4C0QC

Transportin 3 in complex with ran(q69l)gtp
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
169
structure length
169
Chain Sequence
VQFKLVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGPIKFNVWDTAGLEKFGGLRDGYYIQAQCAIIMFDVTSRVTYKNVPNWHRDLVRVCENIPIVLCGNKVDIKDRKVKAKSIVFHRKKNLQYYDISAKSNYNFEKPFLWLARKLIGDPNLEFV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for Nuclear Import of Splicing Factors by Human Transportin 3.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein/gtp-binding protein
molecule keywords TRANSPORTIN-3
total genus 45
structure length 169
sequence length 169
chains with identical sequence D
ec nomenclature
pdb deposition date 2013-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4c0qC00
3A1SA 3HWSA 2ZRCA 3BIFA 1UFQA 4JT4A 1XU4A 2BEJA 5F98A 3TK1A 2Z5FA 3K70C 4FMDB 3ZS9A 1E94E 1NN5A 4XH9B 2V1UA 3B9QA 2FGJA 5K8TA 1M8PA 2A5JA 3SHWA 4RD1A 2AWNA 3ZZ0A 2IS6A 2AX4A 1YR7A 2GKSA 3KKMA 3RABA 1DAIA 2J41A 5LPNA 3TAHA 5DN6A 2FSFA 2IYWA 2ZYTX 4RVCA 2QNRA 1OFUX 2B21A 4LUCA 5TDHA 2EYUA 2ANCA 2O0KA 1N6PA 4PQRA 5GJBA 2OFXA 4OQLA 1W2HA 3GJ6A 4LOAA 4GSYA 2H57A 4XVRA 4DLZA 4JLNA 3EIHA 1HH4A 1U94A 3AKYA 4M8NE 3UG6A 1P9RA 1SXJE 3GJ7A 2O8CA 1LVGA 5G3ZA 3CWQA 1S96A 4ZIRA 2GESA 3IKJA 3MWJA 2WIAA 3B1XA 3AVOA 1QHHA 2JLQA 2HCBA 5J47A 4TLDA 3NDBB 2ZVPX 2OUKA 1A1VA 1Z06A 4MGYR 2ZJ5A 1PUJA 1S8FA 2ZU6A 3P27A 3NTUA 5C4GB 1WDTA 3GJ8A 1OIXA 1Y3AA 3EPJA 2J0VA 4URUR 4Z8XA 1OT3A 1G18A 2CHGA 1II8A 3K70B 1LV7A 5CB6A 5C46F 2IK8A 1CRQA 1XEXA 1E32A 4PO9A 4RFSA 4UNRA 1P2SA 1YJ5A 1FPMA 2BV3A 5JI2E 3NWJA 3KTAA 1NKTA 2F1JA 4OHVA 4D26A 1T91A 4LBYA 4L16A 4DLSA 2XB4A 1OV4A 4IVRA 2GEVA 4BLOA 4YONB 1SZPA 4B2IA 3LVRE 2BMJA 3BJIC 2XTZA 1UBCA 5JECA 3K09A 3CRQA 1OIVA 4D0GA 1E0AA 4D25A 3U2QA 4EIWA 1FP7A 4P4SB 3DZDA 2BVNA 4QNMA 4OJKA 4RCZA 2FZ4A 1S3GA 3FTQA 5TY0A 2VP2A 1GNPA 1UKEA 3AKCA 2P2LA 2X8AA 5HZKA 3QXHA 2VF8A 3GLHB 1OSNA 4MUBA 3ZZUA 2YWFA 3SE0A 4LHWA 4PAQA 2TMKA 3EC2A 5FBLB 1IY2A 3CBQA 3EZ6A 3GCGA 4NYMR 2P6NA 2XAUA 3TQCA 4TWZA 4KAXA 1GNQA 1SXJA 3KXIA 1X8KA 4UJ5A 3PVSA 5FPSA 3DDCA 5LB2A 4QBHA 3UMFA 5CJPA 3WYAA 3QY0A 2C04A 2RAPA 3NBYC 1FNMA 2FSIA 2GCNA 4ZCMA 1CF4A 3SQXA 4A92A 1OYYA 2DYKA 2ZJBA 4CRWB 1ESMA 3K0AA 1VG8A 1R4AA 3I3SR 4MGKR 2OFWA 3RS0A 2ZUBA 5AJYA 4JLDA 3VMFA 2RMKA 1IONA 4EDHA 3EXAA 