4C0GA

Structure of the not-box domain of human cnot3
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
90
structure length
90
Chain Sequence
TVEFYQRLSTETLFFIFYYLEGTKAQYLAAKALKKQSWRFHTKYMMWFQRHEEPKTITDEFEQGTYIYFDYEKWGQRKKEGFTFEYRYLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords CCR4-NOT TRANSCRIPTION COMPLEX SUBUNIT 3
publication title Structure and Assembly of the not Module of the Human Ccr4-not Complex
pubmed doi rcsb
source organism Homo sapiens
molecule tags Gene regulation
total genus 17
structure length 90
sequence length 90
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2013-08-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.1020 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4c0gA00
5FU7B 4BY6B 5FU6C 4C0FA 4C0DB 5FU7C 5FU6B 4C0GA 4BY6C 4C0DC
chains in the Genus database with same CATH superfamily
2V8JA 3EG0A 1K8AC 3M4YA 3LH0A 1ZA1B 1D3BB 3BDUA 2YHTA 4ME7A 3VS4A 2RQRA 1VQMQ 1EIFA 1GFCA 2RA2A 1JJ2A 3UWNA 1QCOA 2HZYA 2O01E 5GAN6 1M8MA 2RQUA 2E6ZA 4JJBA 2HMAA 4ZNXA 3OS1A 3REAB 1IRXA 1Y71A 2CP2A 5CAIA 3JSCA 2K5LA 2CP7A 2YRDA 5GAN7 3G4SA 2KYBA 3QSUA 2RK2A 1XNIA 2E65A 2DE0X 3CPFA 1M90R 4OB3B 1B34B 5I22A 1E6HA 2ECZA 5KYWA 3M0PA 3VS2A 4RG2A 3VS6A 1W70A 1WJQA 2K3XA 3OMCA 2DYIA 3QKJA 2O31A 4KULA 3L42A 2EJGA 4JPBW 4Y92A 2K3YA 2O9SA 3CMEA 1VQ4A 1MHNA 1YJNT 4LDUA 4Z02A 2RO0A 2Y90A 3S6WA 2KRMA 3TCJA 2A3LA 3RDVA 2K57A 1KHCA 1YITA 4XK8E 1EX4A 4WTOB 3EGXB 1VQPA 3TSWA 2QTXA 3WXMB 1E7OA 1IHVA 4C8QD 4RMOA 4PFPA 1PD0A 3H9NA 1VQ4Q 1MNDA 4AG1C 2MI6A 1Q86C 5CR2A 1U06A 3OYNA 1K9MC 3PIPA 3CC2T 3CCVT 2LQ8A 3EGUA 3FLGA 4X1VA 3S3MA 4M77A 1TWBA 1QP2A 3CC4T 3OYGA 1IZ6A 2LX7A 2OTLT 1Q7YR 2DXUA 2JTFA 3G6ET 1NLPC 1VQ8A 4OMOA 1VQ6A 3KFVA 3MO8A 4LDWA 1SRLA 5DM7R 4PKCC 4MZMA 1DJ7B 1T0JA 2XIDA 2HDAA 3HRTA 4YTLA 2RJEA 1NYFA 3M0RA 4FYWB 5GAN4 3OW2A 3C12A 5D6WA 2EWNA 1VQ8Q 1MNEA 4WCIA 3GLXA 4PNOA 2RHXA 3NPFA 3R6NA 1YHQA 4HT9A 3DB4A 3JCMb 2PZ1A 3OYMA 1KSWA 4AFUC 1SF9A 2QDYB 2PTKA 3A5ZB 4N4GA 1PCXA 2CGHA 2XMFA 3LYIA 4LE9A 2J05A 2RN8A 2A0FB 4PJOD 4QVZA 1YCYA 3LW5E 1T3SA 1MV0B 2JMCA 3M53A 1FMVA 1HSQA 1ABQA 1AEYA 3VJPA 2OTJT 3UT1A 1KC8C 2ESWA 2PVDB 4J83A 3M0TA 1QP3A 4Q5WA 1X75C 4CC2A 4IUPA 3JCMe 3C95A 1N27A 1WXTA 3UA6A 5HCKA 2QGFB 1M8VA 3EH1A 4KGVB 4M7AA 2ZCFB 1QCNA 2OAWA 4BE0A 2MIOA 2R58A 3C4SA 1CSKA 3T9NA 1VYTA 3INZA 4EMGA 3H0IA 4MDXA 4J6XA 1TU0B 1B7TA 3HFNA 4FT4A 3VS7A 5LL6S 4JZ4A 3QYHB 2DEQA 3RIRA 1M90C 3MEUA 3META 4BACA 5KE2A 2R57A 3UATA 5KE3A 3I56T 5GAMd 4JUVA 1MUZA 3A8LB 2E5QA 3QWYA 4M77C 3CPWP 1VQ5T 1S72T 3AHUA 1JO8A 2JS2A 1O75A 1GBRA 1QVFP 1N6AA 1K73R 3VYGA 4RTXA 2O4XA 1D1CA 2L3SA 1PM3A 4BD3A 4HXJA 2CP3A 2D9TA 2RNAA 2YDLA 1G83A 3E1SA 2HSEB 3UA7A 3GBQA 2HBWA 3G71T 3MEWA 3EG3A 4DEXA 5FW9A 3V7CA 1IXDA 1MGQA 2E6NA 3UDCA 1BB9A 3EAEA 4VUBA 1W1FA 2HQHA 1NBEB 1OOTA 1SRMA 2OX7A 5GANe 3ASKA 3HHTB 5FRMA 3O8VA 2AT1B 2FPEA 1OI1A 1V1CA 2JM9A 1M30A 4C8QB 1W2BS 3X26B 1F1BB 4BI8B 4ATOA 3EH2A 1HD3A 3JB9I 2QG9B 1I5OB 4J9IA 4NL3A 1Q7YC 3CMAT 3M5AA 2EYZA 1YJWA 3EFOB 1VQNA 5LJ5d 3CD6T 1IO6A 1AWJA 4C0DC 3OYAA 3EG9B 2CT4A 4HT8A 5FRNA 4M77E 3OYCA 4QW2A 3LGLA 2NUPA 1FMWA 2I0NA 4PJLA 1C0MA 1ABOA 3M0QA 3BE3A 2DL3A 2ATCB 1XQHA 2VXFA 2QEXQ 3VS1A 3I55A 1YJWQ 2L8DA 1VQNQ 5FLXE 4M7AC 4A63B 1UTIA 4C5GA 1LOJA 1GCQA 2MK5A 1AZEA 2J6FA 3J81E 4OB2B 2DMOA 1C6VX 2ROLA 3M56A 2Z0WA 3JCMf 2DFUA 4XTXA 1GXIE 3M58A 3JCMV 4XQ3A 2RQVA 1ZSZA 2PU9B 2YSQA 3ZBDA 3ME9A 2E5KA 2LC4A 3QXEB 4L6V5 2F5TX 1JB0E 2NUTA 5KYUB 3CCRA 3CCEQ 4M7DD 1UGSB 4AFZC 3CXCS 5CKDA 1GBQA 3ZFJA 2OI3A 2JJ9A 2CDTA 1BI3A 2KY9A 2K4YA 1FYNA 4RTYA 4FYYB 2E64A 3VRZA 2MMPA 4RTZA 4E47A 2A08A 4LD6A 4HCZA 5IHIA 3VS0A 4XTVA 3X24B 2H3EB 1KQSA 3PNWC 3M0SA 2G3RA 3LLRA 4RTWA 2M16A 4FT2A 3VS5A 1UJYA 1AZGB 4JRKA 1SHGA 2RJDA 2DL4A 4C8QG 2K5IA 1B07A 4QVDA 2P0KA 2HEQA 2RQWA 2F2VA 2XDDA 3HPWA 2LJ0A 3RERA 1BIBA 2I2LA 4Y91A 3QBYA 5GAMg 4PLLA 3R6OA 1LPLA 4E7IA 3BDLA 1VQOT 1QVFA 3RMSA 1K8AU 3CCLT 1NEGA 1WHJA 2ED1A 4ZTFA 4PJOA 2C0TA 2H3JA 5GANf 4XTYA 2FG0A 4PL6A 2E3HA 2EGEA 2EJ9A 1K73C 5EC7A 4XU2A 1I1JA 1U5SA 1OULA 1ACMB 3H41A 4FSSA 1VQLA 2EJFA 2X4WA 1KK7A 1UHCA 2YLCA 3A8OB 5I11A 5KCOA 3CCSA 2FPFA 3X20B 2DF6A 2D6FA 2RJCA 1VIEA 2CZ6B 4KH0B 3M55A 4J9BA 1OU9A 2LCSA 3CBMA 5LJ3j 1VQLQ 2V26A 4L5GA 2EYWA 1NG2A 1WQWA 2H8HA 1GCQC 5CVIA 2QQAA 4Z8AA 3CCSQ 3CCUA 4DOWA 3FC3A 1N8RR 3LWIA 4C0ZA 3HKSA 4PJOG 3QPHA 2XD0A 4WF2A 2BZ8A 1I0CA 1ZSZC 5GMKh 4LUEA 5IT9E 1VQ7A 2AK5A 3TU4K 3CCUQ 5LJ5g 3JCMc 4LDYA 3MHXA 3I5SA 2DD4A 2VGMA 3QDFA 1YJNQ 1Y57A 4M78F 1JRIA 2EYXA 5KYYA 4MZPA 4C5IA 4EDUA 5IN1A 3D7SB 2K79A 1BYMA 3X25B 1JU5C 3CCVA 4M7AD 1YWPA 4J9FA 2DVEA 2Y4YA 1X2KA 1VQ7Q 2HKNA 1Q86U 4E7KA 1D1BA 1QVGP 2DAQA 5I21A 4D8KA 4HCCA 1LJOA 2V1RA 1M3CA 3JB9G 4PJJA 3FDRA 1JXOA 1NLOC 2RK1A 3CC2Q 3CCVQ 5A0DA 1Y07A 2QQRA 1RABB 1M3BA 4ESRA 2K2MA 3JCMh 1YI2T 4PJMA 3I5RA 2CUDA 3F70A 1QKXA 4OB1B 5KYXA 1FWZA 4O5VA 2J7IA 2OTLQ 4FSXA 3NTIA 1Z9ZA 1K0SA 1K1ZA 2J6OA 4HKEA 3G6EQ 2YUQA 1U1TA 4C92F 1BI1A 4XTWA 2E1HA 4PJOC 4CC7A 2QTVA 4C8QE 1VQMA 2CH4W 5KYWB 2YUNA 3SFMA 2P84A 4RCBA 2JUFA 2RHYA 3VKIA 4OGEA 1WHLA 4ELYC 2CZ7B 1H8KA 2JZ2A 2FVUA 2HQXA 1RLQC 3G1JA 4C0FA 3JCMW 2L3PA 1M27C 1EZZB 4EMHA 2MWOA 2EYYA 2KMTA 4B9XA 1TUGB 4O6JA 4ANJA 2PVGB 2HD0A 1G3YA 3ZEHA 4E2FB 3GPLA 4ZGJB 1UB4A 5IXBA 4RCCA 1G3WA 1K4US 2MPXC 4DOVA 1WX6A 1B3QA 1UFFA 5L23A 2ED0A 2K7AA 2DETA 2OTJQ 1WQ7A 1PRMC 2NWMA 2P0PA 2L89A 2AZVA 5J3BA 1NJIR 3ULRB 4M77B 1PWTA 1QWFA 5GANh 1JJ2S 3QO3A 1H3ZA 5KCHA 1KG1A 4LD9K 1YIJT 3E9GA 4ZN1A 5CK9A 4M7DA 2JNGA 2RMOA 4OB0B 1D09B 2DX1A 2VB6A 1UEBA 3CCQT 4PJOE 2EAYA 1M90U 9ATCB 2DRMA 4PJNA 5FROA 2FRYA 4F17A 3OS5A 3RBBB 2X4XA 2BZYA 2FZKB 2KT8A 1WJSA 2MWPA 1NPRA 1OV3A 5CKFA 3DLMA 1IHWA 2HCKA 4D6WA 1N8RC 4ZGDB 2GQVA 1KQ2A 1VQ5Q 5AT1B 3RMQA 1S72Q 4XU0A 4A4FA 4P5NA 4EMKA 2DRKA 4AT1B 2IG0A 2LTOA 4M7DG 4JJDA 1TUDA 1BK2A 1AT1B 1RAGB 3G71Q 1WJRA 1VQ9T 2C0IA 4DEYA 3OS2A 1X01A 1FXXA 3OSSC 3VV0A 1QVPA 2B86A 3QHSA 1IGUA 1V76A 3BFMA 4M75F 5FWBA 4C0DB 1QVGA 3CCJT 5CQXA 2CT3A 3RESA 2LQKA 3EFRA 2P4TA 4MMLA 5AYFA 5GMKe 2DZ9A 1TTHB 3MP1A 4M7AB 3FB9A 4HA8A 1XJWB 4XAXB 1MMAA 1W4SA 1VYUA 2XK0A 2MF2A 5GAN2 1Q7YU 3OYJA 4M77G 1AWWA 