4C0QC

Transportin 3 in complex with ran(q69l)gtp
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
169
structure length
169
Chain Sequence
b'VQFKLVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGPIKFNVWDTAGLEKFGGLRDGYYIQAQCAIIMFDVTSRVTYKNVPNWHRDLVRVCENIPIVLCGNKVDIKDRKVKAKSIVFHRKKNLQYYDISAKSNYNFEKPFLWLARKLIGDPNLEFV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRANSPORTIN-3
publication title Structural Basis for Nuclear Import of Splicing Factors by Human Transportin 3.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein/gtp-binding protein
total genus 45
structure length 169
sequence length 169
chains with identical sequence D
ec nomenclature
pdb deposition date 2013-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4c0qC00
5BN5A 4Q00A 5K8UA 2PJZA 4HB3A 4Q9IA 1CLUA 4JL8A 2CBZA 2XTMA 2BBWA 2N46A 2XB4A 1FL9A 2QEQA 4LPKA 2QE7D 1QRAA 1GSIA 3OIVA 4LGMA 2PX3A 1OV4A 4PAQA 5AJYA 5B2ZA 4CGZA 1IM2A 1CJTC 3T61A 1U8ZA 5D3QA 3B5JA 2C77A 3N2EA 2QENA 2RB4A 3OZXA 1C9KA 3KB2A 4DIEA 3IQXA 1GRNA 1A4RA 3NHAA 3TE6A 4JL5A 4B47A 2WIAA 4F7WA 2CCJA 2AX4A 3I1FA 2V4ZA 4CVNA 3U44B 3CH5A 5F2EA 1AQUA 2VQSA 5CJ2A 2QPAA 2J3EA 2J0UA 4H1VA 1QVAA 4NPHA 3LNCA 1M7GA 4PPGA 2QTFA 3B78A 1JBKA 4W7SA 1E0SA 1VG8A 3QKRA 1N25A 1TF7A 1GIAA 2X1VA 4Q1DA 2FE4A 2IYTA 1OB2A 1CEEA 3KFXA 2W2VA 3LQQA 3GLHB 1XMVA 2ZJOA 2FV8A 1ZJ6A 3FE2A 4NCNA 3VU9A 4UNQA 5TXGA 1XD2B 2QQ0A 4AURA 3LWNA 2W0MA 4DZZA 2GESA 3AVWA 3DOEA 4TLDA 1GRQA 1YR6A 2GZAA 1OXXK 2CHGA 4TMZA 4X8HA 4DLUA 3GLGB 1IHUA 1Z29A 2BEKA 2WJVA 4O25A 1DAHA 4HB2A 4UJ5A 2J1LA 5FTMA 4Q1BA 2REOA 4TYNA 4W5HA 4YDSA 2ZRKA 1CJMA 5LB4A 4AYXA 3VR2A 1PV4A 3HWSA 4FWIB 2BCGY 3AF0A 1KMQA 1Z6AA 1YHNA 4XVQA 3W6NA 1YRBA 3I3SR 3TQFA 1SXJD 3LLMA 3BB3A 2AFHE 4PZLA 3Q5EA 2IA5A 2CE7A 2J0VA 2Z83A 3MUFA 2PMKA 2PCLA 4LX0A 1BOFA 4MITA 3EWSA 4NYMQ 1AKYA 4D4JA 1TQ6A 2ZRMA 1S1MA 4D81A 5FR2A 1E94E 1KKMA 2CNWD 2FSGA 3GCGA 4AYTA 1KI8A 3QOFA 4R9UC 3CZQA 3R8CA 3LBIA 1MRNA 3GJXC 4OKSA 4DVGA 2G0TA 2CXXA 3ZD6A 4KFUA 5KPJA 2I4IA 4MGIR 5J5CA 2OEPA 3N2IA 1MH1A 2ZYUX 1KAOA 2D2EA 3QXJA 2Q3FA 2WHXA 3B82A 1E0AA 5JI3E 2K5UA 3RS0A 5JRZA 2VP6A 2LKDA 2R6AA 1YZQA 4V0MA 3EIQA 4IEIA 1SHKA 5M04A 2AN9A 1L7VC 2QORA 2QRZA 2RKOA 3I32A 4RD2A 4HEJA 1DAGA 1NMYA 2D2FA 1HH4A 4Y0VA 4B32A 5KOYA 2Z4RA 4C30A 1KO1A 4TLBA 4WW0A 2O8EA 3KUDA 4R71A 1E9CA 4DKXA 4EFLA 1JQLB 4IOKA 2WWWA 1HV8A 4U02A 4YDHB 5EE1A 3SOPA 1NMZA 1ZD1A 1XTQA 5L3SB 4IDOA 3ZZUA 1EESA 1KI2A 4MYCA 1H8HD 1X1SA 3OE7A 1W0KA 3PQCA 1IBRA 4I81A 4IJMA 1ANKA 4MRPA 4NONA 2F43A 4UXHA 1U2RA 2CJWB 2GETA 5JS7A 3TGPA 4Q4JA 3IUYA 3IPYA 3LD9A 1DG1G 4KSBA 1SHZA 1N6LA 2O8BA 3MWYW 2ERXA 3I8XA 2RGAA 1BS1A 1WF3A 2FMXA 3A1UA 1GUAA 1G7TA 3G82C 3NTUA 1FMJA 1IN7A 3QNUA 2R44A 5EXSA 1GL6A 4CEIB 6Q21A 5CM9C 4IOJA 4HB4A 3ZGXA 4QJ3A 4CZ2A 5BN4A 3SNHA 1JALA 4ABYA 2JASA 4JS0A 4BLOA 1EFUA 4OI0A 2WJIA 2NTYC 2VHQA 4IXNA 4URYR 1CJUC 4EPTA 1T5IA 2HXYA 3PENA 1KDPA 2W2XA 1HT2E 4ZDWA 3CIOA 1VCIA 1I2DA 4IRUB 1E32A 4JIMA 2YWEA 3OFNA 4G5RA 1ZUHA 4PSAA 2I1QA 2R6CA 4B2LA 4DJTA 1KSHA 3B7GA 5JECA 3SE0A 2Q6TA 1D5CA 3ADCA 4DDUA 1IY2A 4RZXA 5KTYA 5EZ6B 3OEED 4IDHA 3KZ1E 5AUPB 4QGHA 4ASUD 1T8TA 4OHVA 3EIHA 1GWNA 3AGPA 1OLOA 4TN1A 3FGNA 1IJFA 2CDNA 1XTSA 4D0NA 5HKKA 3AKDA 1F5NA 1FP7A 1G19A 3ONWA 3T12A 4B35A 4WVFA 4DLZA 1VG1A 3E2IA 5SZJA 4GP6A 4HAXA 1Z47A 2AK3A 2F1JA 1S3GA 2AWOA 1DO0A 4OK6A 1X8JA 1IY0A 5JBQA 1ZW6A 2X77A 4LSGA 4IFBA 3I73A 4UNRA 1EFHA 4OHZA 3THWB 1ETUA 4PHFA 2JLYA 5H1YA 5JWHA 4CF7A 4KJZA 4A36A 4YMSA 1OW3B 3CB4A 1VMAA 2EFHB 1E9EA 4YXWD 1E2FA 4PC7A 1EG7A 4WAUA 4U7DA 4YQFA 3SC3A 4B76A 3DKPA 3HP1A 3RSOA 3ICQB 2JLSA 3SHFA 1XD8A 1UF9A 4PX9A 4MYHA 4UNSA 1G21E 1YRAA 3LVRE 4V0NA 1XD9A 1R0ZA 1N0WA 2RHMA 3U44A 2ORIA 5HE9A 1OXSC 2H57A 4A82A 4FMCB 4B6EA 2NGRA 2ZJAA 2OXCA 4JZKA 2VSFA 3AH8A 1WBBA 3H2YA 3NXSA 2B8WA 3MSXA 4E07A 4DLVA 1ZM4A 1NVVR 5DIFA 3X1ZA 1RRFA 3NKVA 1SVKA 5BYKA 1F6BA 1J2JA 1UKYA 4RCZA 4A0FA 2ATXA 3K0CA 2C2HA 4HI0E 1R8QA 1E9RA 4M9XA 1DO2A 2JJ1A 4DBLC 4FIDA 3TW4A 1N0UA 1Z0JA 4XWOA 2FWRA 2CL7X 2WIBA 5SZHB 5G3YA 3GLHA 4FCWA 4RJLA 5DHFA 3ASYA 2H18A 1OE0A 1I4DD 3QVUA 1QHHB 3HYRA 4Z1MA 1I4TD 2O52A 1XD2A 3IHLA 2HUPA 2OBMA 3WMEA 1KJZA 3BERA 4Q48A 4XVUA 1S9HA 4QHTA 2W0SA 2QMUA 3HR7A 2IL1A 3K09A 1KI6B 4B43A 4BFTA 3GLGA 4NP6A 1CR2A 2MSDB 3B1WA 1VDZA 1NKSA 1XZQA 2KBEA 1G4AE 2EYUA 4PTLA 1W47A 3WY9A 2RGGA 3BXZA 3AVOA 2JLXA 1D6JA 3RS7A 1P9RA 2WWGA 1ODFA 2NIPA 3C8UA 4Q9LA 5F9HA 1IONA 4MKFA 4DB4A 2JDID 3CO5A 4B2PA 2ZJYA 1CBUA 2L0XA 4HAUA 4B6FA 4DUGA 1MO4A 3RHFA 521PA 4OHWA 2MSEB 1LFDB 1G9XA 3FFAA 3PVSA 1XTRA 4RSGA 2C8VA 3BBPA 4TYPA 3RS4A 2HCBA 1N6NA 1XB2A 1ZIOA 2ORVA 2ZIAA 3LH5A 4URWR 1JJVA 4PSKA 3KKNA 1RIFA 4FXPA 3F5FA 4Q02A 4RKEA 1IN4A 1E0KA 2ZI6A 1P2SA 5JWRA 3SQXA 3KQKA 3NWJA 1KIMA 1VCOA 4ITRC 1AQYA 1Z6XA 5EUQB 4P4SB 4AWXA 2ZU0C 3GJ3A 5JSZA 4ZKDA 1D2NA 2ZRLA 3B13B 5E4FA 1G8YA 2QAGB 1DVRA 4TTRA 1J7KA 1VCNA 5B58C 3IILA 1ZU4A 4ON9A 2JLRA 3I92A 5FOVA 3QPVA 5HTKA 4LBZA 3GLFE 2JGNA 3W6PA 1TEXA 1SXJE 1LY1A 5K8LA 4XTCS 5L3SA 3PCRB 1E3MA 2WV9A 4PAMA 4B3CA 3TQCA 1U99A 2WBLC 4QBIA 1S8FA 5LD2C 