4C0HA

Extended interface between pcf11p and clp1p and structural basis for atp loss in gly135arg point mutant
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
427
structure length
422
Chain Sequence
GDNEWHKLVIPKGSDWQIDLKAEGKLIVKVNSGIVEIFGTELAVDDEYTFQNWKFPIYAVEETELLWKCPDLTTNTITVKPNHTMKYIYNLHFMLEKIRMSNFEGPRVVIVGGSQTRKTSLSRTLCSYALKFNAYQPLYINLDPQQPIFTVPGCISATPISDILDAQLPTWGQSLTSGATLLHNKQPMVKNFGLERINENKDLYLECISQLGQVVGQRLHLDPQVRRSGCIVDTPSISQLDENLAELHHIIEKLNVNIMLVLCSETDPLWEKVKKTFGPELGNNNIFFIPKLVDDVYKRSLQRTSIREYFYGSLDTALSPYAIGVDYEDLTIWKPSNVFDNEVGRVELFPVTITPSNLQHAIIAITFAERRADQATVIKSPILGFALITEVNEKRRKLRVLLPVPGRLPSKAMILTSYRYLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for ATP loss by Clp1p in a G135R mutant protein.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
molecule keywords MRNA CLEAVAGE AND POLYADENYLATION FACTOR CLP1
total genus 121
structure length 422
sequence length 427
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06807 Clp1 Pre-mRNA cleavage complex II protein Clp1
A PF16573 CLP1_N N-terminal beta-sandwich domain of polyadenylation factor
A PF16575 CLP1_P mRNA cleavage and polyadenylation factor CLP1 P-loop
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.1030 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4c0hA01
3.30.70.2410 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4c0hA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4c0hA02
5AJVB 3CWQA 4XH9B 3WRYC 5HCNA 4NYMQ 5FL7A 4CDGA 1OIWA 1R10A 4L9WA 3VR5A 3AKYA 3TH5A 1FOEB 2X8AA 2QROA 4LJYA 3NDBB 5KNDA 4LPSA 3L8ZA 3FMFA 3EZ7A 3VNUA 4QOSA 2R6AA 1A7JA 1CKEA 2D7DA 4RZXA 2F9MA 4D80A 1KMHB 2GRJA 3A36A 3B1YA 3NH9A 1XD2A 1BMFA 1ZJ6A 4DSOA 4JLDA 1UPTA 3S1AB 3PEWA 5EE1A 4K8OA 2PJZA 3TUJC 2JLVA 4QJ3A 1UKYA 5KSPA 3W3ZB 2RGAA 2QAGB 2J59A 1XTIA 2QORA 2WJGA 1M34E 2OT3B 3A1SA 4TT3A 2IEYA 3GD7A 1E0AA 3IPYA 1G41A 1H8ED 3CRRA 1R8QA 1XDBA 1GWNA 1Q1EA 2FDCA 1CR0A 4Q4LA 4E22A 1GAJA 1OXVA 1AN0A 5D3QA 4KYIB 2C8VA 2G3YA 4JVSB 4ZKEA 5KHOC 2PEYA 3ZS9A 3U60B 1ZCAA 3GLIA 2H18A 4Q1AA 2ZYUX 4IDQA 4F4IA 1P6XA 2GCNA 2QTHA 5FTMA 3SS8A 4OI1A 1IHUA 4A6XA 1XEXA 4DCTA 1KHTA 3I32A 2PMKA 2XSZD 4M1TA 4BFXA 2NZ8A 4LDJA 2WMOB 2A5JA 1G3UA 1KGDA 1W0KD 3ASZA 2O8EA 4BLSA 4TLDA 1UBCA 2WIBA 3NHAA 3EPJA 1ZU4A 3CH4B 3KQLA 3AVYA 5LD2C 1KAOA 1E2NA 1NL3A 4XWKA 4DCVA 1AS2A 4RKEA 3PEVA 3SHFA 3LLUA 1RYHA 1YR7A 3BH0A 4BFYA 4TMKA 3CRW1 4BZXA 2ZAOA 1ZAKA 4NCHA 3LX5A 2IYYA 4R71A 2OESA 3AVUA 3SZRA 1V5WA 3WBKA 2QGNA 3QEJA 2WJYA 4YLGA 2JJ2A 1XFAA 4ZIRB 1E32A 2F6RA 4W5WA 3KKMA 1N5JA 2ZYWX 2KBFA 1U94A 4UXHA 1N2CE 1WMSA 2WOOA 4JVMA 4FMBB 3KZ1E 3BXZA 1H8HA 1G1MA 1WRBA 1W2HA 3AVWA 2XXAB 3EIQA 3B9PA 3TAUA 421PA 2EYUA 2HLDD 5JLJA 1T0JB 1CS4C 3U61B 4IFEA 5DO9A 2VYFA 4GP7A 3IDQA 2OFOA 3EWSA 4BEBA 5A4JA 4N1AA 3ZVLA 5B64A 2D2EA 3IEUA 3B78A 1S0UA 4B3FX 2BBTA 3FMIA 1TQ6A 4LC1A 3UATA 2F3TA 3DMNA 4D0NA 2XNDA 4F4JA 4TN1A 1TQ4A 4UJ5A 4QGFA 5J40A 4B6EA 4KV9A 1E2PA 4G0NA 3GLFA 2JLXA 4D25A 3ZIAD 3AKCA 1ESMA 4QHYA 4LX0A 4HB2A 3GLHE 1UBEA 5CDFE 2J9RA 1EFRD 3KQNA 1Q22A 3BB3A 4BEJA 2R6CA 2BMEA 4E5UA 2WTUA 3MAAC 4QHSA 2IT1A 1E2LA 3RNLA 2VHTA 2VSFA 4K81B 1GIAA 3KKQA 4A8JB 1T91A 4OK5A 2ZRNA 2J1LA 1P2VA 4JKYA 4NMMA 5DHAA 3SBEA 1OT3A 4TMZA 4XVQA 2NPIA 3VR2A 4M1WA 1A4RA 3UMRA 2IS4A 1J99A 1I2DA 3HR8A 3ZD6A 4HLDA 2XJ9A 4NCIA 2V3CC 1R5NA 2JLQA 1XX6A 1R0ZA 4AI6A 1DARA 3OZXA 2OG2A 1P73A 3P27A 5HTKA 1WB9A 1IY0A 2BBOA 3MWJA 4JLVA 2ZI9A 2QQEA 5HZKA 1XPRA 2H5EA 3L2OB 1VPLA 5EUQB 3REFA 1PUJA 1R6BX 1U0LA 3N2IA 1BH2A 4M9ZA 3UWOA 4EPXA 2WPDA 5G3YA 4RD2A 3EZ6A 5HCIA 3GEIA 1XZPA 3QF7A 1NN0A 1IQPA 1DOAA 4TQ9A 4LV8B 3ND8A 4PANA 1S4QA 3VX3A 1DAHA 4MQBA 2WV9A 1Z3IX 4CEJB 1NVWQ 2FFAA 1VECA 5C4GB 1G291 1E2MA 4HAUA 4HDQB 5D3MA 1KYIA 4RD1A 3GLIE 1JJVA 2V1UA 2IYWA 2Q21A 4OI0A 1A5TA 4I81A 2IYZA 1ZCBA 2QT0A 2A7QA 2P0EA 2QSYA 3NWJA 3GLFB 4LI0A 2LKDA 2ZROA 2BOVA 2ZJBA 3FHTA 5KPDA 4DT1A 1DBSA 1ZP6A 3WMFA 1BYIA 2CE7A 4B73A 2JJ1D 5FTJA 1W36D 1Z08A 2HJVA 4GBMA 2CBZA 3ADKA 3VR3A 1I4TD 2YC4C 4O25A 3QPVA 1E6CA 1L7VC 4DDVA 4JT4A 3GJ0A 4URXR 4EPVA 1XMVA 1E2JA 1GUAA 4X8MA 1GNRA 3K0CA 3OFNA 3W8RA 2R8RA 3AGPA 1W36C 5EE0A 3W6OA 4NKRA 4OK3A 2F1JA 5DHFA 4LJ4A 3MWYW 2HV8A 2ORVA 1WF3A 2GEDA 4KFSA 2VPPA 3C5CA 1ZNZA 3L43A 2W0MA 1NJFA 1G17A 3K0FB 4FWTA 3MMPA 4ARZB 1S3GA 621PA 3KJEA 3O8RA 3B6EA 2GCOA 2GVDC 1KIMA 2H57A 2Q3MA 3BBPA 1KNXA 2IWHA 1E2FA 4JLMA 4Q47A 1TPZA 4WZ6A 4Q7LA 3FOZA 4CRWB 5EZ6B 3EPLA 4XTCS 2NMVA 3AF0A 2GXUA 2UVQA 3GJ8A 1IY2A 1CJVC 1HE1C 3ZVNA 5IRCD 2H17A 2IEZA 2YNMA 5AJXA 4Q5IA 5JI3E 1XD9A 3UMFA 3QKTA 2AWOA 4OHXA 3W8NA 3UK6A 2BEKA 1C9KA 3TSZA 3PR1A 2H8KA 4C0JA 1UKEA 2C78A 2YC2C 3KUCA 3KTAB 3DDCA 3IPXA 5FBVB 2AK3A 4RFSB 5CK5A 2RH5A 1E2EA 4C7OB 4HI0E 3WNDA 4KODA 4QBGB 1S1MA 2ZSAA 3WRXC 4GOKA 2ZI5A 4D82A 1E1QA 1KI2A 2O0JA 1XU4A 4DCSA 2MSDB 3HWSA 1F6BA 4TSFA 5CLLA 3WMGA 3AF2A 4JYCA 3A4LA 2E87A 2QZ4A 5K8TA 4I4LA 1C4OA 1GM5A 1P7CA 4EPRA 2FMXA 3RS7A 1JPNA 1G4UR 2J0UB 5KNCA 1LFDB 3UG6A 2CHGA 4JSTA 4PPGA 2Z6VA 2ZRHA 3GLHB 1JR3D 4ZCIA 2O52A 3LY5A 2FF7A 1IXSB 4RD6A 4F93B 3KUDA 3BFVA 1NBMD 3R20A 3CR8A 3HPRA 3VR4A 3CNLA 4F7WA 1QHYA 1KO7A 3CPEA 3HPQA 2OE2A 3K0SA 