4C0QC

Transportin 3 in complex with ran(q69l)gtp
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
169
structure length
169
Chain Sequence
VQFKLVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGPIKFNVWDTAGLEKFGGLRDGYYIQAQCAIIMFDVTSRVTYKNVPNWHRDLVRVCENIPIVLCGNKVDIKDRKVKAKSIVFHRKKNLQYYDISAKSNYNFEKPFLWLARKLIGDPNLEFV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRANSPORTIN-3
publication title Structural Basis for Nuclear Import of Splicing Factors by Human Transportin 3.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein/gtp-binding protein
total genus 45
structure length 169
sequence length 169
chains with identical sequence D
ec nomenclature
pdb deposition date 2013-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4c0qC00
4NYIQ 1Q20A 5F9HA 4KU4A 2ORVA 1R5OA 2D06A 3S1AA 2A3RA 4CEJB 1OV4A 1NVUQ 4Q4LA 1E1RD 1II0A 4HDOB 4F4JA 2BJWA 2ZRKA 3T1VA 4ARZB 2W0SA 1KJYA 3NBYC 3OAAA 4I99A 3K0CC 4PR0A 4ZI2A 5B64A 1MV5A 2G3YA 2B6HA 3QXJA 1B23P 4W5JA 4C0LA 1EG7A 2HEIA 5F2EA 1BYUA 4K81B 2H1LA 3CBQA 2DYKA 5EZ5A 3V4RA 2WWHA 1FQKA 2PT5A 3ASZA 3CZPA 1ZD8A 3HR7A 4P32A 3RS3A 1Q1BA 2FEMA 3OF5A 3BFVA 2PT7A 3O8DA 1E0KA 4D4KA 1GL6A 3BK7A 2ZJZA 2OLJA 1FPMA 2RMKA 5K8UA 1N6NA 1A2BA 3WMEA 2FFHA 5BYJA 1QHSA 2ODBA 2XXAA 2F1RA 4LBVA 4BZQA 3THXB 4HAZA 2XOKD 4M53A 1NLZA 4KO8A 1MT0A 4JLJA 3E5HA 1GNRA 3AKEA 3DKVA 4I1UA 5FOSA 1TUEA 4TN1A 5JLJA 2RGNA 1BO6A 2FNAA 5EP4A 2WIBA 4BFYA 2GZDA 3RSLA 1MRNA 1JR6A 3FHCB 4KHZA 3O8RA 2G0NA 4EDHA 4DB4A 3AF4A 4NU0A 3F8TA 4NE2A 2ATVA 3B1YA 3BBPA 1HY3A 5H68A 3ICEA 2GZAA 1P2TA 1XD9A 2ZYUX 4KSBA 4PZZA 1G3UA 2VBCA 4EPWA 3A8TA 1YJ5A 4MGYR 4BASA 2BM1A 2F3RA 4E07A 3W6NA 4WZBE 1TF2A 2J59A 4FCTA 1OXUA 1GRRA 1P7CA 3ADDA 4P4SB 2JAQA 1R6BX 3KTAB 1KO7A 4ARZA 4Q1EA 4EPVA 4B47A 3OEEA 3C5CA 3BS4A 1OKKD 4GMDA 2A7QA 1LS6A 3A4NA 2ZJ8A 2GETA 3ZZUA 1QVRA 4M21A 3EC1A 5HZKA 3TUZC 1KKMA 5KDDA 2RAPA 4HI0E 1ZW6A 2Q3FA 2R6DA 3EG5A 4ILEA 4PHGA 4E22A 5BWMA 2ZRJA 4IRUB 2IF0A 2OESA 4M9QA 1YRBA 1W4RA 2G83A 1P4SA 2PMKA 4UNQA 2AX4A 1Z63A 4CRWB 3OIVA 1KI9A 4QRHA 4URUR 2IT1A 2E87A 5KU1A 3GFPA 1KIMA 4P3YA 3FMFA 2VHQA 1GWNA 3Q85A 2W6JA 2IW3A 2WBLC 3B8HA 3AVVA 1AS2A 3LNCA 1U8YA 1NSFA 3OFNA 3C16C 4US2R 1GNQA 4TT3D 5TDHA 3C5HA 1TF5A 1YKSA 4M22A 2OO7A 4Q7MB 5CDFA 4A9AA 1WBBA 2FFBA 3GMTA 4O25A 4BFSA 2OCYC 3ONWA 4Q66C 4M9XA 4QNMA 3EC2A 1E99A 2WAYA 1XTJA 4FWTA 3QF7A 4C30A 1GFIA 4Z54A 2GTPA 2YWEA 5J4HA 4URXR 4EFMA 4LV8B 4Y0VA 2B8WA 1DAKA 2EW1A 3C41J 4PO1A 1XTIA 4BRWA 1KI2A 2D74A 2ERYA 5KSYA 2AKYA 4NYMR 3ZIAD 4KV9A 3UATA 1FTNA 3QBTA 3K0SA 3GLHE 1Q12A 1X3SA 4DLUA 1XEWX 3VR6A 5EE3A 4RVCA 4LHWA 5HCIA 4IDNA 3PV0A 5HZHA 2X8AA 4H1UA 2FEOA 1QRAA 2G6BA 1DVRA 1Q44A 2BKEA 1H8HA 1UAAA 4GFDA 4D25A 2V4ZA 1KKLA 1D2EA 1R2QA 3THYB 2ZRFA 4OK5A 2FGKA 721PA 5HKKD 3AEZA 4GP7A 1Z6TA 4I1OA 3M4YA 2XB4A 4P4SA 1N6RA 3FKSD 3CKLA 3KTAA 3RS7A 3GP8A 5IRCD 5UKDA 5LDDC 3OIYA 2ZYWX 1HE8B 3BE4A 4OQNA 3NDPA 3ZLJA 4URZR 1ZBDA 1HQCA 1RZ3A 4DUGD 4F4CA 5LBIA 2QN6A 1OHHA 1GSIA 1FP6A 2FH5B 2WPDD 4FI3C 5EE9A 1RRGA 2IS4A 3EWSA 3WYAA 1EFTA 4LBZA 1NMZA 1E2FA 1S4QA 2AK3A 1US8A 1M74A 2QY9A 2REBA 3ZD7A 1IHUA 1QF9A 4QXAA 3QVVA 1G41A 4Q21A 3LX5A 2VRWA 1F3OA 1S1MA 3C7KA 3TVDA 2ZJ5A 5IF9A 4NMMA 2OILA 4DDWA 2FSIA 1Z5ZA 1ZCAA 5IDVA 1K5DA 5SZHB 2O52A 1QG4A 3BAFA 4MKGA 4WBSA 4QHSA 2KB0A 4Z1MA 2ZR9A 4L9WA 1G7CA 5FL7A 5HPYB 2PCLA 2G77B 2Q6TA 1G8YA 3BB4A 3AKYA 2VHCA 3FMOB 2W2TA 1WBDA 2IK8A 1FFHA 2ZRAA 5E3HA 5L3QB 5KNDA 5M04A 3TAHA 4PPGA 5FBWB 4FCVA 2V7QD 3MGCA 2YNMA 5FR2A 3GJXC 4HUQA 3UPUA 3C4JA 5TMPA 4AURA 1XMIA 5DYIA 2OLKA 1S2MA 2EVWX 3U60B 2O5VA 3KJIA 5IT5A 2QAJA 5DLQC 3U4QB 2GZHA 3P20A 4B6EA 4PC3A 1KZGB 2RHDA 2ZS7A 5EXSA 3U3KA 3HWSA 4IEIA 3BORA 2IWRA 3T12A 2H92A 2P5SA 3I8SA 2BKUA 1XFAA 2GF9A 3Q72A 4PO9A 2BDTA 3EWAA 4QBGB 2O8DA 2REXB 1S3GA 3OE7D 1KOFA 3QI2A 1G3MA 4B3CA 3LXXA 4Q47A 1NKTA 1VYUA 2FWRA 2VP6A 3UIEA 3M6AA 2AFHE 3IPXA 3PG5A 5AJVB 1E96A 2PMDA 4OYHA 4M2LA 1E1QA 2NZJA 1DG1G 3D31A 3IHWA 4UKDA 1U8AA 2YV5A 4BE7B 2QBYB 1BOFA 1G3QA 1AGRA 1G9XA 3X1WA 4D4LA 3SN6A 5A4JA 2C96A 5JBQA 1KHTA 1TL7C 4B48A 4B73A 3PJRA 4W5HA 2ONJA 3L2OB 1EX7A 4UJ3A 1UBCA 2BHRA 4BFWA 3HDTA 5CM9C 1C4OA 1SHKA 3CPHA 3TRFA 2QRZA 4KLNA 2AN9A 1E2PA 3R9WA 2H16A 1ZU5A 5CK4A 3P4YA 2YWGA 1ZM4A 3NBFA 1Z0IA 5GJVC 3UG7A 4Q5IA 2Q9BA 2HCJB 2IEYA 3L0OA 4S35A 1L4UA 1XB2A 5DO9A 2PL3A 5K8TA 3ZZTA 2XTZA 3NEYA 5FOUA 1W36B 3PUXA 2O8BB 5L3QA 2V1UA 2ORWA 1X8LA 1AM4D 3KJEA 1PLKA 1VHTA 2R6GA 1JAIA 1P3JA 2QA5A 3AP1A 2BCGY 2D2EA 2KWIA 5CYOA 2FJUA 3C15C 3K09A 4NZYA 4U02A 4I4LA 2R9VA 5KNBA 1ESMA 2ZI4A 3QKTA 4M1KA 2R44A 3I4LA 3X1ZA 5F3WB 2VEDA 3U4QA 4F38A 2FSFA 5L3RA 4BQSA 3LBNA 1NN0A 2OT3B 4X8OA 1A7JA 5F9FA 4R98A 1XTQA 3QXXA 1LY1A 5DISB 2QM8A 2CDNA 2Y8EA 1KK1A 1EK0A 2DBYA 2ZETA 1WB9A 1JAHA 3CRQA 3B7GA 4LRWA 1S0UA 2XJ4A 3QVUA 3KQHA 1VDZA 3FYHA 4BLTA 2J0VA 1CLUA 2VSOA 3QJYA 3Q7QA 4PAOA 2X77A 1KY3A 3B13B 1IN5A 1CJUC 1JPJA 3O47A 1OT3A 4D0GA 1CEEA 1E98A 1SQ5A 4BEJA 1QG2A 2KBFA 3IO3A 4EAQA 2QBYA 1CR4A 2VL7A 4LYHA 1U2RA 2ZAOA 1SULA 5FTMA 5JECA 3IPYA 2OCBA 1R8SA 2YINC 4TSFA 1GKIA 2LCFA 4Q4HB 1BKDR 2JJ2A 