1RFLA 4R98A 1NMXA 2ZROA 1OYWA 3QEOA 3L0OA 3RS2A 2FFBA 4GPTA 2PT5A 4IVQA 2ZTSA 2XSZA 2OLKA 3NBZC 4BLQA 3I62A 1PUJA 1XDBA 1KZGB 4EPVA 4PC6A 1KY3A 5LBIA 1XWIA 1CJKC 4NHOA 1A2KC 1GOTA 3IHWA 4PPFA 4TLAA 2FJUA 2ZI5A 5FOXA 1B0UA 4C0QC 5FL7D 5JLJA 2LWIA 3LX8A 4PHGA 4Y0AA 4CEIA 3SN6A 3V9PA 3CX8A 1E2LA 4Z8XA 3AGQA 5J4YA 4MGKR 4ESHA 3BWDD 4NYIR 1KJYA 4UNPA 4YONB 4HLUA 1U0LA 3SFZA 4P4UA 4B48A 5CDFE 3I4LA 1COWD 1V5WA 3CPJB 4AKGA 4A0RA 1UJ2A 1TQDA 2J0UB 2J41A 3CLVA 3EW9A 2RGXA 3CUEF 3NBFA 4QM6A 5HZKA 2QAJA 3CR8A 3BGWA 3RRMA 3QKRB 4KODA 4LWZA 4OQLA 5JZVA 2JLQA 1G7SA 2ZS8A 3QEJA 3IEVA 4PQRA 2CHQA 4EFNA 4QJ5A 4PO8A 3KXLA 4JLVA 3UKDA 4HUQB 1QG2A 3U7GA 4LHXA 3VU9B 1E79A 1E2HA 1ZYUA 2R6GA 2EVWX 4G5GA 4LV6A 4NBSA 4QFMA 5GVSA 3DHWC 5P21A 4MDFA 4Q21A 2XJ4A 1MABA 2CVHA 3NC0C 1GZSA 1QBKC 2ZSAA 3KTAA 1MRSA 1T3HA 3MFYA 3K0CC 1SKYB 4B73A 1Z0KA 2Z6VA 1OSNA 5FBLB 1DBSA 2KJQA 5FBWB 3THWA 2UZ3A 2GA8A 2VBCA 4Q03A 2N42A 2WOOA 2VL7A 1OIWA 1JPNA 2GJAA 1YZGA 4GT1A 2EWWA 1RZ3A 3E70C 3T15A 4BWYA 1SVOA 2GVDC 4F4IA 3FHTA 1XCMA 1EWRA 1KO5A 1NLYA 1HE1C 1N6HA 2JEOA 2IEZA 3K09C 4QHYA 2PBRA 3KKMA 1F2TA 1WBDA 3BD9A 3QXHA 4I1SA 2VP4A 2D62A 3KB1A 2ECKA 2XNSA 2IYZA 4DCSA 2QM8A 4E09A 2WMOB 4M1YA 4EAQA 3PEVA 1UBEA 4OHXA 2QMOA 3EXAA 4LJ6A 1G5RA 1G7CA 4V0OA 3EZ2A 2NO6A 5LB2A 421PA 1EK0A 4B3XA 4E03A 4LJYA 2QBYA 1DAFA 1E9SA 2KWIA 1KOFA 4N0DA 4PHTA 3U2QA 1OFTA 4M4SA 1IXZA 1OH8A 1VYTA 2RGCA 4NU0A 1P5ZB 3EPHA 1KDTA 1T5LA 4Q5IA 1XEFA 5GJWC 4B3BA 1U9IA 4DSUA 2Q9BA 2Q0HA 4AY2A 1I4LD 4KHZA 3M1IA 1XXHE 2G9NA 5B64A 5CIQA 1M6NA 2DR3A 3EC2A 5TVKA 2HXSA 1K8RA 1Z07A 5DISB 4Z51A 3SJAA 4BLTA 1D2MA 4TL9A 2OCPA 1NRJB 4TSFA 4D0GA 4AKIA 1KI6A 3UG6A 2DHRA 3A1WA 3K0FB 3REFA 4TT3A 5J4HA 3KL4A 2F9MA 3EIEA 1VHTA 2R8RA 3WNCA 2IWRA 1KHTA 2V55B 4BFSA 4PQFA 1E1QA 2QTVB 3UMFA 3FHOA 4LI0A 2GXQA 1WQ1R 2O8BB 1JR3A 2O0KA 4M22A 1C1YA 1G4UR 4D2IA 1Q44A 2BDTA 1JXMA 1NL3A 4RY2A 5EXPA 4AD8A 3DM5A 4ZO4A 2ZYWX 3Q3JB 3ZZTA 1E99A 1OFUX 1VG0B 1GNPA 2YINC 1O87A 2ZJBA 3SDZA 3QJYA 5CK4A 4M9SA 2DY1A 2ZR9A 3OE7D 4OQNA 4I99A 1UKVY 3T1VA 4ZDIA 3AB3A 4RZ2A 1JEEA 3ZQJA 1JAHA 4MKGA 3ZH9B 1KMHA 4A6PA 5KU1A 3A4LA 1TF2A 3U3RA 3WNDA 3EZ6A 1BKDR 3P27A 5TDHA 4BLPA 3CBQA 2XNDA 3X1DA 4UNNA 5C1BA 2C5LA 2JLZA 4LV5B 3UG7A 1J90A 3AF3A 3RYTC 4D25A 2RHDA 2O8CB 1E1RA 4LJ5A 2ZI4A 1U8YA 3HPQA 2DCUA 1QVRA 5KUTA 1CULC 4UXIA 2CL6X 5DGXA 4C7OA 2ZE7A 5DI3A 1N2CE 3B6EA 4RFSA 4V0KA 1Z0DA 3ICEA 4HLUC 5DSZA 4PC3A 2D4HA 2VP0A 3MWLA 2VHJA 2YWGA 2YWHA 2FU5C 2PL3A 3NH6A 4BEBA 4D4KA 1LNZA 1XRJA 4P32A 4QC2A 4MYTA 3GJ7A 3SU8A 2H5EA 1LS1A 3M6AA 5CB6A 5HR5A 1TADA 1II0A 5DN6D 4OK5A 5FFMA 221PA 2Z4SA 2O0JA 2ZUDA 4BPBA 1J70A 2PT7A 3P1JA 1G20E 1Z0AA 2HCJB 3TRFA 3PV0A 1M2OB 1N6KA 5A4JA 1KTVA 1KSFX 4PR0A 1KNQA 2EWVA 5AJZA 1ZINA 1KK1A 1FNNA 1VYUA 1Z0IA 3O8RA 2RMKA 3AP1A 3ZDQA 3OEHA 4XH9B 1Z0FA 5G40A 2NMVA 5GJVC 3VKHA 2WJJA 4GOXA 3SYLA 3PEYA 1U0HC 5KSZA 5DHAA 4L4UA 2IXGA 1MOZA 1GP2A 1VPLA 3GFTA 1G6OA 4OI2A 1L2TA 4Q66C 2A7QA 1US8B 2BBTA 5FI0B 1W0JA 721PA 2MMCA 4L9SA 3EPKA 3QQ5A 4KLZA 1YZTA 3D8BA 3DZ8A 1KY2A 1SVMA 1ZC3A 5EJEA 4LYFA 3J81k 3RRZA 3QY0A 1S3SA 4WXPA 2JAQA 3TAHA 2AKYA 2QP4A 2AKAB 2AR7A 2R9VA 2X2FA 4S2EA 2ZI9A 3RANA 5IHPA 1W2HA 2WVJA 1G3QA 2WWIA 4IKEA 2C9OA 4NYJR 4C4PA 4GOJA 3B9QA 4TMKA 2WICA 5BXQC 2QTHA 1QHGA 4KLNA 5ELXA 2F1HA 4LBVA 3AF1A 3TLXA 5C46F 1DELA 1LVGA 3PUZA 2C9YA 5KSPA 2RH5A 4URUR 4DSTA 4GBMA 3W3AA 4HUQA 1KAGA 1X86B 2P0EA 2G1JA 4B34A 3PUXA 1KNXA 2VHTA 1ZM9A 1TAGA 4RVCA 1DOAA 5EE0A 3VFDA 3AVVA 5L3QB 5KO2A 1KI7A 2RAPA 4URVR 3IIKA 5AJXA 3CRW1 1L8QA 3HJNA 3FKSA 3VMFA 1U9IC 3GJ0A 1YZKA 2DFLA 3VR4A 2OSBA 3ZVRA 2IYUA 3RS5A 3C16C 1E2EA 3QPUA 2A5GA 3A1VA 4DCTA 2GCPA 1SULA 2GXAA 1ZCBA 2HF8A 2IX3A 4CT4B 1Z63A 1S9DA 4D4LA 3MCAA 3RRNA 3DVLA 3RC3A 1WB9A 3LA6A 4DWJA 3FHCB 4TZ0A 1YR8A 2EQBA 3QF4A 2FSIA 2HF9A 5EXTA 1NP6A 3A58B 3BFKA 4HAWA 4CIDA 2DFKB 3C7KA 1HT1E 4NMMA 1DG3A 4IDQA 1E2NA 1G18A 4KAXA 3VHXA 1NY5A 4WA7A 1Q1QA 2J46A 3LXXA 4JJKA 3QSYA 5CYOA 1W4BA 4KSCA 3U3MA 4TTPA 4A0GA 3M4YA 1ZNXA 4Q4LA 2ZREA 2WAXA 5F9FA 3VNUA 2IS4A 1E2DA 1VIYA 4JLDA 4LJ7A 2VEDA 3LW7A 1FTNA 2BV3A 4LYJA 1NBMD 2BMJA 3ZS9A 3AVXA 2YOHA 1MO6A 2IS2A 1U94A 2H16A 5K8IA 1W7AA 3W5IA 5JS8A 4M53A 1D8TA 2ODWA 2QGNA 3QF7A 2W6JA 3QKUA 2G3YA 5JSZB 2VHCA 1P2VA 4GP7A 1Q22A 1Z83A 4NCKA 4NCIA 4AYWA 3ZLJA 2XZPA 1D2EA 2Q3HA 2ZJZA 1WE2A 3AP2A 4CYMA 2SHKA 2J45A 4IXMA 1EFCA 3GLIB 1HQYE 5HCNA 1UBGA 3BH0A 3IO3A 4XSGA 4A8JA 1U90A 2OUKA 1SKQA 1NG1A 1FUKA 4LBYA 3SZRA 1ZBDA 2A3RA 4U5XA 3K0FA 2ZRIA 3ADBA 4YMVA 2WWFA 1NG9A 2OLJA 1G3UA 4G0NA 4N0EA 2BMFA 3QXXA 2QAGC 2FSFA 3ASZA 5JJKA 4DT1A 3WYGA 4JKIA 1AGPA 1HEIA 1Q1EA 2Q21A 3RAPR 2V9PA 4LJ9A 1LTQA 2LKCA 5J4LA 1AZTA 2W2TA 1NJGA 2IYQA 5J40A 4FMBB 1OIVA 2W58A 4LCBA 3BOSA 3EC1A 1Z22A 2A5FA 3MMPA 2A5JA 2QN6A 3AKEA 3EZ9A 1N5IA 3VHLB 1CR0A 3UANA 2VH5R 1AA9A 3K9LA 1K5DA 4ZCLA 3SHWA 1J8YF 2CMKA 3A4MA 2IYLD 2OT3B 4CT5A 3K0SA 4ESVA 2P6RA 2C96A 5EP2A 3FOZA 4TQAA 1PUIA 2IT1A 4CW7A 2XX3A 3K9HA 3OESA 1VYVA 2E9SA 3DPUA 1QZXA 4QBFA 4Q4HA 2GAOA 2YYZA 4M2LA 2O8CA 3AUYA 1WRBA 4UXJA 2GEVA 1LS6A 1ZD8A 1OH5A 3Q85A 4HAVA 1ONBA 4RD3A 