1PJRA 4ZKDA 2GXAA 3H2YA 3FHOA 1NN5A 1XZQA 3K53A 3NEJA 2FV8A 4Q1FA 4CZ2A 3OAAA 4O2RA 1NLFA 4B74A 1NI3A 2ORWA 1E4VA 1XF9A 2IK8A 1YR6A 3AP2A 4ZIRA 4M22A 2ZYVX 2XAUA 2BCGY 3IKJA 3BK7A 5DE3A 3BERA 4POAA 4XOIA 3NG1A 2QAGA 4D0GA 3AM1A 2F3RA 4NYIQ 1US8B 2NIPA 5G41A 1LNZA 3RVBA 4Q1CA 1Z0JA 5EE9A 1M7HA 4DUGD 5KUTA 3EZ2A 2AD1A 4ZCMA 2QL6A 2J5XA 4ZV4A 5GVSA 4DDWA 2VTKA 2EFEB 1U0JA 1US8A 4RZ2A 1JJ7A 4X8HA 4N0EA 2BJWA 5BYKA 3P20A 2OILA 1S1CA 3CRMA 3QF4B 4NHOA 2G6BA 3TRFA 2BMFA 1U99A 1XTSA 1KDRA 3A37A 4BLQA 3BOSA 4WIAA 4TQAA 4TZ0A 3NC0C 4KJZA 4TZ6A 3PQCA 1CLUA 3LAWA 3OE7D 3TAHA 2FFHA 3ETLA 1FNMA 2R65A 1P5ZB 1HUQA 3EWAA 3TJZA 2VL7A 4PSAA 3IILA 3RRMA 2RGXA 4DZZA 1KDTA 1GNPA 1AGPA 2AR7A 4AD8A 3V00A 3F3YA 3WY9A 4XWOA 3L0OA 3AVOA 4IW3B 1DADA 1LTQA 2VO1A 2QMUA 2QA5A 1IN7A 1MV5A 2MMGA 2TMKA 1R4AA 1JBKA 3LW8A 5ELXA 2A5GA 4UKDA 4A92A 2O5VA 2FSGA 3G0HA 1L8QA 1E0KA 5KDOA 1T9HA 1XP8A 4BQSA 1Q1ZA 3K1JA 1FNNA 4Q21A 3QXHA 1MO5A 4G5OA 1XTKA 1G6HA 2GEVA 2AXPA 3THXB 1OHHD 2FSFA 4LV6A 5C4MA 3RS4A 4EJSB 4NYJQ 4BE7B 4N3NA 3KXKA 2ZRMA 1JI0A 1FQJA 1NKTA 4ABYA 2CLCX 4ITRC 2XB4A 2WWGA 3QXXA 4M1OA 2NGRA 1W4CA 5JBQA 3O8CA 3SEAA 1J8YF 2GZHA 4A2QA 1UFQA 2C77A 3UMSA 1GL7A 5FOUA 3TQFA 1PV4A 1VG0B 1IN8A 4NDZA 3RC8A 4OK6A 4C0AC 3CB4A 4NH0A 3TUIC 2GETA 3GLGA 3QNUA 1VG1A 4YMTA 4MRRA 3CUEF 2GJAA 3BD9A 1E9CA 4XD7A 1LB1B 1KNQA 3PG5A 1P3JA 2ZJAA 4L8GA 5FL3A 3WHLA 3ZVRA 4CEJA 1N6IA 5B58C 3BWDD 2ZRIA 1U0HC 1VYUA 2P6UA 2F43B 3ZZUA 3U7HB 4ZDIA 4TQUS 1M7BA 4HUQB 3RRZA 2IUTA 4YONB 1G20E 4HB3A 1S3SA 2QP3A 3BIFA 5CIWA 3QKSB 3EIHA 5CJ2A 4C2TA 1E1QD 1DO2A 3QVUA 4TMWA 4DXAA 3M0EA 4RD4A 1OFTA 1GRQA 1Q20A 4LZZA 4DSTA 1NVVQ 1G16A 3TLXA 3A6PC 4B33A 3MWKA 2WWYA 2JLRA 4A4DA 3VKGA 2BVNA 3TR5A 3WYFA 2A9KA 4D4KA 1TX4B 2LCFA 5SZHB 1YRBA 2VF7A 3SJAA 1RC8A 1EFTA 3T1QA 4QKQA 5JRJA 1KKMA 1S8FA 2HXYA 3Q7QA 1RZ3A 2DHRA 1SKYE 5HKKA 2HCJB 4OHZA 2XGJA 4GSYA 1MO6A 1J70A 1OIVA 4PO8A 1E9FA 1PUIA 3B2EA 4WW0A 4LUCA 1TAGA 2ZI3A 1U8ZA 4FMCF 2ODBA 1AZTA 4Q19A 1KSFX 4E03A 4PHGA 3CWZA 4Q9LA 5FBRB 1JNYA 3D31A 4WZAE 3QG5A 5HZHA 3BAFA 2GCOB 3OAAD 4Q01A 3PVSA 4TT3D 4PC7A 3MGCA 4JS0A 4Q4AB 1YRAA 1L4YA 3NBYC 2DWPA 1DAKA 4P32A 3H1TA 4FCVA 4BASA 3U3JA 1E2IA 4NZYA 1VIYA 2OXRA 5L3RA 5KPJA 1OH5A 4KFTA 2DWQA 4RCZA 5EQTA 1KKLA 4BRUA 2VF8A 1QVAA 1CXZA 2OFXA 4MKGA 3M1IA 1JALA 1YE8A 1UEIA 2ZI6A 1FUKA 1N6PA 5KSZA 2XTZA 2Q6TA 3K8YA 3THXA 4PC1A 3T5DA 5IHPA 4B3BA 1N5LA 4IXMA 2J7PA 4PQFA 3K70D 1G3QA 1G7SA 4JVNA 5BN4A 3IEVA 4M9SA 1EX7A 1XXHB 2B8WA 3D7MA 2FFBA 2O8FB 3Q5DA 2YKGA 5FTKA 2EFCB 4LBZA 5SZKB 3PEUA 4BLRA 4PPFA 2X1VA 1GG2A 4OHVA 4TYYA 3N5CA 4PR0A 1DS6A 2G88A 2Q9CA 1AZSC 3GJ7A 5FOVA 1P9WA 1COWD 2ZEJA 3EG5A 1SXJA 4B71A 4XSHA 2FFQA 2ZE6A 1U2RA 1ZVQA 4QJ4A 4JBXA 4LGMA 2QAJA 4B2PA 2H1LA 4L4UA 3MD0A 3KKOA 1W4AA 1GL6A 3IIKA 2OSBA 1T4GA 3MG9A 4ACBA 2OCYC 3TVDA 3VFDA 4ESVA 1CR2A 4KBFA 3AKDA 1SHKA 5AUPB 4L9SA 5DI9A 5DN6D 2XZLA 2F1HA 1AGRA 3L8YA 1QHSA 4DLVA 5CYPA 4JL6A 4S35A 3P4YA 4TL9A 3T1TA 1HT1E 2O0HA 2QMHA 3EW9A 4UXIA 1G5RA 1II8B 3T06B 2J0VA 2OEPA 5FPSA 1BS1A 4AC9A 1GITA 2V55B 1R5BA 1XTRA 2B8TA 4HDCA 4MGKR 3CX6A 1X8KA 5JJLA 4AKHA 1GILA 1DO0A 2OAP1 4QG7A 3D6TB 2VP9A 2ATVA 2HT6A 4D0LB 3QBTA 4IFBA 1J7KA 3AV0B 5B2ZA 3BS4A 4DEXA 3U3RA 2ZSBA 1K5GA 4ACAA 4BZPA 4LHVA 2IS6A 2QI9C 1AQYA 3F8TA 3ZQ6A 2ZVPX 1EFRA 1VKJA 1Y3AA 2WAYA 4J0QA 4TTRA 3RSLA 3E1SA 4HAXA 4Z1MA 1DG3A 3TIFA 3I5YA 1ZD8A 3P4XA 4HLUC 1G3MA 3K09C 5FUVA 3TGPA 1RKBA 5CM8B 3SJCA 2ZJZA 5SZIA 1X86B 3ECCA 1TQDA 5JFGA 2KBEA 4LJAA 2NZJA 2H16A 4PAQA 4Q48A 4UNRA 4P0TA 1X3SA 1SVIA 3B1XA 2RMKA 4R9UC 2ONJA 4G5RA 3TW8B 4HZIA 5JZVA 1W47A 3JZAA 3ND9A 1K5DA 2BC9A 4WVFA 3CF2A 3IIJA 4H9GA 2IXGA 5F2EA 4A6PA 2O8EB 2JA1A 1M6NA 2WIAA 2A5DA 2D7CA 5FFMA 2WHXA 4PPQA 5HR5A 2CCJA 4AY2A 5JMTA 4V0NA 1W5TA 4A0HA 3R8FA 2ZR9A 5JCZA 4C2UA 3LBIA 3B60A 2RGNA 2WPDD 5CIQA 4EJSA 3A4MA 1G4AE 2RGNC 2ZE7A 3B5JA 5E95A 4EJSC 1G5TA 1QBKC 2IYUA 3LWNA 3FMPB 3G5UA 4R98A 4Q9JA 4LBYA 4C7OA 1CJUC 4JL8A 4MDFA 4DB2A 4KFUA 4NE2A 3NEYA 1G9XA 2BBSA 4OI4A 1HEIA 2G9NA 3GP8A 5FR2A 4LYHA 2AL7A 5KO2A 1PLJA 2ZRCA 2Q9AA 4DJTA 3K9HA 1OW3B 4TL7A 4IXNA 1Z47A 3L0PA 5FR1A 5FPYA 4G1UC 4ON9A 3SJZA 2ZE8A 3GQBA 4R2IA 3K70B 1VG8A 2JJ1A 1GOTA 4PXAA 2OFWA 4HLUA 4IEEA 5E7JA 3SFZA 5F9FA 1OSNA 4PHTA 1L2TA 1SGWA 2OBMA 1QHIA 3WHKA 2HYDA 1T5IA 1CTQA 4D6PA 1FX0B 3MUFA 5F3WB 3OIUA 2N1BA 1N5IA 4G01B 4LC0A 4QL3A 4DLSA 2GKSA 1Q12A 3BRWD 2IXFA 2QG6A 4GMXA 4RD3A 3SYLA 5KSOA 4A15A 5FPTA 4PAOA 2V8OA 3ZLJA 4RCYA 2QBYB 3M4YA 1OYYA 3MSXA 1RVDA 4EPTA 4MITA 3THYB 4CEIB 1KSGA 2HF8A 3NBXX 2W6IA 2RHDA 3EC1A 4EFLA 1XJ0A 4OJKA 1OH7A 4KLNA 5EXSA 2PBRA 3PJRA 1NBME 2VHJA 4LYAA 3PV0A 3THWB 1X1SA 4EFMA 3ADCA 4OQMA 4A1FA 4HZUA 4JLNA 4LBVA 4A9AA 4IHQA 4JVLA 3ICQB 4JSYA 1MO4A 1D9XA 4NBSA 1W7AA 2O8FA 3Q5EA 2XSZA 3K0AA 5FPKA 1OB2A 4V0MA 3OIYA 4Q4JA 4L15A 4QNMA 1XMIA 2J41A 2O8CB 2P5SA 2IBMA 1HYQA 1F2UA 1T0HB 2FGKA 3LO5A 4ASUA 3CH5A 3U4QA 2NPFA 1IBRA 2BCJQ 1AM4D 4ZO4A 5FOSA 3O8BA 1KMHA 2IF0A 4M9XA 3OIVA 2QT1A 5BN5A 1QG4A 2B6HA 5DLQC 1YZTA 4BFSA 1P4SA 3X1WA 1QHGA 3KJGA 2PL3A 4L16A 4NP6A 2CL7X 4AG6A 4W7SA 3DVLA 4A36A 2XITA 4NYJR 1E9AA 4Q4AA 2BKEA 1DELA 2F43A 4HEJA 3IIMA 2W0SA 1ZNWA 4PQYA 1Z2AA 