3U5ZB 1AIPA 1XP8A 1T0HB 1XTKA 2Z4SA 3V00A 3WHKA 3N70A 1W4AA 2RGDA 3L82B 5KNBA 3I5XA 4ACBA 1NJFA 2XITA 1KI2A 2GA8A 3K9NA 4GMDA 3LD9A 2QT0A 3SR0A 2J0UB 4GZLA 3W8NA 5FI0B 2E9SA 3FKSD 3ZVMA 2QMUA 3VR2A 2R62A 4Q21A 2F1RA 1ZU4A 3GLHE 5KNCA 2NPFA 4DLUA 4TSFD 3T06B 1VMAA 3QVUA 2ORWA 1EFHA 3O8BA 4FW9A 3WYGA 2CMKA 4B3DA 3MSXA 1E99A 1UEIA 4X8MA 3SYKA 2WIBA 4V02A 5B64A 1UEJA 1QBKC 2OG2A 2C9OA 1GNRA 1XEWX 1RE0A 2VL7A 2CNWD 2ZRLA 1JBKA 1XCPA 3RWMB 1SXJD 2JGNA 3HDTA 3GJ0A 1KHTA 1P75A 1EFTA 4EKDA 4HB2A 4AG5A 3KDSE 2YZ2A 1PLLA 4Q01A 3IEVA 5FL3A 1OHHA 3B9PA 1HT1E 1DG1G 1I4LD 4PQYA 1KOFA 4IDHA 3TE6A 4B34A 4JL8A 2H92A 4Q1CA 4FMBB 1MABB 3EARA 2XZOA 4RKFA 1KDTA 2FPLA 1DAEA 4JS0A 4HSEA 3C5HA 3FVQA 1KI6B 2EWVA 1XEXB 1L2TA 1TMKA 1KAOA 2W2VA 4ON9A 1CBUA 4RZUA 5EUMA 4FMDF 1N6HA 4HB4A 2XZLA 4JLBA 3WY9A 5J4KA 4PZLA 2IYZA 4Q9HA 4ARZB 3FMFA 4EPWA 3PEYA 3B6EA 1RPZA 1WBDA 4QBIA 5KSPA 4YMSA 3IUYA 1Z5ZA 3VR5A 1UJ2A 3D31A 4B3XA 4WVFA 1ZNZA 4QRHA 5L8VA 4A0RA 2XX3A 1M7BA 4JL6A 4KXFB 3SNHA 3D6TB 3V4RA 3BGWA 5TB5A 3SBEA 2IWRA 3K70D 1G16A 4RJLA 3AB3A 1TEVA 1IN5A 1FTSA 4LBVA 1TF7A 2QZ4A 1T6NA 2NZJA 4KBFA 1P62B 3KKQA 1R2QA 4AIIA 3GLHA 3FHTA 1UADA 1UPTA 3M1IA 1PV4A 5JMTA 2ZSFA 4PSAA 2JJ1D 1UF9A 4LV6A 3CM0A 3QPWA 5K8LA 1OF1A 1EWQA 2IYQA 5FOWA 3SC3A 4CEHA 4DKXA 2JASA 5CYPA 3FMPB 2IYYA 5J4LA 2OM2A 3NC0C 5JSZA 2O8BA 2MMGA 3PFIA 4XTRA 2PZEA 1LTQA 3CUEF 4B3FX 3CPEA 2MSCB 2JLXA 2ZJZA 1HURA 1XJQA 3BFVA 4HUTA 4W5JA 3W5IA 2OAP1 1W0JD 5G41A 5AR1A 5GADl 4B74A 1XEWY 2H17A 2NO0A 4DT1B 5AUNB 2FNAA 2JCSA 3GLIB 5JS7A 1XWIA 2D06A 4WBSA 3GPLA 1IY0A 3LDAA 4PFSA 1L8QA 3R9XA 2B6HA 2FFQA 3VNUA 3PUYA 2WVJA 4FI3C 2AK2A 4JSYA 3AM1A 2ZUCA 5L3RA 3A8TA 5JJLA 3VTKA 1CULC 4Q1FA 2EFCB 2PZFA 4K46A 3SJCA 2OXCA 3D3QA 2NZ8A 3DL0A 1TAGA 3PV0A 4PC3A 4V0OA 3SFVA 2IF0A 4DUGA 3K09C 1W2GA 1N5IA 3EZ7A 5L3VA 3AVVA 2XNDA 2OE2A 1IN6A 3IQXA 4UJ3A 1IM2A 4EPYA 2ZETA 3CNNA 2ZIAA 1KTVA 2H16A 4D6PA 1RVDA 1CS4C 2IHYA 2ANBA 3L0PA 2IYXA 1E2LA 2YYZA 3LXXA 1DADA 4LJ7A 4Z1MD 4HLCA 4TL8A 1WXQA 1XPRA 2KWIA 3ONWA 1E2HA 2GDJA 2JJ2A 2PT5A 2VQSA 3GJ5A 3U7EB 2QL6A 4KSBA 1XB2A 4DSNA 3TW8B 4IEEA 1ZUIA 1D5CA 4F38A 3T34A 1E2QA 4D4MA 2FWRA 4RFVA 4RD6A 1E9AA 4LPKA 3NKVA 4NL4H 3SDZA 4DSUA 4Q1BA 2CL7X 1SVKA 3E2IA 4PTLA 1OFIA 2C8VA 3QKSB 3AF3A 1DOAA 2J0UA 4B32A 3I1FA 4CVNA 1CEEA 4KVAA 2CJWB 