2ZUBA 1CR2A 3LBIA 3LXRA 2MMGA 5J4VA 4HAUA 4ACBA 1OFIA 2WJYA 3G5UA 4HDCA 3EX7C 2YVUA 1AZTA 4HAXA 2UKDA 3WNDA 4XWAA 4QG7A 4BLPA 3D3QA 1CJTC 2GKSA 1COWA 3KXLA 5E7JA 4E03A 2ZR0A 1UDXA 3CNNA 1YZGA 2ZRPA 4ABYA 3F0TA 3NWJA 5CLQA 3IIJA 2GXAA 3RRNA 2JLSA 3RS0A 4KLZA 3H2YA 2C98A 3X1XA 3R9IA 4TQUS 1Q22A 2PLRA 3T5GA 2V6JA 4KVAA 2O8BA 1W4CA 2GCOB 3PENA 4DCUA 2FF7A 5JFGA 4B3XA 3RLFA 4A82A 4JVLA 1YR8A 4XOIA 4ZDIA 5KPDA 2RGEA 5BW8A 3FPAA 1R5BA 4NYMQ 2WV9A 4B43A 3UANA 2L0XA 1FX0B 1JI0A 4B34A 1QHXA 3BB1A 1CIPA 3TUIC 3X1YA 1Q1EA 1KI7A 4V02A 1ZC4A 3MCAA 1DOAA 3SU8A 1WQ1R 1XEXB 3OHMA 3K70D 3T15A 1TTTA 3R7WB 1RJ9B 3ND9A 1Z07A 1TQ4A 1W2HA 2QI9C 3QG5A 1J90A 1DO0A 2PZGA 3ZZ0A 5FTJA 1UFQA 4KFTA 4BFUA 4M1WA 3HU3A 2OBMA 5KPJA 2DR3A 4FMBB 4URWR 4KITB 1T4GA 4Q9JA 4G5SA 4CEIB 1ZNXA 3NHBA 5JCZA 2Z43A 1SKYE 1SVKA 2QRNA 2WWGA 3QUSA 5AK0A 4Q4HA 1SXJD 4GPTA 5BXQC 6Q21A 1W2GA 2R6CA 1Z6GA 2BBWA 2IUUA 3A58B 2ZREA 3GEHA 3W3AA 4PSKA 3ZVNA 1E4YA 1TEVA 2NO0A 2VHJA 4A8JC 1N6HA 2YOFA 5GJBA 1Q1QA 1VIYA 1G1MA 1RW4A 2BIFA 3BC1A 1V5WA 5JS7A 1EXMA 4JT2A 2ODNA 2P3SA 2VTKA 1FP7A 1H8EA 3IIMA 3JZMA 5EP1A 4DEYA 1KO8A 4KI0A 3EZFA 1T8UA 3DEFA 1QHGA 4EJSC 1R8QA 1UKVY 2XGJA 2QAGC 3GCGA 2JLWA 1E2MA 1U0LA 1HUQA 3JVUA 2BVNA 2A5DA 1YZQA 2GCOA 4FMCF 3VR5A 2JASA 2P6UA 3LQQA 4N0DA 2GVDC 3QXSA 2HUPA 1EWRA 4OI2A 1TEXA 3AVTA 4PQRA 1OIWA 2GVZC 2V9PA 1IN4A 3RHFA 4PHHA 5CK5A 4JSYA 2EYQA 2AWOA 2IYTA 4UNPA 1FX0A 1M34E 1AJEA 1XMJA 4DSTA 3CIOA 3VKGA 1Z83A 2ODWA 1DAFA 4DKXA 1XTRA 3KKNA 5C2JB 2VHUA 4G3XA 3TH5A 2IXFA 1XEXA 2OM2A 2UVQA 1HV8A 2F3TA 1AKYA 4LY6A 3WBJA 1WP9A 3ZGXA 1JB1A 1AK2A 1TU3A 3NHAA 5BN3A 3R7WA 1TQ6A 2Z4SA 1RJ9A 4TYQA 4BFTA 3TKLA 4XVRA 2BEKA 1NLFA 1KTVA 4IOJA 3HJNA 1SVSA 3FKQA 3PUWA 2XNSA 5KDLA 3NBZC 2A5JA 4RD2A 1RE0A 1JALA 4K46A 2CE2X 4CEIA 4Q03A 2WJIA 2YWFA 3RRYA 2QGNA 3GQBA 3KXKA 1CR0A 2ZE8A 2P2LA 1CRQA 1NF3A 4JJKA 4FN5A 1D8TA 2OBNA 3UWOA 4GZLA 2AD1A 4M1OA 3WBKA 1RKBA 2PEYA 1G7RA 4DJTA 2J5XA 3GEEA 1JQJC 3W5IA 1MABB 3AKDA 4A2PA 5FOXA 1U81A 3K9LA 3EIHA 4CT5A 5JEEA 1F2UB 4HATA 3A1VA 4AIIA 2ZJ2A 5DIFA 4JIMA 2ZITA 3AP3A 3PFIA 4URYR 2WKPA 4IW3B 3WRXC 5K8LA 4A36A 1MH1A 1XMVA 3U6KA 1W0KA 1X86B 3ZS9A 4QJ4A 3QF4B 4G5GA 2HT6A 1OPXA 2AHOA 4UXHA 4RKFA 4DLXA 1Z28A 2IYUA 4HAVA 1DAEA 2ZSFA 4EPXA 4L16A 4KYIB 5FH9A 2HYIC 5FI1B 5FPYA 2HXYA 3FE2A 3WP1B 3KQNA 1GIAA 2P0EA 4KODA 4QGAA 3P32A 4Q18A 2KBEA 2W58A 5EXPA 5AJXA 5TB5A 1P2UA 3L0SA 2R2AA 4TMVA 4R2IA 4KVGA 1LVGA 1KDOA 2V55B 2NIPA 1NL3A 4V0OA 3BWDD 5DI3B 4DC9A 3KQLA 3UXMA 3EPJA 2B7BA 3CF2A 4X8LA 1E9BA 3TSWA 4EKDA 2BC9A 3J81k 1G3RA 2FGJA 1W7AA 1SKQA 3IEVA 4A6XA 1IN7A 3VX3A 1XWIA 2EYUA 1DELA 3RVBA 1ZNYA 4HLUC 2BMJA 2GCPA 5JSZB 4AY2A 2ODEA 4RFSB 4NYJQ 4YMVA 3VR2A 2GNOA 2OSBA 1E69A 1N5LA 4DLSA 2CNWA 2CL6X 3P26A 2IS6A 3WNCA 1N6KA 4CZ2A 1KAOA 2GEUA 1DARA 2VP4A 4KCGA 1GL9B 1XMSA 1KO1A 1UBFA 3MFYA 421PA 4PO8A 1MABA 4Y0AA 3VTKA 621PA 4QM7A 1UBGA 1XCMA 1ZMXA 1DADA 2OE2A 3SDZA 2ZRLA 4Q1FA 4C2UA 2Q3MA 1QBKC 2OEPA 3OFND 2ZR7A 2ZI6A 3C14C 1F2UA 3AUYA 3FB4A 2IC5A 4HEJA 3PUYA 4Q1AA 1RYHA 2GJAA 1KJZA 3QXHA 5JI3E 4IVRA 4Q9KA 2ZVPX 1AS3A 5EQTA 1KO5A 3QSYA 4TZ0A 3CH4B 5DGXA 2IYWA 2JJ8A 1II9A 3QF4A 5CJPA 1N5IA 1FMLA 2ZVQX 1U98A 1Q3TA 1YZTA 2LKDA 3F5FA 1OIVA 3A6PC 3B9QA 2DB3A 2N42A 4C9BA 1WRBA 5IK2D 2NMVA 2NQ2C 4M0LA 4OJKA 1N6PA 4OI4A 4Q4AA 5H8WA 1OB5A 1Q1ZA 4DVGA 4LDJA 4F91B 3VFDA 3ASYA 4FXPA 3CRW1 4QC2A 1H8HD 4NCHA 4NCNA 4U00A 3ZJYA 4B76A 1LS1A 4N1AA 2C9CA 4FINA 2XEXA 5CLLA 4ZO4A 2IX3A 2A5GA 121PA 1ETUA 4DIDA 2VQSA 3SFVA 2BCJQ 1Z6AA 1KMQA 3TSZA 3LV8A 4BEBA 5JSZA 3GLHB 2F1IA 2HCBA 4JVNA 4RFSA 3KZ1E 3T34A 4C0JA 1ZUNB 1CU1A 2VA8A 3AV0B 1F48A 1UKEA 4NTZA 2YKGA 2ZUDA 4A92A 1EFUA 1X1SA 3VQTA 5JWOA 3CUEF 2OXCA 3EIQA 3NG1A 2FN4A 4YLGA 2J7PA 2VPPA 1T5IA 3LBHA 1VPLA 1J7KA 4WIAA 1JEEA 2CCJA 2EFGA 1IN6A 2GESA 1W48A 5AUQA 1OH5A 4QHTA 1U99A 4HLCA 4Q4JB 2A5FA 4F92B 4W7SA 2K5UA 2X19A 3QKRB 1J8MF 3SHFA 4DCTA 2XNDA 1I4DD 4NCKA 5FPSA 4CEJA 2W6IA 4B2IA 4RJLA 1D2MA 3HU1A 2JLUA 2IYQA 3DL0A 3EA0A 2N46A 2HV8A 4TMXA 1ZIPA 1G4AE 1SXJC 2LKCA 1H65A 2AFIE 4WOPA 4DT1B 4CF7A 3UG6A 1OJLA 4LSGA 1XD2B 1YR6A 2B7CA 4BFXA 3QE0A 2QMHA 3JVVA 2BBTA 5E7MA 3KKOA 3H4MA 2IYVA 3HYRA 1VCOA 1P5ZB 2YJTD 1P2SA 2HLDA 2P5TB 2WZQA 3SYNA 3CF6R 2YC2C 2QROA 3DM5A 4RD6A 2ZAMA 2J9RA 5JHGB 5LB4A 1A4RA 3I32A 1OB2A 4KXFB 2NPIA 3K53A 3K9HA 2QE7D 3MRSA 2ANBA 4OQLA 2IEZA 2DWPA 2XSZD 2J3EA 2Z6VA 3OEHA 4OQFA 3TIFA 1DS6A 4I1VA 3THXA 1HE1C 4PC1A 3CR8A 4BZPA 3WHKA 1ZRHA 2DFNA 1CP2A 3UK6A 1T0JB 4AG6A 4IXNA 2FPLA 3B6EA 2ZUCA 3GLHA 1YE8A 3CX8A 3X1DA 1E32A 1L4YA 2J41A 5EXTA 2R8RA 4B3GA 1U9IC 1E1RA 1PVOA 3EZ7A 1IN8A 1Q21A 1CTQA 2GA8A 3QKUA 1HEIA 5FI0B 3A1TA 3CRMA 4C0HA 2IS1A 5FOTA 2O8FB 1YZUA 3IQXA 3SYLA 3B5JA 2ZRDA 1HYQA 4DHEA 1UEIA 5GJWC 5CDFE 3VR3A 1NVXQ 2ZU6A 5CYPA 3TGPA 4U7DA 3GJ5A 2NPFA 1PLJA 1G19A 3JZAA 1IJEA 5DYGA 4QM6A 2BEJA 2WSMA 2WICA 1YQTA 4PPFA 1N6OA 3ZVLA 4GP6A 5GJCA 3QKRA 4LJ8A 1A82A 2RGAA 2ZJYA 2FZ4A 4BLRA 1E2EA 1XRJA 2FE4A 1E2DA 2ECKA 4UJ5A 2CMKA 2GHIA 4AI6A 4DLTA 2QNRA 1NP6A 2C2HA 1PV4A 1AN0A 1U8ZA 4Q9HA 3NDBB 5FL3A 1DPFA 1JJ7A 4JLOA 4OK6A 2XOKA 4PANA 