2CLCX 4IEEA 3HU2A 4TWZA 3WMFA 1R4AA 1P75A 3VTKA 1WCV1 2X2EA 3B8HA 3SBEA 2AHOA 4DLXA 4JVSB 1G8FA 3P32A 1AS2A 4P31A 4W5JA 4RFVA 5E95A 4OK3A 2ZRGA 5FBVB 3U61B 3FVQA 1BMFA 1MABB 4M21A 3KTAB 4XD7A 3A4NA 4Q7JB 4BZPA 3C41J 2RGDA 8OHMA 2ONKA 1WXQA 2OM2A 1E2IA 1P62B 3U5ZB 3ZVMA 5FPHA 1FQKA 3LFUA 4BFUA 2CK3D 2QE7A 2YC4C 2ZVQX 1Z2AA 3F8TA 2V6JA 1Q20A 4MQBA 2WPDD 3RS3A 2BIFA 1T0JB 4M0LA 4Q9JA 1DS6A 2QI9C 5JEEA 1E69A 2QG6A 1XEWX 2ZM5A 2ZRCA 3K0EA 1NN5A 2BBOA 1IXSB 3SI7A 1F2TB 4PC1A 2ZR7A 4KXFB 1EFRD 3LO5A 4US2R 2NO1A 1H8EA 1OFHA 1US8A 1UM8A 5L3RA 3UIEA 1FOEB 5AUOB 2ZETA 4O3MA 1ZMXA 1Z2CA 1GNQA 1UEJA 1YJ5A 4JLKA 1CRQA 3ND9A 2QBYB 3BJIC 4QNRA 1AGRA 3CH4B 3FMPB 1UKEA 1ESMA 2JIZD 4HATA 3NDPA 1M7BA 1QF9A 2KSQA 1JECA 2PZEA 4BUJA 4XWKA 2V54A 1OH6A 4FW9A 3WYAA 4BRUA 5JHHB 3BH6A 1F2UB 4DEXA 3KJIA 1NIPA 3IKJA 2NO0A 4GMDA 5BQ5A 1NSFA 1FX0B 2OXRA 4B33A 4D6PA 5DI9A 4YMTA 3DMNA 3KKQA 3OAAD 4JJZA 2ZXUA 2ZJ5A 5L3QA 5JCZA 2VHUA 3BORA 4MRVA 4MRNA 1DPFA 3GJ4A 1G3RA 2XXAB 3U6KA 3GJ8A 3AUXA 2D74A 2BEJA 4MUBA 1E4YA 2PCJA 2VF7A 4LYAA 1GKYA 1XFAA 3GLFA 2DBYA 3CR7A 2VSOA 2W6IA 1SXJA 2NZJA 2RGEA 2ZAMA 5EE3A 1Q3TA 5IK2D 4NCJA 1XP8A 4HLCA 5DH9A 5J4KA 2GILA 5KNDA 1XBTA 2OG2A 2QPTA 2HV8A 4LHYA 1Z06A 3VNVA 3O8CA 3WP1B 4A8JC 4JVMA 4HLQB 1RYHA 4PSVA 2CNWA 2IHBA 2XZLA 3D31A 5IF9A 2V3CC 2W83A 3VR1A 1SQ5A 4CDGA 2C98A 2J7PA 2JATA 3AM1A 1KK0A 1ZRHA 1ZC4A 3TW8B 4IOLA 4JT4A 5LDDC 1W4CA 2IF0A 3FDIA 3QXSA 3U4QA 1VIAA 1GDDA 5D3MB 4DHEA 4C2TA 1XJ0A 1KMHB 5K8TA 4BLSA 4M9ZA 2ZS9A 1VG9B 2IXFA 2PH1A 1B23P 5KDOA 2IS6A 4OBEA 5HZHA 1XCPA 3AVQA 2GCOA 1E4VA 3EG5A 2KI5A 2Q3MA 4C2UA 3BE4A 3MD0A 3AVYA 2RCNA 3VR3A 2XZOA 5CLQA 5CDFA 3VX4A 1G8GA 4US1R 4EQ6A 1GILA 1LV7A 2QY9A 4C7OB 5DI3B 4RFSB 4K81B 2H1LA 1E2PA 1N6RA 1YQTA 3WYFA 3BK7A 1OT3A 3E1SA 3GLIA 4LK2A 1WA5A 2VIIA 3U3JA 5JMTA 1BYUA 4K46A 1AK2A 2D06A 4JT2A 2IUSA 4BZXA 2CLSA 4A2PA 2YC2C 2BMEA 5FTJA 3WBKA 1KO4A 2OCYC 1F3OA 1ZP6A 2ERYA 5CJPA 2NPFA 1SVLA 5FR1A 5B30A 5BWMA 2ODBA 4CRWB 4ZIRA 3CONA 4AIIA 2XNDD 4AKEA 4DIDA 2RGBA 2WWXA 1RRGA 1Z8FA 3AKCA 2CLDX 1XU4A 3K70B 1E1RD 4DLRA 1NBME 1UAAA 5AJVB 4M1KA 1KO7A 1R5NA 1II9A 3B1VA 2FNAA 3L0SA 2PEZA 3FMIA 4D26A 2G0NA 4IHQA 1XJCA 5FL3A 2GWHA 1ZM3A 3UPUA 1W48A 1NN1A 4NL4H 4MH0R 2JLVA 1Z3IX 1W4RA 4XJXA 2Z0MA 5FPTA 1OHHA 3NBXX 4IW3B 3AVPA 3UK6A 3KJHA 3MWJA 4JYCA 2YKGA 1P9WA 3Q7PA 1N5LA 3GJ5A 1VKJA 1ZIPA 3NEYA 1DAKA 1M74A 4HYYA 2NZ8A 1OKKD 1WP9A 2W00A 3NHBA 4C0JA 3BH7A 1ELOA 1Z6TA 3S1AB 1A1VA 1Q0UA 3BB1A 3OEEA 3D7MA 1TU3A 3HU1A 3K8YA 3K53A 4XVRA 2P67A 4P4TA 1EWQA 5EP3A 2PX0A 5EZ5A 3SR0A 4A9AA 3OEHD 4NYMR 4II7A 3LX5A 4FCVA 4O2RA 3IPXA 2ZANA 4EPRA 821PA 1U0JA 4AG6A 1K6MA 1RKBA 5JCPA 4HAYA 3HDTA 3QBTA 5A5GA 3UMRA 1OJLA 3KJEA 3EPJA 2FA9A 2OHFA 3QENA 4F92B 3N5CA 3BC1A 3TUIC 2IXEA 4L9WA 1FNMA 3C5HA 5JJLA 4KITB 2IEYA 1BYIA 1P3JA 2CL0X 2R62A 3FTQA 3AVTA 3EZ7A 3NC1C 3VQTA 5KYKA 2QT1A 2BKEA 4EJSA 4ZDJA 3SS8A 1EGAA 1S4QA 4DXAA 4F38A 3QXCA 1GG2A 3Q72A 1RW4A 2EFGA 5A0FA 3TSWA 2CE2X 2RGNA 1KYIA 2DB3A 1NF3A 4YXWA 4Q9KA 1TF5A 3I8SA 3PEWA 1K5GA 2FSHA 3MGCA 3GQBA 1GTVA 2Z43A 3AF4A 3SEAA 1YR7A 1QHNA 3IQWA 4M1WA 1G64A 2QSYA 5DLQC 4D82A 3QF4B 4LUCA 2IHYA 4FMDF 5TY0A 3TNFA 1CIPA 4LYHA 2A2ZA 4HAZA 3NG1A 1M34E 5GVRA 2BM0A 2G77B 1PLLA 5FPSA 3IBYA 1Z28A 2VSXA 4ILEA 2ZRPA 3PUYA 2ZS7A 4DLYA 1QHSA 1TU4A 4URZR 3RVBA 4YMUA 2AL7A 4L16A 2FEMA 4G5SA 2REXB 1E2KA 1AS3A 2QU8A 2VP5A 3ADDA 4GOKA 4D80A 3QG5A 3PR1A 2QSZA 4M1MA 2ANCA 3H86A 1NN3A 3ZIAA 2KE5A 3LLUA 3KJGA 5IDVA 1II8A 1W5TA 1IN6A 1X8KA 2BM1A 4I1OA 1GVNB 1JR6A 5FI1B 4TYQA 1GKUB 1F2UA 4LY6A 3KUCA 5TB5A 4EPXA 3KQLA 3CM0A 3PIRA 2X19A 1HTWA 2Z5FA 4QRHA 1OXUA 4KFRA 4Q1FA 1JB1A 1FX0A 1T8UA 2FFHA 1TTTA 1MT0A 4A8JB 2AFIE 2P3SA 4JLBA 1Q57A 2ZUCA 2DFNA 2VTKA 1ZCAA 4LHZA 1KKLA 2EFEB 2JA1A 3TIFA 1Z08A 3GEHA 2VPPA 2XXAA 3V4FA 2WKRA 4LV8B 5FPYA 3VR5A 2CCGA 4HDCA 3K0AB 1L4YA 3W5JA 2ZYTX 3JVUA 4HB0A 2BMDA 2CHVA 2P65A 3UMSA 2ZRAA 3T1QA 4ZDKA 2JDIA 2O0HA 2V1XA 1PLJA 3PEUA 4TLCA 2W6JD 5KDDA 4DT1B 2J0SA 1EX7A 1MR3F 3QIAA 4KO8A 4I1VA 3WHLA 1Y63A 3NBYC 4EIWA 2V6IA 1KK3A 4QBGB 3QKTA 5BW8A 1BIFA 2FGJA 5KNBA 4DB2A 3IBGA 3RNLA 4JLPA 1W36B 2Q9AA 4TL7A 2ZITA 2D7DA 2A78A 3LY5A 4Z54A 5F3WB 5HCIA 1GITA 5EUMA 3P20A 2GDJA 4IDPA 3W6OA 1CJVC 1W0KD 4MRSA 5D3MA 2D3WA 2FOLA 4IDNA 4QG7A 4TMWA 1BH2A 2PEYA 2YOFA 1CF4A 3WMGA 4BE7B 1KJWA 3CF6R 5CB8A 2I1VB 4U00A 1NVVQ 1RJ9A 3R20A 2D7CA 3EARA 2F3TA 2XOKA 2H92A 2AXPA 2GF9A 1E9BA 2XB2A 4HDQB 1U98A 2GEDA 4H9GA 4Q4HB 1UPTA 1WDTA 2ZYVX 4MDEA 3MWKA 5FH9A 5KSOA 4TYYA 2WJHA 4YLGA 4DCVA 4XWAA 1GNRA 4L15A 1NJFA 3V4RA 3F0TA 1CR4A 3L0IB 4C0HA 5AK0A 4N3NA 1DARA 2BWJA 4BFXA 4KYUA 4DDVA 1GM5A 4O0MA 3GD7A 4GZMA 2JJ8A 3CKLA 1YR9A 2XTZA 3LQRA 2E1RA 1ZU5A 1KK2A 4F91B 2G88A 4C9BA 3VR6A 1G8HA 4TMXA 4QNMA 1V43A 1VECA 4HLDA 4BGDA 2ZR0A 4QJ4A 2GCNA 4Q18A 4PHHA 1Q21A 4E5UA 2YOGA 2UKDA 4QHSA 3OFND 5KDLA 3E5HA 1LB1B 3WXMA 5CYPA 5EE5B 2J87A 3B2EA 5TV2A 2P6NA 5EP4A 4V02A 1P2UA 3K9GA 4HZIA 3WRXC 4JLMA 4QKQA 1XZPA 4JSYA 5FOWA 4AKHA 3H0KA 1E9AA 4LC1A 2DFTA 4EKDA 2OFOA 4YC7A 3GFOA 3CNOA 4XOIA 3Q5DA 3QPWA 3CRQA 4L8GA 5HKKD 1O3YA 5IT5A 3THOA 