3ADKA 2ZVQX 1E2KA 1WQ1R 4DLTA 2JATA 4GFDA 3VU9B 1ZIPA 1RFLA 2IW3A 4KFTA 2ONJA 1FQJA 2VSXA 4C0HA 2CVFA 3I62A 1OJLA 4LRWA 1J2JA 2BM0A 5C18A 2O0HA 4GOKA 4IOMA 2G77B 4B3BA 3UK6A 3W5JA 3WRYC 2QMEA 3SOPA 1ZD8A 4DIEA 2DB3A 4IOLA 4DDWA 4TYWA 1CP2A 3DO6A 1YZKA 3LXRA 1VCIA 4OQMA 5H8WA 2VSFA 4MQBA 1GDDA 2ZRNA 4JJZA 5F3WB 1ZU5A 1S9HA 2ODNA 1OH8A 1Q1EA 4DSTA 4M9XA 5JHHB 4AWXA 1EXMA 3ZVLA 4IDQA 1KDPA 1TX4B 3KUDA 1E2IA 2ODEA 2XZPA 1DEKA 2KB0A 3ZIAA 2PL3A 4EPXA 4Y0AA 1JAHA 2YVUA 3GD7A 4I1UA 4IEIA 1KO5A 1E1RA 4RZ3A 2R9VA 3LW7A 1LF5A 4NH0A 3VKHA 4GI7A 1KZGB 2J46A 1XEFA 1OB2A 1TF2A 4U00A 3H2YA 4EJSB 4ACAA 1FMJA 1PLKA 2ODWA 3DKVA 4WAUA 4IVQA 4MRPA 1YRBA 3PXGA 4BFSA 4B76A 1Z47A 2FG5A 4IHQA 2R8RA 5JWHA 1NLYA 3HU3A 1G4UR 3O47A 1E69A 4KYIB 2IS4A 1Z29A 1E9CA 2YNMA 1G3RA 2ZM5A 4B71A 3THYB 2A30A 2YHSA 2WKPA 2NIPA 2C03A 2QSYA 3KFXA 4CW7A 1UM8A 1N3BA 4LX0A 1NLZA 2OHFA 1OFHA 4WXRA 2NO6A 521PA 4AYXA 2Z43A 2PEZA 4W7SA 4WXPA 3DM9B 1W48A 2FFAA 3CF2A 3MRSA 1TPZA 4MRVA 5EXSA 3OF5A 5H70A 4ZKEA 5EJEA 3R20A 4LBZA 5EP1A 5HKKD 4OK3A 3RRNA 4YXWA 1RKBA 1XNJA 4KITB 1E3MA 4QL3A 2ZRJA 4MKGA 4W5HA 1W36D 2H18A 5JFGA 2GNOA 4P3YA 3GLFE 2YWHA 3OHMA 3ZQJA 2NG1A 1KYIA 3LVQE 2AD1A 4W9MC 3TUIC 4FWTA 5DYIA 5CDFE 1AA9A 1Z3IX 1U9IC 5DI3B 4ILEA 4A2PA 1OLOA 1E0JA 1RW4A 1CJMA 1XMJA 4HYYA 3W90A 4URYR 4I81A 2QA5A 4O0MA 3DMNA 3KTAB 2EQBA 5D3QA 2LKDA 2F1HA 4Q9KA 2A5GA 4ZDWA 1G7TA 2BBTA 2YC2C 1KSJA 1IXZA 4YDSA 1S4QA 3BB4A 5AUOB 1VHLA 1R10A 3DM5A 2GVZC 3GEHA 1B23P 2XXAA 1KK3A 4Q02A 1G3MA 3EPLA 2IEZA 3GJXC 3LAWA 2JIZA 3LX5A 2ZROA 3WP1B 2WWWA 1ZNXA 1ZM7A 1X6VA 2KBFA 3EZ9A 2VH5R 3NBZC 4JSTA 4MYTA 1LB1B 3G82C 2R6FA 2AK3A 4BEBA 1P6XA 3UG7A 5GJCA 1DELA 4I4LA 3O8DA 4JKIA 4E22A 4AG6A 4L4UA 1LFDB 2AHOA 6Q21A 2WJIA 1FTNA 2QAGA 2REXB 721PA 4X8OA 4CEJB 5AJXA 3GLGE 1M2OB 4M22A 2A3RA 3AF4A 3ND9A 5HKKA 3QI2A 1QG2A 2AKYA 5IDVA 1COWD 2QQEA 4LY6A 1A7JA 1UDWA 2WJHA 4E5UA 2W83A 2BBOA 5HPYB 1GITA 5JRJA 3EZFA 4TL6A 1Z6GA 1GM5A 1RYHA 4RD4A 4Q1DA 3DHWC 4A2QA 5KDOA 3EWSA 3TSWA 2ZPTX 3MG9A 2WKRA 3BOSA 1DAFA 1T5LA 4G5OA 2C99A 2P65A 1J70A 1G17A 4GT1A 3FGNA 4QXAA 3MAAC 2VP4A 4P31A 4CGZA 2OAQ1 3QG5A 2ZYVX 5L3QB 3LW8A 3C41J 3THWB 4A6PA 2W00A 2QSZA 4TMKA 1VDZA 4V0LA 2JIZD 1O87A 4LC1A 1WB9A 5FH9A 4IFEA 2HEIA 4MH0R 3QENA 2KE5A 4M0LA 4JL5A 1ZD1A 2DFLA 1UBFA 4BWYA 2VHCA 4BECA 2J7KA 