Z02 A;  2LP5 A;  2D8H A;  5GJV B;  1KC8 U;  2KY9 A;  2M02 A;  1PRL C;  3R6O A;  4AFU C;  3CC2 T;  2ED0 A;  6AT1 B;  1VQN T;  4NL3 A;  2EJ9 A;  3MP6 A;  2KAF A;  1YWP A;  3CQT A;  4HCC A;  2E12 A;  4C8Q C;  1CKA A;  4ZTJ A;  1VQK Q;  2ROL A;  2VWF A;  4KUL A;  3S3M A;  1YIT T;  3NPF A;  2R5M A;  2EKH A;  2HZY A;  3VUB A;  4A4H A;  2QA4 A;  2YDL A;  3JV3 A;  4HCB A;  2K5I A;  2A08 A;  4J6Y A;  4ZN1 A;  4VUB A;  5GAO q;  1KJW A;  2OAW A;  1HYO A;  2K2V A;  1I8F A;  2ZPI B;  5LJ5 j;  5GMK m;  2VAS A;  3NGP A;  1N8R U;  1K9M R;  1D3B B;  3UAT A;  2CSI A;  1Q82 R;  3UWN A;  1TG0 A;  3HP9 A;  1SF9 A;  2CT3 A;  3OW2 A;  1FX7 A;  2RQW A;  3FDR A;  4CC3 A;  1JJ2 A;  3CCR Q;  2O2O A;  4OP0 A;  5J3B A;  3CXC A;  3HL8 A;  3HTR A;  2K6D A;  4IUV A;  3SWN C;  3JB9 H;  4E7L A;  3V7S A;  3OQ5 A;  2FB7 A;  2RNA A;  4JJB A;  2NWM A;  2QAS A;  1X75 C;  2BZX A;  2HEQ A;  3VYG A;  4C92 D;  3QG1 A;  4KGX B;  4Z89 A;  2CZ0 B;  3OYD A;  4B9X A;  4M78 D;  5CIU A;  4AFZ C;  1G3W A;  2DJZ A;  2EGC A;  1JEG A;  4XTV A;  4Z8A A;  4C92 E;  5KE2 A;  4M7A F;  1FYN A;  5HKC A;  4DBR A;  3VS0 A;  1ZSG A;  2QEX T;  1NYG A;  2JTF A;  4LDU A;  3OY9 A;  2F1L A;  4BDY A;  3ZL7 C;  2DX1 A;  1JB0 E;  2PUO B;  2LRQ A;  4C92 B;  3M0U A;  3F70 A;  4A4G A;  3AHU A;  1UHF A;  1VUB A;  1HD3 A;  3X24 B;  2DL8 A;  2QQA A;  1Z9Q A;  2J7I A;  4FIB A;  1H64 1;  1X6O A;  5GMK e;  1TUC A;  2CP6 A;  2JS0 A;  1IXD A;  3JB9 D;  3JB9 F;  2QTX A;  3VU3 C;  2EYZ A;  1O75 A;  2HQE A;  5D6X A;  1KD1 U;  3M4G A;  3J80 E;  1M3C A;  2BTT A;  3TU4 K;  2ROT A;  3QYG B;  4C92 G;  3I35 A;  3KFV A;  5LJ3 j;  2KT1 A;  3JAM E;  2JNG A;  2COZ A;  3CCR T;  4AFS C;  4ZGE B;  2MOX A;  1JBM A;  4CC4 B;  4A4E A;  2DTI A;  3CCL Q;  2VXE A;  2GCX A;  1VQO A;  1ZUY A;  3OB9 A;  1VQ6 A;  1B3Q A;  4M4Z A;  4IKF A;  4Y91 A;  2RK1 A;  2XDD A;  4NS5 A;  3OSS C;  4LD6 A;  5GMK j;  2FEI A;  3FLG A;  1F1B B;  5GAN 7;  1YIT A;  1BCO A;  3RNJ A;  2KRN A;  4GLM A;  3L2V A;  2XMF A;  5AT1 B;  4M7A E;  1FXX A;  5FWC A;  4JJD A;  4C92 F;  3CCE Q;  5FLX E;  4RTX A;  3Q1J A;  2I0N A;  3CME T;  3CCU A;  9ATC B;  2HCK A;  5GAM f;  2EAY A;  2ZPE B;  4C92 A;  1BYM A;  2ED1 A; 