2DXCA 2WACA 4R56A 4KGXB 4XU1A 3JCMd 4N4HA 2CSIA 3H0HA 4BDZA 2LJ1A 4IUVA 3OYEA 5GAOr 3CD6Q 3SHWA 3C94A 3EG2A 3SD4A 5I2MA 3SWNA 5LJ3h 1Y0MA 1TSFA 4J7IA 4F7UA 4A54A 2X35A 4JLGA 1WPYA 5A0GA 3OW2S 4E6RA 3VUZA 1FX7A 1YN8A 4UC4A 2F2WA 2HL5C 2L5QA 4MDWA 2R5MA 4M7DC 3G7ZA 1Y96B 2M9UA 1Z9QA 2O4XB 3AT1B 2XDBA 1Q82R 1M4ZA 2JN0A 2DYBA 5IHKA 3DKMA 3MJXA 3FIFA 1RUWA 2M51A 1JBMA 2CP6A 3V8KA 5D6XA 3EFSA 1WI7A 2X9HA 2YUPA 2ENMA 4A4HA 2RHUA 4J9EA 3G4ST 1KQSP 4PLIA 2L3RA 1M1KR 2VXEA 4BE2A 5HK3A 2JW4A 2GCXA 4JJNK 2DNUA 1NJIC 1VYVA 4GY5A 1RLPC 2EQIA 5CCAA 2M02A 4EMKC 2JXBA 2D0NA 3WVEB 2YUOA 2KROA 2YLBA 2D1XA 3V8LA 5KH6A 1SSFA 5GANd 2YRVA 2KAFA 1YJ9A 1BI2A 5FU7C 3GP8A 4M78A 1AD5A 4DBQA 3CMET 1VQ4T 2JS0A 4FYVB 1D1AA 2KI7A 4L59A 4M7AG 2HQEA 5D7UA 2W0ZA 2YRCA 2ZPIB 4QT7A 1SHFA 1G8XA 2AZSA 4B9WA 4GLMA 1YITT 3V7SA 4LUDA 2KT1A 2D8HA 2XU8A 1BIAA 2NUPB 1VQPT 1CKAA 5ECAA 1YJ9Q 4CC4B 4M7DE 5D6YA 3WVDB 2GTJA 3RR6A 2XG8D 2QAZA 4X9DA 2Y4XA 2K2VA 2WSEE 2BUDA 4OMPA 3CCLQ 1K73U 1KD1R 1WXUA 3FRNA 4DQ2A 2K5FA 4DBFA 3KXTA 1EFNA 1E6GA 2HL3A 2ZPHB 1ZSZB 2VC8A 4FW2A 2P0QA 2A7YA 4C92A 5FU6B 4OGCA 1WFWA 2NUTB 1OU8A 3SWNC 1VQ6T 2QEXA 2KK4A 3E19A 4CI0C 4J8OA 1M9SA 5GJVB 5DLQE 2EKOA 1R8OB 2R5AA 4JRPA 3TREA 2PVOB 2X3WD 3P8HA 1VQKA 3H6ZA 2ROTA 1TS9A 2YXYA 1LCKA 4ZN3A 1YHQT 1QQJA 3C0CA 2YWWA 4GLKA 2LCLA 2WSFE 2V8KA 4LNPA 3URGA 5A0LA 3PTAA 3TEEA 1PRLC 1GRIA 3CCEA 5GAMj 2JM8A 1QLYA 3JCMg 1AWXA 3PFSA 2CYZB 1VQKQ 2E4HA 3V7RA 1PSEA 4LDVA 2LT1A 5GAOl 2QYZA 4E7ZA 5GAN3 3HRSA 1UHFA 4R55A 2QA4A 1NM7A 1OPKA 3FJ5A 4PJOB 4M4ZA 4V2SA 2DXTA 2DL8A 4MZTA 2EQJA 1Q82C 4J9DA 1RAFB 2RI3A 4LXCA 3LX7A 2A37A 4OMLA 2QA4Q 4F7UE 8ATCB 2GFUA 3L2QA 3GNGA 2QXFA 4LN2A 5J26A 2KXDA 3H0FA 5CKEA 2G6FX 1YI2Q 1KIKA 3QYGB 5LJ3e 3OBWA 2K3BA 1BCOA 1M1KC 1M3AA 2EQMA 4CC3A 1RI9A 4M7AE 3QDRB 3Q1JA 4D8DA 2KNBB 2VVKA 1D0ZA 2FB7A 3OB9A 2DXBA 5LJ5j 2KVQG 4NL2A 4FU6A 1X27A 2LQNA 5GANg 1VUBA 3CC7T 3VS3A 4KBMB 1VOMA 2ZZDA 1ZQ1A 2ZAEA 3M59A 4RG8A 1ZA2B 4KT0E 2DL5A 2EVRA 3TSZA 3M9QA 1YCSB 5KYYB 4E7HA 3TQ7P 4M75A 2ZPBB 2PUOB 4ZTJA 1RADB 2EYQA 3CPWS 3MPUB 1R0CB 2XDPA 1QVFS 3M0UA 1LVKA 1FMKA 2LZ6B 5EG2A 1SG5A 5HKCA 5IHNA 1KD1C 2CREA 1D0XA 5FWCA 1IREB 1IB8A 1WNLA 1YJNA 1Q81R 2F2XA 5GAN5 2E70A 3L2RA 4FIBA 4A4GA 3A8GB 1YIJQ 1ZX6A 4ELZC 1TXQA 2L3QA 1M2VA 3MEVA 1MMGA 5KYXB 1I4K1 2RJFA 2LNHB 5FU6C 4LDXA 2E12A 4J7FA 1U8RA 1VQNT 1PKSA 2DKGA 4PK4A 4FM4B 1RL2A 1OX9A 3N5BB 2O2OA 4Z88A 5J39A 2L2PA 4F16A 2DVJA 3CC2A 8AT1B 3OS0A 1WLPB 2VWFA 1N8RU 3I55T 4JDSA 3CC4A 2PNIA 3NMZC 3OY9A 3L2UA 1ZLMA 2KBTA 3TVTA 2RI2A 1K9MU 2MAMA 2OTLA 1HJDA 3J80E 4IIOA 2X3XD 1WHKA 3G6EA 3PVLA 3OYBA 2VYTA 1PKTA 2VV5A 3CC4Q 4QQGA 2EW3A 3PGGA 3CCRT 1VQ9Q 3A98A 4JS4A 1GFDA 3CBOA 5LJ3f 3MP8A 4RUGA 1G5VA 3MP6A 4OVAA 3LH5A 4M78D 2SEMA 1G3TA 3V8JA 5IH2A 3JB9J 1BKBA 1J3TA 1SEMA 2CP5A 4XTZA 4RTVA 4M7DB 5I2SA 3OYKA 4RTUA 1QW1A 4M75C 2A28A 1YP5A 3GNFB 3ZL7C 3RKYA 4TVRA 4BI3A 4N4IA 2OTJA 1WXBA 4F14A 3RNJA 2D0QB 4IURA 2V8IA 2VKNA 3QJ6A 4J9HA 3OQ5A 2JMAA 1KC8U 2E10A 3PE0A 3QUIA 4KRTA 3EHQA 1NEBA 1UECA 4C92D 4AFQC 3NGPA 3CCMT 2DERA 1UG1A 4EMKB 3J7AF 2J6KA 4C8QF 1TG0A 2CSQA 2O88A 4EIKA 3JCMQ 1T0HA 2DJQA 4XTUA 1VQLT 2EKHA 3S3NA 5GAMh 2FZGB 2XI9A 1NPPA 2XICA 4J6WA 5FU7B 2XHCA 3JV3A 4MMKA 3CCST 2BTTA 3EGDA 3I56A 4DBHA 5C6SA 2O9VA 2DO3A 4GBQA 3M57A 1N5ZA 3G4SQ 2DLPA 2KGTA 2RHZA 4QVCA 1VQ5A 1S72A 3MKDA 1YBYA 1IGQA 1D3BA 2PQWA 1NJIU 1AOJA 3SDZA 3CCUT 3OBYA 4HVWA 3OYHA 4HCKA 4M75E 3I56Q 1Q81C 2COZA 2X4JA 3M4GA 4A4EA 2A36A 3JCMJ 1ZUYA 2LMJA 5CIUA 3G71A 4OMNA 1A0NB 1PC0A 1W2BP 2B8AA 2CZ0B 1X6BA 3UPUA 1VQ7T 3KBGA 2KE9A 2M1HA 3CMEQ 3QWXX 2HNIA 4E7LA 1R77A 1B34A 3SWNB 2X51A 2KR3A 1YITQ 2QDLA 4F7UB 4B6MA 2CP0A 4KUDK 1UUEA 3HTRA 5GAOm 1VQPQ 2KSSA 2LNVA 2LJ3A 3A8MB 4PJOF 5GMKm 1PSFA 3L2WA 2XKOC 1OYXA 1XOVA 1ZBXA 3A8HB 3QZ5B 5LJ5h 3REBB 3CMAA 1PG5B 2LT4A 2COWA 2J06A 3CD6A 2W10A 2EGAA 2BKDN 2KDSA 1N9RA 1X6OA 1OZ3A 1UGRB 3EGXA 3RKXA 2GQIA 3CMAQ 1QVGS 3JB9H 4X34A 1VQ6Q 1PD1A 2LX9A 1KJWA 1CKBA 2NYSA 2QASA 2KRNA 1VQMT 3JB9F 2EPDA 3CXCP 5DLOA 1I5LA 1XTDA 2DTOA 2IIMA 4C0GA 3QIIA 2FEIA 5HK0A 3NFCA 4M75D 3NHNA 2AKLA 1YHQQ 4M78B 2KYMA 5GAOq 2EQUA 1QKWA 2V1QA 4IIMA 4E7JA 3JAME 2MYSA 3LGFA 2D8JA 4OF1A 2QGGA 4BY6B 1NE8A 2CKKA 2AIRB 4ORZA 3OA6A 2LCCA 1X6GA 3M54A 1K9AA 2X4YA 3HFOA 2RM4A 2E41A 2QQBA 1OX8A 2CS7A 1N9SA 1JQQA 4JRQA 1H92A 2QK0A 5IXFA 1M2OA 5GMKj 3OYYA 2F69A 2LP5A 2COYA 2VUBA 3PMIA 1Q82U 3BW1A 4F7UG 1QMCA 2M0YA 3JB9D 3GOXA 1BI0A 2BE9B 4JJCA 1QWEA 4F04B 2ZPEB 4J9GA 1WHHA 3ER0A 3L2ZA 1M1GA 1TH7A 4C92B 3DB3A 1AVZC 7AT1B 1NYGA 2K6DA 2RI5A 5CKBA 5GMKi 2F5KA 3PMTA 2L0AA 1G2BA 3JRZA 2OJ2A 1VA7A 2LVMA 1VQOA 1TUCA 3CCLA 5CO7A 1M1KU 1WHGA 1RAEB 1G3SA 1OZ2A 3E9FA 1OEBA 4N0AA 3PIOA 4IKFA 1O9SA 3RUXA 4PFOA 4C5HA 1Y96A 4Z89A 3LWHA 3CC7A 2KXCA 1W2BA 5HY6A 5GJWB 2M0OA 1VQOQ 1ARKA 2P4RA 2ZPFB 5GAMe 4K11A 3BY7A 2IVWA 1GL5A 2EIFA 1K0XA 1WIEA 2DJZA 4NS5A 5KYNA 3CC7Q 2JTMA 1BU1A 2BE7D 4JZ3A 1HYOA 1Y7XA 4A4KA 2JTEA 1WZOA 4DA4A 2C0OA 1Q95G 4M78G 3EG1A 1X2QA 4CRIA 3L2VA 1VQ8T 4FW1A 4KUIA 1UGQB 1R0BG 1I8FA 6AT1B 5L8RE 4J9CA 1AWOA 1KD1U 4IUUA 2ZGWA 3QG1A 2EBPA 2JVVA 1NZ9A 3OYFA 4M7DF 4HVVA 2E3IA 1WDXA 1TOVA 2WSCE 2FO0A 2DBMA 4KGZB 4OP0A 4QQDA 3P8BB 3SEMA 3JCMX 3CXCA 4FCYA 2RB6A 1PNJA 1D0YA 2FYKA 4C92G 4Y28E 2RPNA 2RQTA 1LNXA 4E7SA 3NTHA 5GANj 5LJ5e 3I9QA 3P8DA 5GMKl 1ZBJA 3I35A 1X43A 3UF4A 4C8QA 5LJ3d 4EPCA 4BE1A 2GFAA 3I55Q 1YI2A 4M77F 4HCBA 3VU3C 2LRQA 1RI0A 3OSVA 4M78C 4AFSC 1KHIA 4NOYA 2QI2A 4JRIA 5M9OA 2FPDA 4BDYA 3EFOA 2HAXA 1W6XA 1S1NA 2DA9A 4BY6C 4M75B 3FEOA 3EG9A 1H3HA 1V29B 3S3OA 2DM1A 1I07A 4J6YA 1GCPA 1I81A 4N0AC 4X9CA 2RH2A 2C06A 5DY9A 2DILA 1K8AR 5GAOp 1SSHA 3CCRQ 4BB7A 2CZ1B 3FJPA 3MCAB 3H8ZA 1AHJB 3DLLA 5A2QE 1UGPB 2DTIA 3THKA 2KRSA 2YT6A 3PVQA 2BZXA 4OMFB 4AMCA 2MCNA 2DIQA 2VGNA 3JCMP 3GIBA 4OMMA 1U1SA 2BIVA 1QCFA 1JJ2P 4PFZA 3A1PA 1KQSS 1ZSGA 1M2VB 5GAN8 1M5Q1 1YJ9T 3L1AA 4C92C 5GAMf 3CPWA 4M77D 2KQWA 4XU3A 2MOXA 3OMGA 5KYUA 1MV3A 3KUFA 1M1FA 3SB2A 1WHMA 1ZUKA 4F7UF 1SKUB 2GTOA 2DD5A 3CQTA 4RTTA 3CCMA 1ZUUA 5IAYA 4RKUE 2EGCA 2NUZA 2CUBA 2AHJB 2DZCA 2GNCA 1YIJA 2GBQA 4M78E 3X28B 2DTHA 2JOYA 4IUQA 4AG2C 2FZCB 2HKQB 4QKUA 2LQWA 3EHRA 1SPKA 4M7AF 1WGSA 3CCQA 5CKHA 3CCMQ 3HSBA 1RAHB 1MMNA 2EQKA 2K9GA 1PHTA 1YFNA 3IQLA 1BBZA 2F1LA 4IUTA 5CQYA 1YWOA 4J5YA 2DK3A 4FL6A 3E2UA 2QEXT 1YJWT 4II1A 1KQ1A 3VUBA 3CCQQ 2GGRA 2HBPA 2HSPA 1OPLA 4C8QC 1MMDA 1Q86R 4M75G 3CBPA 4DBRA 3U23A 1HXDA 1K9MR 1HK9A 1WA7A 2GF7A 3HP9A 2DIGA 1JEGA 2QQSA 1U3OA 1UDLA 4ZGEB 1Q81U 2QQ9A 4KH1B 1VQKT 5LJ5f 3GF5A 4C92E 4HVUA 4R0KA 3HL8A 2OAUA 2JT4A 4QQ6A 1OQKA 3QZ9B 4A53A 4OMQA 2RD1A 2DEUA 3VRYA 1K76A 1BCMA 4C5EA 1VQ9A 1ZHIA 3CCET 4FYXB 3OYIA 1YNZA 3RKWA 3CCJA 3PT9A 1KFZA 2NLUA 2RF0A 4JS5A 3CEYA 1JXMA 1X69A 2VASA 2IPOB 2FHDA 2QA4T 1RACB 3OYLA 3QJYA 5LJ3g 1RAAB 1H641 2DBKA 3OW2P 1RAIB 1UGVA 3CCJQ 1UE9A 2RHIA 2SRCA 1UJ0A 2KEAA 3OYDA 2ZPGB 2DL7A 1WYXA 2AKKA 3HRUA 4BI4A 2LDMA 2FRWA 3MEAA 3O5ZA 1C1AA 3VYHB 2DPPB 2CH4A 4JLIA 2ABLA 2FL7A 4BUGA 3EGDB 5GAOn 1P92A 5C0MA 1VIFA 2EFIA 2PUKB 3NTKA 1KC8R 1T3LA