1IXRC 4QM7A 1W48A 4TYQA 1A2KC 1F60A 4LWZA 2O0KA 4JLKA 4IOMA 4RZUA 1FFHA 1KSJA 2W83A 4NTZA 5FUXA 3SDZA 3U2QA 1CR4A 2CDNA 1N0VC 3X1XA 1N6RA 2FSHA 1PLLA 2CLSA 4RD0A 1NBMA 2VP4A 4US1R 1CU1A 4B75A 1NIJA 1RPZA 4AYTA 2CK3A 4KO8A 1R0WA 4LK2A 3AKEA 4F38A 5JECA 3RSOA 2IWRA 3Q85A 2B7CA 3GEHA 4YMUA 4Q4HA 1YVDA 2YZ2A 1W2GA 2XOKD 5JHHB 2C9YA 4HB4A 3R7WA 5JCPA 2CEAA 4X8OA 1KDOA 5EP4A 1Z6YA 2QGZA 1Q0UA 1TF7A 2F7SA 4PHHA 2QU8A 3I3SR 1U81A 2Q3FA 3B1WA 4KVGA 1NVVR 2ZITA 2IUUA 4C9BA 821PA 4TMTA 1CRPA 2GBLA 4L5BA 2D06A 1X6VA 2GBLC 1F48A 2W6JD 4US0R 5EXPA 2NO6A 2UZ3A 3IO5A 4B32A 2CLDX 2H7VA 3C7KA 2GDJA 3C15C 4KITB 2A5YB 1IN5A 2W2XA 3IO3A 2QPAA 5KYKA 2QBYA 1EFCA 3EASA 1YZKA 2VIIA 4ERNA 2ZRDA 1YR8A 1Z0AA 2ANCA 2QPOA 2Q0HA 2WSSA 3V9PA 2FZLA 1BKDR 1NMXA 1TL7C 3IBYA 2AFHE 4P3YA 2JLUA 1MABB 2OXCA 3FFBA 5L3QB 1EESA 3BH6A 3AB3A 3GJ3A 2ZI4A 3QENA 4PSKA 4MRNA 1KO1A 5KTYA 3TKLA 1P2UA 4QC2A 4KLZA 5FOXA 2Q9BA 3SYKA 2G0TA 4M1KA 2GK7A 4A82A 2WVJA 4GPTA 3JVVA 2FN4A 3HYTA 3NBFA 1QHNA 2NTYC 1W1WA 4RKFA 1KJZA 4PQRA 5K8LA 1FP7A 1KK2A 1SVOA 2VQSA 2VP6A 3B13B 4AKEA 2FJUA 5JSZA 3NVAA 3RWOA 3WP0A 4HAWA 2CNWD 4GFDA 4K46A 1R8SA 2FOLA 2N42A 4PZYA 2QNRA 4W5JA 4DDTA 2XB2A 1SVLA 3C16C 1WCV1 2ZI7A 3L0IB 3LXXA 4EUNA 4YMSA 3PITA 3UKDA 4P4SA 4GDFA 2GZDA 3KDSE 3EPKA 1SXJE 3CONA 2JGNA 1LY1A 2WAXA 5FTLA 3BGWA 2ZTSA 4OHYA 3DL0A 4FXPA 3U3KA 1TEVA 3LVQE 5CDFA 3EZFA 1GRNA 3SU8A 4B6FA 2ZU0C 2PX3A 3P32A 1I2MA 2GF0A 4IVQA 4D2IA 1RRFA 3T15A 1T3HA 1ZM3A 1FTSA 4GP6A 4BWYA 2G83A 1W49A 2QP9X 1D2NA 1E9SA 5HPYB 1AIPA 4JL5A 2ODWA 4MYHA 3ZDQA 4F92B 5KDDA 1ODFA 3AEZA 4O2LA 5K8IA 1DAEA 4LY6A 4I1VA 4UXJA 4WZBE 3FPAA 3MJHA 3B85A 1G8FA 6Q21A 3ZD7A 2EW1A 3NXSA 5H8WA 3CRQA 3Q7PA 2W2TA 5L8VA 4HLQB 2IA5A 2IYLD 3FKSD 1IJEA 1MH1A 2HDNB 3W6PA 2KE5A 3M6AA 5LB2A 2DBYA 5KU1A 1B23P 1Z5ZA 1KJYA 4JBWA 3KFXA 5KSYA 2BM0A 4MA4A 5GJVC 4YDHB 1IN4A 1ELOA 1ZINA 3AVPA 4KYUA 1SULA 2JLYA 1AK2A 2D62A 2A78A 1TU4A 1NY5A 2YWFA 2GZAA 4UNPA 2JEOA 1ZNXA 4DLYA 4JT2A 1R2QA 1GP2A 4IEIA 1ZRHA 2GNOA 2DWOA 2GXQA 3QPUA 3KQKA 1R0XA 1D2MA 1R0YA 2IYRA 3BC1A 1SQ5A 3IGFA 3LX8A 2MSEB 3EA5A 1M2OB 1NN3A 5AWFC 3W5JA 1MRSA 2VHCA 4TSFD 4NU0A 1T3SA 1W5SA 1XNJA 1ZM2A 2G1KA 3UWKA 2AHOA 5EZ5A 2ZJ2A 5JJKA 4Y0AA 4DDUA 4URVR 4KI0A 5K8UA 4Q00A 3WBJA 3A8TA 2CK3D 1FUUA 1M8PA 2J45A 1TQ2A 1FZQA 1G8GA 1XXHA 1ONBA 4DBLC 4D26A 2DFLA 1MT0A 4H1VA 2PLFA 1TF5A 2XOKA 2N46A 8OHMA 4Q4HB 2ZAMA 2FA9A 1E2KA 3I4LA 2A3RA 4IOJA 4BLTA 2XZOA 1VMAA 3X1YA 4IDHA 1OKKD 5EXXA 3BORA 3DOFA 4AYXA 4MRPA 2O8DB 2BV3A 2FPKA 1HH4A 3W90A 1E1RA 5BXQC 4PFSA 5AUOB 1QHXA 1XTQA 5JSZB 2YOFA 4LJ9A 4MGYR 1P9NA 4GI7A 4Q7KA 1XPOA 2IX3A 3ASYA 1NKSA 3I5XA 2QY9A 1G3RA 1KI6A 2R44A 2QENA 2X77A 4EIWA 4PSVA 5D3MB 1NSTA 4GRAA 3RRNA 1PVOA 5DI3A 3X2SA 1EK0A 2ZRBA 3OF5A 1WBDA 3I61A 1DVRA 2FX3A 3CPHA 1H65A 4Q66C 2ZUDA 2Z4SA 3B82A 3FVQA 1QRAA 3T61A 3K09A 4WAUA 2HXSA 1ZUHA 3TSOA 1KSHA 1RFLA 1U98A 1GFIA 1XB2A 2CHQA 4KFRA 4LHXA 2EYQA 1N6KA 2QUZA 2OLJA 2AFIE 1R5OA 2WBLC 4GZLA 3QI2A 2REOA 4RSGA 1Z8FA 2ZJYA 3LBHA 3BH7A 4Q9KA 3DPUA 2K5UA 5C46F 2UZIR 3LLMA 3C4JA 4MKFA 2BBWA 1D5CA 5BW8A 2FH5B 2PT7A 2JATA 2QM8A 3OEHA 3ICEA 1E96A 3GCGA 1L4UA 2CCKA 4Q4JB 5J5CA 1XEWX 2NG1A 1GDDA 2GAOA 2J0QA 5C18A 2OM2A 3LBNA 5CJPA 1P60A 4BECA 1Z6TA 4Z54A 3U7FB 1VCOA 2ZRFA 2CJWA 4DLUA 4UJ3A 3GJ5A 1HURA 4V03A 1G5PA 4IVPA 1FP6A 2O8BB 1VG9B 2ZU6A 4GMDA 2FU5C 1T6NA 1N0WA 1Q3TA 2VP0A 4LYFA 4DT1B 4LYJA 3IHWA 3NBZC 1KK0A 3UIEA 1IONA 3P26A 1VIAA 4KCGA 4Q7MB 5TDHA 3THYA 3SQXA 1XCPA 5LDDC 1EX6A 1W0KA 2IC5A 1XCGB 1W0JD 4Q18A 2OHFA 2IL1A 5EP3A 1F2TB 1CIPA 2J87A 1J8MF 5CYOA 521PA 1MR3F 3RDPA 3EX7C 3I8SA 1FTNA 4C0SA 1OXUA 2IYTA 3DO6A 2V6IA 3TUZC 2V7QD 2W00A 2G77B 3AUXA 4GT1A 2CL6X 2C5LA 4XIGS 4YC7A 3MFYA 2CL0X 1KJWA 2A2ZA 3QY0A 1UDWA 2FG5A 4Q7JB 2C99A 1W36B 1E4YA 4JLAA 5AUNB 1VTKA 3RHFA 2OLKA 1Y63A 1N3BA 4MKIA 3DM5A 2R6GA 1KI7A 3B1VA 1XMJA 2FWRA 5LD2B 3ZGXA 1Z29A 2VLIA 3SC3A 2XJ4A 2BWJA 4A2PA 4YQFA 1N6LA 4GNKA 2W2VA 1LVGA 4YMVA 1HA3A 4HLCA 4WXRA 1HY3A 4DLTA 2B21A 2HCBA 1VCIA 2IYXA 3NC1C 3B8HA 4A8JC 1KZ7B 5DGXA 2QRNA 4QGHA 5FUYA 2BHRA 2XEXA 1D8TA 1OF1A 1VCMA 1GKIA 4MUBA 4LBWA 3B7GA 4LJ7A 4B3DA 1KI4A 1U9IC 1ZUNB 1VHTA 1NN1A 2FPLA 2ZUBA 1E9EA 1OXSC 4B3XA 2D74A 2V9PA 4XTRA 2WJJA 4M4SA 5E3HA 2IYQA 3ONWA 5IK2D 1F2TA 4AYWA 5L3SB 1U90A 4OHWA 5CB8A 5HKKD 4CIDA 2FE4A 2ZSFA 3LVRE 3DKPA 1E0JA 1N6OA 2XTMA 4DRZA 4FCTA 1AKYA 3AQ4A 4MYUA 2AKYA 2IHBA 1G64A 4GZMA 2GTPA 1YZQA 2C03A 2F1IA 1B0UA 1SHZA 2RKOA 4MGIR 4LHWA 1D2EA 4DHEA 4DLWA 1W4RA 3SJBA 2DB3A 4GOJA 2QTVB 4OKSA 2HJGA 5AUQA 2YV5A 1IN6A 1F2UB 4KBGA 3T35A 2JLWA 1SVMA 3GMTA 1E2HA 2XX3A 1HE8B 3LA6A 2E1RA 2JDIA 5B57C 5JHGB 2W6ID 2IHYA 3L82B 1TMKA 3EXAA 3CIOA 1KK1A 2C98A 1YJ5A 4B2LA 5JRZA 4AG5A 4M1MA 1UKZA 4HSEA 1NMZA 3DM9B 4HB0A 4PTLA 1FL9A 1W46A 1YR9A 3UANA 2ZIAA 3AH8A 4ESHA 3CF6R 1ZUIA 1RYFA 4AKIA 3QVVA 4JLPA 4GL2A 3ZZ0A 1KMQA 1AS3A 1GVNB 1NF3A 2A30A 2YVUA 1NVUQ 3O8DA 4IKEA 4TMXA 4Y0VA 2A5FA 1T3LA 2B7BA 4B44A 1ETUA 3V4FA 5FUWA 1VYTA 4TLAA 2ODNA 4NYIR 3R9IA 1UBFA 3RLFA 1JPJA 5JJIA 3TE6A 3ADBA 2GILA 4LV5B 1BYUA 4EDHA 3OHMA 4Z51A 3LNCA 4ZI2A 4C0LA 1VCNA 4ASUD 2P65A 4PZZA 1I4DD 2F1RA 2ZM5A 1QHHA 1OH8A 1Z07A 1ZC3A 3QPWA 3VU9A 4MGZR 