#chains in the Genus database with same CATH homology
 3JB9 J;  1S72 T;  2DZC A;  4BI4 A;  3EFS A;  5CQX A;  1XNI A;  4N4G A;  4JRQ A;  3QZ5 B;  5IT9 E;  4BY6 C;  3PTA A;  3M53 A;  3DB4 A;  1UGQ B;  2CGH A;  2EQM A;  4HCZ A;  4QVD A;  2EQJ A;  1QVF S;  3CMA T;  4KT0 E;  3UPU A;  2RJF A;  4J6W A;  4LDV A;  1M90 U;  2EJF A;  4JS5 A;  3V7R A;  1Q82 C;  4M7D C;  3MEA A;  3TRE A;  4EDU A;  3SDZ A;  4EMG A;  3LLR A;  2FL7 A;  4ZGD B;  3CXC S;  4M75 E;  3G6E A;  1I5L A;  1YHQ T;  4M78 E;  1YBY A;  4DOW A;  1GXI E;  1G3Y A;  3JCM h;  1JJ2 S;  2QQB A;  1VQO T;  2MAM A;  4M75 D;  3RKY A;  3HFN A;  5D6W A;  3CCQ A;  3BDU A;  1NJI C;  3UT1 A;  2MF2 A;  3N5B B;  2YLB A;  3CCL A;  2VGN A;  1OI1 A;  1G3T A;  2CZ1 B;  3FEO A;  3ZFJ A;  3QZ9 B;  1XOV A;  2MMP A;  4E47 A;  2VUB A;  4JLG A;  4C0G A;  5GAO r;  3OYJ A;  3X20 B;  3I55 A;  1HK9 A;  3L2Z A;  4TVR A;  3A5Z B;  2QI2 A;  4R55 A;  1PSE A;  4F7U B;  3OYA A;  4M7A G;  1ZQ1 A;  2QA4 T;  3RIR A;  4NL2 A;  3HFO A;  3CCS A;  3OYC A;  5A0G A;  4IUR A;  1WQ7 A;  1EIF A;  4OVA A;  2RB6 A;  1QVP A;  4EMK B;  3OYH A;  2JOY A;  4OB2 B;  3RMQ A;  4E7K A;  2K5L A;  2QQ9 A;  3PIO A;  4PKC C;  3LYI A;  3GP8 A;  2O4X A;  2BKD N;  2E41 A;  1JRI A;  2QDY B;  2ZPF B;  4IUU A;  4JDS A;  4C0D B;  4ZN3 A;  5KCO A;  2X4J A;  1Q86 U;  3CC7 T;  4LD9 K;  4M7A D;  3GOX A;  3PNW C;  3OS1 A;  5IAY A;  3CME A;  2LDM A;  3CCR A;  3JB9 G;  5FRN A;  4MZP A;  2RHX A;  4M78 G;  2R57 A;  1K9M U;  3G71 T;  4E7I A;  2LQK A;  3RUX A;  4C92 C;  1P92 A;  2KSS A;  4ELZ C;  1YJN T;  2RHI A;  3MP1 A;  2XKO C;  3JCM f;  3JCM X;  5CO7 A;  3P8B B;  4R56 A;  4PJO G;  4EMK A;  1Y96 A;  4JRK A;  2QXF A;  2K3X A;  4L6V 5;  3V8K A;  4PJO B;  4BI8 B;  3H6Z A;  1B34 B;  2DAQ A;  3HRT A;  3EAE A;  3DLM A;  4RG8 A;  5GAM h;  3BDL A;  5M9O A;  4M7D F;  2EYQ A;  3OYF A;  4ME7 A;  3CD6 T;  3RER A;  4PJO E;  2ZGW A;  4C0Z A;  3G71 A;  3NFC A;  2LT1 A;  1BI3 A;  1UB4 A;  1KQS A;  4HKE A;  2VXF A;  3QO3 A;  