4DLSA 3I5XA 1JEDA 3ETLA 1EX6A 4EPWA 1YVDA 5EXXA 4B3GA 1COWA 4JVNA 2IUUA 1BMFD 4O2LA 2RGNC 4XD7D 2G1KA 2YHSA 2GAAA 4DSNA 3NDBB 4G1UC 2IC5A 1T4GA 2AWNA 1IOZA 3VKGA 4IVRA 3ZQ6A 4FWTA 3S1AA 2H17A 3AQ4A 3MJRA 1T3LA 1PVOA 3WRYC 2GEUA 1R7RA 2HLDA 5FPKA 4FD2A 1P2TA 2VLIA 1PLKA 2FEOA 4MUAA 3T35A 1VCMA 4A92A 4CEJB 3SFVA 4BEJA 2ZSDA 3U3OA 1HY3A 2G83A 4XTRA 1VTKA 2IYXA 4C0KA 1A82A 1R0WA 1XMSA 2YV5A 4JL6A 1DADA 2P2LA 4TL8A 1H8ED 1TQ2A 2ASEA 3T1TA 2VO1A 3TR5A 3O8BA 2O8DB 3SJBA 5E7IA 2QMHA 1LW7A 2FN4A 1IN8A 2PMDA 4NKRA 2IWHA 3VAAA 4PAOA 2YVUA 2AD1A 2QZ4A 2UVQA 1YZLA 2FZ4A 3IIMA 4V03A 5H68A 4TMTA 3QUSA 2QM7A 3MLEA 3U3KA 1JQJC 4DLTA 3I72A 2X8AA 2V7QA 3QKSB 3VKWA 3GLFB 3ZVNA 1R2QA 1SXJB 2GXSA 2FGKA 3JVVA 1DTSA 1YZUA 3OHMA 4PQYA 1X3SA 5H70A 2OZEA 2OO7A 1OB5A 1NI3A 1P7CA 1DAIA 1RPZA 2PLFA 1SVSA 2JJ1D 2DYKA 1N0VC 3K9NA 3TMKA 2OBLA 2O5VA 3GEIA 4NTZA 5UKDA 2WZQA 3C15C 4DSOA 3LRPA 4P33A 1ZVQA 3X1YA 4Z1MD 2QRNA 4NYIQ 2HDNB 4Q19A 1H65A 5AWFC 2F6RA 2A5DA 1ESNA 3OIYA 4QM7A 1NNEA 1N6IA 1YE8A 1MV5A 2NPIA 4NCHA 1Z6GA 5J47A 5FOUA 4RZ3A 3U4QB 4NDZA 3JZMA 3TVTA 4ZV4A 2QA5A 4EUNA 1G7RA 1UFQA 1R8SA 4Q7LA 5TARA 3EAQA 1FZQA 1HUQA 2W6ID 4GFDA 2DWPA 4GMXA 4ACBA 5H8WA 2ZQ5A 2J5XA 4X8LA 2EU8A 2IF2A 3IDQA 3MG9A 1KDOA 2GCOB 2R65A 1ZUIA 3DL0A 4C0BA 2Y8EA 2FPKA 2JJ2A 4TMVA 4IFEA 1W49A 2A30A 4DUGD 1TMKA 4EQ6B 1AJEA 2J7PD 3Q9LA 3LBNA 4BQSA 3PFIA 3A6PC 1F48A 4AI6A 4TLEA 1OFIA 4JBWA 3Q7QA 3CF0A 1E98A 3CRMA 3LAWA 4JVLA 2VA8A 2HYIC 4HSEA 3KQHA 3EZFA 1OYYA 2GVZC 4BRWA 1HURA 1W4AA 4M1SA 1JJ7A 2F1RA 3L82B 4S35A 3EASA 3Q8XB 2AK2A 3CX6A 2QL6A 2DWOA 1LF5A 1TX4B 3TK1A 4FINA 2DPXA 2IYVA 3WHKA 3W90A 1A5TA 2FZLA 3CW2A 1HQCA 3K0AA 1IQPA 2WSMA 4ZIRB 3R9XA 1YU9A 4J0QA 5JJIA 4LJ8A 2WSSA 1SKYE 1NSTA 2V8OA 1P72A 1G3MA 1R5OA 3B9PA 1ZM2A 1JI0A 4JLAA 2GKSA 4Q1AA 2OE2A 2ZRHA 4F93B 2IS1A 2C04A 4K8OA 4BECA 4V0LA 1L4UA 2VRWA 3R7WA 3NVAA 4ACAA 4L5BA 4BLRA 2NOAA 4LPSA 2JCSA 5HPYB 3I5YA 1JXOA 3RC8A 4X8OA 1KI4A 3TBKA 4DDWA 3QBVA 4WXRA 1R0YA 5CIWA 3RDPA 3TH5A 4JLNA 5EE9A 1S2MA 4LJAA 4GZLA 3K70C 1GL7A 3SYNA 1NN0A 5FUYA 1N3BA 1TUIA 3PUWA 2OESA 3P4YA 3ZJYA 4BFVA 2XSZD 4EPYA 4KI0A 3H4MA 3FWYA 2QNRA 1DE0A 4GL2A 4LHVA 2B7BA 1GFIA 4C0AC 4YMWA 1DEKA 1KI9A 1FQJA 2C99A 1ZNYA 2ZEJA 3RWMB 1AZSC 1UKZA 1G1MA 4DCUA 5BN3A 1OPXA 2HEIA 1GRRA 2QMEA 4LOAA 3A1SA 1G17A 4V0ME 4OI4A 3BFVA 1AM4D 3UWKA 3UXMA 5DYGA 5BYJA 1I2MA 2I3BA 3FPAA 1IN5A 1ZAKA 2ZRNA 1W2GA 1E9FA 4FN5A 4W5WA 5DN6A 1OHHD 3OF5A 2ZI7A 3SYKA 3T5DA 1PJRA 4LDJA 5AUNB 2GK7A 1NLFA 3BFXA 4LJ4A 2BCJQ 4KCGA 5FUXA 4N1AA 4Q1CA 4EJSB 1XXHB 1T91A 3LXRA 3ZD7A 3KQNA 1DAEA 1KI3A 2IBMA 3B60A 3CRVA 5DO9A 5JEDA 5DNYB 1SVIA 1P6XA 2WMNB 3JZAA 3CPHA 3LW8A 4PPNA 3CWQA 3RRYA 3THXA 2O8FB 3RWOA 3B85A 5FUVA 1CS4C 2Q9CA 3T1OA 4ARZA 3KQUA 4R2HA 4R7ZA 2QQEA 3GJ6A 5JFGA 3CRRA 3O47A 3MAAC 2B7CA 4GRAA 2OCBA 2PZFA 3T5GA 4CEHB 1Q1BA 1E79D 1XF9A 1A2BA 3EA0A 4M9QA 3TAUA 3ZYCA 3ZZ0A 4WBSA 3VX3A 1AN0A 5E7MA 2PJRA 1T6NA 1EXMA 1LF0A 3D3QA 2ZAOA 3B1XA 1JNYA 3M0EA 1AKEA 2NQ2C 3L2OB 3KDSE 5KNCA 3DEFA 4WZAE 1MO5A 1W1WA 1XEXA 3QE0A 4US0R 1N5KA 4WIAA 121PA 3OIWA 4BFWA 4PFSA 1XEWY 4NZYA 3KKPA 3BS4A 1Q12A 2GTPA 1FUUA 2VP9A 3EX7C 3TVDA 1S0UA 4CEJA 4JKYA 4WZ6A 1II8B 3TUJC 1SGWA 3I61A 3CX7A 3IGFA 2J0QA 2KBFA 1GL9B 3AKYA 4PZYA 2BJWA 3QI2A 3FYHA 2BC9A 1G16A 1XMIA 4KVAA 2O8DA 2HJVA 1E6CA 3MRSA 2ZJ2A 4RD1A 4AG5A 4QGFA 1E9DA 3FB4A 1W5SA 2F7SA 4MA4A 2BBSA 5DE3A 1E2QA 2C03A 4LRWA 4Q47A 4OQMA 1QHXA 4FMDB 4NE2A 5IRCD 2DWQA 2ZRBA 3LBHA 4Q7MB 3QKSA 2GHIA 4C0SA 1P61B 3ZIAD 4H1UA 4KFSA 4B74A 5CLLA 4A2WA 1GKIA 1XMJA 3DKVA 4BASA 1G8PA 1QG4A 3U7FB 3U7HB 1RYFA 2ZRFA 4RD4A 2GK6A 5AR1A 3DMDA 5JWOA 2KB0A 2QP3A 3KX2A 3X2SA 1ZNZA 3CZPA 4URXR 5KHOC 3OIUA 1P4SA 1QHYA 3C5CA 5G3ZA 2F3RA 2WM9B 3EPLA 621PA 1Z6YA 4PPQA 4KBGA 4TSFD 1NBMA 4R2IA 3SJZA 1IY1A 2A5YB 3CF2A 1M7HA 1TL7C 3LDAA 1TNDA 1U8AA 2QGZA 3CWZA 5E7JA 1UDWA 3TSOA 4TT3D 4I4LA 3HR8A 1P73A 2PZGA 3FFBA 3T34A 1RJ9B 4ZPXA 2IW3A 2R6FA 4NYJQ 1E1QD 1ZM7A 2ZE6A 4Q4AB 2QROA 1N6PA 5JI2E 1JR3D 5C2JB 1AS0A 1W36C 4KFTA 1Z5ZA 1C4OA 1HYQA 2OAP1 3KXKA 1HE8B 2WOJA 2F9LA 2ZU6A 3THYB 4AC9A 1SVWA 1IJEA 1MKYA 4POAA 2WJYA 3A1TA 1E2JA 3TJZA 4KVGA 2PLRA 3X1WA 3DOFA 1SZPA 1H8HA 1XPUA 4Z8YA 3ZVLA 1J99A 3L8YA 2HT6A 2J9RA 3V00A 2ODNA 1OIXA 2N1BA 3GLHE 1KZ7B 4EDHA 1R6BX 2B92A 5SZIA 1N5JA 1OF1A 2WJGA 2C78A 1KI1A 2F1IA 2HYDA 2FPLA 4RD0A 3ZS8A 5AJWA 1XX6A 1KSGA 2GZDA 1Q3HA 5GJBA 5EP1A 5FTKA 2XOKD 4EFMA 2E87A 2GBLA 1CKEA 5CM8B 5CITA 3GLGE 1P9NA 4HZUB 2ANBA 3HYTA 4PC2A 4BFZA 2GJ8A 1OXVA 5GADl 4KV9A 1TUEA 1GAJA 2EYQA 3WBJA 4Q1EA 4RD6A 4FI3C 4ZKEA 1M8PA 4MKHA 3U60B 2QT0A 2CVFA 1E96A 2FFQA 1P60A 4B71A 1KSJA 4A0HA 1RRPA 3GPLA 3LVQE 2CJWA 1NKTA 3N70A 2FFAA 3ND8A 2HT1A 4TZ6A 5DYIA 4QGAA 4B44A 4G01B 1U81A 2ZI3A 1CRPA 5LPNA 2REBA 4PO1A 1QHIA 2WWHA 3W8RA 4A2QA 4XIGS 4ZI2A 1R10A 4JLJA 2R6DA 4OYHA 1UBCA 1KGDA 4F4CA 4WZBE 2F55A 1W46A 4MGZR 4GDFA 4AK9A 2XGJA 1S96A 3PXGA 4LHWA 4TQUS 2WKPA 3K70D 1BO6A 2YWFA 5JHGB 2NO7A 2MMGA 2GJKA 4UQOA 4ASUA 2ZSEA 3W8NA 2XITA 1CTQA 2XJ9A 3DZDA 3F3YA 3L0PA 4G5OA 2GXUA 4PANA 1OH7A 2R2AA 3KFVA 2ZE5A 4TL6A 1TPZA 2B21A 1D9XA 3GMTA 