3REGA 3NKVA 2JDIA 2OXRA 2RH5A 3L0IB 3MD0A 5KTYA 2IUTA 1TPZA 3MG9A 1U90A 3AF2A 2NO6A 2P65A 3MJHA 1KMHB 3G82C 4PC6A 1XTSA 5DI9A 1G8PA 1G21E 4Q00A 1QDEA 2QGZA 1NKSA 2VF8A 1KI6B 1XEWY 4JJZA 3LLMA 1FQJA 2BMDA 3TW8B 3RS4A 1CBUA 4A6PA 1P60A 1O87A 1OH8A 1RFLA 1AQYA 2IL1A 3ZVMA 2KJQA 1SVWA 4AWXA 4EUNA 5DN6D 4JYCA 4A0RA 4RD4A 2V3CC 4BGDA 4KBFA 3CB4A 2YWHA 4LHZA 4TLBA 4II7A 4JL6A 4C2TA 4ASUA 3FFBA 4LCBA 5G53C 4CEHB 4M9SA 2J0SA 5DHAA 3KB1A 4M1YA 4DLVA 1P9NA 3H86A 3THWB 2OUKA 1KAGA 1OE0A 2B8TA 3DPUA 4RFVA 3BRWD 5B2ZA 1OKKA 4JL8A 4IXMA 3T35A 2QENA 4JT4A 2CHQA 2PZFA 3LX8A 4KSCA 3R8FA 1ZAKA 4A8JB 2NO1A 3SI7A 3IBYA 5EE5B 3ECCA 3WXMA 2QPAA 2ZSEA 1OW3B 2ZANA 3DKPA 4IVQA 1FNNA 4TSFD 2JJ2D 3Q5DA 4ZV4A 5B30A 4DWJA 2W2XA 4LGMA 4FMDB 5KSPA 3LDAA 4Q19A 4XSGA 3THYA 1IJFA 1I2DA 1Z0FA 2EWVA 5FPKA 3CX6A 2AXNA 4M4SA 1OH7A 2ZTSA 1ZJ6A 1COWD 1XEFA 4EJSB 1E2KA 4OBEA 1FL9A 5JEDA 2QAGB 3GFTA 4TT3A 1VCIA 2C77A 1XPUA 1LTQA 1VG9B 4GDFA 3QY0A 1FUUA 2G1JA 4MYTA 3SZRA 3AVPA 2ZRIA 2VLIA 3WYGA 5L3VA 2WKQA 3A1UA 3NEJA 2FV8A 4NONA 4W5WA 3AVQA 4PSVA 3D8BA 5FUXA 4DSOA 4LJ9A 4LJ7A 1RPZA 2CCKA 4MGIR 5FTLA 3CM0A 1S1CA 1JJVA 4KFRA 4CGZA 1R0ZA 1XJQA 1GL7A 1KI6A 4DBLC 1XF9A 1MO5A 4ZCIA 2ZEJA 4TQ9A 4NCIA 3VR1A 2X2EA 4PTLA 3MJRA 4DDUA 1XPRA 5DNYB 4JBYA 1MKYA 5H1YA 4DCVA 1ZM7A 3AF0A 3DOFA 5LD2C 3SJBA 4XSHA 1NNEA 2GAAA 2IUSA 1JR3D 1Z6YA 2WSSD 4LJYA 1TF7A 4JYBA 4QFMA 4CEHA 5CM8B 1EFCA 4JLMA 5KOYA 4R7ZA 1N0WA 4DEXA 2WWXA 3CR7A 5KYKA 3THWA 3BOSA 5JJKA 4LPSA 2IHYA 2HXSA 2DWQA 5EE1A 1ONBA 5AWFC 1X8JA 3EZ2A 2QTHA 1NBMA 4GNKA 1Z6XA 3AP2A 3UMFA 2DWOA 1I2MA 4C0SA 4PC7A 5EZ6B 4DUGA 1OXXK 4DRZA 1NI3A 3FTQA 1M7BA 2VSXA 3W8RA 5SZJA 1M6NA 4GSYA 2WPDA 3ZQJA 1C1YA 2J0QA 1FUKA 5FTKA 3U5ZB 3RS5A 1R5NA 2DY1A 3PEYA 4Q9LA 4NYJR 1XJ0A 1E0SA 4U5XA 3TAUA 1JPNA 4ERNA 1EESA 3VHLB 1CJMA 3I3SR 1P2VA 2XITA 2IYRA 3W5JA 1TAGA 5TY0A 1BYIA 3L43A 1GZSA 4EJSA 2YOHA 5CITA 3GPLA 1IQPA 1R7RA 1ZIOA 4QBIA 4R2HA 3T1OA 3T61A 1W46A 1Z0KA 3PVSA 1NY6A 3NXSA 2YOGA 3LO5A 5JWHA 2V54A 4MRSA 1G64A 1IM2A 1GRNA 3EXAA 3AVOA 1NN1A 4Q7JB 5CJ2A 3PCRB 1NIJA 3B82A 5J4LA 1LFDB 4B74A 1AA9A 1ZM2A 2WJGA 2P6RA 2VSFA 4Q1BA 4MRNA 1E6CA 4MGZR 4Q9IA 3SJAA 5G3YA 1KDRA 1KSFX 2MSEB 3B60A 4WZ6A 2WOJA 4RD1A 4V0MA 5DE3A 5FOVA 2C9YA 5C46F 1KK3A 1KK0A 3DHWC 2FSGA 3KL4A 4M8NE 3ZVRA 2PJRA 4PHFA 5FPHA 3MWJA 1Y63A 3IUYA 4LWZA 5L3SB 3ICQB 3SR0A 2JIZD 2DFTA 4JLAA 3M0EA 4HLDA 1Z0AA 4EFNA 5LPNA 3SC3A 3U44B 3O8CA 1LNZA 4HDQB 3AF3A 2C99A 1N6LA 2WHXA 1MR3F 4B2PA 1U0JA 5DH9A 2JCSA 4O0MA 3A36A 5EUQB 4RZ2A 3GJ8A 2IWHA 2O0KA 3OE7A 2VIIA 4BRUA 1AS0A 1CR1A 3N2IA 1VYTA 3AVYA 1UBEA 2BMEA 2HF9A 1F2TB 1FZQA 3VNUA 1RYFA 5FBQB 2PCJA 1G7TA 4XD7D 4KFUA 2ZRGA 3V4FA 3BH6A 5GVRA 4HUTA 4PAMA 1GRQA 1G6OA 3BJIC 3VR4A 2GXQA 3T1TA 4LBYA 1NRJB 2C03A 4LPKA 3Q8XB 3CWZA 2EFEB 2CLSA 4MRVA 1T3LA 2ZI9A 3GLGB 2OCPA 4L4UA 1ZD1A 4UXJA 1WMSA 2B92A 4GBMA 3BERA 4Z8YA 4WXPA 3QQ5A 2W83A 5DHFA 4B3DA 2WJHA 1W0JD 4KYUA 4UNSA 4HLQB 4F7WA 4JBXA 2QMOA 4LC0A 1TQ2A 2LWIA 4D0LB 2KE5A 1RVDA 4HZUB 3WY9A 2GJ9A 4Q7LA 4TLDA 1LB1B 4MKFA 2C95A 1CULC 5F98A 4HZIA 2FMXA 1PLLA 2CVHA 3NTUA 1Z0DA 3KKQA 2GJ8A 4XVQA 3KKMA 3IQWA 2JLVA 3PR1A 4ZIRB 1EFRA 1IY1A 4XTCS 4G01B 1ZP6A 4PPNA 1M7GA 3CNOA 1OH6A 1SVMA 3EPLA 4TTPA 2BM0A 3TR0A 5J4KA 1FTSA 3RC3A 3TQFA 2F43B 4YQFA 1E79A 1R10A 1W4BA 1JR3E 4Q1CA 5L3SA 4GT1A 4Q1DA 3DDCA 1KNXA 4L8GA 2IBMA 4B3BA 3SBDA 3IHLA 4HLUA 1CJKC 4A4DA 1GAJA 1TMKA 2NO9A 4D2IA 3U6BA 5EJEA 2I4IA 3PQCA 3WYFA 2XJ9A 1G5RA 1TNDA 1J70A 2YHSA 3RAPR 1G5TA 2FFAA 1W44A 3K09C 1PJRA 1VCMA 1PUIA 1GILA 3KDSE 4G5QA 4V0NA 2ZRBA 4IJMA 5KO2A 1NN5A 1Z08A 3E2IA 1T8TA 1EX6A 2FPMA 2ZU0C 5HE8A 2C8VA 2CEAA 3LY5A 4IKEA 4MYCA 4QHYA 2F1HA 5E95A 3KKPA 2ZI3A 5EE0A 4AKGA 1F2TA 2I1VB 4TTRA 2KI5A 2YZ2A 3PEUA 4JSTA 5AUNB 4LYJA 1HURA 1DG3A 2GK7A 4TYPA 3KQUA 3EPHA 3BH7A 3NH9A 2D62A 3FMIA 5C4GB 4RZ3A 4PZLA 1P73A 2CLCX 3NC1C 1TQDA 3K0CA 1SXJB 2VF7A 1LV7A 3U3JA 4TL7A 5JZVA 3GLGA 1P9RA 4UNNA 1CJVC 1M1YE 1ZM9A 1W5SA 4Q02A 3ADCA 2EQBA 5A5GA 2QZ4A 1IY2A 4EQ6B 5EXXA 1ZINA 3OAAD 4M1MA 1UEJA 4AK9A 1HQYE 4NCJA 3GLFB 3LW7A 2ZPTX 2JLXA 1D9ZA 4JLKA 2DFLA 4TZ6A 2RGDA 1DBSA 4C0BA 1E2IA 4CIDA 1EWQA 3ZH9B 3AUXA 5JJLA 4JMPA 1E9RA 3BXZA 3GLIE 4TMWA 4UQOA 1WDTA 2H5EA 4ZIRA 3AF1A 2EU8A 1G6HA 1SVLA 3I72A 2ZRNA 3CO5A 1S96A 1IOZA 4C0KA 4BUJA 3U61B 4CVNA 1P72A 1KI4A 1J8YF 2GBLC 4QGFA 1XNJA 4AKEA 2F43A 4B33A 2DCUA 3MAAC 2BV3A 2XZLA 2ZM5A 2IS2A 4TL9A 4LJAA 4TQAA 3QOFA 3EA5A 2GJSA 3THOA 2Q0HA 3CX7A 3W9YA 3LW8A 4G1UC 4HAYA 3PEWA 2ZRMA 3H0KA 5E7IA 2H18A 1T91A 2Q9CA 5FFMA 4M1TA 4G0NA 2J7KA 2J45A 3ND8A 1NJGA 5KHOC 5JHHB 1GP2A 2CHGA 2JLRA 2R6FA 3IIKA 4WXRA 5JCPA 5FOWA 3VHXA 3MMPA 4OHVA 2UZIR 1Q0UA 2O8CB 1M8PA 1YR9A 3CRRA 4LJ5A 1Y3AA 3RC8A 4J0QA 2VHTA 2CE7A 2C9OA 5C1BA 4OHYA 3EASA 4GRAA 4GOXA 4JZKA 2WIAA 3LH5A 2VH5R 2HF8A 5EUMA 1BMFA 3LD9A 3W34A 5HCNA 4DCNA 3GJ3A 2ZJAA 1ZC3A 2AXPA 1V43A 2FSHA 1E9AA 5CIQA 3QIAA 2ZROA 1E9DA 3TLXA 3SBEA 1SXJA 1TADA 1G291 4P31A 4EPTA 2NZ8A 2JLYA 1OFUX 2XNDD 5CB6A 4LK2A 2I3BA 2F9MA 2QSYA 2ZE6A 5BN4A 4EQ6A 2VP2A 3OEED 4R71A 1E4VA 1E94E 3GLFA 1QHNA 3KUDA 4MGKR 2Z0MA 4NPHA 5ANRB 4DB2A 