3KBG A;  3QYH B;  4O5V A;  2P4T A;  4M7A A;  4BAC A;  2RA2 A;  2KQW A;  2DXB A;  2HQX A;  5GAM g;  1X01 A;  2XI9 A;  2XHC A;  3I56 A;  4NOY A;  3J81 E;  4XTX A;  1VQL A;  4N0A A;  4HA8 A;  5GAN 4;  4PL6 A;  3CBO A;  1YJ9 A;  2XDP A;  1BIB A;  1Y71 A;  2CYZ B;  1BI2 A;  3V8L A;  2BIV A;  4XAX B;  2KVQ G;  5CKB A;  1VQ5 A;  5A0D A;  3CC7 A;  3OMG A;  2DKG A;  2IVW A;  2DXT A;  5GMK l;  4D6W A;  2RM4 A;  5J26 A;  4JJN K;  1VQ9 A;  1K73 C;  4FT4 A;  2HD0 A;  4JLI A;  4OGC A;  2LX9 A;  4LDX A;  3ER0 A;  5GAO m;  1YJ9 T;  3HSB A;  3J7A F;  2RI2 A;  4XU0 A;  3FC3 A;  2VYT A;  2QEX A;  2HNI A;  2CZ6 B;  4J5Y A;  5LJ5 f;  1K8A C;  5LJ3 g;  3S3N A;  5FU7 C;  3OYK A;  1N27 A;  4JRI A;  5GAN j;  4QW2 A;  5CCA A;  1YIJ T;  2WSF E;  1YJW A;  2H3J A;  2K5F A;  2LC4 A;  1KHI A;  2L8D A;  3MEV A;  2DXU A;  2RJC A;  4M77 G;  5HY6 A;  5I2M A;  2I2L A;  2Y4X A;  4M75 A;  4M7D E;  3VYH B;  1N8R C;  4DOV A;  2XIC A;  3SWN A;  3LWH A;  3M55 A;  3KXT A;  4BY6 B;  3CCM A;  2DO3 A;  1R8O B;  4XTW A;  4PJO D;  4XTU A;  5LJ3 h;  4M78 B;  2HBP A;  1VQ6 T;  3INZ A;  2NLU A;  5DLO A;  2DIG A;  3CPW A;  3GNF B;  3JB9 I;  4J7I A;  1VQ7 T;  2K4Y A;  1PSF A;  3OA6 A;  2XID A;  2D6F A;  4WF2 A;  2KK4 A;  3OMC A;  2RI5 A;  4M7D A;  4M75 C;  3QII A;  4CI0 C;  1KD1 C;  4EMK C;  4F7U G;  4M78 C;  4OMF B;  3SD4 A;  2GFU A;  1NPR A;  2KDS A;  4IUP A;  3JCM b;  5GAN 6;  1N9R A;  3OBW A;  3OS5 A;  1VQP A;  1YJN A;  4J83 A;  4A4K A;  1W2B A;  3CD6 A;  3L2U A;  4O6J A;  2A3L A;  4ATO A;  3JCM e;  3LWI A;  2JZ2 A;  5GMK h;  5CKH A;  1YI2 A;  1OYX A;  3QUI A;  4A54 A;  1DJ7 B;  3MEW A;  2DIQ A;  1KQ1 A;  4N4H A;  5CR2 A;  5GAN f;  5LJ5 h;  3OYB A;  2XK0 A;  4HT9 A;  4M7A C;  1Y7X A;  3CBP A;  3FIF A;  5LJ3 f;  1W2B S;  4QVC A;  3QJY A;  3JCM d;  1B34 A;  1MGQ A;  5LL6 S;  3VUZ A;  2XG8 D;  4HT8 A;  2LCL A;  2E6N A;  2M9U A;  5IN1 A;  3P8H A;  3P8D A;  1YIJ A;  4M7A B;  1BI0 A;  2RD1 A;  3WVD B;  1HXD A;  3OYG A;  2PUK B;  4P5N A;  3L2W A;  5LJ5 g;  5GAN e;  5GAO l;  4E7H A;  3KUF A;  4KUI A;  3E1S A;  4M77 C;  2LT4 A;  4MZT A;  