3A36A 5FPYA 2IYLD 4M53A 3GLGB 2VP6A 1G3IA 1YQTA 4MKHA 2O8DA 1E2JA 2J7PA 2W6JD 5EXXA 1AJEA 1XMVA 4MKFA 3FOZA 1U8ZA 4YMUA 3THYA 5FPTA 3RNLA 1SULA 4HZIA 2OFOA 5BXQC 1E0SA 1CLUA 4A8JB 1ZBDA 4Q1AA 1IHUA 1XXHB 1JJVA 4C9BA 1E6CA 1G5PA 2OBNA 3PUWA 2HF9A 4B73A 5KOYA 4CEJA 4JZKA 3H86A 3ECCA 1AS3A 3VQTA 3HR8A 3DMDA 5KO2A 4GMXA 3X2SA 4NKRA 2AXNA 2BDTA 3AF2A 2ZSBA 3U7HB 1N6KA 1U0JA 1RRCA 1D2MA 3W3AA 1ZC4A 4GPTA 3SYNA 2DFNA 1P2VA 4TMZA 2FJUA 3BH7A 3FB4A 2BBWA 3OIWA 3QQ5A 4TYQA 3EW9A 3LBNA 3TSOA 2JA1A 4YMVA 4Z8YA 1I2MA 2G1JA 3M4YA 4HZUA 4I1VA 1QHNA 3ZZTA 2WJVA 3GLIA 2R6DA 2X19A 1XRJA 2A9KA 4PPFA 1MKYA 2WICA 2O8FA 3BC1A 2FV8A 3HR7A 4Q9LA 3T5DA 2DWPA 1X8JA 2VRWA 4R98A 4BLSA 2D62A 3L43A 4LYFA 5HTKA 2IEYA 2VO1A 2ZEJA 3HYTA 2FX3A 5FBWB 1GKUB 1E9BA 1SVLA 1VKJA 2RHMA 5DO9A 3U3RA 1CJKC 4IW3B 2QRZA 3A1WA 2QBYA 4ESVA 2Z83A 4KBGA 4TQUS 2DPXA 4XOIA 2G1KA 3P4XA 4IVPA 1DG3A 1LY1A 1E4VA 1Q1QA 2CHVA 3H0KA 3R7WA 3R9WA 2PJRA 4D80A 5GJVC 4QHYA 2BKUA 5KYKA 1JPNA 2ZUDA 3JVUA 3AVYA 3E1SA 3PEUA 4WZBE 1SHZA 3TBKA 1GRNA 3IILA 1ZAKA 2QP9X 4LC0A 1VG1A 2F3RA 3GEEA 4JMPA 4NE2A 3E70C 5EXTA 2VTKA 3FYHA 3K0CA 3PITA 3BK7A 1DAHA 1CJVC 1EGAA 4CT4B 3BE4A 2FSHA 3KKPA 5A5GA 1E9DA 3JVVA 3NBXX 5FBQB 4B48A 1W5TA 3NEJA 1N5LA 3QUSA 4P4SA 5LB4A 2G3YA 2AXPA 3UIEA 2ZRIA 2RGEA 4DJTA 2B8WA 2NOAA 1G21E 4H1VA 1TF5A 5C4MA 4PX9A 4C0SA 1HY3A 2ZE6A 1XPUA 1ZINA 2ZRKA 3LX8A 4L15A 3R7WB 3NH6A 1NMXA 1SVIA 3WMFA 2GBLC 1JR3E 1KKMA 1TQ6A 2QQ0A 3RS5A 4LJYA 1G64A 5B30A 4DCTA 2PCJA 1F2TB 3UWKA 3C7KA 2C9CA 5J4YA 3BRWD 3SJBA 1VHTA 3B1VA 4XTCS 1GOTA 5KPDA 3FDIA 2WPDA 3FFAA 3SU8A 1BMFD 2OZEA 4QBFA 2WWYA 4Q5IA 1Z2AA 2RGNC 2N42A 1PJRA 2C78A 3GQBA 3O8RA 5JJKA 4V0NA 4HB0A 4TQAA 1TU4A 1W0JA 2KJQA 5TARA 3SJAA 3MJHA 2KSQA 4H1UA 3KQNA 1QHSA 3L0OA 1GZSA 3CIOA 3KUCA 1N6IA 3QPVA 3W34A 5JWOA 2PH1A 4UKDA 3PUVA 4HAZA 1NVVQ 4X8HA 1OYWA 1W0KA 3F8TA 2ZJ2A 4LSGA 5B58C 3A37A 4L9WA 3UWOA 2ATVA 4A0GA 2Q6TA 4OBEA 3EIEA 2WSSA 2ZANA 1NVUQ 4F4CA 2HDNB 3U7FB 2V7QA 1T3HA 4OJQA 2WSMA 1XFAA 3CF6R 2A5FA 1G291 3HU2A 1U98A 1P2TA 1TL7C 2O5VA 2VP0A 3OAAA 3OEHD 3GLFB 3QKUA 3KQKA 2AR7A 1Q20A 4IOJA 3WMGA 4D82A 1GRRA 2HJGA 3MFYA 1RRFA 1US8B 1XMIA 3EG5A 5EXPA 4WZAE 4ITRC 3U3OA 1MT0A 2QEQA 1CR2A 4EQ6B 1S0UA 2X2FA 1W5SA 1E9EA 2ZE8A 3AF1A 4DXAA 3CZPA 3W6NA 1KO4A 4URWR 2E1RA 4LWZA 1HE1C 1IJEA 1GKYA 2GZHA 