1Z6XA 2WOJA 3Q3JB 3LQQA 2WM9B 3FHCB 1OPXA 1BOFA 5JS7A 2R2AA 1V43A 1VDZA 1QF9A 1XXHE 2Q3HA 1N25A 1GL9B 4LPKA 5TMPA 1ZIOA 1KO5A 3OFND 2ZXUA 1TTTA 1ZU5A 2V54A 4TYNA 2ZR0A 4D4LA 2O8DA 5GJBA 1EFHA 2ATXA 4Q02A 1E2DA 1E0SA 4FI3C 4OQLA 4B35A 1E79D 1G3IA 4EQ6A 1D6JA 1PZNA 4JLJA 3QKUA 5J4LA 1E99A 2OZEA 4JKIA 3ZH9B 1W44A 1I4LD 2XZPA 4OL0A 3BE4A 3SFVA 3E70C 2FGJA 2GJ8A 1ZM7A 3AVTA 4G5QA 1NJGA 1CEEA 1UADA 1S9DA 2ZRPA 1TUEA 2C9CA 1M1YE 4XVRA 3VHLB 5FI1B 2E9SA 1QVRA 3QE0A 4Q1DA 5DISB 4A0FA 4PO1A 2ZYTX 1EWQA 4U5XA 4QBIA 2PMDA 2DFTA 3A58B 3UXMA 1G19A 3Q9LA 3F5FA 1SKQA 4M21A 4NCJA 1MOZA 5H1YA 1X8LA 3QIAA 3RANA 1MKYA 3O47A 3DMDA 4ZPXA 4F91B 3C14C 3K0EA 4I1UA 3C41J 2NOAA 4HUTA 3HJNA 2CE2X 2VSOA 2AX4A 4URUR 3VTKA 3TR0A 4W9MC 2AWNA 2AXNA 5G40A 1EFUA 2UKDA 4PC2A 3VQTA 3U44A 2PH1A 1CJTC 2R62A 4GOXA 4JJKA 5JEDA 2J3EA 1TU3A 1IJFA 3WP1B 4F4CA 4TYWA 4IJMA 1OLOA 2ANBA 4E07A 5A0FA 2GEUA 1RIFA 4KSBA 1YZUA 4QXAA 4G3XA 4QJ5A 4DLXA 2QAGC 1G7RA 1CR1A 2AKAB 3K0FA 5BWMA 3D8BA 2O8CA 4TMVA 4LHYA 3E5HA 4G5GA 3TNFA 4JLBA 3W9YA 2NO1A 1DAIA 4M0LA 4B76A 1OXTA 1XRJA 2RGDA 1II9A 2KSQA 3U3MA 3U3OA 3THOA 2NO0A 3SHWA 2VEDA 2WSSD 2QM7A 3ADDA 4DEYA 5EP1A 4V0LA 1XCMA 221PA 1S9HA 4P31A 3A1TA 5UKDA 2EWWA 4QNRA 3TMKA 1Z0FA 2OAQ1 3LW7A 1J90A 1KTVA 3N70A 2ZREA 4OQFA 2IYSA 3FMOB 4Q9HA 4II7A 1IXZA 4UNSA 5FBQB 1DTSA 4CEIA 5CB6A 3VMFA 4TLBA 1NLZA 1VYVA 3WMEA 1A1VA 4I1OA 4C0KA 1Z2CA 4LRWA 1BMFD 2HUPA 3VX4A 1AJEA 1M7GA 2EFHB 2EVWX 4IOLA 2IS1A 1WDTA 4KAXA 3E2IA 2RCNA 4H1UA 1JQLB 3CW2A 3TSWA 5FTNA 2I4IA 2BJVA 2H92A 3W3AA 2YOGA 1Q1BA 1FPMA 3GLGB 2JDID 3GLFE 1P62B 4DIDA 2V6JA 1P61B 1XEFA 1DAFA 4OYHA 4QGAA 4QFMA 3GLIB 4LJ5A 3U4QB 4NPHA 2CXXA 2ERXA 3WYGA 4C3ZA 5JEEA 2ZQ5A 4DCNA 1JR3E 1DG1G 3DHWC 5JS8A 3P1JA 5GVRA 3R7WB 1CF4A 2OCAA 3K0CC 3LD9A 5M04A 4DC9A 5EJEA 2P6NA 2ZUCA 4LOAA 1LS1A 4EAQA 4AWXA 5L3VA 2EQBA 1CJMA 3N2EA 1UM8A 1OHHA 3JZMA 2R6FA 3HP1A 3PUZA 1G6OA 4B43A 2AN9A 3KQUA 4P33A 1HTWA 5J4YA 1Z06A 3QSYA 5DIFA 3TBKA 4M1YA 3PEYA 2FNAA 3X1DA 2Z5FA 4HZUB 2EFDB 1O3YA 5IF9A 1U8AA 3GFPA 4B3GA 5BQ5A 1JXOA 3K70C 2NO9A 3CO5A 3J81k 3VU9B 1E94E 3KFVA 5CLQA 2PLRA 1XWIA 4NCNA 5SZJA 5L3SA 1G18A 1U9IA 2VH5R 5FBLB 4URYR 1KK3A 2QQ0A 3CR7A 4PX9A 5DH9A 2WWHA 121PA 4MYTA 3IQWA 4C30A 5LPNA 1JB1A 2I1QA 4FMDB 1DE0A 2VSXA 3FYHA 3KB2A 3GJ6A 2I3BA 3CKLA 2QE7A 4HDOB 1E9DA 3AGQA 4QRHA 4YDSA 5KDLA 4AKGA 2IF2A 5FOTA 4PO9A 2FEOA 2ZRAA 1G8PA 1II0A 3R8CA 3TVTA 2YHSA 2J46A 1G8YA 1ZD9A 2Z4RA 5TV2A 1TEXA 4RZ3A 2C2HA 1YZGA 2JAQA 1WQ1R 4MH0R 3T5GA 1NSFA 5G53C 4IRUB 4B34A 2IYVA 2R6DA 4XD7D 3CPJB 2JIZA 2OUKA 5TB5A 4HUQA 2RGCA 1D9ZA 2ZR7A 3DOEA 2IW3A 4JLOA 1Z6AA 4A2WA 2C95A 2OBNA 3CZPA 3WXMA 3RS3A 4DLZA 3MLEA 2PCLA 4CVNA 3T12A 3GFOA 1MO3A 1QHHB 2DCUA 2YYZA 3BFKA 4HAVA 3DZDA 3KL4A 4U02A 1HV8A 4U7DA 3T1OA 1IOZA 3DKVA 2EU8A 1J2JA 4P4TA 5GJWC 3SYNA 3G82C 2REXB 4WBSA 1NG9A 3CNNA 3SBDA 4UNNA 1CULC 4RFVA 1IY1A 1GSIA 2V1XA 5LB4A 3UPUA 3SR0A 1KO8A 4V0KA 1TADA 4QM6A 3VNVA 3RS2A 4YMWA 2W6JA 3TW4A 3X1ZA 2J7KA 2D4HA 2GJ9A 2ZS9A 4JZKA 1JQJC 1KI8A 2WJVA 4FD2A 4FW9A 1RRPA 1HT2E 2CMKA 3AVQA 2Z0MA 1UJ2A 2WZQA 3PFIA 5FL7D 2PX0A 4E09A 4DSUA 3PCRB 3SN6A 3EPHA 2J7PD 1HQYE 4NONA 5C2JB 4TL8A 3ZVMA 2QTFA 1KI1A 2YWEA 1EWRA 2RHMA 3DEFA 4ILEA 4OI2A 4R7ZA 1WP9A 2ZVQX 2EFGA 2YWGA 1F5NA 1KI3A 4BLOA 1Z6GA 3T34A 4DSNA 3KXLA 4IDPA 3AVXA 2PZFA 2CCGA 4DVGA 4ZDWA 1T8UA 1C1YA 3ZZTA 2ZRLA 3H86A 1COWA 3LXRA 3UG7A 2JLSA 4B3CA 2IS2A 3D3QA 4S2EA 5AJZA 2P2LA 3GPLA 2DR3A 2IUSA 4P4UA 3SOPA 4XVUA 3QBVA 1W4BA 3QKRB 3QJYA 1AA9A 1RRGA 1KO4A 4HATA 3F0TA 3FTQA 3VHXA 1Z28A 1RJ9B 4KVAA 5JWOA 1PLKA 2AD5A 3QEOA 4PC3A 1E3MA 5E7IA 2VRWA 2X19A 4ZDJA 1YU9A 3U6KA 1YZNA 3RRYA 1AKEA 2QP4A 2ZJ5A 2D3WA 1DAMA 4R2HA 1XJQA 1XPUA 2RGEA 2WWXA 4BRWA 1VHLA 1ANKA 1JEEA 3BB4A 1ZC4A 5AJYA 4W5HA 3IHLA 2YINC 3GLGE 2HYIC 3CX7A 2WJIA 1IAQA 2QMOA 3B9QA 1SXJD 5J4HA 2HF9A 3BB1A 1NNEA 3RAPR 2QMEA 3B1ZA 4AIIA 3IQXA 1NMYA 2OBLA 3AP3A 3EA0A 3A4NA 1GRRA 1NY6A 4RJLA 2BMJA 2MMCA 3KB1A 4IOKA 5BYJA 3KTAA 1CBUA 2ZRKA 1KY2A 5F98A 2REBA 1OJLA 2VA8A 4M8NE 5E7MA 5FI0B 3FB4A 2ZPTX 1N0UA 2BDTA 2QN6A 2QE7D 4Q1BA 3CNOA 1LV7A 1Z0KA 1G7TA 4M2LA 3RABA 5EE3A 2JJ2D 3OESA 4FINA 4B48A 2XXAA 3HR7A 3PXGA 3QF4A 1ZM4A 4HAZA 2J0UA 3RS5A 2VBCA 1KAGA 1XEXB 3KX2A 3IUYA 4TYPA 2R9VA 4D4JA 5J47A 1H8HD 3Q8XB 2OCBA 1XBTA 2ASEA 4MUAA 4XSGA 3MWLA 4FCWA 5EP2A 2GA8A 1A2BA 2PT5A 3FGNA 4FMCB 3FKQA 3V4RA 4PPNA 5IK2A 1BIFA 2LKCA 3BJIC 5FH9A 4MDEA 1KI9A 1Q57A 3AUYA 1ZBDA 2GESA 4HYYA 2CJWB 2PCJA 1JR3A 4JYBA 3T1VA 5B30A 4ZCLA 1E98A 3OEED 4NYMR 1NP6A 2XNDD 2X2EA 3HYRA 4KXFB 4B2IA 1O87A 1FQKA 3MRSA 3DZ8A 3EARA 1XEWY 2QSZA 3FFAA 3CX8A 4TL6A 1WA5A 5LBIA 1M74A 1OFUX 2ZANA 2D2FA 3WYAA 3ZIAA 4A0RA 3W34A 4PZLA 3THWA 3QXCA 5KOYA 1QZXA 4B47A 1GZSA 1TNDA 3IBGA 1NLYA 3NIBA 1UAAA 3BFXA 4N0DA 2ZETA 2GAAA 2W58A 1NG1A 2WKPA 1WE2A 2B92A 4FMDF 5AJWA 3W5IA 4LJ8A 2YJTD 2JLZA 3CBQA 4AURA 1ZYUA 1E2QA 2L0XA 2WICA 5DYIA 1OKKA 5IT5A 2VP5A 1UF9A 1P75A 3FE2A 1YKSA 1ZW6A 3WNBA 4CYMA 5JI2E 4JJZA 1RJ9A 2WWIA 2X2FA 4DUGA 2ZJOA 4US2R 3CRVA 2NQ2C 3LH5A 3LFUA 2Y8EA 3U7GA 3AF4A 4PHFA 4BFUA 1ZIPA 1Z0IA 2GVZC 4Q9IA 2DFNA 5KNBA 1YZLA 3EC2A 1E69A 1S96A 3QOFA 1K8RA 3U5ZB 1JEDA 1IM2A 2WWWA 3AF3A 