2NG1A 2FF7A 2H7VA 3GP8A 2JLUA 3K1JA 1RVDA 1CP2A 4RCYA 2G6BA 4A1FA 1R0XA 1W0JD 3TUZC 1HA3A 2QP9X 4JBYA 3WP0A 4G5QA 4UKDA 3DDCA 3HU3A 2FX3A 4JYBA 4ERNA 3GLIE 1XJQA 2VYFA 4TQ9A 3R8FA 5FBRB 3W9YA 4OJKA 1XXHA 2CK3A 2P5TB 4ZCMA 4OHYA 3FKQA 4ZCIA 2WPDA 3NIBA 4DEYA 2B8TA 3PJRA 1T0HB 2HLDD 4FMCF 3TKLA 3PG5A 4X8MA 2FH5B 2XEXA 2O8FA 2OV2A 3ADKA 2BOVA 3CNLA 3U6BA 2WTUA 3G0HA 2IK8A 2GNOA 3X1XA 1EFRA 1G6HA 1NVUQ 4PXAA 4KU4A 4DRZA 2VP2A 5SZKB 4OI1A 1TEVA 4QOSA 4A6XA 5FOTA 4CEHA 1Q1ZA 1UBFA 2AXNA 1N6OA 5G53C 1T9HA 1RC8A 1RRCA 2ODEA 4UJ3A 2OFWA 3G5UA 2ZPTX 4RKFA 1VHLA 3AV0B 3KKOA 4B3FX 1SXJC 2XAUA 3BIFA 2GJSA 4FCTA 1XTKA 2P5SA 1CR1A 3FKSD 1T3SA 1X6VA 4Q9HA 2IYRA 2J7KA 2JIZA 2AD5A 2FG5A 5G41A 2FDCA 2V7QD 2YJTD 5C4GB 2IYSA 2GZHA 2ZVPX 1J8MF 1XNJA 1RE0A 3C14C 4TTQA 1R5BA 4OQXA 3BAFA 4Q7KA 3SBDA 2FPMA 3IIJA 3P26A 5ANRB 3OAAA 4JMPA 4PO9A 2WKQA 3R9WA 2GRJA 5AUQA 3R9IA 4TYWA 1TQ4A 4MGYR 4BZQA 4DDTA 4GI7A 1KO8A 2ONJA 3FMFA 4QBHA 2TMKA 4DC9A 4A4DA 5EQTA 4NH0A 1XTJA 5CK5A 5E3HA 2YNMA 1ZNWA 4C0LA 2C95A 2OFXA 2OBNA 2WAYA 5L8VA 2A9KA 3PITA 1CXZA 5IK2A 4P3YA 4M1OA 4BFYA 2OAQ1 4W9MC 3CNNA 3AF2A 3A36A 2BJVA 5FUWA 5C18A 1G291 1NLZA 1FP6A 1X8LA 1NY6A 2GJ9A 3L43A 4KBFA 5J4VA 3NH9A 2P6UA 4HUTA 3W34A 1YZNA 4LBWA 2NO9A 1YKSA 2O8EB 3H84A 3O8DA 3WNBA 2JJ2D 1QHHA 2UZIR 1S1CA 5F98A 4RZUA 3RLFA 3CPEA 2B6HA 1XPRA 2J59A 4JLOA 3R7WB 3HPRA 1ZUNB 1G41A 3D6TB 4QL3A 1IAQA 2ZSFA 2BVNA 1M1YE 2CCKA 2F43B 2JLWA 3AEZA 4Q4JB 2GBLC 1PZNA 2C9CA 2YZ2A 4G3XA 5FOSA 1X1RA 3IO5A 2ORWA 4XSHA 3SJCA 5FTLA 3BRWD 3DM9B 5B57C 2WWYA 3ECCA 2ZSBA 3NEJA 4ZI3A 1W44A 3H1TA 4Q4AA 2WSSD 2QPOA 4HDOB 2ZE8A 4QXAA 4MYUA 3RABA 3EA5A 3W3ZB 3C4JA 4B3DA 2ATVA 2ZRJA 3A8TA 1FTSA 5FBQB 3MJHA 2OILA 1XPOA 3THYA 3TR0A 3AVUA 4I1UA 4M8NE 1NVWQ 1JPJA 1QDEA 4KYIB 4C3ZA 3B1YA 4A15A 1W36D 3QVVA 1E0JA 4LC0A 4P0TA 4PZZA 2VF8A 4OQFA 2IUTA 4Q01A 1G3IA 5C4MA 2QUZA 4OJQA 4GSYA 1E2MA 2IYYA 4JSTA 3T06B 2EFCB 1KDRA 3PUVA 1XCGB 4DCNA 1XTIA 5TMPA 3AP3A 4P4SA 1MO3A 4F4JA 5LD2B 1G5PA 3IEUA 4MRRA 3TSZA 4D0LB 2OCAA 4JBXA 3LV8A 3L8ZA 1AIPA 4OL0A 3KXIA 2ZUBA 1JAIA 2QAGA 2BKUA 1NIJA 1UEIA 2LCFA 1CU1A 1ZD9A 3GEEA 2H8KA 4HZUA 3REGA 4B2IA 4LZZA 5KSYA 1NVXQ 1EFTA 4D4MA 5FL7A 1A7JA 1D9ZA 3THXB 4MKIA 2IYWA 3DO6A 2MSCB 4ARZB 1UADA 1JR3E 2EFDB 3RSLA 1E2GA 2EW1A 3B1ZA 5GJCA 3SQWA 1IXRC 1UDXA 4IVPA 1G5TA 5JRJA 1DAMA 3BB4A 1WMSA 4WOPA 5L3VA 4DLWA 2V1UA 4EJSC 2BHRA 4M1TA 3UATA 4QGGA 3QG1A 4IOMA 1FPMA 2GF0A 3UWOA 2HJGA 4B75A 3FMOB 3P4XA 1FW6A 1OKKA 1OXTA 2ZJ8A 2XTNA 3GFPA 1FFHA 4GNKA 4E22A 3A37A 3EWAA 3U7EB 5KPDA 2CEAA 1FMLA 1XEXB 1Y3AA 5HE8A 2ZRDA 1F60A 5FTNA
chains in the Genus database with same CATH superfamily
5BN5A 2GLUA 5K8UA 4WBNF 1CLUA 1LLCA 2WR8A 4JL8A 2Y1KA 5EEGA 2O07A 3Q7IA 2CLHB 1AKVA 5B2ZA 1U80A 2NUAA 2PX3A 5DT9A 2V7TA 2YVKA 3DVSX 4FIZA 4PGHA 5E0OA 3T61A 4M1EA 3IEMA 2C77A 2NUBA 4GZ5A 4AJEA 1UP7A 2GAFA 1VLZA 3O31A 3QWHA 2PS0A 3L02A 1WD7A 3PNLA 3U62A 4EEKA 3HVUA 2VVTA 2HV9A 4B47A 5K3BA 2WIAA 2V98A 3QUCA 3J81A 4B5KA 2WT8A 3TFWA 2ZKIA 1NXQA 5CH8A 2VJMB 4JUBA 2O7RA 3G8DA 5DEOA 5AXDA 4KOEC 5A5VA 3DFUA 4F56A 3OJOA 2X0RA 4KK4A 1AQUA 5HA5A 1P1FA 2QPAA 5CJ2A 2J3EA 3LS2A 3MT9A 3JYHA 4NPHA 1C8BA 1DDIA 2WZDA 3LNCA 4Q9DA 5FJJA 3WLEA 1Y1PA 3B78A 4ZO8A 1JBKA 1E0SA 2KQUA 4MWCA 1QIMA 3BZWA 3RSZA 1TF7A 1IPHA 1GIAA 4XQ9A 3S2ZA 1W4ZA 4EUFA 2UZ4A 2FE4A 3H5NA 3NWPA 2XQVA 1OB2A 3P19A 1BW9B 1K3UB 2IUEA 3A1NA 3MWGA 3KFXA 3S8EA 3CH7A 2WABA 2VNIA 3SG0A 1VGQA 2IZ6A 2ZJOA 3MIIA 2JD1A 2OA0A 3VU9A 1CZRA 2GOYA 1I1OA 2Z8ZA 1VL0A 5H83A 1R88A 4OX9B 4JJAA 5BUQA 3KSRA 5FA6A 2W0MA 1Y48E 1U0EA 4DZZA 2CLFB 2OVFA 5IDYA 1DMRA 4XGNA 5PGMA 4H08A 3ED5A 1GRQA 3LKBA 1W8DA 2M32A 3KT8A 1IL0A 2NTEA 2E4YA 3GLGB 2PS9A 1GPJA 2XQFA 4U0JA 1IHUA 4X54A 3N87A 2WJVA 3HWX1 3EOZA 5IC5A 4UJ5A 5FTMA 1LTHR 1OREA 1OLXA 3BXOA 4D9EA 1JAZA 2GYWA 4W5HA 3AETA 1I5EA 1CJMA 4QX6A 2A0KA 2R6JA 1JHXA 4MV0A 5D2CA 1RQRA 1XC7A 2IPMA 3AI3A 3N1UA 3PXDA 4IQGA 3VSAA 2BUCA 1AKTA 1USGA 1KMQA 1NBAA 1Z6AA 3W6NA 4X65B 1YRBA 1NLUA 2C42A 2POCA 3IYLW 3Q3EA 4QOHA 1N1MA 5JSKA 3VJRA 3KQTA 1NVAA 4MVJP 4RW0A 1TJYA 2CE7A 2IA5A 1IEXA 1L3CA 2AN4A 2J0VA 2Q7OE 3O4HA 5DP1A 4NYMQ 4D4JA 3D6HA 3LXUX 2ZRMA 4DMFA 1AXEA 2VDKB 4EABA 5C1PA 1E94E 2EP5A 1KKMA 2JGDB 3C3YA 3VAYA 3VYRB 3K9QO 7MHTA 3VDXA 1NNSA 3CZQA 1AUXA 1ZK1A 3R8CA 5AQ1A 4E46A 2E4VA 3MZ0A 1UC9A 1J2YA 4I0WB 3B9RA 4XXHA 3IAXA 3V48A 1RWXA 2CXXA 1XZIA 5KPJA 2P35A 1TC1A 4EYOA 4F5WA 4ZOAA 3N2IA 4EITA 2YZMA 3A4TA 4BP3A 1ZOIA 3IP7A 3KWLA 2ZYUX 1KAOA 5CT9A 3MHTA 1DSSG 2D2EA 1VLVA 2DE0X 4RTPA 1E0AA 5ESXA 1PJ2A 2K5UA 1HGXA 1MF7A 2YICA 2LKDA 3FJ1A 2WA1A 2OV6A 3WGZA 5ILQA 4IEIA 5FQNA 3I32A 1L7VC 4WE3A 3DB1A 4ER6A 3A3PA 2DETA 3A2NA 2D2FA 1PSZA 1QFYA 1S8OA 3FTEA 5IH7A 1UJ5A 2QXTA 3FKJA 3TW0A 3WE7A 3JQ7A 4S0XA 4C30A 2QUKA 4AL4A 2WFLA 4WW0A 1L7EA 1G5IA 3AILA 1WUYA 3PPIA 4RNCA 4X94A 1ZW1A 4DKXA 4X9XA 2A9RA 3VR3D 3TOVA 4DDKA 1QRTA 2I87A 3RVOA 2VAPA 4AROA 5L3SB 5IVPA 4UARA 4MYCA 1X1SA 1MTOA 1TKBA 4R8SA 4RTQA 4IY1A 1NVBA 3JD3A 3VGPA 3M6FA 1O4VA 1FUIA 3N8HA 3SSMA 5IX8A 2FPWA 2XD4A 5JS7A 2GETA 4MB6A 4JEHA 3JD4A 3FOWA 3WTCA 5JNRA 1GGNA 