2DFKB 2R6GA 3BFXA 4IJMA 4PZYA 5CK4A 3REFA 5CB8A 3U4QB 1W36B 4NONA 1P9WA 2ORIA 2XJ9A 3RWOA 2DBYA 3LV8A 2BIFA 1D8TA 3OESA 2V1XA 3LQRA 1R8QA 4TMTA 1SXJC 4UNPA 2VBCA 5E7IA 1XD8A 3QXJA 4F92B 4GOJA 2GILA 4DBLC 1G5TA 1GUAA 1NN1A 1OE0A 1D9XA 2HYDA 4JLMA 1G8FA 3VX4A 4C0BA 1JR3A 5GVSA 2GXAA 5KU1A 2BWJA 3P1JA 4JLAA 4QNRA 1AKEA 2GJ8A 1TEXA 2WSSD 3MMPA 2OXRA 3B60A 4M9SA 4DCNA 4N0DA 4YDHB 1JXOA 5FFMA 3OAAD 5K8IA 1F3OA 1W49A 2VPPA 4HAWA 1KSFX 3T12A 1XZQA 3KJGA 1AM4D 2FMXA 4PQFA 5CITA 4URVR 1NBMD 4XIGS 1MV5A 2BHRA 4MYUA 3FPAA 4QJ5A 5M04A 3ND8A 3GLFA 2IL1A 2ZJOA 1H8HA 2YINC 1HTWA 1UKZA 4HI0E 1PLJA 3K0SA 1ONBA 2IC5A 4NU0A 3CLVA 3PEVA 1IXRC 2GBLA 2MMCA 2AD5A 1UBEA 3NHBA 2L0XA 4TTPA 1TADA 1ZW6A 3DOEA 1CU1A 4RZ2A 3CR8A 1OXVA 2G0TA 3B1WA 3ZIAD 4QKQA 1XDBA 4BZQA 2IF2A 4F91B 1QRAA 1R6BX 4Z54A 1R0WA 4Q4JA 3ZGXA 1TQDA 2HT1A 1PVOA 5F2EA 2P5TB 1U0LA 3WNBA 4FXPA 2JDID 4Q4LA 3EA5A 2OCBA 3CX8A 3N2IA 3K0FB 3L8YA 2ZU0C 2RHDA 1YR6A 1BYIA 2P3SA 2OCYC 4F7WA 2ZR9A 4BZPA 4F4IA 5CM8B 1P7CA 4ASUD 2HCJB 1DE0A 1CKEA 3H1TA 3LH5A 1HE8B 4A6XA 2GXUA 2NGRA 4HLDA 2G83A 4DUGD 2C2HA 2QMHA 1R0YA 3C14C 3WYFA 4HUQA 4B3CA 5IT5A 4QM7A 1EFUA 3SBDA 1TNDA 1XCMA 3CR7A 2EYQA 3CW2A 3KXKA 3DVLA 2OCPA 2RCNA 2XNDD 3B82A 1ZP6A 4M4SA 3QPUA 4XWAA 4YLGA 1YR9A 4ZCIA 1F5NA 3CRMA 4M1KA 4E09A 4AY2A 4XD7A 2J9RA 4WA7A 5EUQB 1MO5A 2GXQA 1E9FA 4GRAA 1TU3A 4MRRA 1Z6XA 5F9FA 5DSZA 3TUZC 1YZGA 3HPQA 4CEHB 2Q9AA 4IRUB 4V0KA 4KCGA 2JLWA 1MH1A 1XZPA 3SYLA 3SI7A 2P6UA 3SQWA 2SHKA 3NHAA 2IXFA 3IO3A 1MRSA 3D7MA 4LCBA 3AH8A 2ZITA 4BLQA 4CEIA 5KNDA 2PX0A 4BASA 5DNYB 2D74A 4C4PA 1J90A 2JDIA 3VHLB 1U0HC 1CR0A 4EFLA 1G8PA 2H5EA 2RGBA 4OK5A 1VYTA 3OEED 4OK6A 4LBWA 3B7GA 1W4CA 1NSFA 2WV9A 3QXCA 1JI0A 2EWWA 1LS6A 3T1OA 3OE7D 3W3ZB 1Q1ZA 1Z28A 4PC7A 4DEYA 1Q0UA 3NC1C 1R5NA 3CB4A 4BFZA 1E9RA 2PT7A 4FMCF 3A4LA 2QT1A 4Q48A 4D0NA 1JJ7A 3IDQA 4JBXA 1OKKA 2HLDD 3QKTA 4A15A 4LGMA 1N6OA 2A5YB 3O8CA 5FTNA 2ZAOA 1P60A 3J81k 4AKGA 4QGHA 2VP9A 1E0KA 2GK6A 3JZMA 1G4AE 4XD7D 4JLOA 2QROA 1MO4A 4RD2A 3RRZA 2RGCA 2D7CA 5EQTA 1GSIA 1KK1A 4H9GA 2CJWA 4MDFA 3REGA 3TNFA 1NLFA 3NH9A 2REBA 4KYUA 4Q19A 2BCJQ 3QG1A 4CT5A 5FR1A 1FX0A 3IO5A 4TLAA 1G8YA 3FHOA 2HUPA 1N6RA 2BJVA 5EE1A 5B57C 2KBEA 4LPSA 4PHHA 4ZI2A 821PA 4NPHA 3MUFA 5FL7A 1VCNA 1XF9A 1X86B 2QI9C 1SGWA 1KI7A 4EPTA 1YZUA 1HA3A 2B92A 1Z0KA 