3GLHA 2ONKA 5EXTA 1QDEA 4KHZA 2KB0A 4EKDA 1SVSA 4NCKA 3LRPA 1KI6B 3PUXA 2JASA 2P5TB 4Z8XA 3KKNA 2ERYA 5HE9A 2GF9A 2DY1A 1CJKC 3LDAA 2KJQA 2P3SA 1SKYB 1FMLA 2WKRA 4I99A 3OE7A 5H68A 1G21E 3S1AA 4A0GA 2EWVA 2GJSA 1K6MA 2DPXA 4BFTA 1XD2B 3QXJA 5ANRB 1Q44A 2ZJ8A 5C1BA 1SXJC 2C96A 2ZSEA 2Z83A 4NL4H 5J4KA 1N5KA 1R7RA 4D81A 1BO6A 4C4PA 2MSCB 1CP2A 2BKUA 1N6HA 1OYWA 1TF2A 2ECKA 5BN3A 1DPFA 3H84A 5L3QA 1ZNYA 4M9QA 3OEHD 3H4MA 3U44B 2ZS7A 3QXSA 1LF0A 4CT4B 4JIMA 4IDNA 2RB4A 3EAQA 4ARZA 4LHZA 1KOFA 4YXWD 3RS0A 5JWRA 3I72A 1Q1QA 4TWZA 4BFWA 1NRJB 1KDPA 4QHTA 5DNYB 1E79A 4CEHB 3R9WA 4DCUA 2PZGA 3QQ5A 3U6BA 1WBBA 1DAGA 1Z0DA 3VR6A 5CK4A 1GTVA 4XWAA 1XD8A 3ZQJA 721PA 4OBEA 3AVVA 3WNCA 2GK6A 3GJ4A 1T5LA 1N6NA 4OQXA 1OXXK 3CLVA 3I92A 4RVCA 5E4FA 4PC6A 2ODEA 3KXIA 2ORIA 2VHQA 4P4SB 1W0JA 2G0NA 3MJRA 1FW6A 4DIEA 4BFZA 4LSGA 2WJHA 3QG1A 1MRNA 2XNSA 3FDIA 1P2TA 4O3MA 1XMSA 3CZQA 4V02A 5FOWA 2V7QA 3L0SA 1OB5A 2KWIA 5FPHA 4BGDA 1ZM9A 3C8UA 4EPYA 5EUMA 3MCAA 2LWIA 3PUVA 4DLRA 3NHBA 1S2MA 3HDTA 1UBGA 4TLEA 3VKWA 3AP1A 4V0OA 2BIFA 5JWHA 4IDOA 5CITA 1X1RA 2CHVA 1GKUB 1GKYA 3PUWA 4M53A 3PUYA 4MYCA 4QBHA 4DB4A 5F9HA 1OV4A 5IDVA 3VKHA 4D4MA 3K9LA 5DSZA 3CF0A 3HU2A 1Z63A 4EFNA 2G1JA 2GCPA 4FWIB 4Q1EA 2RGBA 2ZE5A 1E2GA 2SHKA 3RWMB 3OEEA 2BMDA 3I73A 1ZMXA 2QEQA 3KKPA 4MKHA 1SXJB 3PENA 2VP2A 4KSCA 3GJXC 2ZRJA 3EZ9A 1X8JA 3C5HA 1JAIA 1RW4A 2CVFA 2DYKA 3I8XA 4AK9A 4BLPA 2XTNA 2HT1A 2F9LA 2WSMA 2OCPA 2CVHA 1A82A 5AK0A 2F55A 4Z8YA 4A8JA 4X8LA 1GNQA 5FBWB 1G8HA 3U7EB 3TK1A 1LW7A 4RY2A 2V4ZA 1ZD1A 3K9GA 1ESNA 5GADl 2WWFA 2FPMA 1Q3HA 3REGA 5HE8A 1EGAA 4JBYA 4LJ6A 2IXEA 5TXGA 1UDXA 4QGGA 4RFSA 2PZEA 3SE0A 5TVKA 3GFTA 1OFIA 4CF7A 3W6NA 2FEMA 3SQWA 1G7CA 4CW7A 4MRSA 3VR1A 2FSIA 1LS6A 3EIEA 4CGZA 1RE0A 3LV8A 3AF1A 4CEHA 1H8EA 3OIWA 4TTPA 2J0SA 1DEKA 2ZSDA 1HQCA 3KJIA 1OH6A 4EPWA 1EXMA 1SVWA 4UQOA 1UEJA 3NKVA 2I1VB 2QPTA 4V0ME 3RC3A 4ZDKA 4C0HA 1FX0A 2YOHA 1OE0A 5P21A 2GJKA 2AK2A 4I1SA 1LF5A 2GXSA 1KY3A 1Q21A 2OO7A 2P67A 3K9NA 3LQRA 3NTUA 1SZPA 4MRVA 3SI7A 1XJCA 2BM1A 2RAPA 3A1UA 4EQ6B 4HAYA 2C9OA 1KZGB 2JJ8A 1YHNA 1JR6A 1E9RA 2KI5A 4DKXA 4JMPA 2O8BA 4FN5A 2GHIA 3TQCA 3NDPA 1FMJA 4Q03A 1T8TA 2CNWA 1Z83A 1E9BA 1WXQA 3JVUA 4C0QC 2ZS8A 1U8YA 3HU3A 4TTQA 5DN6A 1II8A 4DWJA 4YXWA 3R9XA 2JCSA 4KU4A 1JAHA 2FZ4A 1AS0A 4U00A 3A1WA 3HU1A 2BEJA 1P72A 2HEIA 4UNQA 3GEEA 5TARA 5AR1A 1MABA 1TUIA 3CM0A 1P2SA 3Q72A 2P6RA 1P9RA 2Z43A 5J4VA 1CRQA 4WA7A 3H0KA 2C04A 3VAAA 3KJHA 1YQTA 4BZQA 2HLDA 3ZJYA 4ZI3A 5EE5B 1F3OA 1QG2A 1OIXA 4BFVA 2YWHA 4BPBA 2JIZD 4FIDA 4Z1MD 2OV2A 2NO7A 1Z22A 1EG7A 1UKVY 4G5SA 2QRZA 4XJXA 2VHUA 3PIRA 5TY0A 5A5GA 4URZR 4WXPA 5DI3B 4OQNA 4M1SA 5DYGA 5H70A 3SNHA 3FKSA 2WKQA 1JECA 2GWHA 3FWYA 4QBFA 2ZRGA 3KQHA 4TLCA 2RGGA 5GJCA 4C0BA 4O0MA 4OJQA 1AQUA 2PJRA 1JXMA 3NH6A 4WOPA 5CM9C 2WMNB 2DFKB 3A1VA 1OFHA 3I62A 4LCBA 3QKSA 3I1FA 1NIPA 3QUSA 2PEZA 3K0AB 1E1RD 1SVKA 4URWR 3QKRA 5G3ZA 3ZS8A 1XTJA 4PAMA 3ZYCA 4BUJA 1RRCA 4CT5A 4IVRA 3RYTC 1NVXQ
chains in the Genus database with same CATH superfamily
3OX3A 3FM9A 3A13A 4YI5A 5FL7A 2ZBGA 3RU7A 3EZ5A 4K1XA 3BCSA 3FMFA 3GCWP 4USUA 3BSOA 2BUBA 3MR5A 1XRQA 2OZLB 1EP1B 2RFLA 4HZFA 2QLFB 4JBGA 4ZDNA 1TJNA 1F1BA 1NLSA 1UPTA 2HA7A 2IVYA 3BB5A 1UKYA 1VIVA 4RVFA 3NBKA 2QORA 3OZEA 2H48A 1RT2A 5KWEA 2ET1A 4BGIA 4FT8A 3I45A 5KB3A 3KUXA 3TQEA 4MTLA 2JH9A 4TVBA 2Q6VA 4I5FA 1J06A 1P9OA 1PGW1 1R092 1IUPA 4JLSA 1P6XA 5A3SA 2Y68A 4J1TA 2PMKA 3D8CA 3RFTA 4M1TA 2NZ8A 3RAEC 3D6VA 3DLHA 4IUBS 5F3EA 1WF2A 3NYIA 1F1JA 2JIMA 3DDHA 2NM0A 3BSFA 3EPJA 4LA3A 4A91A 3KQLA 4X66J 1KAOA 4ZU3A 1RKJA 4RKEA 3SHFA 1HJFA 2OP0A 4GRIA 4C0OC 4CQ1A 1A3CA 1DMSA 4O33A 3SQOA 2VBIA 1NUUA 1Z13A 2WJYA 4HMOA 2JJ2A 2C5EA 2YNMD 3OEAA 3G8TA 2B78A 4UXHA 1U94A 3UT6A 1N2CE 3PIIA 4D02A 3DTNA 1QCYA 1WRBA 4IIEA 3HKZD 2PE8A 2I9PA 1U3DA 4EGJA 2WT2A 4M37A 5DO9A 3POSA 2XA2A 1HMVA 4HTFB 2Z58A 1S02A 3D3BJ 3UWTA 4KGXA 1X7ZB 4D0NA 5J40A 1NV8A 4O44A 3ZXXA 3T9ZA 3GRYA 2E2WA 4J7UA 1F35A 4I0BA 3RR7A 5KFXA 2A33A 1X80B 5EQJB 4YJ2B 2VSFA 1ONAA 1AUSL 1GIAA 4HVCA 2AUMA 1IBMJ 4IEPA 3AM4A 3FUWA 4M1WA 4ZKAA 2JC1A 5BYSA 1CUUA 3R7FA 1M8KA 4QU8A 1ZPVA 1RMU3 3HT0A 4OBBA 3AXSA 3MWJA 1TM5E 2TMDA 2XGSA 1YRUA 3M8QB 5AICA 3EGEA 3MMBA 4IKPA 1VRUA 1XZPA 4MUJA 1T3TA 5AK3A 1Q0TA 3MPDA 3M9NB 5NULA 5KC9A 4DSFA 4ZAVA 3OU7A 2YH2A 3WKEA 4DU7A 1YVUA 4HAUA 4GM4A 3K77A 5GADI 4L4ZA 4OI0A 1GLGA 2HNAA 2QN2A 4IH6A 3CJIC 4WRRA 4B73A 1G5IA 3G9ZA 1BWRA 2Y2UA 2K06A 1HXS3 3VR3A 3WG3A 2O5CA 4LZAA 1A76A 4DDVA 4R1MA 1OKOA 1A7KA 4Q7QA 2QJWA 1OAAA 4CLKA 4R5PB 4KXNA 3KOZA 4R2XA 1KMIY 2YWXA 5DBIA 3O8RA 3K1YA 5DTIA 4ZYVA 3QWFA 1EYZA 1KNXA 4JLMA 1ZBE2 4KAJA 4O4HF 3HFGA 5F5QA 4KH9A 4UW6A 1ML4A 1YNSA 4O2AA 4AEMA 1OBFO 3EPLA 3T7IA 2R7WA 1PYGA 3IOYA 3WJ2A 3TB4A 3ROPA 3QZ8A 5IVCA 3PR1A 3WR0A 2C78A 5IT9A 3KK0A 1E2EA 3R2JA 4K5SA 4LZOA 2ZUUA 1XU4A 3K0KA 1P9LA 1KQKA 3AF2A 3K1ZA 1O94C 2XT6A 3OMLA 3SDSA 2UVVA 1I7PA 3WGYA 1XDSA 3BH7B 1YASA 2ARXA 2HKXA 4C8YA 2BCEA 3VHXB 1HI8A 3LGAA 3ONNA 5DDRC 2ZBQA 3TW8A 1E20A 1OMOA 1LWNA 3BVCA 3BFVA 3G2MA 3I5CA 4LY9A 3DLCA 4GVBA 1K0FA 3C14A 4RVGA 2QUOA 2GPWA 1W8DA 4ZKDA 1E3WA 2P8SA 1M3SA 4RK7A 3P9YA 2BONA 4LNHA 3VJRA 5LM3A 