chains in the Genus database with same CATH topology
1N9RA 2EJ9A 2V8JA 1K73C 1X6OA 1K8AC 4XU2A 1OZ3A 3M4YA 1UGRB 3LH0A 3RKXA 2ZPHB 2VC8A 1D3BB 3BDUA 2P0QA 2A7YA 2YHTA 4X34A 4ME7A 4OGCA 5FU6B 4C92A 1QVGS 1VQLA 3SWNC 2LX9A 2EJFA 1VQ6T 1EIFA 2RA2A 2QEXA 3UWNA 1JJ2A 2KK4A 3E19A 2X4WA 2YLCA 4CI0C 1VQMT 2O01E 3A8OB 4J8OA 5GAN6 5KCOA 3CCSA 3JB9F 5DLOA 1I5LA 1M9SA 1XTDA 3X20B 2DTOA 2E6ZA 5DLQE 2EKOA 2D6FA 1R8OB 2R5AA 2RJCA 4C0GA 1VIEA 3OS1A 4JRPA 3QIIA 1Y71A 3TREA 2CZ6B 2PVOB 5HK0A 3NFCA 5CAIA 3JSCA 3M55A 4M75D 2K5LA 5GAN7 3G4SA 3P8HA 3CBMA 5LJ3j 3QSUA 4L5GA 2RK2A 1XNIA 1WQWA 2E65A 3H6ZA 4M78B 1VQKA 5GAOq 2EQUA 5CVIA 2QQAA 4ZN3A 1YHQT 3CPFA 4OB3B 3CCUA 4DOWA 1B34B 3FC3A 4E7JA 4GLKA 2LCLA 3JAME 3LWIA 2WSFE 2V8KA 3LGFA 3URGA 4C0ZA 5A0LA 3PTAA 3HKSA 4OF1A 3TEEA 4BY6B 1NE8A 2CKKA 3OA6A 4PJOG 3CCEA 3QPHA 2XD0A 5GAMj 2LCCA 3JCMg 3M54A 2X4YA 4WF2A 3PFSA 3HFOA 4RG2A 5GMKh 2CYZB 2RM4A 2E41A 2QQBA 2CS7A 1WJQA 2K3XA 1N9SA 3OMCA 5IT9E 1VQ7A 3V7RA 4JRQA 3TU4K 1PSEA 4LDVA 3QKJA 4KULA 3JCMc 4LDYA 3L42A 5LJ5g 3MHXA 2DD4A 2EJGA 2VGMA 2LT1A 5GAOl 2K3YA 4M78F 3CMEA 1JRIA 5GAN3 1VQ4A 1MHNA 3HRSA 1YJNT 5GMKj 4LDUA 3OYYA 2RO0A 4Z02A 4R55A 2QA4A 2Y90A 4MZPA 2F69A 3S6WA 4C5IA 4EDUA 2VUBA 3PMIA 5IN1A 3TCJA 3BW1A 1Q82U 4F7UG 2A3LA 1BYMA 3X25B 2K57A 3JB9D 4PJOB 1KHCA 3GOXA 3CCVA 4M7AD 1BI0A 1YITA 4XK8E 2DVEA 2Y4YA 4V2SA 2DXTA 4MZTA 2EQJA 3WXMB 2QTXA 1VQPA 1Q82C 4E7KA 1Q86U 2ZPEB 2RI3A 4C8QD 4RMOA 3LX7A 3ER0A 3L2ZA 3JB9H 1M1GA 1TH7A 4C92B 2DAQA 5I21A 3DB3A 4HCCA 2RI5A 2MI6A 1LJOA 5CKBA 5GMKi 2F5KA 3PMTA 1Q86C 3JB9G 4F7UE 3FDRA 5CR2A 2GFUA 3OYNA 3JRZA 3GNGA 2QXFA 3L2QA 2RK1A 5J26A 1K9MC 5A0DA 1Y07A 2LVMA 2QQRA 3PIPA 5CKEA 1VQOA 3CCLA 5CO7A 3CC2T 3CCVT 1M1KU 2LQ8A 3QYGB 3FLGA 3S3MA 3JCMh 5LJ3e 1YI2T 4M77A 1G3SA 1OZ2A 1QP2A 3OBWA 3E9FA 3CC4T 3F70A 4N0AA 4OB1B 3PIOA 4IKFA 1O9SA 1FWZA 3RUXA 3OYGA 4C5HA 1Y96A 3LWHA 3CC7A 4O5VA 1M1KC 4FSXA 3NTIA 1IZ6A 2EQMA 4HKEA 2OTLT 1W2BA 5HY6A 4M7AE 1U1TA 2DXUA 2JTFA 2M0OA 1BI1A 4C92F 4XTWA 3G6ET 1VQ8A 3QDRB 2ZPFB 1VQ6A 2E1HA 5GAMe 3Q1JA 3MO8A 3BY7A 4LDWA 2IVWA 4PJOC 4C8QE 1VQMA 2EIFA 2FB7A 5DM7R 3OB9A 2DXBA 3SFMA 2KVQG 4PKCC 2DJZA 4NL2A 4FU6A 4MZMA 4RCBA 1DJ7B 2JUFA 4NS5A 2XIDA 5GANg 2RHYA 2JTMA 3VKIA 4OGEA 3HRTA 4YTLA 2RJEA 1VUBA 4ELYC 3CC7T 4KBMB 2ZZDA 5GAN4 2CZ7B 1Y7XA 3OW2A 2JZ2A 3C12A 4A4KA 5D6WA 2FVUA 1ZQ1A 2HQXA 4DA4A 2EWNA 3M59A 4RG8A 4M78G 4KT0E 3GLXA 4CRIA 4PNOA 3L2VA 2RHXA 1VQ8T 4KUIA 3M9QA 1UGQB 4C0FA 3JCMW 1I8FA 1YHQA 4HT9A 3DB4A 4E7HA 4M75A 3JCMb 4EMHA 3OYMA 2MWOA 2ZPBB 2KMTA 2PUOB 5L8RE 4O6JA 4B9XA 4ZTJA 2EYQA 3CPWS 2QDYB 2PVGB 2HD0A 3A5ZB 4N4GA 1G3YA 3ZEHA 3GPLA 1KD1U 2CGHA 3LYIA 4IUUA 2XDPA 1QVFS 4ZGJB 1UB4A 2ZGWA 4QVZA 3QG1A 4PJOD 5EG2A 4RCCA 1G3WA 2JVVA 1YCYA 3LW5E 1NZ9A 4DOVA 3OYFA 4M7DF 3M53A 5HKCA 1KD1C 2WSCE 1IREB 3VJPA 1WNLA 1WQ7A 2OTJT 1YJNA 2P0PA 3UT1A 1KC8C 2L89A 4OP0A 2PVDB 4J83A 4QQDA 3P8BB 5GAN5 5J3BA 2E70A 3L2RA 1QP3A 4M77B 4FIBA 4Q5WA 3A8GB 4A4GA 5GANh 1JJ2S 3QO3A 4ELZC 1X75C 5KCHA 3JCMX 1H3ZA 3MEVA 4IUPA 1YIJT 4LD9K 1KG1A 1I4K1 3JCMe 3CXCA 2RJFA 3E9GA 3C95A 1N27A 4ZN1A 5CK9A 5FU6C 4M7DA 2JNGA 2RB6A 4LDXA 2E12A 2FYKA 4J7FA 4OB0B 4C92G 4Y28E 1U8RA 1VQNT 1M8VA 1LNXA 3NTHA 1UEBA 2DKGA 5GANj 4M7AA 2ZCFB 4FM4B 3CCQT 5LJ5e 1RL2A 3P8DA 5GMKl 3N5BB 4BE0A 2R58A 4PJOE 5J39A 3C4SA 3T9NA 4C8QA 2EAYA 3INZA 4EMGA 5LJ3d 4EPCA 4BE1A 3CC2A 1M90U 3OS0A 4MDXA 4J6XA 2GFAA 1YI2A 1N8RU 3HFNA 4FT4A 4M77F 5FROA 4HCBA 3I55T 3VU3C 4JDSA 3OS5A 3CC4A 2LRQA 3OY9A 5LL6S 1RI0A 3OSVA 4M78C 3L2UA 2X4XA 2MWPA 1WJSA 3QYHB 1NPRA 2RI2A 1K9MU 1KHIA 2DEQA 4NOYA 2QI2A 3MEUA 4JRIA 3DLMA 5CKFA 3RIRA 1M90C 3META 5M9OA 4BACA 2MAMA 4D6WA 1N8RC 2OTLA 4BDYA 4ZGDB 5KE2A 2HAXA 2GQVA 2R57A 3J80E 5KE3A 3I56T 5GAMd 3G6EA 4BY6C 4JUVA 4M75B 1KQ2A 3A8LB 3FEOA 3RMQA 2E5QA 1V29B 3OYBA 4M77C 2VYTA 3S3OA 4J6YA 1VQ5T 4XU0A 1I81A 4P5NA 4N0AC 4A4FA 4EMKA 2VV5A 1S72T 3AHUA 4X9CA 1O75A 4QQGA 2RH2A 2IG0A 1N6AA 3VYGA 2C06A 5DY9A 2LTOA 2O4XA 5GAOp 4M7DG 4BB7A 2CZ1B 3FJPA 3MCAB 3H8ZA 4BD3A 1AHJB 3PGGA 3CCRT 3DLLA 5A2QE 1UGPB 2D9TA 2DTIA 4JS4A 3CBOA 5LJ3f 1WJRA 1VQ9T 3E1SA 3MP8A 1G5VA 3OS2A 1X01A 1FXXA 3OSSC 3G71T 3VV0A 3MP6A 3MEWA 1QVPA 4OMFB 4M78D 4OVAA 3QHSA 3V7CA 1G3TA 3BFMA 4M75F 1MGQA 2E6NA 2DIQA 2VGNA 3UDCA 4C0DB 3JCMP 3CCJT 5CQXA 1QVGA 3EAEA 3GIBA 1U1SA 3V8JA 2BIVA 4VUBA 3RESA 3JB9J 1BKBA 2LQKA 1KQSS 3EFRA 2P4TA 4XTZA 5GAN8 1M5Q1 4MMLA 1YJ9T 5AYFA 3L1AA 4C92C 5GAMf 5GANe 4M77D 5I2SA 3ASKA 3CPWA 4M7DB 3HHTB 3OYKA 5GMKe 2KQWA 4XU3A 2DZ9A 5FRMA 3MP1A 3O8VA 1QW1A 3OMGA 3FB9A 4M75C 4M7AB 4HA8A 3KUFA 1M1FA 3GNFB 4XAXB 3RKYA 3SB2A 1W4SA 4TVRA 4BI3A 1OI1A 4N4IA 2OTJA 4F7UF 4C8QB 2XK0A 2MF2A 2DD5A 5GAN2 1W2BS 3X26B 2D0QB 4IURA 3CCMA 1Q7YU 3OYJA 5IAYA 2V8IA 4M77G 3QJ6A 2DXCA 4BI8B 4ATOA 2WACA 4RKUE 4R56A 3JB9I 3OQ5A 4XU1A 3JCMd 4N4HA 2AHJB 2DZCA 4NL3A 1YIJA 4M78E 3X28B 1Q7YC 3CMAT 4BDZA 2DTHA 2JOYA 4IUQA 3M5AA 4IUVA 1KC8U 2E10A 3QUIA 3OYEA 5GAOr 1YJWA 3C94A 3SD4A 1VQNA 5I2MA 3SWNA 5LJ5d 5LJ3h 3CD6T 4M7AF 1WGSA 4C0DC 3OYAA 5CKHA 3CCQA 3HSBA 4J7IA 4F7UA 4C92D 4A54A 2X35A 4JLGA 1WPYA 5A0GA 3OW2S 4HT8A 2EQKA 4M77E 5FRNA 3VUZA 3CCMT 3OYCA 4QW2A 3LGLA 4EMKB 3J7AF 4C8QF 1FX7A 4UC4A 4IUTA 2L5QA 4MDWA 3JCMQ 2R5MA 4M7DC 5CQYA 3G7ZA 1XQHA 2VXFA 1Y96B 2M9UA 2O4XB 4XTUA 1VQLT 3I55A 2XDBA 1M4ZA 5GAMh 