4OL0A 4IOMA 3HPQA 5JI2E 5G40A 5JMTA 4WW0A 2XXAB 3EARA 3EZ9A 2CBZA 1XTKA 3RRZA 4AYXA 2IXEA 2RHMA 3VKWA 3I73A 4UXIA 4RZUA 3O8BA 2JATA 1GM5A 2JJ1A 5D3QA 1VCNA 1Z47A 3LA6A 4Z8XA 4HAWA 4O3MA 4B2LA 3NBXX 1XBTA 4QBFA 2QORA 2W6JD 4BFZA 3P4XA 4TL6A 3U7HB 2A78A 3GJ6A 4EIWA 1OLOA 3A4MA 2QT1A 2ZE5A 3DO6A 4GL2A 1NN3A 2FX3A 2PX0A 3QENA 4AD8A 1BS1A 4PFSA 2C04A 1XPOA 3OIUA 2RCNA 3OEHD 2Q9AA 3OIWA 4A0FA 3V9PA 5KUTA 1U9IA 3I5XA 1ZD9A 3N5CA 3U7EB 1JBKA 4DZZA 3LAWA 3PUZA 4PC2A 1MOZA 4ESHA 2A2ZA 2O8CA 2FFQA 1JECA 3SQXA 2OAP1 2JEOA 2HYDA 4IVPA 1XXHE 4FIDA 4S2EA 5D3MB 4KFSA 3UWKA 1S8FA 1GDDA 4TYYA 3ZQ6A 3FHTA 3AVWA 1MO6A 4CT4B 1E9SA 1XP8A 1OSNA 4GOJA 3B85A 3MWLA 4LC1A 4DLYA 5DI3A 5JRZA 3NC0C 1K6MA 4YDHB 1UDWA 1R4AA 1MRSA 1XCPA 3L82B 1KDTA 1GVNB 1AIPA 4NH0A 3Q7PA 1NMYA 1PZNA 3ETLA 4CYMA 3HR8A 4ZI3A 1A2KC 4B75A 4O2LA 3CWQA 2QPTA 1ZNZA 4HB4A 2BWJA 1MO4A 3SS8A 2CL7X 2FU5C 1G4UR 5J40A 3K1JA 5CB8A 2ZYVX 1CS4C 1QHHB 3RYTC 4XVUA 4BPBA 2W00A 3RABA 4D82A 1JXOA 4F4IA 1E0AA 3K70C 1LF0A 1OHHD 2TMKA 1P62B 1GKUB 2VYFA 1CKEA 3NH6A 2JDID 3GJ7A 3U3MA 1QVAA 4OHWA 2FZLA 4C7OB 2WM9B 4GOKA 4BZXA 4IDOA 1G20E 4KBGA 4M1SA 1NIPA 2ASEA 2D4HA 4PPQA 3VMFA 2RB4A 1Z0JA 1ZUIA 4IFBA 2QQ0A 5LD2B 1TUIA 5C18A 3BFXA 2ZS8A 4Z1MD 4MRPA 1E3MA 5FL7D 3IKJA 4IFEA 4B32A 3Q5EA 1FMJA 1KSJA 3MWYW 5FUWA 1A5TA 3B1ZA 2BJVA 2P6NA 3B2EA 2J87A 3IILA 4IEEA 4K8OA 4JL5A 3FMPB 5CIWA 2DHRA 2GK6A 2IYXA 2CK3A 2O0HA 4N0EA 4ASUD 2NTYC 1ZM3A 1YZNA 2E1RA 4OK3A 2IYLD 3QPVA 4XIGS 5D3MA 3GJ0A 3TBKA 4FCWA 1KJWA 3FGNA 3TE6A 1MO3A 2IYYA 2GXSA 2GWHA 2HJVA 2EWWA 2QMEA 3CRVA 1ESNA 4XTRA 4C3ZA 2WWFA 4HB2A 5HE9A 2P67A 1NG9A 4YXWA 1VHLA 3QEJA 4P33A 4Q01A 4P4UA 3WHLA 1E2QA 2G0TA 1UKZA 3SJZA 4ZDJA 5AJYA 3SEAA 4V0KA 2YYZA 1KYIA 3VNVA 4MITA 3H1TA 1US8B 2XZPA 3MUFA 4DLZA 3IEUA 3CONA 4XJXA 5K8IA 4NBSA 4HYYA 2HT1A 2YC4C 1K5GA 2OFXA 1N0VC 3PUVA 4QL3A 3W6OA 1G17A 1E9CA 1QHHA 1S9HA 3MSXA 3MWKA 3WMFA 3G0HA 1CF4A 4LYAA 2OAQ1 1IXSB 1N0UA 2AL7A 2XTMA 1E1QD 3RS2A 4IOLA 2JLZA 4M9ZA 4RSGA 3SQWA 4KJZA 1UPTA 3K0FB 4G5RA 2C78A 1IXRC 1BH2A 3TJZA 4C7OA 2MMCA 3B78A 3QEOA 3UMRA 3K9GA 4YMSA 2QP9X 4Q4JA 5SZIA 1JNYA 3CPJB 1KY2A 4MUBA 2FA9A 4KAXA 1OYWA 2GILA 5BN5A 1NLYA 3KJHA 5IK2A 1Z2CA 2IYSA 4MA4A 4IDQA 3B1XA 3B1WA 2G9NA 1NVVQ 4BECA 3P27A 4MYUA 3TNFA 4HUQB 1GITA 2GXUA 4TLEA 1GTVA 1AKEA 4DT1A 3SE0A 1ZVQA 5FR1A 1Z29A 4B3FX 3PIRA 4V0LA 5AUPB 4G5OA 1XD2A 1JQLB 2VO1A 1KI1A 2ZJBA 1G16A 2VP9A 4QJ5A 4FMCB 1G18A 3GJ4A 3AKCA 1U0HC 1HT2E 2PZEA 1U94A 2O8DB 2FG5A 4L5BA 1D2NA 2JLQA 4TYNA 1QHYA 4DSNA 2OHFA 1XU4A 2G1KA 3QPUA 3EIEA 4BLQA 1Q3HA 1RC8A 3PITA 4HSEA 4IHQA 1B0UA 4WAUA 4LUCA 3ZYCA 1D5CA 1NBMD 2EFCB 3QPWA 3FWYA 1E2NA 1ZU4A 1ZYUA 3BGWA 4L9SA 4A0GA 1HH4A 3B1VA 4PHTA 4ZDKA 4LJ6A 2RGNC 1IBRA 4LHXA 2VP5A 1ELOA 5JRJA 4X8HA 4ZCLA 521PA 3OZXA 4LV5B 1FNMA 4Z51A 4E5UA 3KUCA 2GF0A 3OESA 4IDPA 4RCYA 4AYTA 4DDTA 2QEQA 1FOEB 1SGWA 2OFWA 4TMKA 3X2SA 4BLOA 2J0UB 1OYYA 3AVUA 1XJCA 3QXCA 4ACAA 3I92A 3TSOA 3GEIA 4QJ3A 2NGRA 3RSOA 3DM9B 2KSQA 2DFKB 2OV2A 1DAIA 5KSZA 3RNLA 3TW4A 4JS0A 1DE0A 1KSHA 2D3WA 2OCAA 5FPTA 2ZXUA 2O8FA 2Z5FA 1VTKA 3T1QA 3K0FA 4D0NA 1E2LA 1UADA 4WA7A 4AG5A 1G5PA 2IF2A 1IY0A 1VG1A 2ONKA 2CCGA 1JXMA 4ZCMA 5BYKA 2XB2A 3DMDA 4MRRA 3IBGA 4URVR 3DZDA 3QKSB 3UMSA 2BBSA 4R9UC 4QGGA 4QGHA 4YMTA 3A1SA 1SHZA 1E2HA 3U7FB 4PQFA 3AB3A 2NO7A 1UKYA 5FUYA 2X1VA 3I8XA 1N3BA 4DSUA 1F60A 2RGCA 2AR7A 1N2CE 2QE7A 1Z2AA 3W6PA 3Q3JB 4D81A 1Q57A 1LF5A 1YVDA 2WWWA 2XSZA 2A9KA 3LLUA 4O2RA 2WWYA 2Z4RA 1N25A 2N1BA 1WE2A 2VP0A 3GD7A 4PXAA 4JLBA 1W36D 2A5YB 3IO5A 2FDCA 4NDZA 1CXZA 2ZSDA 1ZNWA 4A2WA 2AWNA 4AYWA 4V03A 1HA3A 2QTFA 4YONB 2PLFA 1VIAA 3B9PA 4E09A 1KMHA 2F6RA 3EAQA 4I1SA 3ZIAA 3RWOA 3U3OA 2CHVA 1EGAA 1QZXA 2OG2A 1NJFA 2F1JA 1RRFA 5J5CA 5KNCA 2EFHB 5TXGA 3WP0A 4BLSA 2ZS9A 2AK2A 2O0JA 2Q3HA 1L2TA 4OHXA 4POAA 3RRMA 5KDOA 4OI0A 2R6AA 3ZS8A 4JVSB 3K8YA 2XX3A 4TLCA 1OXTA 4LJ4A 3U2QA 2C5LA 1GOTA 4JLPA 1IONA 4JLVA 3KXIA 3VU9B 3D6TB 5HKKA 2J0UA 8OHMA 4A0HA 1W1WA 3CZQA 1J99A 3FKSA 1YZKA 5TARA 4JLNA 1J2JA 1K8RA 5AJWA 2H57A 2JA1A 4DIEA 4C4PA 2ZQ5A 3I5YA 3SNHA 4JKYA 2J46A 4MKHA 3TQCA 4A8JA 3KJGA 2WTUA 1AQUA 1OF1A 5P21A 3K9NA 4N3NA 1GNPA 3SYKA 1EFRD 1I4TD 5J4YA 4LOAA 3CF0A 1T0HB 2ORIA 3QNUA 4MQBA 4LZZA 3LVQE 3QKSA 1KO4A 2RKOA 1YU9A 1G7SA 1E79D 3ZDQA 4D80A 2D7DA 2QTVB 5BQ5A 3W3ZB 4NP6A 1E9EA 1X1RA 3KX2A 3AQ4A 3TMKA 2QAGA 5ELXA 4TL8A 4D4JA 2WJJA 4AKHA 1SKYB 4A1FA 1H8ED 5KSOA 1TX4B 1RIFA 3BB3A 1Z3IX 5FUVA 1NBME 1UJ2A 2CXXA 3CNLA 1KNQA 3HU2A 3LRPA 1G3IA 3CW2A 2V1XA 4OQMA 4F93B 5DN6A 1W5TA 2R65A 2EFDB 3BH0A 5JWRA 3R8CA 1LW7A 3AGQA 4HB3A 3BIFA 2IXGA 4Q7KA 4NHOA 2XZOA 5B58C 2RGBA 5C4MA 2OBLA 3KFXA 3PEVA 1DTSA 2QPOA 5A0FA 5LB2A 4TMZA 3ADBA 2V7QA 2BMFA 4PAQA 1N5JA 3REFA 3D7MA 3FDIA 4LV6A 1VG8A 1WF3A 3PXGA 1W49A 1Z06A 1CRPA 4DLWA 4L15A 4B71A 5FBRB 3U7GA 1KZ7B 3VKHA 1P61B 2QT0A 3CLVA 1E2JA 1VMAA 2Z83A 5AJZA 4PSAA 3TUJC 2HDNB 3IDQA 4NYIR 4DXAA 2UZ3A 4D26A 4FWIB 5J47A 4C0AC 3VU9A 1IAQA 5HTKA 2CL0X 2ZE7A 3A4LA 1NVWQ 4ZPXA 3HPRA 1Z22A 2JGNA 4AKIA 3NVAA 4LYFA 3ZD6A 3GFOA 3NIBA 3QG1A 2W2VA 5B57C 4DDVA 5AUOB 3KFVA 1GKYA 1SZPA 4V0ME 