5EZSA 5LFAA 3FLPA 4D8TA 1E4VA 4MMXB 4AK3A 2IXHA 3TGLA 3QE4A 2ZFUA 1WCDJ 1U2PA 3GUUA 1VBD1 3FCSB 2QL6A 3AIKA 3HS3A 3BE5A 4RE6A 3ORQA 4YGYA 4CM6A 4P53A 3EPPA 1XTSA 3A37A 1FOD2 1T5TA 1QB7A 2FDIA 2JFBA 3Q0EA 3E05A 1FFGA 2ZMLA 1FNMA 2VT2A 2ZQYA 1CVNA 4KQGA 2BNMA 2VFVA 5BUCA 4IICA 5ILGA 2IV2X 3LL7A 2QDXA 1QONA 3KV4A 3IUQA 2IHUA 2CFIA 3ESAA 3KGZA 4YI3A 2QRUA 2Q0XA 1HBNB 2WVHA 4HOYA 3NAHA 3DI6A 5CLHA 2Q5CA 1KETA 2CLMB 4ZKTB 3GCWA 1JMKC 1H0RA 5LASA 3A6FA 2GKGA 3QX8A 1VFPA 3NPAA 4B3RF 1G6HA 1RUJ1 1OHHD 5EUBA 2XRZA 3PJFA 4N3NA 3DXSX 4GQ7A 2FHSA 2ACEA 2WWGA 4MAFA 5LMNB 2P6CA 5IFMA 4X63A 2W7PA 1IN1A 2JH3A 2JGKA 3T1NA 2OGSA 1P0MA 3N8NA 2YC2A 1OI4A 3DF7A 3Q1KA 3CEJA 2BZDA 3KQ4B 3BWDD 5HDQA 4D3YA 4XBNA 2P6UA 2O9JA 1KFDA 4CCOA 3DYAB 3HY3A 3GG0A 2IUTA 1CZRA 2HU2A 3NJZA 4O59O 5JZMA 4B9MA 5IH3A 5KHAA 1YQUA 1XAIA 1NVVQ 4B9TA 1X9WA 2QK4A 2JLRA 3VKGA 3ZDRA 3WYDA 1SPXA 1OFGA 4O9EA 3H50A 4N8OA 2Z5GA 4J37A 4AJ4A 4ZPJA 2HXYA 3QV1A 4M0EA 3D64A 1U12A 2HCJB 4UEWA 2OORC 3B2EA 4D92A 3IEKA 3CZMA 1XLUA 5IASA 2XYQA 3K2OA 3AHEA 4JDUA 3H3UA 3MLAA 1QGUB 3ELHA 4F3MA 3GRUA 4OMCA 3R44A 1JFFA 4G3IA 4NMXA 2JFNA 2LKZA 1LHWA 1LQ2A 1E2IA 4USVA 5L3RA 3NCHA 5CVVA 4WKRA 4H14A 2PAAA 4MGTA 3C7AA 4KE8A 4NVRA 1FUKA 1IOVA 3CT9A 1UOQA 2H48B 2J7PA 2IFWA 1G7SA 3ONFA 4JVNA 3FWPA 4M9SA 4S2FA 2RI1A 2WO3A 5I9NA 3T4VA 1FDVA 1HDCA 3ZU6A 1F12A 3HM9A 3X2FA 1RZRA 3HEMA 5JCTA 4G8JA 4IDFA 4CDWA 2ZTVA 4NXNB 3LQYA 4I5DA 3VFDA 3BTSA 1JXLA 1PO11 2FZCA 4FDVA 1CUYA 1AXGA 4S35A 4I66A 3T1TA 2O0HA 1SCQA 3N9NA 4WOBA 3T3PB 3OZUA 4DV3B 5B3KA 3NEKA 5KFLA 5K7SA 3H0OA 4I6AA 4MGKR 4AI0A 3DO8A 1J27A 2ATVA 2RDNA 3DAHA 3GK3A 5IT4A 5F1YA 4MROA 4P2XA 3UHJA 2IUWA 2ZVPX 1X7VA 1VKJA 2FVCA 4TTRA 3RSLA 4KY3A 2ZH7A 1WB6A 4ZGWA 2KBEA 4JYMA 2W4MA 1ODKA 3GGGA 3IMFA 7ABPA 2B6AA 5K8OA 4HZIA 2C20A 1GTL1 4DGSA 1C7JA 5HR5A 1IY8A 3K9BA 5KG6A 1T5HX 4Y24A 3RLIA 5JNTA 4C05A 5EJ1B 2OFGX 1G4AE 5E9QA 4EQVA 4R98A 1GAQA 3QX9A 1CJUC 4YW6A 1ZIDA 3QRWA 3GR6A 2G9NA 2FCAA 3EDMA 5BNOC 4L0PA 1FVFA 2ACYA 2EP5A 3K9HA 3L0PA 2I2SA 4P5YA 4NV1A 4H4KA 4IIJA 2W93A 1CP3A 5IUNC 4HSGA 1SXGA 3DN7A 3WHKA 1JF8A 1VBZA 1SCKA 1NJIT 1NYQA 3DKIA 2BFEA 2I2CA 4HADA 5CDSA 2BH2A 1F8GA 2CGPA 5F1RA 1WHTA 2IM3A 3G6VA 2OW4A 4KWKA 1MVLA 3ER9A 2PLV1 3I2DA 1X1SA 3ADCA 4X3CA 4IHQA 4JVLA 3K32A 3OFKA 2YZNA 2AFVA 5DXJA 3IMEA 1XPWA 1FX2A 3FNBA 1FFXA 4IZ6A 5E0KB 4EYGA 1KR5A 3L8DA 3DHEA 2PYZA 4QQPA 1KITA 3S99A 1Z0UA 2C0CA 1NDCA 1D2AA 3LIPA 2RB7A 1PHPA 3WW1A 2BJDA 1EFVB 1VBC2 4MK7A 1Q17A 3NYRA 3GVHA 4AUMA 4ZCTA 4UHKA 1Z2AA 4I1PA 2A2CA 3BHNA 3DR5A 2W68A 3EZYA 2XLGA 2Q6IA 1U3FA 2Z5VA 5J1SB 4H16A 3POBA 2ZT7A 2GFIA 4EKEA 2R7UA 4B75A 2XWJB 3MF6A 5G4KB 3TLJA 3SFUA 4AJKA 2VDWB 4QARA 2F1KA 3WB1A 3OBTA 3RSOA 1I51B 5K3BA 2VR4A 5DBFA 5LMNF 5C9AC 2JAXA 2C9YA 3LP1B 1TMMA 2CEAA 1QDOA 5EQUA 1Y7BA 4DXZA 2QU8A 2JLEA 821PA 1UXGA 3NLCA 2Y99A 4PYNA 3WKBA 2PUEA 4KITB 1M2OA 4R0EA 3VTZA 3R0RA 3H9AA 2B0CA 5IABA 2TUNA 4PR6A 4QG3A 1NMXA 3RVNA 4AMGA 4PSKA 5L7WA 4DV4B 2JRLA 3U4DA 4JI4B 4QC2A 3COJA 3SYKA 1DQYA 2HSGA 5I9MA 4EYIB 2RGWA 1FBTA 1RI3A 3G8DA 1KK2A 4AZSA 2FJUA 3PQ6A 1L3UA 2R1ZA 3QLVC 5KYXA 4PZYA 4UZSA 1HQKA 4RANA 3RGWS 1P5HA 2RVAA 2CY6A 4WBBA 4XF3A 1DWUA 4DR6F 3DGPA 1Y89A 1EGQA 1XJWB 2ZU0C 3P32A 4JI6F 4QO7A 4REOA 5HPYB 4J1XA 2O3DA 8ATCA 3FFWA 1YAJA 5JMOA 4IEOA 2XUPA 2GSWA 4ZQIA 3A1EA 1P7PA 1WLTA 1GNSA 2JARA 2K3IA 4ILRA 4YB6A 4D94A 1RPNA 1WCIA 3VAZA 2N3ZA 3J7LA 1IJEA 2VUGA 2KE5A 4GUAA 4QDKA 6LDHA 4MA4A 5EJ7A 1NQXA 3ZTSA 3BR9A 1GPYA 1JLGA 3H5YA 5ITVA 4R40A 3OD2A 5JZOA 1N5SA 1KWKA 1BCRB 3DTVA 2VHCA 2XSJB 4JR0A 3JARB 1JA1A 3SEQA 1RTZA 2CK3D 5DGDA 3GG1A 1V37A 1RT3A 3WWCA 2LW8A 1NKCA 3K4PA 2OXTA 2DBBA 5LOVF 3HR4A 2QZSA 4MUNA 2GAJA 1H2WA 4MRPA 4K86A 1C50A 1TZMA 1E1RA 3KCCA 5D8AA 4N3BA 1RWMA 3QX3A 4Q24A 5LRRA 1G3RA 1KI6A 2J7MA 3O6QA 4G1BA 4LO7A 4RL4A 3P0IA 5JQGF 4J0JA 3JAMU 5K45A 3DP7A 3ZLBA 3I61A 3TE7A 3RU9A 4JD5A 5FZCA 4D99A 1P4GA 2AEFA 5KOXA 1EFVA 4DPNA 3QNMA 4KWUA 3KMSA 2HXSA 4HMQA 5C3QA 2EYQA 5CCEA 2QUZA 1TT7A 4DMFA 2SBTA 3DPUA 1RVF1 2N7CA 5T4FA 1WLDA 2VDLB 1L0BA 2IU6A 2PT7A 4AE2A 3ISNC 4PYOA 2FW0A 5CR9A 3EBRA 2DVBA 1GDDA 2G5PA 4M0KA 2XBO1 1X1BA 1Z6TA 3N28A 2CJWA 1VQNS 4AWDA 4YFUA 5DXAA 4CO1A 1PGL2 4KWEA 3O2NA 3B94A 3R41A 3OPWA 1IONA 5J1EB 1WNFA 5FQOA 1FSGA 3HA2A 5K09A 1W0KA 4Q18A 1ZG3A 3HJGA 4NMXB 3FGVA 1RXIA 2IY8A 4FFHA 2HMIA 1S2LA 1XRMA 3TR6A 4K5QA 4XQEA 5EIBD 3B5IA 2QR3A 3HVIA 4Q7JB 1W36B 4LXXA 4REQA 4IIJB 2XMZA 3KNAA 3CDZB 1F2HA 1HDXA 2DHXA 2XBO3 3O94A 2C2NA 1CUWA 4O9GA 3DP9A 5KOWA 2R66A 3E01A 1HY3A 3G5AA 4Y67A 4IRDA 4DR4B 4LJ7A 3AUUA 1NX6A 4YJFA 2GGPB 1E9EA 4N77A 2V9PA 3O8NA 1KL7A 4NYOA 3L7CA 3EQ7A 1ZZ7A 3GEDA 2AKYA 3W20A 4HT3B 5DBOA 2GTPA 1D2EA 3L07A 3JSXA 4LBIA 3O6VA 3WC0A 1NPDA 4ZS2A 3APBA 2CGEA 1HE8B 1W6QA 1OIAA 2ZH4A 3E53A 4ARSA 3F4BA 2BRKA 3EFHA 3CIOA 4PNHA 5LZ5A 4HDMA 4CU5A 4W6XA 3UANA 4ESHA 3LQVA 3FN9A 5DCLA 2LEAA 1Y4ZB 3HHNB 4FQ8A 4DCJB 3PQFA 2A9OA 4YVSB 3HHLA 5C8CB 1U1EA 3ZGZA 1OYOA 2WOMA 1MJGA 5CFMA 3DDIA 3LNCA 3NJVA 1OH8A 3SZMA 2AX3A 4MGZR 4YB7A 2WM9B 3IUBA 1VDZA 1QF9A 4BO6A 4AVVA 2D7FA 1FNZA 4CL0A 1KY5A 3E7PA 3N76A 1W581 3FIUA 3O95A 3MUTP 2PS9A 3DDNA 3OZAA 2ATXA 4Q02A 3E6AA 1CS0A 