4CEIB 1FFHA 3KZ1E 4NCJA 4LHYA 5DH9A 1JEEA 1QVAA 2QPTA 2RGXA 1EESA 1WRBA 2WWFA 1X1RA 4TQ9A 2QMOA 1DPFA 4RD3A 3I72A 1XTJA 2R44A 221PA 3WHLA 4HEJA 1VG0B 4HAUA 3K0EA 1P3JA 1XXHA 3SS8A 3C8UA 4Q00A 1B0UA 3RANA 3GFPA 4LJ5A 5CJ2A 2GAOA 2WWXA 3TH5A 1QHHB 5JJIA 2J7PD 1NRJB 2RGAA 2W6JA 3LLUA 2J87A 1XJ0A 2BCGY 1VG9B 5DHFA 3PR1A 5TV2A 2V55B 5E4FA 4US2R 3SFZA 3BXZA 4DSOA 3A6PC 3IIMA 3Q5EA 5DE3A 1WMSA 3CWZA 3VNVA 3CRW1 2OCAA 1US8A 1D6JA 5E3HA 1XTQA 3LLMA 1NL3A 1WBBA 4NCKA 2V6IA 3B1ZA 2N46A 3PJRA 5AUPB 1DAGA 2JLSA 5FBRB 2PJZA 3T61A 3GJ3A 2GJSA 4OI1A 3RHFA 2DCUA 4LK2A 2WAYA 3FKQA 4LJ6A 3UPUA 2V6JA 3F5FA 1A82A 3I32A 3QF7A 3Q5DA 2RB4A 2IT1A 1ZD9A 3KJEA 1OFTA 4Q9IA 1EX6A 3LBIA 4QHSA 1Z0DA 4LHVA 2F9LA 2ZRAA 1E1QA 2W6IA 2ODBA 3GJ4A 3RS4A 3S1AB 3T35A 1U8AA 1QHYA 4QJ3A 3TRFA 4HDQB 4R7ZA 1NSTA 4AKEA 4BLPA 5SZKB 4A4DA 1V5WA 3IPXA 3A4MA 2ZS7A 4RFSB 1NKSA 3UANA 2JLYA 1YR8A 4QHTA 4HATA 2X77A 2EU8A 3RRYA 1CJTC 1ODFA 1NF3A 4CIDA 2AWOA 4M1OA 5C2JB 1T5IA 1ZM3A 3RC8A 5IHPA 3BWDD 2ECKA 3AUXA 3ICEA 3IHWA 1Z0IA 2R6CA 1SKYB 5A4JA 1WP9A 2GJAA 3K0CC 1YU9A 1Z8FA 4LV5B 2IYUA 2WWHA 5FUVA 4NYJR 5FOVA 4AURA 1JAIA 5DI3A 3L0IB 2MSEB 2CL6X 2VHTA 2RGGA 2OSBA 4PC6A 2YV5A 2VYFA 3ASYA 4OQNA 1E79A 4TL9A 5IF9A 1N6NA 3LFUA 3I92A 4DVGA 2QE7D 1QHIA 3ADDA 4DDVA 3KKOA 4BGDA 1U90A 3FMOB 4M9QA 2FH5B 4DLRA 1LNZA 3QEJA 4I99A 5ANRB 2CK3A 4C3ZA 1NVXQ 1H8ED 1N0UA 3Q8XB 3CX7A 5KTYA 1QVRA 3WNDA 3AQ4A 4V0MA 3Q72A 4JLJA 4B33A 2ZYWX 3I73A 2QAJA 3U61B 5G40A 1FW6A 3AKEA 3IGFA 1NG1A 3ZVRA 4AD8A 2HJVA 3LA6A 4IXMA 2QTHA 4G3XA 3WNCA 1KAGA 5DHAA 4MUAA 4G5GA 4A0FA 2UZIR 1G7SA 3BAFA 3IIKA 5AJVB 4PXAA 1J8MF 4PPGA 2CL0X 2BC9A 3IEUA 4TZ0A 4D2IA 4P4TA 4PHFA 4Q9JA 1E2MA 1RRPA 3EZ2A 3R9IA 2XOKD 4QBGB 5F9HA 4C0AC 2F43A 3EA0A 4QGGA 3ICQB 4TYYA 4W5WA 3EX7C 1II0A 2BKEA 2OLJA 4QGFA 1KK0A 1N0WA 2LWIA 3CH5A 2GF0A 1Q3TA 1OXXK 2BJWA 2NO9A 4NYIR 5JRZA 1KI4A 2QBYB 4BRUA 4QC2A 1JEDA 1S1MA 4BEJA 4AKHA 4Q4AA 1E2DA 1IN7A 2QE7A 2ZE7A 3QKSA 1Z63A 1NNEA 4BFTA 1DBSA 1U8YA 1GTVA 4OHZA 5LD2B 2O8EB 4FCWA 3JZAA 2IYSA 4TMWA 1VTKA 1VECA 1RRGA 4CYMA 3U60B 1L7VC 2XB2A 1VCMA 4YMTA 1XD2A 2EFDB 4KU4A 3IBGA 3L8ZA 1H8EA 1N6LA 3QBTA 4MDEA 3I5YA 1F2UA 1W0KD 4A2WA 2F1IA 1E2FA 1G19A 1W1WA 4HAVA 3AVXA 3MGCA 4RKEA 3B5JA 5HZHA 3CO5A 2Q9BA 3I4LA 4EPRA 3EC1A 4ZO4A 5J4VA 2FE4A 1HV8A 3GLGA 5C1BA 3TR0A 