2I1QA 1R0YA 1R0WA 2Q21A 1Z8FA 3CH5A 2QP3A 3H84A 1X6VA 2GBLA 4TWZA 3U3RA 4Q48A 4C0QC 4DLRA 4MDEA 3T06B 1TU4A 1XDBA 1YZLA 1RRCA 4H1VA 1OFTA 3EW9A 3RANA 3VAAA 3R9XA 2ZJOA 4YMWA 4PQYA 2AD5A 1UF9A 4FD2A 2WMNB 5JS8A 4A2QA 2O8EB 4MYHA 4MDFA 2RGXA 3FHOA 3Q9LA 4XH9B 4JBWA 3BD9A 4WZAE 4RZXA 4LHVA 3GLIB 3A1WA 4GMXA 1E2GA 1E0JA 3AGPA 4OKSA 4P0TA 1N5KA 2FPKA 1T3HA 1W0KD 2PX3A 1G8GA 3L8YA 1QHIA 5EP3A 2QM7A 2SHKA 3A37A 4YC7A 3KB2A 2J1LA 3SFZA 4LHYA 3N70A 4LI0A 4ESVA 4ZKDA 2A30A 1JR3A 2WSSA 1G8FA 4OQXA 1I4LD 3W8NA 1II8B 2CJWB 1T6NA 1T3SA 1BMFD 4MH0R 2WMOB 3T5DA 4D4MA 4TLAA 2ANCA 1P75A 4ZDWA 2GDJA 2MSDB 3QBVA 3I61A 5FTNA 5H70A 1EFHA 3KQKA 1OXSC 5EP2A 1AZSC 1YR7A 3U44A 2IYZA 2WVJA 1A1VA 3AVXA 4FW9A 2ZSAA 3DOEA 2FOLA 2CVFA 3E1SA 1GG2A 3K70B 1RRPA 4HB0A 2PH1A 4MUAA 1XD8A 1NSTA 1S3SA 3LFUA 1T5LA 4BWYA 1HT1E 2CNWD 1YRAA 2BBOA 2DPXA 2XAUA 2QP4A 2QU8A 2ZSBA 2GAOA 221PA 3LWNA 2OFOA 4GZMA 4OHZA 1KK2A 1OIXA 1VYVA 2D7CA 2D2FA 4CW7A 4MKIA 4BFVA 2GRJA 1KSGA 3I1FA 3ADKA 1HTWA 1OFHA 2JJ1D 2NG1A 1VKJA 2R62A 2O8EA 1L8QA 2BOVA 4I81A 4ITRC 2REOA 3TVTA 2GEDA 1UM8A 3DZ8A 1VG0B 3M1IA 1P6XA 3GLIA 1DAHA 2GEVA 4RD3A 4D6PA 1W47A 1XCGB 3WRYC 4EFLA 2H7VA 4HZUA 2ERXA 2F9LA 2QMUA 1WA5A 2X2FA 4US0R 2JIZA 2OZEA 2ATXA 3WMGA 1PUJA 3K0AB 1KI3A 1IXZA 3DVLA 4B44A 2GJKA 2QUZA 1M2OB 4W9MC 1DEKA 1AGPA 4RCZA 3FVQA 1D6JA 1SVIA 2CLDX 2WKRA 4TYWA 1ZCBA 3SOPA 3VX4A 4PX9A 1NVVR 3IGFA 1II8A 2PJZA 2CJWA 3LVRE 3EZ6A 5DSZA 3GLGE 3BFKA 4IOKA 4AC9A 3TK1A 1OXVA 1WXQA 3RWMB 3N2EA 5GADl 1DO2A 2ZIAA 3AH8A 5AR1A 3V00A 1KI8A 1W36C 4A15A 5SZKB 2HJGA 4XD7A 2B21A 1NMXA 4EPYA 4PZYA 1XZPA 4YMUA 2QSZA 1C9KA 1ZUHA 1XZQA 5L8VA 2W0MA 1P9WA 3SHWA 1GUAA 1XXHB 4TTQA 3EPKA 2IHBA 3RDPA 2QG6A 4IDHA 4FMDF 3WNBA 2H17A 1JEDA 3S1AB 1SVOA 2MSCB 2WAXA 4DCSA 5G3ZA 1L7VC 1W0JA 3AM1A 2ZI5A 1XX6A 5IHPA 4X8MA 1DAGA 4NKRA 5HR5A 1WCV1 3K0EA 3R20A 1M7HA 4QBHA 4EPRA 3P1JA 2J7PD 3MLEA 4YDSA 4B35A 2ZRCA 4LBWA 2H8KA 2ZYTX 3L0PA 2WWIA 4QNRA 5JJIA 1F5NA 4ON9A 2G88A 4QOSA 2QL6A 3L8ZA 3TR5A 4CDGA 2W6ID 4NL4H 5GVSA 4JLDA 1KGDA 4WVFA 4JVMA 4Q4AB 2AKAB 2WJVA 1F6BA 1N6IA 3FOZA 2PBRA 3FFAA 4JKIA 3SJCA 2GCNA 1O3YA 4GI7A 1BIFA 3UKDA 1G8HA 821PA 3DMNA 3K0AA 4QKQA 4XWKA 4RY2A 2ZI7A 1R0XA 4OI1A 2CK3D 2XTNA 4H9GA 5TVKA 1YHNA 3HYTA 1D9XA 3HP1A 2HLDD 3C8UA 1FW6A 2F7SA 1ANKA 1DAMA 1SXJE 1VECA 1NG1A 1KDPA 3F3YA 3E70C 5G41A 1E9FA 2PEZA 4P4TA 2NOAA 4RD0A 3W90A 4ZKEA 1S9DA 4US1R 1X8KA 4YXWD 1T9HA 3CPEA 2V6IA 2IA5A 1ODFA 1W4AA 3LQRA 2QQEA 4XWOA 3GLFE 2WOOA 2ZRHA 4RKEA 4LX0A 2RGGA 3I62A 5FBVB 5E4FA 2E9SA 4OJQA 4UNRA 2V8OA 4TMTA 5FBLB 5TV2A 1XXHA 4B6FA 1NY5A 2F55A
chains in the Genus database with same CATH superfamily
1G0OA 2I4TA 5BWMA 5C7YA 1QFXA 3CE6A 1WPXA 3DE5X 5JS1A 1OV4A 1RR6A 4OQPA 4EFKA 1ZVVA 4EG5A 1KYXA 3OLCX 2QJTA 4BGEA 1C80A 3DD1A 1DQRA 2BJWA 2AZXA 4OHMA 4H4DA 2QN3A 3WGNA 2EW8A 5FHRA 5AO9A 3EGEA 5EIHA 3OZDA 5F1KA 4D4HA 5C4IA 1WHSA 2XCLA 1L7RA 1MQ8B 2XMRA 4MS3B 3WFZA 2BKLA 3AEUA 1P5FA 1DQZA 4K81B 2WJAA 3CBQA 3CN9A 2R4TA 5EZ5A 2Q4DA 3JTEA 2ZR8A 3MWDB 4W82A 1FQKA 3JW8A 2PT5A 2D5BA 2YJ5A 4LSMA 3DTVA 1ZD8A 3HR7A 3U3XA 1TIBA 3MLBA 4R8VA 3PS9A 4RFLA 2WA2A 3W0LB 4UM7A 1GL6A 4Q4DA 5BVGA 3B12A 5G4KA 1GUBA 1DB3A 3G0IA 4JR0A 4MA5A 4J03A 2Y68A 3UW1A 2AC2A 1T34A 1KFBB 4AP9A 1C30A 1JS1X 2OHOA 5IXSA 1A2BA 2Y6UA 1L7NA 2DLNA 5JYCA 4NOLA 4S2UA 4MV7A 2M32A 2N1MA 3G8DA 3Q2IA 4KDFA 2V5UA 2P40A 2XUZA 4HVAA 5G0SA 5IKEA 4PTYA 2R751 4MWSA 1OVGA 3N0XA 4JJ4A 2C4HA 4PNZA 2XYPA 4YBZA 3BWMA 1PJTA 3HS3A 4H2DA 2W8BB 1P1JA 3A05A 4JLJA 5EJ2A 3IKTA 1T5OA 1GNRA 4L7QA 3AKEA 2Q46A 4UBJA 3I6BA 2RG1A 3FLEA 4GVLA 4HEA6 1GKKA 4KQHA 2GKGA 4BFYA 4DPKA 1HE4A 2X8LA 1J5PA 3N59A 4JR1A 3TZBA 2NTJA 5DHSA 5CU7A 1ZD5A 1VGVA 2X41A 4GZ3A 4M37A 4DB4A 1UDBA 1KYVA 2HMSA 3AF4A 3F8TA 4NE2A 3B1YA 4NU0A 4O2AF 3VOAA 3ICEA 3AY6A 3TLGB 2AFRA 5EYPB 1WBJB 4KH0A 4YV7A 2FMIA 4PZZA 1F4VA 2I4RA 1ICEA 1W96A 2OYRA 4F5DA 4UEWA 2NSDA 1HNWB 4MKRA 4MGYR 1ESDA 4BASA 3C3DA 5F77A 2F3RA 3W6NA 2FMTA 2F4NA 5DXJA 1U8EA 2C07A 3B6KA 2B8JA 3DVAA 1I51A 1OXUA 3L7OA 3MAJA 4M8KA 4UZFA 4YJFB 5ALZA 2ZWAA 4DSAA 2JAQA 3QI7A 2ZM6B 5CCEA 1VHWA 2B2XA 2Y1GA 2QLNA 3PHLA 1XVLA 1KIAA 1Z35A 4WK2B 4CKXA 4QLBA 3BS4A 3HJCA 1OKKD 4GMDA 2A7QA 3A4NA 2EJWA 1FUIA 4M21A 5LOVB 5LZ5A 2HK9A 4YJ3B 1Y5RA 4FHFA 3P9YA 2GZ3A 4HI0E 4DUYB 5JNTA 1XLWA 4IDGA 2Q3FA 3E9CA 3PDIB 2ZJ1A 3I04A 3VYSB 3LKBA 3ORSA 2D59A 5F7XA 2QRJA 1GNTA 2QTBA 1YQWA 2Z3WA 1PJ4A 3O2SB 2PNJA 3VBCA 4CQMB 2YMLA 1Z63A 5BORA 1AF4A 3WQSB 2CGEA 1HZZC 2X7HA 2KPOA 2WKWA 2V6BA 2VNAA 3WK6A 2VHQA 1J5EB 2C31A 4FLEA 3QWFA 3OU6A 3P2MA 4KDRA 4M22A 3FRJA 1WBBA 4F86A 3P4UA 2PKYX 3LK6A 5DTJA 3DKKA 3SX2A 4E0BA 2DETA 1NJ5A 3ONWA 2BFDB 2QVBA 1E99A 2WAYA 3B2NA 2BGTA 4DANA 4MJXA 2B1QA 4MR9A 2IXDA 4TLMB 5F78A 4AX8A 1BQEA 1GFIA 2YJ6A 3RAPR 4WOKA 4DRYA 3WIBA 5J4HA 1ZO8A 2ETVA 2ODAA 2WZCA 2WFZA 1EP9A 3OZEA 4QE3A 4Y0VA 4WQMA 4EFMA 3T5MA 2QVXX 5TQ2B 2EW1A 4KQ9A 4M0CA 1DDGA 3PL5A 1N34B 2CNLA 2JFXA 2PUBA 2AKYA 2PS9A 2AUMA 3EMVA 5TE9A 3I9MA 3RHSA 4KV9A 5E6UA 1CUXA 3UT0A 1K88A 4QPDA 1Y6QA 1SCKA 1X3SA 4DCPA 4WUVA 1VL1A 3T52A 1PQ4A 3G2HA 1Y80A 3CV3A 3H2GA 