3S3NA 2JN0A 2DK3A 2L8DA 4FL6A 4J5YA 5FLXE 2XI9A 2QEXT 1NPPA 2XICA 4M7AC 4J6WA 1YJWT 5FU7B 2XHCA 1KQ1A 4II1A 3VUBA 4C5GA 1LOJA 4MMKA 2HBPA 3DKMA 3CCST 3FIFA 1JBMA 4C8QC 3J81E 4M75G 3CBPA 4OB2B 3I56A 5C6SA 2DO3A 3M56A 3V8KA 1HXDA 3JCMf 4XTXA 5D6XA 3M57A 3EFSA 1HK9A 2GF7A 3HP9A 2DIGA 2RHZA 3M58A 3JCMV 4QVCA 4A4HA 1VQ5A 2RHUA 3G4ST 1GXIE 1S72A 2QQSA 4ZGEB 4PLIA 2L3RA 4XQ3A 1Q81U 2QQ9A 2PU9B 1YBYA 1VQKT 5LJ5f 1D3BA 3GF5A 2PQWA 3ME9A 3ZBDA 4C92E 1NJIU 2LC4A 3HL8A 2OAUA 3QXEB 4QQ6A 3QZ9B 2VXEA 4L6V5 2F5TX 1JB0E 3SDZA 3OBYA 4A53A 2RD1A 3CCUT 5HK3A 3OYHA 4BE2A 2GCXA 4JJNK 4M75E 3CCRA 1Q81C 2X4JA 4M7DD 1UGSB 3M4GA 4A4EA 4C5EA 1VQ9A 3CXCS 1NJIC 4GY5A 1ZHIA 5CKDA 3JCMJ 5CIUA 5CCAA 3CCET 3ZFJA 4EMKC 3OYIA 3G71A 1BI3A 2KY9A 3RKWA 2B8AA 2CZ0B 3CCJA 2K4YA 3WVEB 2YLBA 3UPUA 2E64A 3V8LA 5KH6A 3PT9A 1VQ7T 3KBGA 2MMPA 2NLUA 4E47A 2M1HA 1SSFA 5GANd 2YRVA 2KAFA 4LD6A 1YJ9A 1BI2A 4JS5A 4HCZA 3CEYA 5FU7C 3GP8A 4M78A 3CMET 1VQ4T 2HNIA 3X24B 4XTVA 4E7LA 1KQSA 2FHDA 2QA4T 3PNWC 4L59A 1B34A 2G3RA 2HQEA 3LLRA 3QJYA 3SWNB 3OYLA 4M7AG 2M16A 4FT2A 2ZPIB 5LJ3g 1H641 4F7UB 4KUDK 4JRKA 4B9WA 1YITT 3V7SA 2RJDA 4C8QG 2RHIA 5GAOm 2KSSA 2XU8A 2K5IA 2LNVA 3A8MB 4PJOF 1BIAA 2P0KA 4QVDA 5GMKm 1VQPT 1PSFA 2XDDA 3L2WA 3HPWA 2XKOC 4M7DE 3OYDA 2ZPGB 1OYXA 1XOVA 1ZBXA 3HRUA 5D6YA 3WVDB 3RERA 4BI4A 3A8HB 1BIBA 2I2LA 2LDMA 3QZ5B 4Y91A 3QBYA 2XG8D 5LJ5h 5GAMg 4PLLA 4X9DA 2Y4XA 2K2VA 2WSEE 3R6OA 3CMAA 2BUDA 3MEAA 4E7IA 3VYHB 2DPPB 4JLIA 2LT4A 3BDLA 1K73U 1VQOT 5LJ5j 1QVFA 2FL7A 4BUGA 3RMSA 1K8AU 3CCLT 5GAOn 3CD6A 1P92A 5C0MA 3FRNA 1VIFA 4ZTFA 2EFIA 2PUKB 2K5FA 4DQ2A 4PJOA 3NTKA 2H3JA 5GANf 3KXTA 4XTYA 2BKDN 4PL6A 2KDSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FU7 B;  4BY6 B;  5FU6 C;  4C0F A;  4C0D B;  5FU7 C;  5FU6 B;  4C0G A;  4BY6 C;  4C0D C; 
#chains in the Genus database with same CATH topology
 2V8J A;  3EG0 A;  1K8A C;  3M4Y A;  3LH0 A;  1ZA1 B;  1D3B B;  3BDU A;  2YHT A;  4ME7 A;  3VS4 A;  2RQR A;  1VQM Q;  1EIF A;  1GFC A;  2RA2 A;  1JJ2 A;  3UWN A;  1QCO A;  2HZY A;  2O01 E;  5GAN 6;  1M8M A;  2RQU A;  2E6Z A;  4JJB A;  2HMA A;  4ZNX A;  3OS1 A;  3REA B;  1IRX A;  1Y71 A;  2CP2 A;  5CAI A;  3JSC A;  2K5L A;  2CP7 A;  2YRD A;  5GAN 7;  3G4S A;  2KYB A;  3QSU A;  2RK2 A;  1XNI A;  2E65 A;  2DE0 X;  3CPF A;  1M90 R;  4OB3 B;  1B34 B;  5I22 A;  1E6H A;  2ECZ A;  5KYW A;  3M0P A;  3VS2 A;  4RG2 A;  3VS6 A;  1W70 A;  1WJQ A;  2K3X A;  3OMC A;  2DYI A;  3QKJ A;  2O31 A;  4KUL A;  3L42 A;  2EJG A;  4JPB W;  4Y92 A;  2K3Y A;  2O9S A;  3CME A;  1VQ4 A;  1MHN A;  1YJN T;  4LDU A;  4Z02 A;  2RO0 A;  2Y90 A;  3S6W A;  2KRM A;  3TCJ A;  2A3L A;  3RDV A;  2K57 A;  1KHC A;  1YIT A;  4XK8 E;  1EX4 A;  4WTO B;  3EGX B;  1VQP A;  3TSW A;  2QTX A;  3WXM B;  1E7O A;  1IHV A;  4C8Q D;  4RMO A;  4PFP A;  1PD0 A;  3H9N A;  1VQ4 Q;  1MND A;  4AG1 C;  2MI6 A;  1Q86 C;  5CR2 A;  1U06 A;  3OYN A;  1K9M C;  3PIP A;  3CC2 T;  3CCV T;  2LQ8 A;  3EGU A;  3FLG A;  4X1V A;  3S3M A;  4M77 A;  1TWB A;  1QP2 A;  3CC4 T;  3OYG A;  1IZ6 A;  2LX7 A;  2OTL T;  1Q7Y R;  2DXU A;  2JTF A;  3G6E T;  1NLP C;  1VQ8 A;  4OMO A;  1VQ6 A;  3KFV A;  3MO8 A;  4LDW A;  1SRL A;  5DM7 R;  4PKC C;  4MZM A;  1DJ7 B;  1T0J A;  2XID A;  2HDA A;  3HRT A;  4YTL A;  2RJE A;  1NYF A;  3M0R A;  4FYW B;  5GAN 4;  3OW2 A;  3C12 A;  5D6W A;  2EWN A;  1VQ8 Q;  1MNE A;  4WCI A;  3GLX A;  4PNO A;  2RHX A;  3NPF A;  3R6N A;  1YHQ A;  4HT9 A;  3DB4 A;  3JCM b;  2PZ1 A;  3OYM A;  1KSW A;  4AFU C;  1SF9 A;  2QDY B;  2PTK A;  3A5Z B;  4N4G A;  1PCX A;  2CGH A;  2XMF A;  3LYI A;  4LE9 A;  2J05 A;  2RN8 A;  2A0F B;  4PJO D;  4QVZ A;  1YCY A;  3LW5 E;  1T3S A;  1MV0 B;  2JMC A;  3M53 A;  1FMV A;  1HSQ A;  1ABQ A;  1AEY A;  3VJP A;  2OTJ T;  3UT1 A;  1KC8 C;  2ESW A;  2PVD B;  4J83 A;  3M0T A;  1QP3 A;  4Q5W A;  1X75 C;  4CC2 A;  4IUP A;  3JCM e;  3C95 A;  1N27 A;  1WXT A;  3UA6 A;  5HCK A;  2QGF B;  1M8V A;  3EH1 A;  4KGV B;  4M7A A;  2ZCF B;  1QCN A;  2OAW A;  4BE0 A;  2MIO A;  2R58 A;  3C4S A;  1CSK A;  3T9N A;  1VYT A;  3INZ A;  4EMG A;  3H0I A;  4MDX A;  4J6X A;  1TU0 B;  1B7T A;  3HFN A;  4FT4 A;  3VS7 A;  5LL6 S;  4JZ4 A;  3QYH B;  2DEQ A;  3RIR A;  1M90 C;  3MEU A;  3MET A;  4BAC A;  5KE2 A;  2R57 A;  3UAT A;  5KE3 A;  3I56 T;  5GAM d;  4JUV A;  1MUZ A;  3A8L B;  2E5Q A;  3QWY A;  4M77 C;  3CPW P;  1VQ5 T;  1S72 T;  3AHU A;  1JO8 A;  2JS2 A;  1O75 A;  1GBR A;  1QVF P;  1N6A A;  1K73 R;  3VYG A;  4RTX A;  2O4X A;  1D1C A;  2L3S A;  1PM3 A;  4BD3 A;  4HXJ A;  2CP3 A;  2D9T A;  2RNA A;  2YDL A;  1G83 A;  3E1S A;  2HSE B;  3UA7 A;  3GBQ A;  2HBW A;  3G71 T;  3MEW A;  3EG3 A;  4DEX A;  5FW9 A;  3V7C A;  1IXD A;  1MGQ A;  2E6N A;  3UDC A;  1BB9 A;  3EAE A;  4VUB A;  1W1F A;  2HQH A;  1NBE B;  1OOT A;  1SRM A;  2OX7 A;  5GAN e;  3ASK A;  3HHT B;  5FRM A;  3O8V A;  2AT1 B;  2FPE A;  1OI1 A;  1V1C A;  2JM9 A;  1M30 A;  4C8Q B;  1W2B S;  3X26 B;  1F1B B;  4BI8 B;  4ATO A;  3EH2 A;  1HD3 A;  3JB9 I;  2QG9 B;  1I5O B;  4J9I A;  4NL3 A;  1Q7Y C;  3CMA T;  3M5A A;  2EYZ A;  1YJW A;  3EFO B;  1VQN A;  5LJ5 d;  3CD6 T;  1IO6 A;  1AWJ A;  4C0D C;  3OYA A;  3EG9 B;  2CT4 A;  4HT8 A;  5FRN A;  4M77 E;  3OYC A;  4QW2 A;  3LGL A;  2NUP A;  1FMW A;  2I0N A;  4PJL A;  1C0M A;  1ABO A;  3M0Q A;  3BE3 A;  2DL3 A;  2ATC B;  1XQH A;  2VXF A;  2QEX Q;  3VS1 A;  3I55 A;  1YJW Q;  2L8D A;  1VQN Q;  5FLX E;  4M7A C;  4A63 B;  1UTI A;  4C5G A;  1LOJ A;  1GCQ A;  2MK5 A;  1AZE A;  2J6F A;  3J81 E;  4OB2 B;  2DMO A;  1C6V X;  2ROL A;  3M56 A;  2Z0W A;  3JCM f;  2DFU A;  4XTX A;  1GXI E;  3M58 A;  3JCM V;  4XQ3 A;  2RQV A;  1ZSZ A;  2PU9 B;  2YSQ A;  3ZBD A;  3ME9 A;  2E5K A;  2LC4 A;  3QXE B;  4L6V 5;  2F5T X;  1JB0 E;  2NUT A;  5KYU B;  3CCR A;  3CCE Q;  4M7D D;  1UGS B;  4AFZ C;  3CXC S;  5CKD A;  1GBQ A;  3ZFJ A;  2OI3 A;  2JJ9 A;  2CDT A;  1BI3 A;  2KY9 A;  2K4Y A;  1FYN A;  4RTY A;  4FYY B;  2E64 A;  3VRZ A;  2MMP A;  4RTZ A;  4E47 A;  2A08 A;  4LD6 A;  4HCZ A;  5IHI A;  3VS0 A;  4XTV A;  3X24 B;  2H3E B;  1KQS A;  3PNW C;  3M0S A;  2G3R A;  3LLR A;  4RTW A;  2M16 A;  4FT2 A;  3VS5 A;  