2V7QD 1I4DD 2C96A 3EASA 2F43B 3CPHA 3SHFA 2C77A 2XXAB 4DWJA 3MLEA 4TN1A 2ORVA 1KK2A 3B8HA 4DZZA 3IIJA 1ZCBA 3OEHA 1AS2A 3OIYA 3ADCA 4R2HA 1Q22A 3ZJYA 4XWOA 4ZDJA 1SVOA 1T3LA 3EAQA 4Q4HA 4HLQB 1KJZA 5FI1B 5FTLA 2GETA 3A1TA 1ZM4A 3CKLA 4DDUA 2VA8A 1KY3A 1NIJA 3CONA 4DB4A 2Z6VA 1G9XA 1TQ4A 4DLYA 1FP6A 1R5OA 4V0ME 5AWFC 5G3YA 4BRWA 3LWNA 1EFRA 4ZKDA 1QG4A 2JAQA 3V4FA 2JLZA 2C98A 1HQCA 1YRAA 1TTTA 1DAKA 3RS3A 3NG1A 2EFEB 2KI5A 2QORA 4R2IA 2HXSA 5FOSA 4DCVA 4HDCA 2EVWX 3KKNA 2G88A 5DLQC 5DISB 2VSOA 4PAMA 4QJ4A 1EG7A 5CLQA 1IOZA 4JVSB 1UBGA 2PMKA 5CYOA 1MR3F 3RSLA 1AZTA 1XTIA 4KO8A 1T3SA 2OBMA 2OLKA 1W4BA 1JR3D 5FOTA 4BQSA 2ZSEA 3WP0A 2O8EA 3NIBA 5BN5A 4ABYA 1LS1A 4NDZA 4B35A 1F2TA 2ZRDA 5FUXA 2RKOA 4MKIA 2IXGA 1W7AA 3Q7QA 5FTKA 4JBYA 1T0JB 2R6AA 1KMHA 2ZI6A 4JKYA 2IWHA 2XNSA 3VU9A 1FUUA 4URXR 2AKAB 5EP2A 1E2PA 5AJWA 3MJRA 4FCTA 3MWKA 4FIDA 4KV9A 1IY1A 2WOOA 1KI1A 2ZRBA 5JWRA 1E2NA 3AP1A 4LZZA 4HDOB 4MGZR 3AGQA 1IQPA 1Q12A 4DCSA 2WAXA 2EFHB 3RRMA 4XVUA 4Q18A 4Z1MA 2H1LA 4NP6A 3WBJA 1PUIA 1N25A 1N2CE 3SJZA 1EFRD 4Q4JB 2QAGB 4N3NA 4US0R 1GL7A 2A78A 2D7DA 1KDRA 1GG2A 5EE9A 5JSZB 2C9YA 2IBMA 2WJYA 4IKEA 4PC1A 2ZE5A 5E7MA 5AJZA 1AQYA 1G20E 2IUSA 2QP3A 2CE7A 4E07A 3X1WA 3THXA 1VIYA 1IAQA 2CCJA 2OESA 4IXNA 4TZ6A 2IUTA 3GEIA 3TLXA 1SKYE 4NMMA 2GHIA 4GNKA 3P4YA 2ZI3A 3SZRA 2QRNA 4B75A 4DB2A 1NIPA 1DO0A 1NVWQ 2JLVA 3KJIA 1G3UA 2P5SA 1JR6A 2MSDB 4S2EA 1L4UA 3OFND 4GP6A 5B2ZA 2GCOB 3BD9A 4NCNA 1ZYUA 1AZSC 4G5QA 3FHCB 2Q21A 2JJ1A 4AYTA 4XWKA 4JT2A 3U6BA 2ZJ8A 3K8YA 3CPJB 4QG7A 4RD0A 5BN3A 5LBIA 1P73A 1C4OA 4LHZA 2O0JA 2FEMA 1KDOA 1ZIOA 4D4LA 4GDFA 3AVWA 3N2EA 4PO8A 2IYTA 4MYHA 1KZ7B 1NMZA 3MWYW 2PLFA 1ANKA 2ZRPA 2BEKA 2FZLA 4TLCA 3AUYA 1CR1A 1R8SA 3K9GA 1P5ZB 1WA5A 1G41A 1XCGB 3VR6A 1OH7A 4MRSA 3BB3A 1NMYA 2CHQA 1V43A 1Y63A 4TYNA 2VIIA 2ATXA 1OIWA 1ZMXA 3BS4A 5HR5A 4GL2A 3GP8A 3M0EA 1ELOA 1G7RA 2IXEA 4JVMA 3BB1A 5KSZA 1WE2A 4OI4A 1M6NA 3A1UA 1G6HA 3GFTA 1KI8A 2K5UA 1GL6A 3CZQA 3ZH9B 1S3SA 3OE7A 1JNYA 1Z6TA 4QM6A 2J0SA 4M9ZA 4NZYA 3RDPA 4HB3A 1FL9A 1F48A 5J40A 4C0KA 1RC8A 1KO7A 1ZUHA 4CDGA 2XTMA 4POAA 2HLDA 1U9IA 1A2BA 1W36C 1S1CA 3EIQA 1JECA 3HU1A 1Z07A 1YE8A 1Z83A 4O3MA 4KI0A 5AUQA 5BQ5A 1NBMA 1HYQA 1XD9A 3B85A 2ZI9A 3TGPA 2F7SA 3TVTA 1KY2A 4JLPA 4FD2A 2QTVB 4Q1EA 3C15C 1H8HD 1DO2A 1HT2E 4K81B 1CIPA 