5EE3A 5IEBA 3ZU5A 4ARCA 1YT5A 1LPBB 3AEXA 3JYQA 5HKOA 1YZHA 2HK6A 2QX9A 1G55A 3GVIA 4J94A 4NNPA 4F5YA 1CF9A 3RG8A 4TWZA 1DVRA 2BKEA 4GFDA 3ZWBA 4C7JA 4HRXA 5IM4F 2XF8A 1QV6A 3O8LA 3U4HA 5LC1A 3GZNA 3J7AC 4U63A 3S2EA 4YCMA 4ZANA 3GLUA 1XRNA 4OK5A 3DWEX 2OD7A 5LU8A 5CIYA 1W5AA 3MCTA 1U8CB 1UCFA 3SQMA 1RCTE 1SBHA 1PYGA 3AONB 2QVCA 2W5UA 3OIYA 1HE8B 2WAMA 2Z2ZA 3BE4A 1VE5A 2ON6A 4YS6A 3FPFA 5HFAA 2HBYA 3EMDA 4P86A 2E7ZA 3TDNA 1PR4A 5CBPB 3ZLJA 4I8IA 4GSLA 4AS1A 1UWVA 2HZ7A 5U4XA 4BIMA 3VAZA 3RUDA 3VZRA 3A28A 1GSIA 1USWA 1FP6A 3O5AA 3EVFA 2QRKA 1MU0A 4FI3C 1RC0A 3PB3A 4LXGA 3WJ2A 1EFTA 2IS4A 1NMZA 1S4QA 2QY9A 1US8A 1M74A 3MD9A 4JYZA 4UHHA 4ALMA 1W1IA 2PTGA 1SEVA 1ES9A 4QXAA 3ER9A 3IP8A 5A03A 4CKWA 1UP4A 3DCYA 3M1YA 1G41A 1EP2B 1KQPA 1YASA 1R4MA 3HKCB 3NOVA 3F9IA 4UE2A 1S1MA 3BZBA 3TVDA 2SKCA 4QG3A 2ECPA 1D09A 1JKXA 2G28A 2W98A 2WJ6A 2FSIA 2DP4E 3BK1A 5SZHB 4F2GA 4NV0A 2O52A 5DFAA 1L4EA 1ZLYA 2JI9A 3J81A 4JOSA 3BAFA 3F78A 2A6PA 1E1YA 1OAOA 4MS4A 1N77A 2KB0A 1FYWA 2ZR9A 1G7CA 2Q4BA 3A2NA 4Y67A 5FL7A 3WGYA 1AKVA 4CV2A 2PUFA 1G8YA 4A16A 3CBGA 4ARZB 3ZY6A 2VHXA 4HDRB 4I9NA 4RKYA 4C08A 1X7ZA 1NJ6A 2W2TA 1UM9B 5L51A 1YBAA 3OY7A 4IGEA 3VO9A 1AXGA 3L79A 4JR2A 5BOSB 4AMBA 5M04A 1W59A 3SKXA 5DHQA 3UA4A 4Q39A 1L1EA 1IEXA 3PC3A 4Q1VA 5K03A 1ST2A 3TNJA 4FCVA 1PBNA 1VQ1A 3GJXC 4UU7A 2AOUB 1E8NA 2X5KO 1EVKA 1GPH1 1QH8B 2C94A 4PYRA 5GY7A 1S2MA 2EVWX 3FVWA 4WFIA 5EA2A 4EG6A 2Y1EA 2QAJA 3T3OA 3TMAA 2X3FA 1O94D 4WRRA 2OZLB 1KL7A 1YWGO 4HNSA 3RPEA 3G59A 2WSLA 4B83A 2ZS7A 2IYOA 1LWNA 1MENA 2AHRA 1UJBA 4IEIA 4Q3DA 4YACA 3E53A 3LBFA 2P5SA 2BFCA 1Q0LA 3FIJA 2GF9A 4GYWA 1XWWA 2O8DA 3EWAA 4TXMA 2OGZA 4FHDA 2UV8A 2F3PA 3RH0A 4DCCA 4EBFA 3TL6A 3ZLUA 4G4JA 4FFLA 4LG1A 3RC7A 1QKIA 1ZMRA 4LKOA 3U16A 1XNGA 2AFHE 1L8OA 1XZMA 1OX4A 3G8AA 1XKTA 5DK6A 3MTQA 5DHTA 1JE0A 2P69A 3LWBA 5EQFA 4M2LA 3IQHX 1L4MA 1E1QA 4U2DA 1I1QB 3D31A 2ZT6A 1U8AA 4C21A 3O3NB 4A6EA 1IZYA 2R6JA 3IEXA 3AM4A 3WV5A 2GN6A 1QJCA 1UJ6A 4V0QA 5BWNA 4D4LA 4RJIA 2AIRA 4I8XA 4PZAA 4QGBA 4BP9A 1ADYA 1KZ1A 1TI7A 5A1TA 2OV4A 3KV3O 4MUJA 3A9VA 2ONJA 1MTOA 4L22A 1CQWA 1TKRA 5D00A 5DM0A 1UBCA 2TMGA 3EFHA 3HDTA 5BR4A 1I01A 4K40A 2ZKIA 3E9MA 5CM9C 5EJFA 3JAMA 2ISQA 1R9NA 4ZVUA 1XU7A 4BJHB 2WUEA 1YTLA 2H9AA 2YWGA 3NBFA 1Z0IA 3SBXA 4YRMA 3MOIA 4Z0TA 5GJVC 5E1OA 4Y2QA 1IBLB 1EMDA 4N01A 5EIOA 4KQKA 3B36A 3UG7A 4BNHA 1AMUA 2Z2KA 5DTMA 1I6MA 3L0OA 1GTSA 1XB2A 1SBZA 3T4UA 4WZAB 1G0NA 3OZVA 3PUXA 3SIXA 1X7HA 3JVDA 5L3QA 1VZ2A 5H9VA 2DQKA 3WOHA 3NRJA 3CH7A 3KJEA 1VHTA 5A5FA 8LDHA 1V35A 2QA5A 1K8YB 4TUYB 2BCGY 3A10A 3EYWA 5DLDA 3EDMA 5A1JA 3RVSA 5KNBA 3QK7A 3BFJA 5DGHA 2FUCA 5DM1A 4I55F 3T9DA 3QKTA 1NF8A 4HDSB 1MORA 3WL7A 3U4QA 4EX7A 4MP3A 2VLBA 3UV3A 3DKRA 3AERB 3ZCPA 4OA5A 3NAGA 3GZ4A 1O95A 2BEVA 2OV3A 3HSYA 2CV1A 5CH8A 5F9FA 4MHOA 1U4SA 2Y8EA 3OM9A 2VK2A 1KK1A 3EN0A 1O1YA 2ZETA 3IUPA 3LT1A 3CRQA 1WW3A 5E0OA 3T4XA 5CD9A 1WB9A 5K6AC 3B7GA 1QH0A 1IY8A 1CUHA 2XUQA 2XQIA 1S0UA 1A2OA 1FDUA 1ZGCA 2XJ4A 3KQHA 3A2KA 3E82A 4JBGA 4BLTA 3AR7A 2VSOA 1JEQA 1U3WA 1NGSA 2HA5A 3E5RA 3Q7QA 3QJYA 4OATA 2WD9A 2Y6VA 4GC9A 1KY3A 4H35A 3WYEA 5C5CA 1CJUC 3D81A 2XNJA 1OJ7A 1JWBB 1OT3A 3KEOA 2BEWA 3O47A 1Y0BA 3AZQA 3R5FA 3EVBA 1FXUA 4D0GA 1SQ5A 5GOTA 1LWOA 4BEJA 4EYGA 1QG2A 4KVFA 1JDBC 4PLHA 2VL7A 1BCSB 3ZDRA 3KEGA 1U2RA 1SOAA 2DOKA 3CZAA 2X23A 3ONNA 2XPCA 3UFXB 4E33A 1VYHA 4PG6A 1X1TA 3BSFA 4N8SA 1CR2A 4WK6A 1N5MA 5I9SA 3FZEA 4D6XA 4J75A 4FZVA 4ACBA 5BMVB 2RIPA 1KJJA 4Z5XA 2WJYA 3WK9A 3ZXYA 1HMYA 1MH9A 3QVXA 3EX7C 2YVUA 4EEZA 3OVMA 2GPTA 4YWHA 3VPFA 1XQWA 3BSYA 3ZBQA 5E1MA 1N2OA 2WFLA 4TVKA 4YAJA 1COWA 1E3WA 5E7JA 1FPQA 2BUAA 4E03A 1CG6A 2HSZA 3CNNA 1O2DA 1YZGA 5B1EA 4ABYA 3F0TA 1NVMB 4O4LB 1ZH8A 2CB0A 3H9GA 4BWFB 3EEQA 3WLNA 1WL8A 2ADOA 2NZXA 4RYLA 1H4QA 2I6SA 3RS0A 3VA7A 1JQDA 1RC1A 1H22A 4DTCA 3JATA 2J3QA 2C5HA 4WFQA 4E5YA 3R9IA 1PNOA 1ZXLA 1PWYE 1RE1A 2XYHA 3CINA 4TQUS 1OBCA 1SVUA 4C4XA 4EZEA 3U5TA 3TNDA 3T38A 3J80A 2FF7A 3L84A 4N6OA 2RH9B 1U0TA 2I65A 5JFGA 2CL5A 1YR8A 5BSWA 1WCXA 2RGEA 2FI1A 2FEKA 3FPAA 2NP7A 2P2NA 2R1TA 1HKUA 3REQB 1V16B 3RFXA 3G5LA 2NZYA 5KOJB 1TJ4A 2WD7B 4UD2A 1F06A 2JGMA 5FP0A 1QHXA 3R3WA 3KYIB 3N8DA 3TX2A 1QHEA 1AGNA 1CQXA 4MWDA 1WABA 4KIJA 4KR9A 4BU1A 3LBYA 3WSVA 4HNUA 1Q91A 3VVLA 1X8XA 4UTNA 2ZAIA 1JVBA 4H6WA 1TTTA 2XTAA 4HVLA 3DOIA 3HCCA 1YH3A 4TV9F 3GWGA 3H9UA 2CXSA 1DO0A 2PZGA 3ZZ0A 4ZJZA 1XQ6A 1YQ9A 3N9IA 1UFQA 1Z56C 1MNQA 3HU3A 3JZIA 2J31A 1T4GA 4KITB 4G5SA 1E77A 3IVAA 1LW6E 4CTOA 1U1EA 3GQBB 3RFUA 4NI5A 2Z43A 4QQNA 5DBIA 1SVKA 3S28A 2V0CA 5AK0A 1Z2NX 3RM3A 1B41A 3IP9A 2XMBA 5IKOA 2WHQA 4H6PA 4Q4HA 3D7KA 4JDPA 4BQFA 2UAGA 2RGRA 4PSKA 3GEHA 4CI0B 2AW5A 4QXRA 4MROA 2NYVA 3K31A 4YQZA 2NO0A 4PLZA 1N6HA 2DECA 4JC0A 4N6NA 4YX9A 3M9XA 3NWPA 1CUDA 4MKZA 3ULKA 2QMQA 5YASA 1UZAA 2WT8A 3ZXUB 2XR1A 4DDHA 2L17A 5KOHA 4QFDA 1FQOA 3BC1A 2TECE 3CW9A 5ENDA 3SNKA 4G0WA 4ZYZA 1EXMA 2CXQA 4BAUA 3IAHA 3OQVA 3V42A 1ZMBA 4YRAA 3OQ1A 1WDLA 3ORFA 1H8EA 4B46A 5I8PA 4P53A 1J1UA 1Z0UA 3DTTA 1AMNA 1HYBA 3EZFA 4PYQA 1QHGA 4EJSC 3KV1A 3LECA 3C3AA 2QAGC 3QUTA 3TE7A 2XXBA 