3NP9A 3R0JA 4DLAA 4KSBA 2WMDA 9LDBA 4MNTA 3UJHA 1BVHA 3O1HB 3WLQA 2JGRA 1ZZGA 3G1TA 5CT5A 2I3GA 1WF3A 1H93A 1W76A 1FW8A 1UWLA 1LSUA 2X0JA 4FNOA 1T8RA 2G36A 3A1UA 2P9HA 1G7TA 1TAHA 1JJIA 4P3NA 3NTUA 3OT4A 1IN7A 3ZGZA 3TZBA 1M2NA 3OX3A 1GG5A 4QXRA 1C0PA 3LHSA 3BGIA 5T41A 4CEIB 1EINA 4MVJG 2GAJA 4FW8A 3U81A 1VI2A 1YJBA 1MHTA 4ABYA 3K72B 1VKZA 2Q9UA 1J9EA 4UEJA 4RA6A 4DAEA 4OI0A 4CXMA 4UMDA 4AZTA 4IXNA 1Y80A 3KT3A 4URYR 3JR7A 2E4ZA 1MFPA 2EX4A 1T5IA 2KLHA 3PKZA 3BJEA 3IV7A 3PENA 1EPUA 3T3IA 4U7GA 1H1TA 1ENYA 4M3NA 5GWXA 1NQTA 3I2KA 3CIOA 1GUFA 1E32A 5EQJB 4BX8A 4B87A 4BB9A 3OFNA 1Z36A 1ZUHA 2P5YA 2I1QA 2I1LA 4PSAA 1ESZA 3NT5A 1IQRA 1O6GA 1TU0A 1ZOPA 2VKTA 1D4FA 2HPHA 1GA6A 2WMYA 2BLNA 3WZLA 4RZXA 3SQNA 3RJ5A 5KTYA 5EZ6B 1BSVA 2R7NA 3KTOA 3KZ1E 2AG5A 4W5RA 3TX2A 2R86A 2UUOA 3MJEA 3OTIA 1MIOA 1QUFA 1L4NA 5JCJA 1JT2A 3MFQA 3EIHA 2ZT7A 1B43A 1ZLXA 3NHZA 2P11A 1CHNA 1XTSA 2CDNA 3RIGA 4DYHA 4FVTA 1F5NA 4HXFB 1G19A 1O08A 2Q5LA 3TAXA 3E2IA 3HWRA 1KYWA 3NM5A 1M1NA 1Z47A 4GVLA 4QDKA 4Z1OA 2JI9A 4FNGA 1DO0A 5LBTA 1MJNA 5DBIA 4HZGA 1QFSA 3C6XA 2DJ5A 5JBQA 1ULTA 1ZW6A 5CGZA 2IDKA 3HC7A 3RRXA 3VOBA 4IFBA 2DSNA 3UH1A 2BZSA 5DNUA 3CVJA 3PIIA 5GMOA 1JH8A 3ZDCA 3THWB 2B30A 2E48A 1ETUA 2I03A 2FDRA 4LTMA 2G8LA 3G8AA 4E5PA 2SKEA 3HU5A 4FS3A 5JWHA 1JVSA 2HADA 4X3CA 4CIBA 2WWRA 1S2DA 2VRCA 1PSWA 4IS2A 4BB0A 4GI1A 1KQGA 3FSJX 3RSGA 3T9BA 1VMAA 4RH3A 4MS1A 4XI9A 5LP6B 1E9EA 2RG7A 1Q91A 4MV9A 4TGLA 2FEWB 4XIIA 2OORA 5EZQA 3UJDA 2K7FA 3GUZA 1DEOA 3N0XA 5BP7A 1K6JA 3KB8A 3SC3A 2BGGA 2ESRA 1ZD5A 4HEA6 3DAYA 3DKPA 4MUFA 5H0IA 3I05A 1R6DA 1BXGB 3ICQB 1AOXA 2GSWA 5BRJA 2O3JA 1XD8A 3TTTA 1UF9A 1N8KA 3IQZA 4EI2A 1RAFA 3P71T 5A02A 4C0XA 5KIAA 1E7QA 1BCRA 1N0WA 1YDHA 2OBFA 1XPJA 3BXEA 1OXSC 1FDTA 4MZDA 4FMCB 2G71A 2NGRA 2ZJAA 2OXCA 3EQZA 3ECAA 3QBEA 4EYSA 1P0CA 1GZHB 1QP8A 4DYDA 1YSCA 4E07A 5K0GA 4EZEA 3DLBA 1O96A 3NKVA 2OHXA 3HCCA 3AB7A 3KYDB 4JWTA 1J2JA 1PBNA 1U2GC 1L4LA 1AXRA 1FBNA 2C2HA 4NZNA 4DMMA 4YGXB 2YJ4A 1PGJA 2X6QA 4DG5A 4PYLA 2IEDA 4KN9S 2JJ1A 4F2PA 2MR6A 4K6HA 1QZTA 4TLMB 3RTEA 3RVNA 3TTUA 4IJQA 5SZHB 4C78A 3WQSB 1UMCA 3GLHA 4FCWA 3BYZA 3ASYA 4RS4A 2UUPA 1OE0A 4XFDA 5E4TA 1KMIY 3I04A 2DJIA 4Z9AA 1XD2A 2XRYA 1JAXA 1ZCFA 5CLHA 2CY0A 3D7SA 1NJ2A 3KV1A 4HXYA 1ZBQA 3QX8A 4MR8B 4YJHA 3BMCA 2NVWA 2VT7A 4QHTA 1AB5A 3HR7A 3IEKA 1KBQA 4TUYA 3ABOB 2Q3EA 2XTJA 1M0WA 2HD4A 2VZ0A 3HDGA 4MP8A 4NP6A 3NS7A 3V2HA 1HL3A 2XUAA 3IEPA 4KPUB 3VPHA 3AFIA 1VDZA 1NKSA 4JUDX 1KE1A 1JI3A 1WNTA 3NOOA 4DCCA 1T1RA 4HQ6A 4GPIB 5IZCC 3TG8A 1G59A 5I7HA 3WY9A 1ZSVA 2RGGA 1RI3A 2CWWA 1CE8B 1JLLA 1PEKE 2GRAA 3GWGA 2HMUA 1IQUA 3RS7A 4WUTA 1Z2OX 1IAVA 3PUHA 3GFQA 5CAEA 2CV0A 2X58A 1B1CA 1QIDA 4NNJA 5AKEA 5JAUA 1M5TA 4R1LA 4YJ2F 3WLKX 3ZBTA 2ZLBA 3HKDA 4B7ZA 1MT3A 4YUWA 4HAUA 1F8YA 1NV9A 4B6FA 5ITWA 3FOEC 2VTDA 1ACLA 4GDMA 3IE1A 2JVJA 2QF7A 4OHWA 4Q7EA 3QPBA 1XTRA 4LHEA 5LMZA 4FYWA 1ZIOA 4CFYA 3WL5A 2F48A 2WUWE 3ZWVA 4YRQA 4PSKA 4AWAA 1CYDA 3OCXA 4GI5A 4Y2JA 4MJ3A 1ZA2A 1TAUA 2CLKB 2QZJA 3ZN2A 1E0KA 1XMPA 1PZMA 2ZI6A 4ZOQI 5FHQA 5CA1F 3HBJA 5JWRA 1HZZC 5E9JA 2BFFB 2GKOA 4GLBA 5E6UA 4E0BA 3LPAA 3NWJA 1KIMA 2ZB3A 3TCKA 4FR0A 5HIIA 2OV3A 1AQYA 1NR7A 1NOIA 1KFCB 2GYVA 2OB1A 1XZ8A 4H1HA 4PLCA 3Q8LA 2GPBA 5EUQB 3DMTC 4AWXA 3GJ3A 1EE2A 3RV3A 1ECPA 3ZE1B 1V1RB 3FA2A 1D2NA 1PW7A 3B13B 5IABA 4NEGA 3JD1A 3PR3A 4MMXB 4XIJA 3FN4A 4Z0HO 3JCZA 1ITZA 1QGED 3CUYA 1X7YB 4MQMA 2JLRA 3I92A 1WDWB 3H99A 4LBZA 3HXQA 2HN9A 2JGNA 2RFLA 3U3DA 2BKXA 2GM5A 1SXJE 1TVKB 1MC1A 3O2NA 4RADA 3F47A 3L8MA 5K8LA 1N77A 1KQFA 1KL7A 4GR5A 5TEWA 1E3MA 1Z2DA 1PR6A 3PTAA 1O0CA 4BOYA 3GT4A 2VJAA 4YWHA 2MHCA 2JHCA 1U1FA 1B26A 1B0PA 4R1UA 1NJ6A 5JPDA 1RFLA 3DEIA 4I5DA 2C2WA 3WKCA 4P54A 4EK9A 4HBGA 1TT5B 3W9UA 4IVQA 5E9WA 3E35A 3RTDA 4OFZA 1BOOA 3V97A 4EA8A 2HCRA 3GR6A 2Q1YA 1V2GA 1SZJG 3NUZA 4FN4A 4YAKA 5ILOA 2QR2A 4GGPA 1ZRSA 3DDUA 5JPCA 2WQZA 4GR4A 4Z7JA 4IGIA 1CJKC 5BN5B 4NHOA 3AM5A 4L5AA 3H65A 3STVA 4I9GA 3TEJA 4DBZA 3LT0A 2FJUA 1Y0BA 2QL9A 2J5RA 3SSNA 2MU1A 3T38A 2NVBA 3D3WB 1W5BA 5C9ZA 1P0QA 3RW9A 3LX8A 3B1FA 4L4SA 3D54D 3RYCB 3V9PA 1IXYA 1FC0A 2C7RA 1AO3A 2MR5A 1J0BA 1PG5A 1E2LA 4Z8XA 4WXMA 3AGQA 2J9ZB 1QP4A 3OU6A 3TQSA 3ZV6A 4G0UA 5EC8A 3MGGA 4KE9A 2MIIA 4OHUA 1S6YA 3ZD9A 4M87A 2IPNA 1Z4LA 3SSOA 3E15A 4B48A 1R0RE 1UBOS 4C07A 3I4LA 3KCNA 4HGZA 1COWD 5TMBA 5CD9A 3CPJB 1S2NA 1KEUA 3H1EA 1VZ3A 2OZLA 1N3LA 3P2EA 2OHGA 2J41A 3AUJB 3FNBA 2RGXA 4A16A 5HZKA 2QAJA 3KDPA 3BGWA 1QF6A 3UWPA 5K0ZA 4LWZA 3OLYA 5JZVA 1GZDA 3DKRA 4BX0A 3KIPA 1MVOA 3MMZA 1D0SA 1BE8A 4DCOA 3O1IC 3V4ZA 3WMRA 2CHQA 3OTHA 4QJ5A 4PO8A 4YIKA 3KXLA 2DY0A 3MRTA 2VJQA 3AIKA 4MWTA 3A6DA 1HLPA 3F6RA 1MQ9A 3L5OA 5AKGA 1CUJA 4LC9A 5KJEA 1EQ2A 3DW3X 3OURA 5CLGA 4LHXA 1AF4A 3VU9B 1NTRA 1E79A 2GFQA 1R4NA 2R6GA 1E7WA 2EVWX 1EJBA 4G5GA 4NBSA 5GVSA 4XWTA 3W5UA 1WZIA 4Z4QA 1P17A 4D9IA 2VJOA 3ZYZA 4Y98A 2P2SA 1Y7TA 1E2UA 1ORHA 2ZSAA 5GQSA 5A9TA 3AJEA 3VVCA 2IIBA 4MEBA 4IUDS 2I91A 2AS0A 1KYVA 1B3RA 4B73A 4BBJA 2TMYA 2VHYA 1OSNA 3LUFA 5FBLB 1V3UA 1WABA 2QX9A 1OLXB 5FBWB 2JRLA 5I7UA 2FW9A 3Q4GA 2DBRA 3EFHA 3I5UA 