3QSU A;  3JCM g;  2IG0 A;  4E7J A;  2OTJ A;  4QQD A;  2OTJ T;  2QQR A;  2CKK A;  1KC8 C;  5GAO p;  3OYI A;  3A8O B;  4L59 A;  1VQ4 A;  1U1T A;  3UDC A;  1M8V A;  4YTL A;  5HK3 A;  3G4S T;  1UGP B;  2DZ9 A;  2RK2 A;  4BD3 A;  2PVO B;  4PNO A;  4BE2 A;  3E9G A;  2LVM A;  3MEU A;  3HRU A;  2XD0 A;  4BI3 A;  4QQ6 A;  4QQG A;  3CPF A;  3JSC A;  4M77 E;  5EG2 A;  3CCL T;  1QVF A;  4PLL A;  3AHU A;  3QJ6 A;  4GY5 A;  1VQ4 T;  1IZ6 A;  4JS4 A;  3DKM A;  4MMK A;  1NJI U;  2OTL A;  1BI1 A;  2E70 A;  2Y90 A;  1M1K C;  1VQM T;  1AHJ B;  5CAI A;  5GAO n;  1BIA A;  1LNX A;  4CRI A;  1Q81 U;  1VQL T;  3FJP A;  2DEQ A;  3OYY A;  3BW1 A;  4KBM B;  3M5A A;  2ZPG B;  5HK0 A;  2M16 A;  2ZZD A;  3CCE T;  2V8I A;  3QKJ A;  3M58 A;  5LJ3 e;  3I56 T;  4MDW A;  3HKS A;  2XDB A;  5AYF A;  5D6Y A;  4BDZ A;  2G3R A;  3CMA A;  1VQP T;  4M78 A;  2QQS A;  4X34 A;  2R5A A;  1UEB A;  2MWP A;  2RI3 A;  3C95 A;  5LJ3 d;  1M1K U;  3SWN B;  3QHS A;  4QVZ A;  4ELY C;  2YRV A;  4M77 A;  3A8H B;  1YI2 T;  2FHD A;  2B8A A;  4M75 B;  1O9S A;  4F7U F;  1VQ8 T;  2RHZ A;  1OZ2 A;  3CC4 T;  4X9C A;  1Q81 C;  5J39 A;  4Q5W A;  1M1G A;  3C4S A;  4JRP A;  5CKF A;  1Q86 C;  2EQK A;  4FT2 A;  4J8O A;  2Y4Y A;  3FRN A;  1M1F A;  2RO0 A;  4N0A C;  5FU6 C;  2JVV A;  2RJD A;  4M7D B;  4OB0 B;  4XTZ A;  1VQM A;  3L2Q A;  2E6Z A;  2JUF A;  1QVG A;  3BY7 A;  4Z02 A;  2DVE A;  3URG A;  1NE8 A;  1KC8 U;  3NTI A;  4MML A;  2EJG A;  1S72 A;  2KY9 A;  2FVU A;  1M9S A;  5FU6 B;  2PVD B;  3PMI A;  3R6O A;  4PJO C;  3CC2 T;  5GAN h;  2ZCF B;  4OF1 A;  1MHN A;  5KH6 A;  3CCV A;  2X4X A;  1VQN T;  2RJE A;  4NL3 A;  1I81 A;  2DPP B;  4IUT A;  5I21 A;  2EJ9 A;  4C5E A;  3MP6 A;  4J6X A;  2KAF A;  2M1H A;  2ZPH B;  4N4I A;  1OZ3 A;  1WPY A;  3GIB A;  4HCC A;  4C8Q F;  2E12 A;  4C8Q C;  1G5V A;  3JCM V;  5GMK i;  4ZTJ A;  1WQW A;  1YJW T;  4RG2 A;  3SFM A;  3CCE A;  4XU3 A;  2RH2 A;  2A7Y A;  4KUL A;  3S3M A;  2WAC A;  4ZTF A;  3OBY A;  1YIT T;  1Y96 B;  1VQK T;  2R5M A;  1XTD A;  1WNL A;  3M9Q A;  3VUB A;  1M4Z A;  2L3R A;  4PJO F;  4A4H A;  2QA4 