1UJY A;  1AZG B;  4JRK A;  1SHG A;  2RJD A;  2DL4 A;  4C8Q G;  2K5I A;  1B07 A;  4QVD A;  2P0K A;  2HEQ A;  2RQW A;  2F2V A;  2XDD A;  3HPW A;  2LJ0 A;  3RER A;  1BIB A;  2I2L A;  4Y91 A;  3QBY A;  5GAM g;  4PLL A;  3R6O A;  1LPL A;  4E7I A;  3BDL A;  1VQO T;  1QVF A;  3RMS A;  1K8A U;  3CCL T;  1NEG A;  1WHJ A;  2ED1 A;  4ZTF A;  4PJO A;  2C0T A;  2H3J A;  5GAN f;  4XTY A;  2FG0 A;  4PL6 A;  2E3H A;  2EGE A;  2EJ9 A;  1K73 C;  5EC7 A;  4XU2 A;  1I1J A;  1U5S A;  1OUL A;  1ACM B;  3H41 A;  4FSS A;  1VQL A;  2EJF A;  2X4W A;  1KK7 A;  1UHC A;  2YLC A;  3A8O B;  5I11 A;  5KCO A;  3CCS A;  2FPF A;  3X20 B;  2DF6 A;  2D6F A;  2RJC A;  1VIE A;  2CZ6 B;  4KH0 B;  3M55 A;  4J9B A;  1OU9 A;  2LCS A;  3CBM A;  5LJ3 j;  1VQL Q;  2V26 A;  4L5G A;  2EYW A;  1NG2 A;  1WQW A;  2H8H A;  1GCQ C;  5CVI A;  2QQA A;  4Z8A A;  3CCS Q;  3CCU A;  4DOW A;  3FC3 A;  1N8R R;  3LWI A;  4C0Z A;  3HKS A;  4PJO G;  3QPH A;  2XD0 A;  4WF2 A;  2BZ8 A;  1I0C A;  1ZSZ C;  5GMK h;  4LUE A;  5IT9 E;  1VQ7 A;  2AK5 A;  3TU4 K;  3CCU Q;  5LJ5 g;  3JCM c;  4LDY A;  3MHX A;  3I5S A;  2DD4 A;  2VGM A;  3QDF A;  1YJN Q;  1Y57 A;  4M78 F;  1JRI A;  2EYX A;  5KYY A;  4MZP A;  4C5I A;  4EDU A;  5IN1 A;  3D7S B;  2K79 A;  1BYM A;  3X25 B;  1JU5 C;  3CCV A;  4M7A D;  1YWP A;  4J9F A;  2DVE A;  2Y4Y A;  1X2K A;  1VQ7 Q;  2HKN A;  1Q86 U;  4E7K A;  1D1B A;  1QVG P;  2DAQ A;  5I21 A;  4D8K A;  4HCC A;  1LJO A;  2V1R A;  1M3C A;  3JB9 G;  4PJJ A;  3FDR A;  1JXO A;  1NLO C;  2RK1 A;  3CC2 Q;  3CCV Q;  5A0D A;  1Y07 A;  2QQR A;  1RAB B;  1M3B A;  4ESR A;  2K2M A;  3JCM h;  1YI2 T;  4PJM A;  3I5R A;  2CUD A;  3F70 A;  1QKX A;  4OB1 B;  5KYX A;  1FWZ A;  4O5V A;  2J7I A;  2OTL Q;  4FSX A;  3NTI A;  1Z9Z A;  1K0S A;  1K1Z A;  2J6O A;  4HKE A;  3G6E Q;  2YUQ A;  1U1T A;  4C92 F;  1BI1 A;  4XTW A;  2E1H A;  4PJO C;  4CC7 A;  2QTV A;  4C8Q E;  1VQM A;  2CH4 W;  5KYW B;  2YUN A;  3SFM A;  2P84 A;  4RCB A;  2JUF A;  2RHY A;  3VKI A;  4OGE A;  1WHL A;  4ELY C;  2CZ7 B;  1H8K A;  2JZ2 A;  2FVU A;  2HQX A;  1RLQ C;  3G1J A;  4C0F A;  3JCM W;  2L3P A;  1M27 C;  1EZZ B;  4EMH A;  2MWO A;  2EYY A;  2KMT A;  4B9X A;  1TUG B;  4O6J A;  4ANJ A;  2PVG B;  2HD0 A;  1G3Y A;  3ZEH A;  4E2F B;  3GPL A;  4ZGJ B;  1UB4 A;  5IXB A;  4RCC A;  1G3W A;  1K4U S;  2MPX C;  4DOV A;  1WX6 A;  1B3Q A;  1UFF A;  5L23 A;  2ED0 A;  2K7A A;  2DET A;  2OTJ Q;  1WQ7 A;  1PRM C;  2NWM A;  2P0P A;  2L89 A;  2AZV A;  5J3B A;  1NJI R;  3ULR B;  4M77 B;  1PWT A;  1QWF A;  5GAN h;  1JJ2 S;  3QO3 A;  1H3Z A;  5KCH A;  1KG1 A;  4LD9 K;  1YIJ T;  3E9G A;  4ZN1 A;  5CK9 A;  4M7D A;  2JNG A;  2RMO A;  4OB0 B;  1D09 B;  2DX1 A;  2VB6 A;  1UEB A;  3CCQ T;  4PJO E;  2EAY A;  1M90 U;  9ATC B;  2DRM A;  4PJN A;  5FRO A;  2FRY A;  4F17 A;  3OS5 A;  3RBB B;  2X4X A;  2BZY A;  2FZK B;  2KT8 A;  1WJS A;  2MWP A;  1NPR A;  1OV3 A;  5CKF A;  3DLM A;  1IHW A;  2HCK A;  4D6W A;  1N8R C;  4ZGD B;  2GQV A;  1KQ2 A;  1VQ5 Q;  5AT1 B;  3RMQ A;  1S72 Q;  4XU0 A;  4A4F A;  4P5N A;  4EMK A;  2DRK A;  4AT1 B;  2IG0 A;  2LTO A;  4M7D G;  4JJD A;  1TUD A;  1BK2 A;  1AT1 B;  1RAG B;  3G71 Q;  1WJR A;  1VQ9 T;  2C0I A;  4DEY A;  3OS2 A;  1X01 A;  1FXX A;  3OSS C;  3VV0 A;  1QVP A;  2B86 A;  3QHS A;  1IGU A;  1V76 A;  3BFM A;  4M75 F;  5FWB A;  4C0D B;  1QVG A;  3CCJ T;  5CQX A;  2CT3 A;  3RES A;  2LQK A;  3EFR A;  2P4T A;  4MML A;  5AYF A;  5GMK e;  2DZ9 A;  1TTH B;  3MP1 A;  4M7A B;  3FB9 A;  4HA8 A;  1XJW B;  4XAX B;  1MMA A;  1W4S A;  1VYU A;  2XK0 A;  2MF2 A;  5GAN 2;  1Q7Y U;  3OYJ A;  4M77 G;  1AWW A;  2DXC A;  2WAC A;  4R56 A;  4KGX B;  4XU1 A;  3JCM d;  4N4H A;  2CSI A;  3H0H A;  4BDZ A;  2LJ1 A;  4IUV A;  3OYE A;  5GAO r;  3CD6 Q;  3SHW A;  3C94 A;  3EG2 A;  3SD4 A;  5I2M A;  3SWN A;  5LJ3 h;  1Y0M A;  1TSF A;  4J7I A;  4F7U A;  4A54 A;  2X35 A;  4JLG A;  1WPY A;  5A0G A;  3OW2 S;  4E6R A;  3VUZ A;  1FX7 A;  1YN8 A;  4UC4 A;  2F2W A;  2HL5 C;  2L5Q A;  4MDW A;  2R5M A;  4M7D C;  3G7Z A;  1Y96 B;  2M9U A;  1Z9Q A;  2O4X B;  3AT1 B;  2XDB A;  1Q82 R;  1M4Z A;  2JN0 A;  2DYB A;  5IHK A;  3DKM A;  3MJX A;  3FIF A;  1RUW A;  2M51 A;  1JBM A;  2CP6 A;  3V8K A;  5D6X A;  3EFS A;  1WI7 A;  2X9H A;  2YUP A;  2ENM A;  4A4H A;  2RHU A;  4J9E A;  3G4S T;  1KQS P;  4PLI A;  2L3R A;  1M1K R;  2VXE A;  4BE2 A;  5HK3 A;  2JW4 A;  2GCX A;  4JJN K;  2DNU A;  1NJI C;  1VYV A;  4GY5 A;  1RLP C;  2EQI A;  5CCA A;  2M02 A;  4EMK C;  2JXB A;  2D0N A;  3WVE B;  2YUO A;  2KRO A;  2YLB A;  2D1X A;  3V8L A;  5KH6 A;  1SSF A;  5GAN d;  2YRV A;  2KAF A;  1YJ9 A;  1BI2 A;  5FU7 C;  3GP8 A;  4M78 A;  1AD5 A;  4DBQ A;  3CME T;  1VQ4 T;  2JS0 A;  4FYV B;  1D1A A;  2KI7 A;  4L59 A;  4M7A G;  2HQE A;  5D7U A;  2W0Z A;  2YRC A;  2ZPI B;  4QT7 A;  1SHF A;  1G8X A;  2AZS A;  4B9W A;  4GLM A;  1YIT T;  3V7S A;  4LUD A;  2KT1 A;  2D8H A;  2XU8 A;  1BIA A;  2NUP B;  1VQP T;  1CKA A;  5ECA A;  1YJ9 Q;  4CC4 B;  4M7D E;  5D6Y A;  3WVD B;  2GTJ A;  3RR6 A;  2XG8 D;  2QAZ A;  4X9D A;  2Y4X A;  2K2V A;  2WSE E;  2BUD A;  4OMP A;  3CCL Q;  1K73 U;  1KD1 R;  1WXU A;  3FRN A;  4DQ2 A;  2K5F A;  4DBF A;  3KXT A;  1EFN A;  1E6G A;  2HL3 A;  2ZPH B;  1ZSZ B;  2VC8 A;  4FW2 A;  2P0Q A;  2A7Y A;  4C92 A;  5FU6 B;  4OGC A;  1WFW A;  2NUT B;  1OU8 A;  3SWN C;  1VQ6 T;  2QEX A;  2KK4 A;  3E19 A;  4CI0 C;  4J8O A;  1M9S A;  5GJV B;  5DLQ E;  2EKO A;  1R8O B;  2R5A A;  4JRP A;  3TRE A;  2PVO B;  2X3W D;  3P8H A;  1VQK A;  3H6Z A;  2ROT A;  1TS9 A;  2YXY A;  1LCK A;  4ZN3 A;  1YHQ T;  1QQJ A;  3C0C A;  2YWW A;  4GLK A;  2LCL A;  2WSF E;  2V8K A;  4LNP A;  3URG A;  5A0L A;  3PTA A;  3TEE A;  1PRL C;  1GRI A;  3CCE A;  5GAM j;  2JM8 A;  1QLY A;  3JCM g;  1AWX A;  3PFS A;  2CYZ B;  1VQK Q;  2E4H A;  3V7R A;  1PSE A;  4LDV A;  2LT1 A;  5GAO l;  2QYZ A;  4E7Z A;  5GAN 3;  3HRS A;  1UHF A;  4R55 A;  2QA4 A;  1NM7 A;  1OPK A;  3FJ5 A;  4PJO B;  4M4Z A;  4V2S A;  2DXT A;  2DL8 A;  4MZT A;  2EQJ A;  1Q82 C;  4J9D A;  1RAF B;  2RI3 A;  4LXC A;  3LX7 A;  2A37 A;  4OML A;  2QA4 Q;  4F7U E;  8ATC B;  2GFU A;  3L2Q A;  3GNG A;  2QXF A;  4LN2 A;  