3L7CA 2Y1CA 2VL7A 4LOJA 1JSLA 1Z74A 4LFBB 1KDZA 1IH8A 1RZ3A 3E70C 1B4DA 3KNZA 4J2OA 3AHHA 4DCPA 1NXOA 3BMOA 1EWRA 3D4OA 4B3JA 1N6HA 1J9GA 5LOVF 5I4IA 2JEOA 1JLKA 3E7XA 3IAS1 3W7VA 1QQ5A 1HE2A 5LJIA 4NCBA 1F2TA 4RQAA 5DNDA 3L77A 4I1SA 4MW2A 2BHTA 4DN6A 2ECKA 2K4MA 1D6SA 3CLRD 2QM8A 1EDDA 2IKSA 2EXXA 2NW6A 3B6MA 4OXKA 1JQEA 1T0PA 1TM7E 2GHQA 3FSRA 1PJCA 4INAA 1ZI6A 4ZT2A 2X6RA 1R00A 2EL9A 3K94A 1PT6A 1G5RA 1G7CA 2X8WA 421PA 2NO6A 2OOSA 1R18A 1RRKA 3N3AC 4ZEXA 4LJYA 4B3XA 1C1XA 1H6AA 3AYZB 4TXLA 3BSSA 4QYIA 5AW1A 4ZCRA 5B36A 5CLIA 4B6GA 1IXZA 1QTIA 2XPCA 4CN8A 2OVBA 1E5VA 2VUHB 4Q5IA 4JB3A 4B3BA 2AZTA 3KLBA 3N6VA 3HEMA 3QJGA 3T9CA 3TXYA 4EA6A 2O3RA 4Q3NA 2X9GA 2WF6A 1RD4A 3LZDA 3BX1A 4WZZA 3H3FA 3D3EA 4AY2A 3SHVA 4KQ2A 3BMQA 3F7MA 3UB3A 1XQWA 1A5AB 1QQ6A 2YFYA 2AB0A 5A7GA 3DMYA 3EZGA 4TSKA 3ZH2A 2QTMA 4YRLA 3NYRA 1POWA 1Z3CA 5DHSA 3THRA 4F8YA 4Z51A 4IFIA 3ROGA 1V5FA 4AY4A 2PQ2A 2ZAYA 3MD9A 4BLTA 3CJRA 1PCXA 2XUJA 2Z5VA 3HE3A 1C9MA 1YCFA 1ID1A 2H5IA 4DV0B 1R6XA 3DAFA 1Z25A 3DL4A 3Q7TA 3HA5A 4K5QA 1KI6A 2H2DA 2XEDA 4FE3A 4FDMA 2HUNA 2DHRA 3LGXA 4RLHA 3UG6A 3V8MA 1IHDA 1V9SA 3FPHA 5KTTA 3WNCA 2H51A 1NUUA 1QLJA 1XKXA 3DB2A 3B1JA 1E1QA 1RRMA 4PQFA 5DGCA 1OU4A 3FHOA 1F12A 1FXUA 2PGLA 3F7NA 2QLJA 3E22B 4LI0A 1KE2A 3DXYA 3VPCA 2O7NA 4ENTA 2QN3A 3PFNA 1NWCA 5DLYA 4M22A 1C1YA 1G4UR 5L3ZA 2GPJA 1ZMOA 3W2HA 1WLYA 4GR9A 4EW1A 1I3CA 3PGVA 2BGKA 1NL3A 1A8UA 1RQPA 3C48A 2P9YA 1Q14A 1VHJA 4R5HA 2W42A 1JSRA 2WIGA 1YS1X 2ZYWX 4LX8A 3WSWA 4PZ9A 1QH8A 1WXXA 3BWVA 4RK6A 5LUAA 5K3FA 1GFZA 2YINC 3PFWO 3SDZA 3DJYA 1L3IA 4CUZA 5K09A 4FQ8A 1TLLA 3AM4A 3AXTA 3P0FA 4WZAB 3OZIA 3ACDA 2DY1A 5M3BA 4OQNA 1Z6PA 4EA9A 1PYDA 1UKVY 2VDPB 2Z5GA 4Y6SA 3T1VA 4EW6A 4XVHA 4RDXA 1IEQA 2QM0A 4A6PA 5DCWA 3R9KA 1DJOA 4EKIA 2H11A 1A9QA 1IUKA 3EZ6A 3P27A 1VMKA 2WG1A 3M6VA 5JAZA 1U3VA 2YX1A 2VI5A 3CBQA 1NVFA 3LUGA 2PKQP 1RYMA 4J7AA 4UNNA 1SA0A 3UXHA 2W2PA 4RU1A 4Q9NA 2C5LA 3IUPA 5KCMA 3ZK8A 1VZ2A 2JLZA 4LIPD 1PTJA 5KWVA 3ZDDA 3QWIA 3D8SA 2O8CB 3IVRA 3DE5X 2PX4A 3PX3A 1QVRA 2BM9A 5KUTA 3DE3X 3FYCA 4FYIA 4DMLA 4UXIA 5DGXA 1V8OA 2FXVA 2XWQA 4MCAA 3PRKE 4V0KA 1Y1TA 4L0QA 1MIOB 3B2NA 3SM9A 4HLUC 1ICIA 4DQKA 2YXNA 5A62A 1T2VA 5EZYA 2PD3A 2VHJA 2VDWA 4HJXA 2YWHA 5DFAA 1BGXT 3HK2A 1GGFA 4BEBA 1BGVA 3X43A 4DMCA 3W1WA 4L85A 2P4HX 4L0DA 3HB1A 4M76B 5KX5F 5HR5A 3V7YA 3PGJA 1II0A 5DN6D 1GTG1 1QYWA 2FOIA 4UTXA 5FFMA 4CDRA 1EB8A 5DM2A 5ALQA 3TJMA 1F51E 3DNMA 4OGWA 2BGUA 1DX6A 1GDHA 4OIFA 2ZUDA 4DJFC 4F6RA 4EHLA 4BPBA 1QG6A 2F8SA 1G20E 4AUKA 4BN4A 1O94C 1ZOOA 3TRFA 5C52B 3ESAA 4MW0A 4X6XA 1KTVA 4LSWA 3O1JC 1ZOLA 1Z2PX 3RIYA 3WJ1A 4EAAA 1KNQA 2EWVA 5AJZA 1ZINA 4NU6A 1QIHA 1VYUA 3O8RA 2JGLA 3ROFA 2JBWA 4MS1B 1RAGA 3H83A 1EWKA 4ALJA 1DCTA 3VKHA 5HJ5A 3MJ4A 5GJVC 3O4FA 5FRDA 1KMNA 2B1QA 1MNQA 3C3DA 4GOXA 4L57A 3FPEA 4HFMA 3QLUC 1WPQA 5AM3A 3A1EA 5KTRA 1DJNA 2IXGA 5B12A 4BQNA 4IZIA 4R2JA 1E64A 1W36B 1L2TA 4IJVA 3G5AA 1VP9A 1W0JA 3R7FA 5ADHA 3NVKI 3NIGB 3WBFA 4D3FA 1PWEA 3HCAA 1MLDA 5CURA 1ZC3A 3UJCA 3J81k 2CFTA 3RRZA 4V0SA 3UGKA 2I62A 4XEHA 1U02A 1HDZA 3BEOA 4CM4B 1EVEA 2YHIA 3O2JA 2AR7A 4S2EA 2B5OA 2ZI9A 3TBFA 1A98A 3EXFA 1W2HA 4GMGA 1G3QA 1O96B 4NYJR 3DMPA 2HWUA 1Z15A 2W70A 3WB2A 4GPZA 5JVDF 4GOJA 4JBHA 4L22A 1BTOA 5EY5B 1QV7A 3HJCA 2F1HA 4QQFA 5C46F 4CLHA 3A9WA 3LRXA 1CUGA 2MT9A 4REOA 4YRMA 1MA3A 4BZWA 3I12A 3W3AA 4HUQA 1KAGA 3L9XA 5H16A 1ORTA 1UMCB 4KR6A 1X86B 3V1NA 2X6TA 1TD9A 1IIRA 2P0EA 3PUIA 4PQEA 1JG3A 3CVXA 1KNXA 3QVGA 4R68A 1KEEA 4X84A 1ZM9A 2OBBA 1DOAA 4RVCA 3UEOA 4WINA 1PSDA 1Q0QA 3SOZA 5L3QB 2ZR8A 4U5QA 3BMCB 5AJXA 4YRJA 1GDTA 3CRW1 3PPVA 1GNTA 4PG8A 2M2IA 3CVUA 4KGDA 1TC2A 2FY8A 1GQRA 2DOKA 2FG6C 1OX4A 2CB9A 3CE6A 2YVQA 3JAWB 5FB3A 2FJPA 3C16C 3QPUA 2B2XA 2V7EA 5IDXA 2ETVA 3IAS6 2ZB7A 3DLPX 3A1VA 5D00A 3DQZA 3W79A 4AKTA 1JLLB 1WM1A 2O2HA 3LXMA 3NB0A 4L4YA 2C84A 2GPSA 2HQ1A 1Z5VA 3E48A 2IX3A 3MCAA 1IPEA 3KR0A 3RRNA 5KWSA 3SICE 3LUHA 5CAEB 3FHCB 2HNKA 4U2FA 2W9XA 2JFYA 1XDZA 2NT4A 2B99A 2Q1SA 3ZC3A 1QJ4A 1Q7EA 2Y9MB 4FTWA 3SR3A 1ZVVA 3DL7A 1PS9A 4NMMA 1FDSA 3DNPA 1DG3A 4KAXA 4DKJA 1JWBB 1KMCA 3WGUA 1WKBA 3V7NA 3QSYA 3LXXA 3OCYA 5CYOA 2R1UA 4JB2A 3H11A 3M4YA 5AM4A 3HYNA 4A0GA 2WAXA 5F9FA 5A9RA 5J43A 2IS4A 3RVKA 4NS1A 5BSGA 1Y5RA 4LJ7A 4TQGA 3K7EA 4FZRA 3N76A 2DPHA 2FQ1A 3LC7O 3ZS9A 2X5XA 3S5UA 4FK8A 3VTAA 2Y2UA 1JMVA 1U94A 1UCFA 3KHSA 3RM3A 2Y0BA 3T3MB 1W7AA 3L7YA 4AJOA 2CVZA 1EEHA 4PWYA 3FPLA 3G6WA 2ODWA 5AJHA 3QKUA 3G13A 2FZCA 2BFBA 4AXXA 2CFCA 2XMDA 2VHCA 1LBHA 1QH9A 4GP7A 1JQAA 3ZLJA 1G63A 2PX2A 3FYTA 4DDHA 4A03A 4MTLA 5F76A 3T7TA 1UBNA 1XTVA 3D3JA 3AZOA 5IN4A 2BE9A 3LDFA 4IXMA 4W6ZA 1RKVA 5HBGA 3EVTA 4L9RA 1HQYE 2A6PA 4FSXA 3CZMA 4XSGA 4A8JA 3P9QA 3KLNA 3SHOA 4CL3A 2KMLA 1DT3A 2H1RA 3EVZA 3S2YA 4YMLA 3PNQA 4LF9B 1K89A 1U3FA 5TIIA 1SKQA 4NU5A 2QHXA 1TCAA 4RVGA 4UHFA 1FUKA 4LXQA 3MMSA 5EG5A 1U7TA 3SZRA 1LC0A 5PNTA 3NHKA 1YL6A 1KYQA 1YVUA 4QULA 2A3RA 3GRAA 4R6WA 1ZD3A 3K0FA 4LRTB 2TECE 2QXUA 2V7BA 2VPXA 3UMCA 1Q3KA 1BQ4A 1G3UA 2H3HA 2BMFA 3AERA 3DPSA 2NYAA 3EGDA 3HUEA 4QOJA 4EKGA 5JJKA 3E0QA 4DT1A 3LUDA 4JKIA 2X9LA 