A;  4OB1 B;  2PQW A;  4FM4 B;  5CKE A;  3ZBD A;  3M57 A;  2E5Q A;  5CQY A;  4RKU E;  2K5I A;  3G7Z A;  3VV0 A;  5GAM j;  4HCB A;  1BKB A;  2LCC A;  3DB3 A;  4J6Y A;  4ZN1 A;  1VIE A;  5GAN d;  2E64 A;  3JCM P;  2GQV A;  4VUB A;  3ZEH A;  5GAO q;  5A2Q E;  2X4Y A;  3CCV T;  2P0Q A;  2X4W A;  3LX7 A;  3ME9 A;  1UGR B;  1VIF A;  1U1S A;  4BUG A;  2EFI A;  2K2V A;  4C5H A;  4IUQ A;  2ZPI B;  1I8F A;  2KMT A;  3ASK A;  2DD5 A;  2PVG B;  3H8Z A;  5LJ5 j;  3CCQ T;  3CBM A;  5GMK m;  1ZBX A;  1YHQ A;  1N8R U;  4C8Q D;  1KQ2 A;  1D3B B;  2JTM A;  5GAN 8;  3GNG A;  1RI0 A;  2R58 A;  1QVG S;  3M56 A;  1Y07 A;  3JRZ A;  4UC4 A;  2P0P A;  5L8R E;  4XU1 A;  3HP9 A;  3UWN A;  3JCM Q;  3HRS A;  3MO8 A;  2GFA A;  2CZ7 B;  4F7U A;  3OW2 A;  1N9S A;  4LDW A;  1FX7 A;  3LGF A;  4M77 D;  3FDR A;  1QP3 A;  2EWN A;  1JJ2 A;  2OTL T;  2CS7 A;  3M4Y A;  3EFR A;  3MP8 A;  4OP0 A;  4BE0 A;  1VQN A;  2LTO A;  3CCJ A;  5DY9 A;  1YCY A;  1QP2 A;  3LGL A;  5J3B A;  4B9W A;  3CXC A;  1N6A A;  1D3B A;  3HL8 A;  5DLQ E;  1K8A U;  3HPW A;  1XQH A;  2L89 A;  3E9F A;  4IUV A;  4C8Q G;  3JCM c;  3WVE B;  2X35 A;  4C8Q B;  1IRE B;  2P0K A;  1U8R A;  3SWN C;  3V8J A;  3JCM J;  3JB9 H;  4E7L A;  3V7S A;  4FSX A;  4J7F A;  4V2S A;  3OQ5 A;  1Q7Y U;  2FB7 A;  2E1H A;  1K9M C;  3X28 B;  3L42 A;  1NPP A;  4RCB A;  1KHC A;  1FWZ A;  1VQ8 A;  1VQK A;  2VGM A;  4EMH A;  3GF5 A;  1X75 C;  4XU2 A;  2OAU A;  3VYG A;  1QW1 A;  2DXC A;  3QG1 A;  4C92 D;  4ZGJ B;  2CZ0 B;  3OYD A;  4II1 A;  4B9X A;  3A8M B;  4MZM A;  3RES A;  4M78 D;  5CIU A;  2DJZ A;  1G3W A;  4PJO A;  4LDY A;  5GAM d;  4XTV A;  3WXM B;  5I2S A;  4C92 E;  5C6S A;  1WJQ A;  5KE2 A;  2XU8 A;  4M7A F;  3GLX A;  3CPW S;  3PT9 A;  5HKC A;  4RMO A;  2O01 E;  3OS2 A;  5GAM e;  4RCC A;  2RHU A;  3G6E T;  2QEX T;  2JTF A;  4LDU A;  3OY9 A;  2V8K A;  3DLL A;  4BDY A;  2GF7 A;  3PIP A;  1JB0 E;  5CVI A;  2PUO B;  4GLK A;  3OW2 S;  1SSF A;  2MWO A;  2LRQ A;  4C92 B;  3F70 A;  5FRO A;  4A4G A;  5GAN 5;  2HAX A;  2O4X B;  3S6W A;  2WSC E;  4L5G A;  3X25 B;  1VUB A;  1V29 B;  3A8L