1U0LA 2QDKA 1HUQA 1Q17A 4N3GA 1G66A 1C7IA 3BREA 4DMHA 2CLHB 4IO1A 3DTNA 2GN2A 3RRJA 3JR7A 2JASA 2P6UA 3BMCB 3EPRA 3L1VA 4QEKA 5TJHA 4DLLA 1P6UA 4K6FA 4DFDA 3QXSA 4OI2A 3C1UA 1AUOA 5EXDA 1XMQB 4Q34A 3OQJA 5T4BA 2O07A 1IN4A 1O6ZA 2UVDA 1O9HA 2XA2A 3IMKA 4PHHA 5ALSA 2A9VA 4LQLA 2AWOA 2IYTA 3NIDB 3E3OA 3GRCA 3QHPA 2ZIUB 4DE5A 4BNJA 4FGSA 4DSTA 3CIOA 4P3KA 1HX7A 4FEEA 1E1NA 2XCSB 1ONNA 1RXWA 2VHUA 4RE5A 3IURA 4WLFA 4DWVA 5JBIA 1XEXA 3EZYA 4UM9B 1AKYA 4LY6A 5TC4A 5CVTA 4WNIA 4CHGA 1AK2A 1HNZB 4IIDA 3FI0A 4JODA 1RJ9A 2ZDGA 1WU8A 2XGGA 4OLAA 4TGLA 3TKLA 4KQFA 2BEKA 4E2YA 2FDXA 1QCDA 1J00A 2GM9A 3D2BA 2Y92A 1SVSA 1O94C 4PX3A 5KZMB 3KJQA 4MZXA 1DFGA 2V9CA 3UWMA 3N2KA 1JALA 1K66A 2X15A 2DFPA 2PGIA 4X63A 5DRYA 4AJ4A 4EUKA 4Q03A 4CEIA 2YWFA 2IEIA 4JX8A 2UUCB 2BHLA 3ZGOA 3DF9A 5TSDA 4X93A 1CRQA 1T36B 4X20A 3HKDA 2R4QA 3FI9A 4FN5A 1HGXA 1ONPA 3A3NA 3WBKA 5LQRA 4KL8S 2PEYA 3DW1X 5COBA 4OJTA 5K0ZA 5M29A 3CIFA 3NS7A 1MABB 1H0SA 3AKDA 1HE5A 4A2PA 3WL5A 2R0QC 4YDRA 3D5QA 4Z4IA 3K9LA 3WX0A 1NDHA 4FFSA 4CT5A 5JEEA 4Q6BA 1DX6A 1QU2A 2HX1A 4C04A 2AI2A 1E64A 2YTZA 3FN4A 3PGXA 1RHUA 1NULA 1NW7A 4ZQFA 3ZWNA 4AIIA 1UAGA 4K9MA 2OHIA 3IPAA 5FT9A 4BJ1A 1NBOA 3AP3A 3C3YA 4DMCA 3NT4A 4URYR 3KHSA 3BIXA 4DMKA 3I01M 5K8LA 3FWKA 1VL8A 2CYAA 4S05A 1FSGA 1XMVA 2GBGA 4EVSA 3ZKWA 2XB2A 4YCJA 4QJ4A 3R3HA 2HT6A 1T35A 2C9DA 4RKFA 4MWGA 2PR2A 2IYUA 4S1PA 3TL2A 4BX2A 4EPXA 2XCQA 2DX7A 2XT6A 3PSAA 4KIWA 4L74A 3OD5A 1VPTA 5FI1B 4ZU6X 5C8DA 3WP1B 1PT7A 3KB6A 9LDBA 3UT5A 4Q18A 3UMJA 5CA1A 4MW9A 2PXCA 1EWKA 4Q3CA 3ZX4A 1SXPA 1DRJA 3D8UA 2YWXA 1VKZA 4ZAFA 4E3ZA 1ZHOA 2OSVA 1XG5A 3FWHA 4TYMA 2X5XA 2V55B 4YB8A 3KXPA 2COUA 2Y1LA 3F4BA 4V0OA 4FX2A 2X3UA 3V1KA 3L7YA 4EJFA 5HOEA 3EPJA 3CF2A 1X3LA 1WZIA 5DW3A 3RYHB 4EKDA 3ITKA 2AOTA 4AMYA 4ZN6A 5LYJF 2BC9A 3L6OO 5IAAA 4ENSA 1WSBA 4F3NA 1EX1A 3LO8A 4M7PA 1GUYA 1FLNA 1RSZA 3DE6X 1Z0ZA 1IN7A 3VX3A 5JOQA 1XWIA 3ABZA 1QIGA 3DWFA 1FU4A 1M2KA 1M0WA 3T9BA 4ZYVA 2YIMA 2P78A 3ESZA 4WX2B 2AE1A 4WPGA 5JSZB 2VOJA 2P4SA 4XEUA 4ZZ0A 2J5KA 2OSBA 1E69A 1VPWA 2RARA 1T0BA 2XV1A 1R12A 2CNWA 2L82A 2QSJA 4N3CA 3ZUGA 4DLSA 3H4IA 3WNCA 2OTCA 2IS6A 4WV3A 3KU4A 4FCCA 2ZCVA 3LFTA 4GWKA 5GIPE 1DARA 2EATA 4MW7A 1X7YB 2WJWA 1GL9B 2C4TA 3BFPA 5AKXA 4PG8A 1EDZA 1SUDA 2PWZA 2Q2OA 2VDPB 2P0YA 3H5OA 3TVYA 3KJZA 3N58A 3N3BC 2SKEA 4JXJA 1UBFA 2VJCA 3WKCA 1EX9A 3V2IA 4BV3A 1ZH0A 2F3SA 2IHKA 4Q1FA 1FE8A 5ECYA 3DT8A 4Q12A 3ZE8A 2H54A 4IVNA 5SYAA 4C2UA 1XO1A 4B87A 2KLHA 3AUYA 3FLBA 3AL2A 1E5TA 3ZDDA 3HP7A 4UULA 4RVOA 1WXFA 3GK3A 1Z88A 4HEJA 4XPZA 1LRKA 3WYDA 1KFCB 1KJZA 3QXHA 4IVRA 4E51A 4GDMA 4RLSA 3HYCA 5DULA 3UCFA 5EQTA 1KO5A 4D74A 3G6KA 2IYWA 3HVJA 1N5IA 3FAZA 4EB0A 3GRUA 2F90A 4RYDA 4U7HA 3E8SA 3EXIA 1Z7EA 1U98A 1Q3TA 3KOYA 3NDIA 4B7UA 3M9LA 4RA9A 2NXJA 1DT3A 3U0BA 3KZNA 3DFKA 5T57A 2WYWA 3WE7A 3WLIA 2JGRA 4QT0A 3N7UA 5IWAB 5IK2D 2FFRA 1QNLA 2NQ2C 1PX0A 3LOQA 3WG9A 4R1MA 5EZSA 2ZBEA 3PRKE 3W5JA 2ONCA 4HP8A 2Z8XA 4UTOA 2HUNA 4WJZA 4B8ZA 1VJ0A 1RM3A 2W7TA 3CKKA 3P45A 3ILXA 1T4CA 4GF5A 4YDQA 1H8HD 3JQFA 1L4NA 4BLUA 1X38A 2C9CA 2FQYA 4FINA 4JFAA 2XEXA 2H1IA 2WUVA 3I9KA 1ETUA 5JQGF 4PLPA 5CLFA 1P3DA 5LCXA 1LJ8A 2EF0A 3B52X 4ER3A 4BEBA 2IUFA 4RFSA 3HKEB 1H1LB 3C39A 1P18A 3WLEA 2GD1O 1J24A 2IU6A 1WVIA 3HDVA 3V32A 3VZSA 4AZVA 1O89A 4C0JA 4YRCA 5H02A 4FYJA 2LUOA 1YL7A 4EARA 1X1BA 1TVKA 1V8BA 1ZIYA 3DNMA 1RPJA 2ZBVA 5AOAA 1NVFA 4RH3A 3ZBPA 4GAEA 1JLRA 3IVCA 3CUEF 3RS9A 1UJ4A 2B82A 3EIQA 4QPPA 2XYRA 4YLGA 3UMGA 1CB0A 3K5PA 3EEFA 1T8PA 3FDZB 3LBHA 1ZN9A 4ZI7F 5AW7A 5D5HA 1JEEA 2W2OA 4GLFA 2NM0A 2N47A 1UT8A 2D1FA 3EG9A 4Q3BA 2FWAA 4XASA 1QKJA 2I7XA 4HLCA 4F92B 4HOYA 1E89A 3V8EA 1J8MF 1AHNA 1INLA 1CSEE 2XNDA 3LJKA 4DCTA 3V4SA 2BYTA 4YMLA 2W6IA 3WADA 4MAMA 2GRAA 5IVPA 3EA0A 2HV8A 4OH1A 1JG2A 3L1JA 2VQDA 3UAGA 1BVHA 2G08A 2LKCA 2ZDHA 5CRIA 1MA0A 5DWQA 1IATA 3PFNA 1MTZA 4M0FA 4XX0A 1F6DA 3UG6A 5I8ZA 1GQ2A 2HK8A 1XLTC 1H2AS 2MTBA 5AJTA 1PQYA 1Y6RA 1OGYA 2V7WA 2QMHA 3JVVA 1A9XA 3PLAE 3G9QA 4YR9A 4UBIA 3PYMA 3H4MA 5HEKA 4ARAA 5HXAA 1VCOA 2PYZA 2YJTD 3DONA 4RDHA 3G0DA 4C6SA 1GDHA 3IUJA 2P5TB 4AJIA 2O59A 3SYNA 5FNZA 3TCKA 4OUKX 2YXNA 3VC3A 3DM5A 5HRUA 1YOVA 2YNMD 5A2QA 4UOQA 1PKEA 3DL4A 4KYVA 5LB4A 3AUTA 1OB2A 1GJRA 2FCRA 3DBHA 4DLNA 3T9FA 2C9MA 5F7JA 3DHVA 2ANBA 4JC8A 4PIVA 5JY6A 2XSZD 2DWPA 2Z6VA 3OFVA 4OQFA 3DQZA 1BDHA 2BFBB 1RBYA 3IR7A 4BZPA 3WHKA 1JGTA 3RGWS 4UAJA 3BF7A 3I45A 3F2VA 5ENVA 2JCVA 4N5MA 1FP4A 2PD6A 3B6EA 2OQRA 2B25A 2I6QA 3OP4A 1JIKA 1GGVA 3TTTA 2NV6A 3M5DA 4C4AA 5BWBA 1JZTA 1L4YA 3FUTA 5AVUA 4AT1A 4L4XA 4B5LA 2ZBRA 5IABA 2E5FA 1VDMA 2PRIA 3ZI7A 1ZWKA 3FG9A 3A1TA 4CFSA 2OL4A 3WMWA 1WD5A 1KE2A 1ZCFA 1FFAA 4Y9SA 3HXQA 3I09A 3VR3A 2ZU6A 3NHWA 4BKPA 3UUWA 4U7DA 3MQ4A 1Y34E 1CUUA 1BU5A 1JDTA 2WFAA 2QZPA 3QW4B 1Y8RB 1ORRA 2WSMA 2WICA 1YQTA 4PPFA 1V5EA 1Y4SA 3PHCA 4GP6A 3RIMA 3A32A 4LJ8A 5CMLA 3GEDA 2HFKA 1GZDA 4RZSA 2IZ1A 2JFZA 3ZLTA 3D59A 3COJA 1E2EA 1SCBA 4E12A 2BTQB 3LP6A 2BTEA 3IVMA 1ZGGA 3MT9A 2FPIA 5TVGA 3ZUPA 1PV4A 3O4JA 3P0JA 4RS4A 3MRXA 1U8ZA 1XTTA 3KP1A 3NHSA 4Q9HA 3NDBB 3TIIA 2AGVA 4N54A 3LA8A 