5J26 A;  2KXD A;  3H0F A;  5CKE A;  2G6F X;  1YI2 Q;  1KIK A;  3QYG B;  5LJ3 e;  3OBW A;  2K3B A;  1BCO A;  1M1K C;  1M3A A;  2EQM A;  4CC3 A;  1RI9 A;  4M7A E;  3QDR B;  3Q1J A;  4D8D A;  2KNB B;  2VVK A;  1D0Z A;  2FB7 A;  3OB9 A;  2DXB A;  5LJ5 j;  2KVQ G;  4NL2 A;  4FU6 A;  1X27 A;  2LQN A;  5GAN g;  1VUB A;  3CC7 T;  3VS3 A;  4KBM B;  1VOM A;  2ZZD A;  1ZQ1 A;  2ZAE A;  3M59 A;  4RG8 A;  1ZA2 B;  4KT0 E;  2DL5 A;  2EVR A;  3TSZ A;  3M9Q A;  1YCS B;  5KYY B;  4E7H A;  3TQ7 P;  4M75 A;  2ZPB B;  2PUO B;  4ZTJ A;  1RAD B;  2EYQ A;  3CPW S;  3MPU B;  1R0C B;  2XDP A;  1QVF S;  3M0U A;  1LVK A;  1FMK A;  2LZ6 B;  5EG2 A;  1SG5 A;  5HKC A;  5IHN A;  1KD1 C;  2CRE A;  1D0X A;  5FWC A;  1IRE B;  1IB8 A;  1WNL A;  1YJN A;  1Q81 R;  2F2X A;  5GAN 5;  2E70 A;  3L2R A;  4FIB A;  4A4G A;  3A8G B;  1YIJ Q;  1ZX6 A;  4ELZ C;  1TXQ A;  2L3Q A;  1M2V A;  3MEV A;  1MMG A;  5KYX B;  1I4K 1;  2RJF A;  2LNH B;  5FU6 C;  4LDX A;  2E12 A;  4J7F A;  1U8R A;  1VQN T;  1PKS A;  2DKG A;  4PK4 A;  4FM4 B;  1RL2 A;  1OX9 A;  3N5B B;  2O2O A;  4Z88 A;  5J39 A;  2L2P A;  4F16 A;  2DVJ A;  3CC2 A;  8AT1 B;  3OS0 A;  1WLP B;  2VWF A;  1N8R U;  3I55 T;  4JDS A;  3CC4 A;  2PNI A;  3NMZ C;  3OY9 A;  3L2U A;  1ZLM A;  2KBT A;  3TVT A;  2RI2 A;  1K9M U;  2MAM A;  2OTL A;  1HJD A;  3J80 E;  4IIO A;  2X3X D;  1WHK A;  3G6E A;  3PVL A;  3OYB A;  2VYT A;  1PKT A;  2VV5 A;  3CC4 Q;  4QQG A;  2EW3 A;  3PGG A;  3CCR T;  1VQ9 Q;  3A98 A;  4JS4 A;  1GFD A;  3CBO A;  5LJ3 f;  3MP8 A;  4RUG A;  1G5V A;  3MP6 A;  4OVA A;  3LH5 A;  4M78 D;  2SEM A;  1G3T A;  3V8J A;  5IH2 A;  3JB9 J;  1BKB A;  1J3T A;  1SEM A;  2CP5 A;  4XTZ A;  4RTV A;  4M7D B;  5I2S A;  3OYK A;  4RTU A;  1QW1 A;  4M75 C;  2A28 A;  1YP5 A;  3GNF B;  3ZL7 C;  3RKY A;  4TVR A;  4BI3 A;  4N4I A;  2OTJ A;  1WXB A;  4F14 A;  3RNJ A;  2D0Q B;  4IUR A;  2V8I A;  2VKN A;  3QJ6 A;  4J9H A;  3OQ5 A;  2JMA A;  1KC8 U;  2E10 A;  3PE0 A;  3QUI A;  4KRT A;  3EHQ A;  1NEB A;  1UEC A;  4C92 D;  4AFQ C;  3NGP A;  3CCM T;  2DER A;  1UG1 A;  4EMK B;  3J7A F;  2J6K A;  4C8Q F;  1TG0 A;  2CSQ A;  2O88 A;  4EIK A;  3JCM Q;  1T0H A;  2DJQ A;  4XTU A;  1VQL T;  2EKH A;  3S3N A;  5GAM h;  2FZG B;  2XI9 A;  1NPP A;  2XIC A;  4J6W A;  5FU7 B;  2XHC A;  3JV3 A;  4MMK A;  3CCS T;  2BTT A;  3EGD A;  3I56 A;  4DBH A;  5C6S A;  2O9V A;  2DO3 A;  4GBQ A;  3M57 A;  1N5Z A;  3G4S Q;  2DLP A;  2KGT A;  2RHZ A;  4QVC A;  1VQ5 A;  1S72 A;  3MKD A;  1YBY A;  1IGQ A;  1D3B A;  2PQW A;  1NJI U;  1AOJ A;  3SDZ A;  3CCU T;  3OBY A;  4HVW A;  3OYH A;  4HCK A;  4M75 E;  3I56 Q;  1Q81 C;  2COZ A;  2X4J A;  3M4G A;  4A4E A;  2A36 A;  3JCM J;  1ZUY A;  2LMJ A;  5CIU A;  3G71 A;  4OMN A;  1A0N B;  1PC0 A;  1W2B P;  2B8A A;  2CZ0 B;  1X6B A;  3UPU A;  1VQ7 T;  3KBG A;  2KE9 A;  2M1H A;  3CME Q;  3QWX X;  2HNI A;  4E7L A;  1R77 A;  1B34 A;  3SWN B;  2X51 A;  2KR3 A;  1YIT Q;  2QDL A;  4F7U B;  4B6M A;  2CP0 A;  4KUD K;  1UUE A;  3HTR A;  5GAO m;  1VQP Q;  2KSS A;  2LNV A;  2LJ3 A;  3A8M B;  4PJO F;  5GMK m;  1PSF A;  3L2W A;  2XKO C;  1OYX A;  1XOV A;  1ZBX A;  3A8H B;  3QZ5 B;  5LJ5 h;  3REB B;  3CMA A;  1PG5 B;  2LT4 A;  2COW A;  2J06 A;  3CD6 A;  2W10 A;  2EGA A;  2BKD N;  2KDS A;  1N9R A;  1X6O A;  1OZ3 A;  1UGR B;  3EGX A;  3RKX A;  2GQI A;  3CMA Q;  1QVG S;  3JB9 H;  4X34 A;  1VQ6 Q;  1PD1 A;  2LX9 A;  1KJW A;  1CKB A;  2NYS A;  2QAS A;  2KRN A;  1VQM T;  3JB9 F;  2EPD A;  3CXC P;  5DLO A;  1I5L A;  1XTD A;  2DTO A;  2IIM A;  4C0G A;  3QII A;  2FEI A;  5HK0 A;  3NFC A;  4M75 D;  3NHN A;  2AKL A;  1YHQ Q;  4M78 B;  2KYM A;  5GAO q;  2EQU A;  1QKW A;  2V1Q A;  4IIM A;  4E7J A;  3JAM E;  2MYS A;  3LGF A;  2D8J A;  4OF1 A;  2QGG A;  4BY6 B;  1NE8 A;  2CKK A;  2AIR B;  4ORZ A;  3OA6 A;  2LCC A;  1X6G A;  3M54 A;  1K9A A;  2X4Y A;  3HFO A;  2RM4 A;  2E41 A;  2QQB A;  1OX8 A;  2CS7 A;  1N9S A;  1JQQ A;  4JRQ A;  1H92 A;  2QK0 A;  5IXF A;  1M2O A;  5GMK j;  3OYY A;  2F69 A;  2LP5 A;  2COY A;  2VUB A;  3PMI A;  1Q82 U;  3BW1 A;  4F7U G;  1QMC A;  2M0Y A;  3JB9 D;  3GOX A;  1BI0 A;  2BE9 B;  4JJC A;  1QWE A;  4F04 B;  2ZPE B;  4J9G A;  1WHH A;  3ER0 A;  3L2Z A;  1M1G A;  1TH7 A;  4C92 B;  3DB3 A;  1AVZ C;  7AT1 B;  1NYG A;  2K6D A;  2RI5 A;  5CKB A;  5GMK i;  2F5K A;  3PMT A;  2L0A A;  1G2B A;  3JRZ A;  2OJ2 A;  1VA7 A;  2LVM A;  1VQO A;  1TUC A;  3CCL A;  5CO7 A;  1M1K U;  1WHG A;  1RAE B;  1G3S A;  1OZ2 A;  3E9F A;  1OEB A;  4N0A A;  3PIO A;  4IKF A;  1O9S A;  3RUX A;  4PFO A;  4C5H A;  1Y96 A;  4Z89 A;  3LWH A;  3CC7 A;  2KXC A;  1W2B A;  5HY6 A;  5GJW B;  2M0O A;  1VQO Q;  1ARK A;  2P4R A;  2ZPF B;  5GAM e;  4K11 A;  3BY7 A;  2IVW A;  1GL5 A;  2EIF A;  1K0X A;  1WIE A;  2DJZ A;  4NS5 A;  5KYN A;  3CC7 Q;  2JTM A;  1BU1 A;  2BE7 D;  4JZ3 A;  1HYO A;  1Y7X A;  4A4K A;  2JTE A;  1WZO A;  4DA4 A;  2C0O A;  1Q95 G;  4M78 G;  3EG1 A;  1X2Q A;  4CRI A;  3L2V A;  1VQ8 T;  4FW1 A;  4KUI A;  1UGQ B;  1R0B G;  1I8F A;  6AT1 B;  5L8R E;  4J9C A;  1AWO A;  1KD1 U;  4IUU A;  2ZGW A;  3QG1 A;  2EBP A;  2JVV A;  1NZ9 A;  3OYF A;  4M7D F;  4HVV A;  2E3I A;  1WDX A;  1TOV A;  2WSC E;  2FO0 A;  2DBM A;  4KGZ B;  4OP0 A;  4QQD A;  3P8B B;  3SEM A;  3JCM X;  3CXC A;  4FCY A;  2RB6 A;  1PNJ A;  1D0Y A;  2FYK A;  4C92 G;  4Y28 E;  2RPN A;  2RQT A;  1LNX A;  4E7S A;  3NTH A;  5GAN j;  5LJ5 e;  3I9Q A;  3P8D A;  5GMK l;  1ZBJ A;  3I35 A;  1X43 A;  3UF4 A;  4C8Q A;  5LJ3 d;  4EPC A;  4BE1 A;  2GFA A;  3I55 Q;  1YI2 A;  4M77 F;  4HCB A;  3VU3 C;  2LRQ A;  1RI0 A;  3OSV A;  4M78 C;  4AFS C;  1KHI A;  4NOY A;  2QI2 A;  4JRI A;  5M9O A;  2FPD A;  4BDY A;  3EFO A;  2HAX A;  1W6X A;  1S1N A;  2DA9 A;  4BY6 C;  4M75 B;  3FEO A;  3EG9 A;  1H3H A;  1V29 B;  3S3O A;  2DM1 A;  1I07 A;  4J6Y A;  1GCP A;  1I81 A;  4N0A C;  4X9C A;  2RH2 A;  2C06 A;  5DY9 A;  2DIL A;  1K8A R;  5GAO p;  1SSH A;  3CCR Q;  4BB7 A;  2CZ1 B;  3FJP A;  3MCA B;  3H8Z A;  1AHJ B;  3DLL A;  5A2Q E;  1UGP B;  2DTI A;  3THK A;  2KRS A;  2YT6 A;  3PVQ A;  2BZX A;  4OMF B;  4AMC A;  2MCN A;  2DIQ A;  2VGN A;  3JCM P;  3GIB A;  4OMM A;  1U1S A;  2BIV A;  