B;  4C0D C;  4DA4 A;  2DK3 A;  3X24 B;  3L2R A;  3MET A;  3E19 A;  3OSV A;  3CC2 A;  2EKO A;  2QQA A;  4XK8 E;  3GPL A;  4M7D G;  1LOJ A;  1VQ7 A;  4FIB A;  1H64 1;  5KE3 A;  3HHT B;  1H3Z A;  2DD4 A;  2E65 A;  3VJP A;  3MHX A;  1X6O A;  2D0Q B;  5GAN 2;  1NZ9 A;  3RKX A;  4OB3 B;  4A53 A;  3S3O A;  3LH0 A;  5GMK e;  3PGG A;  3O8V A;  2MI6 A;  1WGS A;  3CCU T;  1M90 C;  1K73 U;  3QDR B;  2EQU A;  3QPH A;  3QBY A;  4Y28 E;  4C8Q E;  3CC4 A;  2JN0 A;  3A8G B;  4XTY A;  1KG1 A;  2AHJ B;  3JB9 D;  3NTH A;  4FU6 A;  3JB9 F;  2QTX A;  3VU3 C;  3JCM W;  1O75 A;  2HQE A;  5D6X A;  1KD1 U;  1WJS A;  3M4G A;  4XQ3 A;  3RKW A;  4BB7 A;  3BFM A;  3J80 E;  1VQ9 T;  3OYL A;  1WJR A;  4C5I A;  3OS0 A;  3TU4 K;  3V7C A;  1TH7 A;  2BUD A;  4BE1 A;  3QYG B;  5DM7 R;  5CKD A;  2WSE E;  1VQ5 T;  2D9T A;  4C92 G;  3CEY A;  4FL6 A;  2PU9 B;  2YLC A;  5FRM A;  4KUD K;  1LJO A;  1KQS S;  5LJ3 j;  3JAM E;  5GAN g;  2E10 A;  3CCM T;  3G4S A;  2JNG A;  3SB2 A;  3CCR T;  4PLI A;  4M78 F;  4ZGE B;  1I4K 1;  4M75 F;  3TEE A;  1JBM A;  2V8J A;  4F7U E;  1Q7Y C;  3M59 A;  5FU7 B;  2DTI A;  3TCJ A;  2LNV A;  4A4E A;  4C8Q A;  2VXE A;  2F69 A;  2GCX A;  3C94 A;  1VQO A;  3M54 A;  4DQ2 A;  3OB9 A;  4A4F A;  3X26 B;  1VQ6 A;  3I55 T;  4M77 B;  1Q82 U;  1W4S A;  3FB9 A;  4IKF A;  4Y91 A;  2RK1 A;  2XDD A;  4MDX A;  4NS5 A;  1RL2 A;  3OSS C;  5LJ5 d;  5A0L A;  4LD6 A;  5GMK j;  3FLG A;  2VV5 A;  3CCS T;  2K3Y A;  3C12 A;  3MCA B;  1G3S A;  2YHT A;  3NTK A;  1UGS B;  1ZHI A;  3PFS A;  5GAN 7;  2VC8 A;  5GAN 3;  5CK9 A;  3OYN A;  1YIT A;  2RHY A;  4M75 G;  2K57 A;  5LJ5 e;  2DTH A;  2ZPB B;  2M0O A;  4M7D D;  3L2V A;  2F5K A;  3VKI A;  4EPC A;  2FYK A;  4M7A E;  1FXX A;  5KCH A;  4C0F A;  3CCJ T;  3PMT A;  2LQ8 A;  4C92 F;  4M77 F;  5FLX E;  2DTO A;  5C0M A;  4OGE A;  3Q1J A;  4X9D A;  3OYM A;  3CME T;  2L5Q A;  3CCU A;  3QXE B;  4JUV A;  1M5Q 1;  2F5T X;  3T9N A;  5GAM f;  2EAY A;  2ZPE B;  3L1A A;  4C92 A;  3LW5 E;  2C06 A;  4C5G A;  1BYM A;  3OYE A;  3RMS A;  2EIF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...