3FFWA 1AGPA 1VBFA 5DT2A 5G0VA 5CVCA 2Q21A 2AEJA 7ADHA 4YWJA 3VZRA 5IAGA 1OT5A 2LKCA 3IQFA 4IJWA 3FRJA 2PMEA 4ENSA 2O20A 1AZTA 1O6BA 3G0GA 2W2TA 3FVVA 3NJ4A 3D6JA 3T3GA 3BAZA 4FMBB 1XRSB 1NMSA 3EMVA 2V6GA 4Z2YA 4WECA 3BOSA 3W06A 1UC4B 1Z22A 1NMQA 5ECYA 2A5JA 3AKEA 3B5IA 1P33A 1Z88A 2V0NA 2XNHA 1MC8A 3UANA 5FA5A 1ESDA 4BDTA 4OGKA 2IBSA 4ZCLA 1TXGA 2PKYX 4HN2A 4WACA 3SHWA 3E2MA 1BD3A 3L1JA 2Q4DA 4Y2YA 3SBOA 4B3HA 3K0SA 3KELA 2PH5A 1KEVA 1UBKS 3E2PA 5EP2A 3MT0A 4C05A 4XW2A 3FOZA 2X5OA 1MTZA 4AAYA 1PUIA 3I5MA 3OFVA 2OZLB 3IJ5A 4B4VA 2QLLA 3FLEA 3C1UA 2E9SA 4YX9A 3HXOA 3BQ9A 4BCCA 3DZBA 1IK6A 1QZXA 2ZJ0A 1FYDA 4IV5A 3JD2A 3NAQA 5BOSB 2XDAA 1FP4A 1P9LA 2VZLA 2W4MA 5CR9A 1WRBA 1DWUA 5B53A 1BHSA 4P7GA 4J07A 3RSCA 5HHTA 3GEMA 1ZD8A 1TCVA 1DQSA 2XLBA 4RNDB 1ONBA 1Y4UA 2NNLD 3V5NA 1PR4A 2PLWA 3MYRA 3M6UA 3WMFA 1RT9A 3BKWA 4RDHA 1P75A 5B55A 1CUUA 2X2EA 4HGOA 3U7QB 3WDKA 3HY6A 3B8HA 2JCGA 5CDUA 3SBEA 4DLXA 4JVSB 3N2KB 3P32A 2GASA 2XUGA 1UPXA 2FW6A 1LCIA 2TSYB 4J1NA 3W7AA 2NACA 2ECFA 2I6XA 2GM3A 2B8EA 1JKFA 1TK2A 4I1IA 4W8OA 3A6JA 3CLSC 3W78A 4M21A 4C01A 1JEYB 2H0QA 2LXNA 1QBGA 1Z9BA 4XD7A 3N86A 1FFGA 5A6SB 3H18A 1EXWA 3C41J 4BZPA 5L45A 5H59A 3FTFA 8OHMA 3QYJA 1JHVA 3ZX4A 5CA0A 2ONKA 2OM2A 1N5RA 4OFWA 1P62B 1IDOA 2XNKA 4OUDA 3RUEA 2ZVQX 2YC4C 5CYGA 1ECGA 1H3NA 1Q20A 4MS3A 5M7EA 4MQBA 3REOA 3NBKA 3G0CA 4IWYA 4BLUA 4CE6A 3R7DA 1PFWA 4M0LA 4UD2A 3DMHA 3GFRA 1DS6A 2QI9C 3U26A 1CY4A 4MVXA 4IO0A 1RQGA 1F17A 2DPYA 3BXPA 1JLSA 3KKLA 3E3AA 4U7PB 2ZM5A 4G36A 2CXRA 3SI7A 1PV2A 5GONA 1F2TB 4PC1A 2ZR7A 1NOKA 1FK8A 4O2AF 1EFRD 3DCYA 4RIHA 4ZVVA 3ZBQA 4US2R 4FFRA 2NO1A 2D1RA 1Q17A 3ZDRA 1LPNA 3E3LA 2A7XA 2IHUA 2FW0A 3IDAA 1FOEB 5SV2A 4E4RA 4Q7QA 1ZMXA 4BNTA 4QUEA 4WLFA 4JLWA 4IQFA 1YJ5A 2BEVA 1CRQA 4JLKA 4BO3A 1C1XB 4RYLA 4AJIA 1I1HA 1YL5A 3PDCA 4QYIB 5CFLA 4JOQA 1B7GO 1QGOA 5DXFA 5MF6A 4CMCA 3ABRB 2JIZD 3NDPA 4HDSA 1QCZA 3JYLA 4GOND 5ERXA 4O08A 1FNBA 2D5CA 2GPYA 5JG7A 2V54A 1IQ0A 3LU1A 4FW9A 3WYAA 4BO7A 5I9IA 1CSEE 5JHHB 2GD2A 1FU4A 2BY4A 5IW8A 3UK0A 4XRGA 1F2UB 4OHFA 3A9CA 4DEXA 4LQ4A 4B31A 2P9EA 3ROMA 3EY4A 1BA2A 3G2NA 2XBUA 4OJYA 4WMLA 1NSFA 4GZ6A 1Y3HA 5BQ5A 5A3SA 3TNJA 3V7WA 4QWMA 5DI9A 3GVXA 4OPMA 3DMNA 3KOXA 3G3EA 3A2KA 5BV0A 2YJGA 3TZKA 5JCZA 3CNBA 1N7IA 1DPFA 3GLKA 1G3RA 4DWOA 2V9CA 4ZHQB 3STWA 3GJ8A 4AF7A 2I55A 4HAOA 2AQIA 2FPXA 4C4YA 2VF7A 3MELA 1GKYA 1X15A 4B0PA 2I4NA 2HR1A 1CNFA 5KNDH 1GVHA 2QPLA 3CR7A 2ODPA 2C5FA 2W6IA 2NZJA 4Z0TA 5H5JA 4EOGA 4YCCA 1EUCA 4RKRA 4CTKA 1N33B 2DHQA 3MTEA 7ABPA 3PQ6A 3UHFA 3EQ7A 1DU4A 4BO9A 4CMBA 2D5BA 2BONA 1TJNA 3C7DB 4HLQB 4JVMA 1K6EA 4GXQA 2G08A 3D31A 2CD9A 3HM2A 5BV2P 1SQ5A 4CDGA 4K0KB 1SUWA 2J7PA 3T41A 4X93A 4F2DA 3LTNC 1H4VB 4MPDA 2NQTA 5DM0A 1YA8A 3W2EA 2VWHA 3TBHA 4XUDA 3WLPA 4D6YA 4DWWA 4JV5B 1V11A 5TR9A 2GWRA 4JKOA 1Z4MA 3QXSA 2LW7A 1N7GA 1VIAA 3TLKA 4YT2A 5D3MB 2OSVA 4NEHB 4DHEA 4N5IX 3HABA 4DUPA 4D8UA 4QPNA 5K0CA 3V1YA 1DIAA 2QUBA 2QVZX 4WCFA 2OPHA 2HEGA 5U4XA 1CJCA 1M73E 1VG9B 3GA5A 1B23P 3WB1A 3TD9A 1BC5A 4XEUA 5KDOA 1Q5PA 2PL9A 5KYXB 1A76A 1SA0B 2AZ4A 3KFLA 4WKPA 4YQEA 2R66A 1WTCA 1XHEA 4CR8A 2KI5A 2OOKA 4C2UA 3EMDA 5K3OA 4TRJA 3BE4A 3I1YA 3LM8A 4M46A 5JARA 3AVYA 4XDYA 2E2WA 1RTKA 1L5VA 2FZWA 1DL5A 5ITZB 1JDVA 4US1R 1GILA 2QY9A 1Y1SA 3GMDA 2XR1A 3ZE8A 5IWCA 2A86A 5M5BA 1U8CB 3NKFA 3TLJA 1E2PA 3WYFA 4A3SA 1OT3A 4WKOA 3TIXB 5EZYB 3GLIA 3O9MA 3HLYA 3U3JA 5JMTA 1BYUA 2VDWB 4DV3B 2D06A 2H7YA 4JT2A 4U2CA 3ONDA 4IIXA 4A2PA 4QYWA 4UCWA 5SY9A 1K08A 5AHWA 5FTJA 2IZ0A 3S8YA 1F0NA 2OCYC 5EIFA 1ZP6A 2AJLI 2NPFA 3RVRA 2TYSB 4ZIRA 1HC7A 3LCJA 1THMA 4DIDA 4J16A 4M8SA 1HBJA 3GLSA 3L1HA 1RQ2A 2B34A 1J22A 1Z8FA 2AH5A 3WGJA 2JFNA 4AS3A 4EO4A 2W6NA 3K70B 3TTVA 2JGJA 1L4EA 1NATA 5KWJA 3L7OA 1Y37A 1OXBB 2QX4A 3L8DA 5FWYB 4P0QB 2P69A 2ZPAA 4RVOA 2PEZA 3FCSB 3FMIA 1Q1NA 1RJFA 4KGXA 4NLLA 4UVHA 3VZQA 4ZYYA 1XJCA 4OMFG 1HOTA 1LSOA 1ZM3A 1FDUA 2IYEA 4YB8A 3VO9A 3UPUA 4OSOA 1QIKA 3ZV4A 5AVQA 3LL4A 4K2AA 5FBKA 4NL4H 1T5OA 2R1VB 1YQXA 1Z3IX 4OB6A 4QDJA 3WA6A 4P7FA 2Z0MA 1OHHA 3NBXX 4IW3B 2HWYA 3AVPA 4KXNA 3HCRA 1TKAA 4KZKA 3S2GA 2QS9A 4BXOB 1BU8A 2WT4A 1N5LA 1YGYA 4N65A 5I4BA 3GA0A 1DUIA 3FGPA 1EM6A 1VKJA 3HCOA 1JFTA 1U2QA 1YUBA 2WAAA 1XNRB 4HYYA 4PNHA 3LUBA 1PVDA 2W00A 1Z4OA 1CDZA 4C0JA 3GCDA 3HCDA 1ELOA 4LZAA 1DOZA 4NZ9A 3EXFB 2B9EA 3A11A 4MPRA 4RLQA 2IV2X 3UAZA 4AP9A 1A1VA 3HU1A 2P67A 3LT1A 4G81A 2F3UA 1EWQA 4RPKA 4XASA 2FSVA 3UCFA 1IC6A 3H2BA 4NYMR 1FVXA 1XA0A 1RWWA 2O7VA 3IPXA 4OQDA 1MG0A 4EPRA 1RKBA 2HU5A 4QSHA 4W9NC 4H7PA 4HAYA 4R41A 4BLWA 3C8MA 2QD5A 4JY7A 3WO0A 2VJNA 4Z3KA 5LNK6 2OHFA 2R8YA 2WZBA 3N5CA 3LWZA 3I42A 3QVGB 2IXEA 4L9WA 2O7QA 1JFRA 2XKKA 3OHSX 4X6YA 2BSAA 4BP8A 1BYIA 5JJLA 1AKQA 1PL7A 1D4ZA 2OLEA 3NC1C 4HNVA 2BKEA 2H08A 1UANA 1FFYA 1P5JA 2XVZA 4DXAA 4EG5A 3RVDA 4KGZA 3RFCA 1RW4A 2EFGA 3HKEA 4ZOBA 5CB4F 2X7HA 2RGNA 5ESWA 4YXWA 4H15A 2A9OA 1D6NA 1X0XA 3KP1A 4QVKA 3S2FA 3IOMA 2FSHA 5JSHA 2ON6A 3GQBA 2Z43A 3AF4A 3SEAA 3U56A 1YR7A 4MAMA 3FRIA 4NZMA 4PIPA 4A8PA 3U0VA 3R6DA 2O5RA 1QLHA 1J0DA 2FETA 3CJTA 1BKSB 4JWKA 4M1WA 1M1YA 4RWEA 1DQNA </