1YC2A 3BVPA 4FI3C 1DAPA 3PF9A 3EXFB 4PWUA 2E5GA 1U9JA 2DNLA 4F67A 1X4EA 1I4LD 3SFVA 4B0PA 4IESA 5EGNA 1USUA 3QE0A 2JLBA 1C9DB 2BF4A 2PMDA 5M2RA 2EJCA 1PCXA 2DVIA 2JGLA 3HB0A 4I1UA 3SGLA 2CE2X 4RLQA 2J1TA 4U4AA 2VJVA 1CY2A 1EP0A 3FH0A 2B43A 4RMIA 5IAVA 5LP6A 1CQJA 1TFUA 2L9NA 1RXEA 2DCYA 2QMWA 4QJ5A 3VGSA 3K0FA 1Q16B 4OXKA 1VKNA 5A04A 3W9YA 2NO1A 3B9CA 1T11A 2ETEA 4TQSA 2X3FA 2I6WA 2RDDA 1YQ2A 1OY8A 3D4BA 4Q82A 1U4OA 2VUIB 3D4IA 1A9SA 2YXPX 3JD4A 1T6BY 3OOHA 4UNSA 4UOZA 4CEIA 4EG4A 5EJAA 5JISA 4I1OA 4FR2A 1ORIA 3H9CA 2I8AA 4EZHA 4U2GA 4OY3A 4H1UA 4KX5A 1HWJA 3L6CA 4IMPA 3R77A 4A4AA 3PXEA 4UM5A 3ZCSA 1P61B 1GAXA 4JVAA 2JGRA 1YJTA 3PGMA 4B3SJ 3E2EA 2JCGA 1M2VB 1Z26A 2QTGA 1B35A 3CSDA 4S1OA 1G6OA 4K0KJ 4AYBD 2CQHA 3MD3A 4QSMA 3ACFA 3VBOC 1QCZA 1K4KA 3SSRA 5K4GA 4OYBA 2YKQA 2QSWA 4UQPA 2DU0A 2M6LA 2PS3A 2VCYA 4PBOA 1NF2A 1U9IA 3R5XA 4IE7A 1QTNB 5DH9A 1E6VB 4TXJA 4KZKA 1QJY1 5LOVA 4UMFA 3SF8B 5E3PA 1TMJA 3A10A 3K5IA 1L3SA 3V7WA 4D46A 3U4SA 3GJ6A 2QE7A 3UQZA 4BQFA 3B3JA 1BEV1 1S1UB 4BV9A 4IR1A 3DV9A 4YPFA 5CVRA 2YHSA 3ESYA 5KFDA 4RZ3A 3T5GA 4BO7A 3NKTA 3ZBUA 1R0BG 2YPZA 2WTMA 4MAKA 1JIIA 3KJNA 2JIZA 4DJ5X 5DOVA 2Z1MA 4KNCA 3M3HA 3TQOA 2MINA 2R063 3E5XA 2G4VA 3DZDA 4XC9A 4ML3A 3I6BA 1HV8A 2N4CA 1IBMB 5KREA 4MNTA 1RHRB 1HMVB 1S1WA 2VNAA 3IAHA 3M82A 1WLCA 1RTDB 2ZS9A 1I3CA 4MKXA 4K6OA 2C9AA 2BFPA 3CF5Q 3I3EA 6GPBA 1C57A 3DM2A 2X4LA 1YKFA 2ZJRQ 2PFGA 1OPRA 2EKDA 1Y8ZA 4CDXC 2MY7A 4AUNA 4QJVA 2EFGA 1VQLS 4BLOA 2EKPA 1RQ2A 4JI4F 4QPPA 2OEMA 3GA7A 4ZHQF 3H86A 4J1WA 3A8EA 3SYMA 4N43B 1SUDA 1RRGA 1DIGA 4PR3A 4ES3A 2O8VA 3QEOA 1UPXA 1YZNA 1FDNA 5ADWA 2JFOA 4QDTA 1XJQA 2A8YA 2IHNA 2XXZA 2OPSA 5J2UA 4JB3A 3I4HX 4CDNA 2WNOA 2ZTLA 4H7FA 3M6XA 4OYAA 1LJ8A 1BQNA 2QVGA 2XMMA 3EA0A 3A4NA 1O97C 2VSYA 2CPDA 1PFVA 4J07A 3Q7TA 2DHSA 5F35A 2QE3A 5IC6B 3L7PA 4FO9A 4WVWA 4WFBQ 1FLVA 4F72A 2XONA 1YIAA 4HAZA 5J47A 1CJVB 3H05A 2JB8A 3RFCA 3U7IA 3FLAA 1DGRA 4C6TA 4LF5F 2TSYB 1A2QA 4DL6A 4PQGA 1ZOPA 2PUVA 4F3TA 4C3LA 3DA8A 3RM3A 3MRSA 2A1UA 3V81A 2VTXA 1ULGA 1X1CA 1IKWA 3AERA 2R2SA 3Q8SB 2M8HA 1HC7A 3IYLW 3CBQA 5E1DA 4Q3AA 4Z53A 1DOHA 4D7YA 2OGUA 4D8XA 4HSJA 1KJ9A 2HA6A 3LFUA 3AF4A 4PHFA 4RORA 5K0UC 5KNBA 4F4XA 1U7TA 3K1AA 5DW3A 5ECDA 3BGSA 4KHZA 1D9FA 1VA5A 1UL9A 1WTBA 1G21E 1EIWA 1Y0BA 3LRTA 5ANRB 2WU3A 4KQHA 2VTVA 4ZHNA 4LFBJ 1E1CB 1POQA 2JG8B 5IHRA 1N6HA 4UUNA 3KLMX 1ZNYA 3KLHB 1FRKA 1Q8VA 1LF0A 2RB4A 1KOFA 4KLRA 2FSUA 3MJEA 2HIHA 4CKWA 4RTKA 4C01A 1Z0DA 1LSJA 1SV5A 3NHRA 8MHTA 3C66A 3LTEA 1VS3A 4ZP1A 2VQ0A 2ZUAA 1JOBA 1VXRA 4F4HA 3IAAA 4BV8A 3FDIA 3NFYA 3H8RA 1U7DA 4XE5A 3EDOA 1S2MA 1C29B 4AZ3B 3G2HA 4DUVA 3TLYA 3NV4A 2J5AA 4V0OA 2CJQA 3IBSA 3ODPA 1Q5OA 5F76A 3DLIA 3LUFA 3FUOA 5DLDA 3CDEA 2XVLA 4XUQA 1K2VN 2X5JO 1RLMA 3ED5A 1AX0A 2YZMA 1BVUA 3RQIA 3M4FA 3VGJA 4WBFA 1NXVA 3T2QA 3JYTB 2YIDA 4Y1ZA 2I6FA 2B8PA 2KLBA 4R05A 2YY5A 4KSCA 4LF7F 4CTAA 4AK9A 5E3JA 2PKWA 3FHAA 5AK0A 1EWYA 5JARA 3ODGA 1EXDA 3LGHA 3TK1A 2E32A 2QLJA 3WDKA 3JD71 5JFTA 2HPUA 2J30A 3PZPA 2FPGB 3KQQA 5DEOA 1Z6QA 2C2OA 4DSZA 1KZYC 3ZXYA 4YAJA 2Y27A 1G7CA 2FSIA 5D77A 1CR7A 4Y8VA 1YJLA 2BANB 1P6UA 3CW9A 5I9IA 2V5VA 4U8GA 4O0NA 3GP3A 4N3GA 2FZGB 3UAOA 1A5AB 1QZUA 2AK2A 4WLNA 3DYIA 5A9RA 2BM1A 3CB2A 3U1BA 1RYYA 2DITA 1ZPDA 4R8MA 5A7PA 1EGHA 1YBVA 3QVLA 5E88A 4AKTA 4CLOB 2OKGA 3TTSA 2FVYA 3WNXA 3GEEA 4UNQA 2RGYA 2MT9A 2VQEF 2Z2YB 3A6EA 1P2SA 2C2RA 1QKIA 1W2WB 1F3LA 3EUEA 4WXEA 2X9LA 1OXKB 2WT0A 1JYFA 1SKUB 4BZQA 5FZ7A 4GS5A 4D3DA 4F4FA 2AGQA 1R18A 1O7JA 1Z56C 2PS1A 1UKVY 4Z99A 1I4WA 1S2BA 2CYAA 4UEJA 5U4XA 3LL4A 3CUNA 2NUTA 3W59A 3ZH2A 3SNHA 1EQAA 2WKQA 3KHUA 5A0TA 2Y0CA 4XOGA 3NRJA 3OYWB 4MRMA 1A71A 4C8ZA 3A2LA 1WZUA 3QKSA 3E9YA 3DMRA 2VXBA 2I0FA 1N34J 1LGNA 1A8MA 1SM4A 5HBRA 1QGAA 1A9RA 2VK4A 3Q2SC 5ARDA 3BMCA 2ZBVA 1UH5A 3ZFGB 4HEQA 1L7AA 3OX1A 3QPCA 4GLBA 2PGOA 3TH5A 1ADFA 3RW6A 3E5NA 1Z39A 4H7EA 2LEBA 5ESWA 2X4GA 1UYXA 1V5FA 3HSJA 3CX4A 2L9DA 5L95A 2Q6LA 1DXYA 3L1UA 4YACA 4LSNA 3A36A 3GCDA 2VZLA 4ZARA 1XD2A 3Q3GE 2PJZA 9LDTA 1AKWA 4L11A 3AOCA 4EBEA 1N5RA 2DPMA 3VHRA 2H2HA 3PXCX 3UAWA 4I0WB 3OSNA 4FDTA 1JQBA 4K4YA 4WM8B 3JQPA 3S6PA 4JVSB 2GNPA 3QRRA 2V7TA 3BN6A 3VDDB 4CQJA 2VD7A 3S1TA 5DSTA 1PKEA 5HMXA 1O94A 3RBZA 2A5JA 4MQEB 4ES9A 3V7NA 4AJ2A 1CLFA 1WSDA 1XEAA 1ZU4A 1COV2 4MCIA 5L40A 5JVVA 4LIVA 1ESCA 3KQPA 4X62F 5ACA2 4BZXA 2GX8A 1AJKA 3L6BA 2WSEC 2AWZA 4JQCA 3LX5A 5KOJB 2W8KA 2IQIA 4YCAA 4RV9A 4L97A 5DDJ3 1EJBA 3AM5A 3H8JA 3AVWA 2XXAB 2YICA 5HILA 3B9PA 1HE2A 4MWDA 1CS4A 4GP7A 2LALA 1UKAA 3RREA 1DQ1A 2D98A 1RAIB 2FPSA 4LZLA 4DCGA 1CEYA 4MB2A 2WB1D 5FO1A 5LSAA 4B6EA 4QOHA 3VH4A 4AJ9A 1E61A 2XW6A 3QLTA 3GLHE 1W87A 5B7WA 2R4UA 3DM2B 5F32A 4RQAA 5BNIA 1WJ9A 2C58A 3PFBA 1T3OA 4F97A 3G2JA 3IFEA 4GAEA 4Q4CA 4AZVA 4FYXB 2QJFA 5M3BA 1K6EA 5GAJA 1XPRA 2H5EA 1SCNE 1SZCA 3T9BA 5DUUA 4EL0A 3REFA 1BH2A 5IN4A 2WPDA 3VUOA 2BJEA 3AZZA 4HC4A 4R0MA 5BNNC 1UX6A 4LV8B 2WV9A 3A14A 1E3LA 1RM0A 2YPYA 1FJCA 3EGWA 2FUNB 2NAFA 4RD1A 3V4IB 4I81A 2HRRA 4YYOA 3UKOA 2VCAA 2L9LA 1UU5A 1NBEA 1N5TA 1G6Q1 1HR0J 4HPKA 3JQDA 1M2NA 4JX8A 1SFRA 5C6CA 1Y3CE 3DMPA 1W05A 5F39A 1J97A 2HIGA 3OFNA 3OLWA 5BN4B 1HNXB 2OI2A 4NKRA 5EEHA 2F1JA 