1QCF A;  1JJ2 P;  4PFZ A;  3A1P A;  1KQS S;  1ZSG A;  1M2V B;  5GAN 8;  1M5Q 1;  1YJ9 T;  3L1A A;  4C92 C;  5GAM f;  3CPW A;  4M77 D;  2KQW A;  4XU3 A;  2MOX A;  3OMG A;  5KYU A;  1MV3 A;  3KUF A;  1M1F A;  3SB2 A;  1WHM A;  1ZUK A;  4F7U F;  1SKU B;  2GTO A;  2DD5 A;  3CQT A;  4RTT A;  3CCM A;  1ZUU A;  5IAY A;  4RKU E;  2EGC A;  2NUZ A;  2CUB A;  2AHJ B;  2DZC A;  2GNC A;  1YIJ A;  2GBQ A;  4M78 E;  3X28 B;  2DTH A;  2JOY A;  4IUQ A;  4AG2 C;  2FZC B;  2HKQ B;  4QKU A;  2LQW A;  3EHR A;  1SPK A;  4M7A F;  1WGS A;  3CCQ A;  5CKH A;  3CCM Q;  3HSB A;  1RAH B;  1MMN A;  2EQK A;  2K9G A;  1PHT A;  1YFN A;  3IQL A;  1BBZ A;  2F1L A;  4IUT A;  5CQY A;  1YWO A;  4J5Y A;  2DK3 A;  4FL6 A;  3E2U A;  2QEX T;  1YJW T;  4II1 A;  1KQ1 A;  3VUB A;  3CCQ Q;  2GGR A;  2HBP A;  2HSP A;  1OPL A;  4C8Q C;  1MMD A;  1Q86 R;  4M75 G;  3CBP A;  4DBR A;  3U23 A;  1HXD A;  1K9M R;  1HK9 A;  1WA7 A;  2GF7 A;  3HP9 A;  2DIG A;  1JEG A;  2QQS A;  1U3O A;  1UDL A;  4ZGE B;  1Q81 U;  2QQ9 A;  4KH1 B;  1VQK T;  5LJ5 f;  3GF5 A;  4C92 E;  4HVU A;  4R0K A;  3HL8 A;  2OAU A;  2JT4 A;  4QQ6 A;  1OQK A;  3QZ9 B;  4A53 A;  4OMQ A;  2RD1 A;  2DEU A;  3VRY A;  1K76 A;  1BCM A;  4C5E A;  1VQ9 A;  1ZHI A;  3CCE T;  4FYX B;  3OYI A;  1YNZ A;  3RKW A;  3CCJ A;  3PT9 A;  1KFZ A;  2NLU A;  2RF0 A;  4JS5 A;  3CEY A;  1JXM A;  1X69 A;  2VAS A;  2IPO B;  2FHD A;  2QA4 T;  1RAC B;  3OYL A;  3QJY A;  5LJ3 g;  1RAA B;  1H64 1;  2DBK A;  3OW2 P;  1RAI B;  1UGV A;  3CCJ Q;  1UE9 A;  2RHI A;  2SRC A;  1UJ0 A;  2KEA A;  3OYD A;  2ZPG B;  2DL7 A;  1WYX A;  2AKK A;  3HRU A;  4BI4 A;  2LDM A;  2FRW A;  3MEA A;  3O5Z A;  1C1A A;  3VYH B;  2DPP B;  2CH4 A;  4JLI A;  2ABL A;  2FL7 A;  4BUG A;  3EGD B;  5GAO n;  1P92 A;  5C0M A;  1VIF A;  2EFI A;  2PUK B;  3NTK A;  1KC8 R;  1T3L A; 
#chains in the Genus database with same CATH homology
 1N9R A;  2EJ9 A;  2V8J A;  1K73 C;  1X6O A;  1K8A C;  4XU2 A;  1OZ3 A;  3M4Y A;  1UGR B;  3LH0 A;  3RKX A;  2ZPH B;  2VC8 A;  1D3B B;  3BDU A;  2P0Q A;  2A7Y A;  2YHT A;  4X34 A;  4ME7 A;  4OGC A;  5FU6 B;  4C92 A;  1QVG S;  1VQL A;  3SWN C;  2LX9 A;  2EJF A;  1VQ6 T;  1EIF A;  2RA2 A;  2QEX A;  3UWN A;  1JJ2 A;  2KK4 A;  3E19 A;  2X4W A;  2YLC A;  4CI0 C;  1VQM T;  2O01 E;  3A8O B;  4J8O A;  5GAN 6;  5KCO A;  3CCS A;  3JB9 F;  5DLO A;  1I5L A;  1M9S A;  1XTD A;  3X20 B;  2DTO A;  2E6Z A;  5DLQ E;  2EKO A;  2D6F A;  1R8O B;  2R5A A;  2RJC A;  4C0G A;  1VIE A;  3OS1 A;  4JRP A;  3QII A;  1Y71 A;  3TRE A;  2CZ6 B;  2PVO B;  5HK0 A;  3NFC A;  5CAI A;  3JSC A;  3M55 A;  4M75 D;  2K5L A;  5GAN 7;  3G4S A;  3P8H A;  3CBM A;  5LJ3 j;  3QSU A;  4L5G A;  2RK2 A;  1XNI A;  1WQW A;  2E65 A;  3H6Z A;  4M78 B;  1VQK A;  5GAO q;  2EQU A;  5CVI A;  2QQA A;  4ZN3 A;  1YHQ T;  3CPF A;  4OB3 B;  3CCU A;  4DOW A;  1B34 B;  3FC3 A;  4E7J A;  4GLK A;  2LCL A;  3JAM E;  3LWI A;  2WSF E;  2V8K A;  3LGF A;  3URG A;  4C0Z A;  5A0L A;  3PTA A;  3HKS A;  4OF1 A;  3TEE A;  4BY6 B;  1NE8 A;  2CKK A;  3OA6 A;  4PJO G;  3CCE A;  3QPH A;  2XD0 A;  5GAM j;  2LCC A;  3JCM g;  3M54 A;  2X4Y A;  4WF2 A;  3PFS A;  3HFO A;  4RG2 A;  5GMK h;  2CYZ B;  2RM4 A;  2E41 A;  2QQB A;  2CS7 A;  1WJQ A;  2K3X A;  1N9S A;  3OMC A;  5IT9 E;  1VQ7 A;  3V7R A;  4JRQ A;  3TU4 K;  1PSE A;  4LDV A;  3QKJ A;  4KUL A;  3JCM c;  4LDY A;  3L42 A;  5LJ5 g;  3MHX A;  2DD4 A;  2EJG A;  2VGM A;  2LT1 A;  5GAO l;  2K3Y A;  4M78 F;  3CME A;  1JRI A;  5GAN 3;  1VQ4 A;  1MHN A;  3HRS A;  1YJN T;  5GMK j;  4LDU A;  3OYY A;  2RO0 A;  4Z02 A;  4R55 A;  2QA4 A;  2Y90 A;  4MZP A;  2F69 A;  3S6W A;  4C5I A;  4EDU A;  2VUB A;  3PMI A;  5IN1 A;  3TCJ A;  3BW1 A;  1Q82 U;  4F7U G;  2A3L A;  1BYM A;  3X25 B;  2K57 A;  3JB9 D;  4PJO B;  1KHC A;  3GOX A;  3CCV A;  4M7A D;  1BI0 A;  1YIT A;  4XK8 E;  2DVE A;  2Y4Y A;  4V2S A;  2DXT A;  4MZT A;  2EQJ A;  3WXM B;  2QTX A;  1VQP A;  1Q82 C;  4E7K A;  1Q86 U;  2ZPE B;  2RI3 A;  4C8Q D;  4RMO A;  3LX7 A;  3ER0 A;  3L2Z A;  3JB9 H;  1M1G A;  1TH7 A;  4C92 B;  2DAQ A;  5I21 A;  3DB3 A;  4HCC A;  2RI5 A;  2MI6 A;  1LJO A;  5CKB A;  5GMK i;  2F5K A;  3PMT A;  1Q86 C;  3JB9 G;  4F7U E;  3FDR A;  5CR2 A;  2GFU A;  3OYN A;  3JRZ A;  3GNG A;  2QXF A;  3L2Q A;  2RK1 A;  5J26 A;  1K9M C;  5A0D A;  1Y07 A;  2LVM A;  2QQR A;  3PIP A;  5CKE A;  1VQO A;  3CCL A;  5CO7 A;  3CC2 T;  3CCV T;  1M1K U;  2LQ8 A;  3QYG B;  3FLG A;  3S3M A;  3JCM h;  5LJ3 e;  1YI2 T;  4M77 A;  1G3S A;  1OZ2 A;  1QP2 A;  3OBW A;  3E9F A;  3CC4 T;  3F70 A;  4N0A A;  4OB1 B;  3PIO A;  4IKF A;  1O9S A;  1FWZ A;  3RUX A;  3OYG A;  4C5H A;  1Y96 A;  3LWH A;  3CC7 A;  4O5V A;  1M1K C;  4FSX A;  3NTI A;  1IZ6 A;  2EQM A;  4HKE A;  2OTL T;  1W2B A;  5HY6 A;  4M7A E;  1U1T A;  2DXU A;  2JTF A;  2M0O A;  1BI1 A;  4C92 F;  4XTW A;  3G6E T;  1VQ8 A;  3QDR B;  2ZPF B;  1VQ6 A;  2E1H A;  5GAM e;  3Q1J A;  3MO8 A;  3BY7 A;  4LDW A;  2IVW A;  4PJO C;  4C8Q E;  1VQM A;  2EIF A;  2FB7 A;  5DM7 R;  3OB9 A;  2DXB A;  3SFM A;  2KVQ G;  4PKC C;  2DJZ A;  4NL2 A;  4FU6 A;  4MZM A;  4RCB A;  1DJ7 B;  2JUF A;  4NS5 A;  2XID A;  5GAN g;  2RHY A;  2JTM A;  3VKI A;  4OGE A;  3HRT A;  4YTL A;  2RJE A;  1VUB A;  4ELY C;  3CC7 T;  4KBM B;  2ZZD A;  5GAN 4;  2CZ7 B;  1Y7X A;  3OW2 A;  2JZ2 A;  3C12 A;  4A4K A;  5D6W A;  2FVU A;  1ZQ1 A;  2HQX A;  4DA4 A;  2EWN A;  3M59 A;  4RG8 A;  4M78 G;  4KT0 E;  3GLX A;  4CRI A;  4PNO A;  3L2V A;  2RHX A;  1VQ8 T;  4KUI A;  3M9Q A;  1UGQ B;  4C0F A;  3JCM W;  1I8F A;  1YHQ A;  4HT9 A;  3DB4 A;  4E7H A;  4M75 A;  3JCM b;  4EMH A;  3OYM A;  2MWO A;  2ZPB B;  2KMT A;  2PUO B;  5L8R E;  4O6J A;  4B9X A;  4ZTJ A;  2EYQ A;  3CPW S;  2QDY B;  2PVG B;  2HD0 A;  3A5Z B;  4N4G A;  1G3Y A;  3ZEH A;  3GPL A;  1KD1 U;  2CGH A;  3LYI A;  4IUU A;  2XDP A;  1QVF S;  4ZGJ B;  1UB4 A;  2ZGW A;  4QVZ A;  3QG1 A;  4PJO D;  5EG2 A;  4RCC A;  1G3W A;  2JVV A;  1YCY A;  3LW5 E;  1NZ9 A;  4DOV A;  3OYF A;  4M7D F;  3M53 A;  5HKC A;  1KD1 C;  2WSC E;  1IRE B;  3VJP A;  1WNL A;  1WQ7 A;  2OTJ T;  1YJN A;  2P0P A;  3UT1 A;  1KC8 C;  2L89 A;  4OP0 A;  2PVD B;  4J83 A;  4QQD