1GUFA 1NONA 2SECE 3G8YA 5KJ6A 5LVAA 2PZMA 2XOKA 1VBMA 3GV0A 2XUGA 5DJ5A 2UDPA 1N8TA 3JARB 3MHPA 4PYJA 3LY8A 5B4VA 1IQRA 3DHYA 1M2HA 2NACA 2F67A 4WBNA 2ZWOA 1Z36A 4IQGA 1UMDA 1JIIA 2GM5A 1RZVA 2JFHA 2NO6A 2P65A 3LT4A 4HY3A 3R6LA 4JP2A 4B7XA 3UAWA 5T8KA 2JFYA 1MZPA 5LZ8A 3G82C 1E8MA 4GSKA 1OLSB 1A8QA 3PNQA 2EF1A 1RADA 4CM8B 1QDEA 4ZC8A 5CCXA 1NKSA 3FETA 4S1WA 3V8MA 2DTXA 2YJ3A 3C8MA 3WGZA 2BRUC 1EFLA 3PQ3A 5HQ3B 2YHUA 1SRQA 1MX3A 1LNSA 3OLQA 3WZLA 3UICA 2GEBA 4A6PA 1J0EA 5KYTA 1MV8A 3HE3A 1AQYA 1DU4A 2GPYA 1OH8A 3ZHQA 4HTAA 1GPJA 4CI9A 2QRVB 3ZVMA 2AEJA 4EI8A 1SVWA 2IHVA 1JFRA 3SKYA 5KKCA 3C8ZA 2HADA 4L6CA 4EJMA 4GRIA 4I5EA 1GPNA 1QTQA 1PL6A 3OMXA 1EFVA 4ASUA 1QPBA 1YB6A 4X64B 5K0NA 1K0FA 3QVWA 1SUEA 3RBVA 4CEHB 1YS1X 1J9ZA 4XDGA 2GTHA 4KP7A 4DLVA 3H86A 5EQDA 2DKNA 1L8XA 4Z9AA 3TOZA 2VZ0A 3AEQA 4RFVA 2Z56A 1BDMA 1RXYA 3BRWD 3CR3C 3T35A 1HRKA 1FY2A 1F5SA 2CWWA 5ALGA 1U2EA 5ED0A 2CHQA 1UH5A 2PZFA 3S8EA 3LX8A 4KSCA 3W5BA 3B48A 4A8JB 4O4IB 2NO1A 3SI7A 2QL7A 1OYVA 3ECCA 1DXYA 1MT3A 2ZSEA 2ZANA 3H87A 4IVQA 5BNTA 4FONA 3QX3A 1P81A 2OBXA 4DG9A 2ZZMA 1KZ4A 2GK3A 3R6DA 1FRZA 1YSCA 1KORA 3LDAA 1EBUA 1EYZA 3CKYA 4LWPA 3SSMA 3TR6A 3ZJ5A 3N8HA 2WIDA 5D84A 2I7TA 1GD1O 2B9VA 1U28A 4B81A 5KYXB 3ZHRA 3SZLA 5A5VA 2NX2A 1TO2E 2J4DA 3TLMA 4RJ2A 2PSJA 4DW8A 3AR2A 4P92A 3VU8A 4OBEA 3UC5A 1UPBA 2FUG6 4N4AA 1R0CA 3PX3A 4TT3A 1VCIA 4K05A 1ZPDA 3JQ7A 2C5SA 2WU1A 1U9JA 1VG9B 1LSSA 3PC2A 1MX1A 1ATIA 1JYSA 2ZRIA 1ENZA 2H5LA 2X1HA 3FZNA 3TEFA 2GLXA 2GZ2A 3PDJA 1CQPA 1PR3A 2Q1XA 4WJKB 5C7LO 2YWBA 4FDMA 4XFKA 4PBRA 2W90A 2OYCA 1PYDA 4L2IA 1GNVA 2OHVA 4FYVA 1KIFA 1R4NB 3SCZA 2HF7A 4LJ9A 4LJ7A 1RPZA 3F8SA 5B1SA 1GPLA 4ZJPA 1SMKA 2ACEA 3KSAC 1YDWA 2BGWA 4J43A 3FPEA 3VJMA 4ARIA 3F7NA 1JJVA 4KO1S 4ND3A 3K2BA 1J39A 2W48A 4AF8A 4DBLC 1IK4A 3A3PA 3EOAI 3VRHA 4ZCIA 5HYVA 4R7GA 3ENNA 1KQFA 2HHAA 4IDAA 4XFDA 2X2EA 3HKBA 1BN6A 4PTLA 3SS7X 1GT6A 2VDMB 1S6YA 2J6IA 1Z6QA 2IFTA 3W8FA 3W6UA 4CF3A 5ICMA 4L27A 1S01A 3NPMA 3VPGA 5BRAA 3I05A 4E4RA 3VPAA 2P9BA 1T9KA 4EG1A 5J1TB 5LD2C 3FPBA 3SJBA 4W4TA 4HXGA 4GC5A 4YAWA 1MOPA 3BL8A 2G70A 1QF6A 1EDDA 1ZRSA 2R5FA 3QEAZ 1TF7A 2GZ1A 4L57A 4QFMA 5KB3A 1C8BA 4X3OA 2IIBA 4UBNA 1PGQA 3DBRB 3F3KA 4OJNA 3U31A 4E5PA 2NZ2A 3THWA 4RMGA 4RTRA 2JGEA 3I01A 3UJ6A 3RROA 2JBAB 5IT4A 1C1XB 2IHYA 2DWQA 2MSWA 5CPFA 1P4HA 4O2BA 2WTXA 4DC0A 4PC7A 1TB4A 1W85B 2GD2A 1NI3A 1S2GA 1MG0A 2VSXA 3FTQA 3LF1A 4ICIA 2HPAA 1M6NA 2YFQA 4GSYA 5SZJA 1UXIA 2WPDA 2DC1A 3QEMB 5FTKA 1QO0A 1BX0A 3CEJA 1R5NA 2QIOA 2X9GA 4HQLA 3K1YA 4NYJR 3VDRA 2PWBA 4AXBA 4RK1A 3OPMA 4RABA 4QRIA 4K1LA 1GU1A 5ER6A 2PUGA 4X7RA 4LISA 4YP0A 3DV9A 1IE3A 3GPLA 2QIPA 2GRUA 3JD3A 3IVRA 3AUUA 1R7RA 1ZIOA 3O1LA 3T61A 5GIOE 5L9AA 2GKOA 3DG9A 2JRCA 1MW8X 4U6SA 4B45A 4MINA 4XPIB 3EBPA 4EB8A 4YPOA 4E46A 1XQXA 2HMUA 3R3JA 3EXAA 2EW2A 3AVOA 4Q7JB 1GGEA 1DHRA 2OAEA 5CJ2A 3RU9A 4ZOQI 3B82A 4BU0A 1OAAA 4QDTA 1AA9A 2ECOA 2WJGA 1CVIA 4LYYA 2DTDA 1PS9A 1XHEA 3QTTA 4B6JA 1JYEA 2XRFA 3F6PA 5LMUB 4RD1A 1JQ3A 2P9FA 4GPD1 4UCXA 4XJVA 5IF3A 4M8NE 2Z95A 3JQ8A 3ICQB 1P0PA 1HXHA 1Q2UA 3IUYA 3O9VA 4G24A 2AZTA 5CVEA 3R4VA 3W7BA 2J9ZB 2JIZD 3PF8A 4IFTA 1J22A 3M0EA 2VDRB 3X2FA 4EYKA 2BD0A 1QQ5A 4QRDA 2DCMA 4HWRA 4BE9A 2XADA 3KQPA 2E82A 3KRTA 1RYZA 2R1VB 4GPBA 3SC3A 2Q07A 3GFBA 3KZCA 4EFNA 3O8CA 1XK7A 2YNMC 3VZCA 3TTWA 1MR3F 4TKUB 4EHBA 3ZU4A 4JNCA 5HIKA 2Q62A 3GUUA 3GJ8A 3KAJA 2I55A 4TVOA 2IWHA 4EKGA 5IZCC 4BRUA 3KOUA 1KEEB 4MX8A 3DMTC 2OP0A 1MPXA 4YRPA 3N2IA 4EKYA 4WUTA 4TS4A 2BMEA 2HF9A 4ZT7A 4O2AB 1RYFA 2VZLA 3PWKA 2G76A 1PFVA 3QVLA 4XD7D 4GEGA 3BH6A 3SYTA 1U5CA 1USUA 2O4CA 1T5BA 4J9UE 4YP1A 3VR4A 3E8MA 1E3LA 4JX9A 3HI6A 3T1TA 1JLLA 2PVCA 4LBYA 2C03A 4YUVA 4E1BA 5JYEA 3H75A 3K16A 1TGVA 2J48A 5E8JA 5AVKA 2YJ4A 3EXHC 4XW2A 2OCPA 1H4SA 1V7PC 3VH2A 1ZD1A 3SZMA 4UXJA 1RACA 2IEGA 1WMSA 2GHQA 1NVKA 3NGMA 1B0AA 4IIJA 5DHFA 1TJ5A 2W83A 3H11B 3MQFA 5HDQA 4B3DA 2YXEA 2X58A 4EELA 2R6ZA 5I7VA 4EJ6A 5A9SA 4V2UA 1JEAA 1ZOLA 5CLHA 5CPBA 4E21A 1KTIA 1RVDA 1IIBA 5KJEA 4C3VA 4Q7LA 3VH1A 1CULC 4HEQA 4RHCA 2FMXA 2CVHA 3NTUA 3KKQA 2YW2A 3IQWA 2YVKA 4P84A 2JLVA 4NZZA 3ID6C 3P9CA 1DKMA 4E5KA 4I6EA 4I6GA 4O8ZA 2NXWA 1M7GA 1Y7IA 1UQRA 4Z2AA 3EPLA 2BM0A 1S8NA 4MUMA 1FTSA 3RC3A 2QF7A 4JJ6A 2F43B 1OBHA 2J30A 2B4KA 2WZBA 3LXUX 5SY6A 3U81A 5L3SA 2E4AA 3DDCA 1CY2A 1KNXA 1JU3A 1ZOPA 4L8GA 5ALYA 1LC3A 1XDUA 3ANYB 4A4DA 1OXBB 2AR9A 1E7WA 2H63A 1GAJA 2NO9A 4D2IA 2WABA 4OB6A 3WYFA 3HXMA 5C3UA 3VPCA 4WY5A 1J70A 3CFYA 3O84A 2FFAA 4V0NA 1PUIA 1OLUB 4CLOA 4IJMA 4I66A 2O8BA 1I7QB 1T8TA 4WKGA 2ZU0C 2D5LA 3A06A 1KYTA 2FWNA 2VDKB 3TTVA 5KEIA 1DWQA 1XQVA 4QHYA 4BC1A 2G8NA 2Y4OA 3OX2A 4AKGA 2VDWB 4DA8A 2EL9A 1F2TA 1I7NA 5CA0A 1JB9A 1ECPA 1CNEA 2KI5A 2ZAGA 3AR6A 1RJEA 1DG3A 4Q3KA 2GK7A 3EPHA 2IKSA 4U9HS 4X3CA 1QTIA 3FMIA 3JWIA 3WB2A 1BSVA 1NZJA 4PZLA 5FV4A 4ZOBA 3E1KA 4AP5A 5K0TA 3U3JA 4TL7A 5ALEA 4UNNA 1XP5A 5IUJC 4L8YA 4R2JA 1XLUA 2A7XA 4IDFA 3WKEA 4QTZA 3A9TA 3L7DA 5BN4B 3OO1A 5JJBA 3EAFA 3OAAD 4JELA 4M1MA 1R6VA 1ZKDA 3TXXA 4WJLA 3OPYB 4KQXA 2ZPTX 1JDJA 1D9ZA 3AHDA 4JLKA 1WD7A 1UBUS 3EXFA 3ZH9B 5JJL