1TM2A 3FJSA 4UM8B 2W0MA 1IN0A 4HHHA 2RILA 3UNPA 5A3QA 2Q3MA 3DDSA 3QVMA 5C1IA 3B36A 1RQPA 1YS6A 1M2HA 4RFRB 4WZ6A 4CRWB 2DXDA 3HHPA 3LOUA 1Z4QA 5FHQA 1HE1C 2XLCA 1NUEA 4PLGA 5HZGA 1Q78A 2AEMA 3SX2A 5AJXA 5FP3A 4IERA 3UMFA 2WD8A 1I6MA 3W8NA 5ALQA 4QZVA 1C9KA 4BNIA 3HB9A 2ICAA 1AOXA 5FV7A 3UDVA 4PLPA 4BU1A 4BO5A 2OO4A 1KI2A 1P1TA 4KH0B 3QLQA 4QQNA 4RY9A 1AFIA 3BV8A 4BN0A 1QQTA 1SKMA 4ZLLA 4HBGA 3KK2A 2VF3A 4WFJA 5K3AA 2VO5A 3HCWA 2QYCA 4ZVKA 1U6KA 1M10A 2O52A 4TQGA 4Q3CA 1DL5A 1CJUB 3R20A 2P2ZA 3PYFA 4MR7B 1O0PA 2DU1A 5DGTA 2RK4A 2F67A 5LYJA 1HKUA 5IKEA 3FCHA 3AHCA 4DY5A 5AW8A 4M22A 5E6RA 4I67A 3KHGA 1GCOA 4URGA 4V1CI 4DUGD 2N7YA 2CBXA 4GO5X 2V7BA 3RUPA 1AFJA 1JJ7A 4QD2A 1FFWA 1Y7LA 3TRFA 4QYZJ 1MB4A 1M9NA 3TA1A 4YW5A 1YX2A 1P5ZB 3EWAA 3I2OA 2N9UA 3RARA 1PN3A 4PSAA 3RRMA 2FIUA 1FNOA 2QL9A 1XR7A 3L0OA 3BD7A 1Y42X 3RUAA 3NHFA 1C1DA 1JBKA 4KMRA 5ELXA 2A5GA 1ONSA 4PYIA 1G38A 4UKDA 1IBKJ 3MECB 4M87A 3MR2A 3DFZA 3M32B 3VPFA 5I7AA 3GMIA 1OLSA 4K2JA 1HOTA 4X6LA 3NP5A 4NYJQ 4BE7B 4R9DA 4IY1A 2M88A 1R4NA 3UY4A 5FZ3A 2VJYA 5BURA 1QYWA 4KR9A 3SEAA 1DC4A 3UMSA 4E11A 4NXMB 4Z1OA 4HH1A 3H7JA 1YS7A 1RYBA 3B00A 3VJMA 1LB1B 1U04A 2K2SA 2ZJAA 3IT3A 1N6IA 4LUBA 5D4OA 2YXLA 4KP7A 1U0HC 2A7AA 3ZZUA 4FLEA 4AMZA 2ATEA 2C94A 4DR6J 1HRI3 4PM4A 3EQ2A 1FSSA 3CXRA 1MVOA 1GZ9A 4KTVE 2W8BA 4OA5A 5A3NA 3FOCA 3TR5A 1FRVA 5KNCH 2WYFA 3G5LA 3QBQA 4LR9A 1YHZA 2OYRA 5I8ZA 2SBAA 3IAM1 2AJ1A 4TY8A 2VBDA 3G82B 4DIBA 2ODBA 4I8DA 2UXBF 4Q9LA 3TS1A 3WZ1A 2HNBA 5FPUA 4Q4AB 4IW3A 2SKDA 3X44A 4WJZA 3LBYA 3OT4A 4C97A 1NXIA 2P3QA 4A73A 3COVA 4CDUA 3TGWA 2R8KA 1JHJA 3T3MB 1T9XA 4H60A 1BEUB 2DERA 4IDKB 2MZTA 3IBCB 4NPAA 4RH1A 2YNGA 1N5LA 2WZCA 4IXMA 1TUBB 1JKJA 5BN4A 3QVTA 2BV4A 1ZO8A 1PAUA 2B8WA 1NZIA 1WR8A 1IQUA 2PLV2 4BXOB 3R6LA 3QNWB 3VL9A 1AB8A 4X0EA 4JBXA 5A8KA 3DJYA 3OTOB 2WU8A 2QAJA 3STVA 4IL7A 4DV5B 3IIKA 1NDUA 3ZFEA 3DDKA 3DLKA 3NHZA 2J8ZA 1X60A 3M81A 1W8ZA 3OTQA 5A2QY 1MJHA 2GBIA 4Z37A 4NJEB 3NT5A 2BQ3A 4TL9A 4NFHA 1I36A 2PS0A 1SB9A 4AC9A 5KFQA 2DGUA 1XQXA 4ZO8A 3KUKA 2UU9F 4WJBA 1CZNA 2NXEA 2PKEA 4XR9A 1RUE2 3Q8WA 4MSVA 5C42B 1YBHA 2CMFA 4ZT6A 5A4IS 2GYUA 5CM8B 4YV0A 3UKVA 1TQDA 1HNIA 2LRPA 1JXQA 1IIRA 4H9GA 4BE3A 5B6IA 4LI3X 3ETPA 5JCZA 3KUUA 2GS9A 3HFKA 4GKAA 4DL0C 3EGXA 4MP3A 4C90A 5DZ6A 2C2XA 4D9MA 2XUHA 1JSLA 2ZJQQ 1GA1A 4ARUA 3O7MA 1OYDA 1N4AA 4B3IA 3VHNA 2PFFB 5FR1A 1OF4A 4NK4A 5FPYA 4G1UC 1HGXA 5DP2A 1P4RA 1YWGO 4R2IA 4RIFA 3UUEA 4JYAF 5BVGB 4HLUA 3IC1A 3U7QA 1ZS6A 1I94J 3A9WA 3W2GA 5IW0A 3EHDA 5KXBA 4DC0A 5CXUA 4FR0A 4M3CF 2BEVB 1BJTA 4FHGA 3O8WA 1RVDA 3AWDA 4FKXA 5M2QA 4RSMA 2R25B 4UU8A 3OPZA 3IE2A 4B3SB 5KAKA 1MZEA 4IV1C 3PV0A 4FF4A 1XDGA 1VMEA 2CPHA 4CKBA 2FDGA 2RQ4A 3FXAA 4YWJA 2Y8WA 3OGSA 4MYEA 5I9TA 2IC3B 5JALA 1WLSA 2P77A 1XEZA 1W9TA 4AQYJ 3ITNA 4JJ4A 1RT7A 2I67A 3OIVA 1AT1B 5JAPA 2WJWA 2P5UA 3N6RA 3RSCA 1VIOA 4Q8KA 2WU1A 1LOBA 4NYJR 1CRZA 2WL1A 4QGNA 3IIMA 5JSYA 3L6DA 5ALZA 4PQYA 3D3WB 2JBAA 3DPRB 3QK7A 4MA0A 1F60A 1G21B 4IOMA 4L7VA 5HNKA 5AVKA 5E3AA 3CJ4A 2ZJ7A 2DNRA 1Z78A 2K1RA 4XARA 2VUJA 1R9MA 3AKEA 4EZEA 2D1FA 3GEHA 3UJ7A 2JANA 4DR4J 1HJGA 3A7DA 3HZHA 1WG5A 3INGA 4DCOA 5EP4A 2VC0A 2BTVC 2LE0A 4QFCA 3QH7A 4H17A 4JI5J 2Q4SA 1FERA 4UPDA 2JGDB 2UZ3A 4J76A 2A5YB 4IQGA 3X43A 2EJTA 2H2GA 1TTQB 2X13A 1WCKA 4ERNA 4FE4A 3V9PA 3FFBA 2QD5A 4C04A 3I6ZA 2ZAGA 1KO1A 2NVUB 3LTOA 1P2UA 2Q9BA 1S4EA 5GY7A 4AJ1A 4QR1A 2NTYC 2YQ1A 3MTAA 3OFEA 4O3QA 4K1LA 3H2SA 1FP7A 2VP6A 3OQ6A 5H16A 4GXRA 2RS32 1YFKA 4RL7A 1E7SA 4W5JA 1QXRA 1VRH1 3FCXA 2G9OA 3HR9A 1SXJE 3SSAA 2JHGA 2WAXA 2GM5A 1GNHA 2FJ0A 3TL3A 2VBBA 4Z82A 5FUQA 1Z7BA 3ESDA 2QJRA 3ITQA 4XGQA 1ULCA 5GINE 3Q8QB 5FJKA 4BWYA 5TQ0A 3JQ8A 3FVYA 4ANEA 4HQKA 2ODWA 4F92B 1DP4A 3TWOA 3ROUA 2Z98A 4LY6A 4WZBE 3K05A 4BVEA 4DXTA 5HF9A 4PTYA 5DVZA 2PK3A 4YMEA 3LA8A 2HHCA 1W28A 2IYLD 3BM7A 1MH1A 3ATGA 2GNKA 2YCBA 2FMTA 2G9RA 1B23P 4JBWA 5EPAA 5FZLA 1W04A 3NETA 4U7CA 3W2WB 1GQSA 2YWFA 1BD6A 5CT8A 2ZKIA 3PUSA 1T1IA 3VCDA 1QLHA 2GNOA 3N2YA 2QQJA 3OF1A 1W5BA 3IGFA 1M2OB 1YQ8A 2JC3A 5C7OO 2C7VA 5IK4A 1CC8A 1TIKA 5JDCC 3VOBA 4TSFD 1T3SA 5C3SA 5EZ5A 1TVRB 2JL1A 5EAIA 3BDVA 3HYCA 1EWVA 4RMJA 1XQIA 2UUBJ 3HBAA 3N87A 4D26A 1DC8A 2I2WA 2LDXA 2CHEA 2NYIA 2XOKA 4BRSA 4Q4HB 4EA9A 1VMAA 2FLWA 2AYYA 3KLIA 1UKCA 4O0LA 2FPKA 4R8UB 3N7AA 3T7TA 3TB6A 4MPPA 3W9UA 2J1EA 3L79A 2XQIA 1LPOA 4PZDA 4J4BA 3IH5A 2A0KA 2JHEA 3BRSA 3FROA 3R09A 4QTUB 3PU8A 4XFCA 2GSDA 1HB4A 1Y3JA 2FX3A 2XMQA 1RWVA 2EFQA 2VZEA 2Z4SA 1V5IB 5JSRA 2RE9A 3NGLA 2BJ3A 3NHLA 3CKHA 4LHXA 3PYGA 1M75A 2KHZA 1PYOB 1E1DA 3N01A 4R9BA 1D5CA 1IKVA 3NATA 4OHBA 2B5VA 5LSRA 3ESQA 4UUWA 2N4DA 4IXTA 1WC1A 2E29A 1B16A 2K6GA 4LDQA 1DTEA 1XEWX 1TU0A 4TY8B 3O1UA 2R7TA 2EK1A 1YRLA 3U7FB 5CFZA 3QM1A 4U95A 4V03A 3G4SS 4IVPA 1YCIA 4GMDA 2IDMA 2R061 5CDTA 3DFKA 2J08A 3NL0A 1N0WA 1AL21 3RC2A 1W6NA 2PMZD 1VP6A 2FSVC 2J3HA 3THYA 1EUCB 2ZOMA 1RR6A 2VKZG 3D7RA 3D59A 5CBPB 4N5SA 4JROA 1PC4A 1MR3F 3MXHP 4FGJA 3BEDA 4EY6A 2FOXA 4K8RA 3ECSA 4LZWA 2XLBA 4M01A 4UM7A 3M8SA 3N53A 1OWLA 2DJIA 3DXYA 1XOIA 1VTKA 2HM7A 1KI7A 4OJNA 4CEYA 2YN2A 3NHWA 4E4ZA 4R41A 3OD1A 2XI4A 3UUWA 4TQRA 3UFXB 4D3SA 3WIBA 4G85A 1HA3A 1JLQB