A;  3P8B B;  5GAN 5;  5J3B A;  2E70 A;  3L2R A;  1QP3 A;  4M77 B;  4FIB A;  4Q5W A;  3A8G B;  4A4G A;  5GAN h;  1JJ2 S;  3QO3 A;  4ELZ C;  1X75 C;  5KCH A;  3JCM X;  1H3Z A;  3MEV A;  4IUP A;  1YIJ T;  4LD9 K;  1KG1 A;  1I4K 1;  3JCM e;  3CXC A;  2RJF A;  3E9G A;  3C95 A;  1N27 A;  4ZN1 A;  5CK9 A;  5FU6 C;  4M7D A;  2JNG A;  2RB6 A;  4LDX A;  2E12 A;  2FYK A;  4J7F A;  4OB0 B;  4C92 G;  4Y28 E;  1U8R A;  1VQN T;  1M8V A;  1LNX A;  3NTH A;  1UEB A;  2DKG A;  5GAN j;  4M7A A;  2ZCF B;  4FM4 B;  3CCQ T;  5LJ5 e;  1RL2 A;  3P8D A;  5GMK l;  3N5B B;  4BE0 A;  2R58 A;  4PJO E;  5J39 A;  3C4S A;  3T9N A;  4C8Q A;  2EAY A;  3INZ A;  4EMG A;  5LJ3 d;  4EPC A;  4BE1 A;  3CC2 A;  1M90 U;  3OS0 A;  4MDX A;  4J6X A;  2GFA A;  1YI2 A;  1N8R U;  3HFN A;  4FT4 A;  4M77 F;  5FRO A;  4HCB A;  3I55 T;  3VU3 C;  4JDS A;  3OS5 A;  3CC4 A;  2LRQ A;  3OY9 A;  5LL6 S;  1RI0 A;  3OSV A;  4M78 C;  3L2U A;  2X4X A;  2MWP A;  1WJS A;  3QYH B;  1NPR A;  2RI2 A;  1K9M U;  1KHI A;  2DEQ A;  4NOY A;  2QI2 A;  3MEU A;  4JRI A;  3DLM A;  5CKF A;  3RIR A;  1M90 C;  3MET A;  5M9O A;  4BAC A;  2MAM A;  4D6W A;  1N8R C;  2OTL A;  4BDY A;  4ZGD B;  5KE2 A;  2HAX A;  2GQV A;  2R57 A;  3J80 E;  5KE3 A;  3I56 T;  5GAM d;  3G6E A;  4BY6 C;  4JUV A;  4M75 B;  1KQ2 A;  3A8L B;  3FEO A;  3RMQ A;  2E5Q A;  1V29 B;  3OYB A;  4M77 C;  2VYT A;  3S3O A;  4J6Y A;  1VQ5 T;  4XU0 A;  1I81 A;  4P5N A;  4N0A C;  4A4F A;  4EMK A;  2VV5 A;  1S72 T;  3AHU A;  4X9C A;  1O75 A;  4QQG A;  2RH2 A;  2IG0 A;  1N6A A;  3VYG A;  2C06 A;  5DY9 A;  2LTO A;  2O4X A;  5GAO p;  4M7D G;  4BB7 A;  2CZ1 B;  3FJP A;  3MCA B;  3H8Z A;  4BD3 A;  1AHJ B;  3PGG A;  3CCR T;  3DLL A;  5A2Q E;  1UGP B;  2D9T A;  2DTI A;  4JS4 A;  3CBO A;  5LJ3 f;  1WJR A;  1VQ9 T;  3E1S A;  3MP8 A;  1G5V A;  3OS2 A;  1X01 A;  1FXX A;  3OSS C;  3G71 T;  3VV0 A;  3MP6 A;  3MEW A;  1QVP A;  4OMF B;  4M78 D;  4OVA A;  3QHS A;  3V7C A;  1G3T A;  3BFM A;  4M75 F;  1MGQ A;  2E6N A;  2DIQ A;  2VGN A;  3UDC A;  4C0D B;  3JCM P;  3CCJ T;  5CQX A;  1QVG A;  3EAE A;  3GIB A;  1U1S A;  3V8J A;  2BIV A;  4VUB A;  3RES A;  3JB9 J;  1BKB A;  2LQK A;  1KQS S;  3EFR A;  2P4T A;  4XTZ A;  5GAN 8;  1M5Q 1;  4MML A;  1YJ9 T;  5AYF A;  3L1A A;  4C92 C;  5GAM f;  5GAN e;  4M77 D;  5I2S A;  3ASK A;  3CPW A;  4M7D B;  3HHT B;  3OYK A;  5GMK e;  2KQW A;  4XU3 A;  2DZ9 A;  5FRM A;  3MP1 A;  3O8V A;  1QW1 A;  3OMG A;  3FB9 A;  4M75 C;  4M7A B;  4HA8 A;  3KUF A;  1M1F A;  3GNF B;  4XAX B;  3RKY A;  3SB2 A;  1W4S A;  4TVR A;  4BI3 A;  1OI1 A;  4N4I A;  2OTJ A;  4F7U F;  4C8Q B;  2XK0 A;  2MF2 A;  2DD5 A;  5GAN 2;  1W2B S;  3X26 B;  2D0Q B;  4IUR A;  3CCM A;  1Q7Y U;  3OYJ A;  5IAY A;  2V8I A;  4M77 G;  3QJ6 A;  2DXC A;  4BI8 B;  4ATO A;  2WAC A;  4RKU E;  4R56 A;  3JB9 I;  3OQ5 A;  4XU1 A;  3JCM d;  4N4H A;  2AHJ B;  2DZC A;  4NL3 A;  1YIJ A;  4M78 E;  3X28 B;  1Q7Y C;  3CMA T;  4BDZ A;  2DTH A;  2JOY A;  4IUQ A;  3M5A A;  4IUV A;  1KC8 U;  2E10 A;  3QUI A;  3OYE A;  5GAO r;  1YJW A;  3C94 A;  3SD4 A;  1VQN A;  5I2M A;  3SWN A;  5LJ5 d;  5LJ3 h;  3CD6 T;  4M7A F;  1WGS A;  4C0D C;  3OYA A;  5CKH A;  3CCQ A;  3HSB A;  4J7I A;  4F7U A;  4C92 D;  4A54 A;  2X35 A;  4JLG A;  1WPY A;  5A0G A;  3OW2 S;  4HT8 A;  2EQK A;  4M77 E;  5FRN A;  3VUZ A;  3CCM T;  3OYC A;  4QW2 A;  3LGL A;  4EMK B;  3J7A F;  4C8Q F;  1FX7 A;  4UC4 A;  4IUT A;  2L5Q A;  4MDW A;  3JCM Q;  2R5M A;  4M7D C;  5CQY A;  3G7Z A;  1XQH A;  2VXF A;  1Y96 B;  2M9U A;  2O4X B;  4XTU A;  1VQL T;  3I55 A;  2XDB A;  1M4Z A;  5GAM h;  3S3N A;  2JN0 A;  2DK3 A;  2L8D A;  4FL6 A;  4J5Y A;  5FLX E;  2XI9 A;  2QEX T;  1NPP A;  2XIC A;  4M7A C;  4J6W A;  1YJW T;  5FU7 B;  2XHC A;  1KQ1 A;  4II1 A;  3VUB A;  4C5G A;  1LOJ A;  4MMK A;  2HBP A;  3DKM A;  3CCS T;  3FIF A;  1JBM A;  4C8Q C;  3J81 E;  4M75 G;  3CBP A;  4OB2 B;  3I56 A;  5C6S A;  2DO3 A;  3M56 A;  3V8K A;  1HXD A;  3JCM f;  4XTX A;  5D6X A;  3M57 A;  3EFS A;  1HK9 A;  2GF7 A;  3HP9 A;  2DIG A;  2RHZ A;  3M58 A;  3JCM V;  4QVC A;  4A4H A;  1VQ5 A;  2RHU A;  3G4S T;  1GXI E;  1S72 A;  2QQS A;  4ZGE B;  4PLI A;  2L3R A;  4XQ3 A;  1Q81 U;  2QQ9 A;  2PU9 B;  1YBY A;  1VQK T;  5LJ5 f;  1D3B A;  3GF5 A;  2PQW A;  3ME9 A;  3ZBD A;  4C92 E;  1NJI U;  2LC4 A;  3HL8 A;  2OAU A;  3QXE B;  4QQ6 A;  3QZ9 B;  2VXE A;  4L6V 5;  2F5T X;  1JB0 E;  3SDZ A;  3OBY A;  4A53 A;  2RD1 A;  3CCU T;  5HK3 A;  3OYH A;  4BE2 A;  2GCX A;  4JJN K;  4M75 E;  3CCR A;  1Q81 C;  2X4J A;  4M7D D;  1UGS B;  3M4G A;  4A4E A;  4C5E A;  1VQ9 A;  3CXC S;  1NJI C;  4GY5 A;  1ZHI A;  5CKD A;  3JCM J;  5CIU A;  5CCA A;  3CCE T;  3ZFJ A;  4EMK C;  3OYI A;  3G71 A;  1BI3 A;  2KY9 A;  3RKW A;  2B8A A;  2CZ0 B;  3CCJ A;  2K4Y A;  3WVE B;  2YLB A;  3UPU A;  2E64 A;  3V8L A;  5KH6 A;  3PT9 A;  1VQ7 T;  3KBG A;  2MMP A;  2NLU A;  4E47 A;  2M1H A;  1SSF A;  5GAN d;  2YRV A;  2KAF A;  4LD6 A;  1YJ9 A;  1BI2 A;  4JS5 A;  4HCZ A;  3CEY A;  5FU7 C;  3GP8 A;  4M78 A;  3CME T;  1VQ4 T;  2HNI A;  3X24 B;  4XTV A;  4E7L A;  1KQS A;  2FHD A;  2QA4 T;  3PNW C;  4L59 A;  1B34 A;  2G3R A;  2HQE A;  3LLR A;  3QJY A;  3SWN B;  3OYL A;  4M7A G;  2M16 A;  4FT2 A;  2ZPI B;  5LJ3 g;  1H64 1;  4F7U B;  4KUD K;  4JRK A;  4B9W A;  1YIT T;  3V7S A;  2RJD A;  4C8Q G;  2RHI A;  5GAO m;  2KSS A;  2XU8 A;  2K5I A;  2LNV A;  3A8M B;  4PJO F;  1BIA A;  2P0K A;  4QVD A;  5GMK m;  1VQP T;  1PSF A;  2XDD A;  3L2W A;  3HPW A;  2XKO C;  4M7D E;  3OYD A;  2ZPG B;  1OYX A;  1XOV A;  1ZBX A;  3HRU A;  5D6Y A;  3WVD B;  3RER A;  4BI4 A;  3A8H B;  1BIB A;  2I2L A;  2LDM A;  3QZ5 B;  4Y91 A;  3QBY A;  2XG8 D;  5LJ5 h;  5GAM g;  4PLL A;  4X9D A;  2Y4X A;  2K2V A;  2WSE E;  3R6O A;  3CMA A;  2BUD A;  3MEA A;  4E7I A;  3VYH B;  2DPP B;  4JLI A;  2LT4 A;  3BDL A;  1K73 U;  1VQO T;  5LJ5 j;  1QVF A;  2FL7 A;  4BUG A;  3RMS A;  1K8A U;  3CCL T;  5GAO n;  3CD6 A;  1P92 A;  5C0M A;  3FRN A;  1VIF A;  4ZTF A;  2EFI A;  2PUK B;  2K5F A;  4DQ2 A;  4PJO A;  3NTK A;  2H3J A;  5GAN f;  3KXT A;  4XTY A;  2BKD N;  4PL6 A;  2KDS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...