4UNNA 3HPRA 3UATA 1YKSA 1Z6YA 5KPJA 2AL7A 2IUUA 2QM8A 3ZS8A 1FMLA 4JVLA 3NVAA 1S2MA 3AKDA 1C1YA 1G1MA 1GRQA 1ZNWA 2I1VB 2XEXA 2Z4RA 2ONKA 1KI6A 3KB2A 3AV0B 2J0QA 4NCIA 4RZXA 5HE9A 2XGJA 1ZM2A 4IOKA 3THOA 3ZQ6A 3L2OB 3MWLA 4BFXA 5FL7D 1SXJB 2QAGC 2I1QA 2R2AA 1FX0B 1FUKA 4DHEA 3FMIA 4B6FA 3B2EA 4EFNA 3PQCA 4B2PA 1QHGA 2IS2A 3TJZA 5JBQA 2O52A 4OQXA 5FTMA 4UNSA 4ASUA 2WTUA 4FMCB 1UDXA 3VAAA 1NJGA 1YVDA 4QFMA 2ZQ5A 4II7A 5JHGB 2G0NA 4GZMA 1P9NA 4KFUA 2V4ZA 4Y0VA 1Z0JA 2B7CA 4HLUA 1E9SA 1O3YA 1YHNA 2IS1A 1HUQA 2OEPA 3RLFA 2YOFA 2GJ9A 4F93B 1E98A 1FQKA 4UNQA 4ARZA 621PA 2OV2A 4OHYA 4RY2A 2ZSAA 4OHXA 3TAUA 1CR4A 1QDEA 2GVDC 1YZQA 2BBSA 4DT1A 4MGIR 5DGXA 2W58A 4OHWA 1WF3A 3KQLA 3DEFA 3K1JA 3RSOA 2BOVA 2YKGA 4PSKA 1TUEA 5EP4A 5DN6D 2O8CB 3QIAA 1K6MA 2D2EA 2DR3A 3NEYA 4Q7LA 4DDTA 1GAJA 3HYRA 3QXXA 1AGRA 4P4UA 3WMEA 4R71A 1BKDR 2UZ3A 5BYJA 4G5RA 1M34E 4LYHA 1GP2A 3I61A 2O8BB 2PCLA 3T1TA 2VHUA 5GVRA 2VHJA 3T5GA 4M1SA 3G0HA 2W0MA 4KLZA 3LBHA 3DKPA 3THXB 1CXZA 1KKLA 1CRPA 2UKDA 2W2TA 1DARA 4MA4A 5FUYA 5FOUA 4IFBA 4YC7A 3TQFA 4RSGA 1QHXA 2F6RA 1I4TD 1VPLA 3TSZA 4C2TA 4PR0A 2F9MA 1BYUA 2IX3A 3F3YA 1ZCAA 4MRNA 1GFIA 4V03A 3H4MA 1J99A 2C95A 3VX3A 5LDDC 1OKKD 2ZI7A 2CCKA 2GEDA 4O2LA 3TKLA 2VLIA 2ZRGA 3OZXA 4US1R 3TR5A 1D2EA 4FWIB 4OKSA 4PHTA 4AKIA 1ZNYA 5BW8A 5L3SB 1SVSA 1JB1A 2D4HA 2IYVA 2OBLA 3DZ8A 4KFRA 2B8TA 5FPKA 2ZRMA 1GIAA 1I2DA 2WJJA 3UXMA 2GRJA 4XSHA 3TMKA 1UKVY 1Z6AA 1KMHB 3VR4A 1CJUC 4IDOA 2CE2X 1R0ZA 2XSZA 5FOXA 1E96A 3T15A 3VFDA 3KQUA 5JCPA 3D8BA 4MITA 1OH5A 1IXSB 4LDJA 2ZSDA 1N0VC 3F0TA 1VIAA 3ZVNA 1W47A 5EE3A 4PHGA 8OHMA 1GILA 2GEUA 4P0TA 3Q3JB 2ZS9A 2ZJYA 1Z0AA 1MABA 1YZLA 5DI9A 4B3GA 5KHOC 4NYMQ 2LCFA 3K9HA 3U4QA 2AFIE 4WZ6A 3RVBA 4C0QC 4D4JA 5IK2D 4XVQA 5JCZA 4X8LA 1JQJC 3Q85A 4DRZA 1VYVA 2X1VA 4BFWA 4DIDA 1RIFA 1J8YF 5E95A 5FPHA 2CLCX 3AGPA 5SZHB 5TXGA 2O8DB 3QF4B 2HF8A 3AP2A 3LY5A 4UXJA 2OO7A 1XJCA 5TVKA 1ZUNB 3W6PA 5AK0A 2BMEA 5JEEA 3U44A 4EPVA 2P67A 4JYCA 4U02A 1U81A 4U5XA 4BZXA 4M2LA 1LF0A 3Q7PA 4NYIQ 3K0AB 3IHLA 1F60A 2DFTA 2CDNA 1HQYE 4O25A 5LD2C 4KODA 3TVDA 2Q3HA 1IN4A 3QF4A 2O8FB 3PG5A 1COWA 2IYRA 4LV8B 1EWRA 2QGZA 1W46A 1T8UA 1NY6A 1A4RA 2FFBA 3ADBA 1OH6A 1M74A 3OIUA 1BO6A 2PEYA 1ZVQA 3BH0A 3U3MA 1P4SA 2G6BA 4EQ6A 1RJ9A 4ZV4A 1J7KA 2C5LA 1SVWA 4EAQA 3SN6A 3FKSA 5ELXA 2A2ZA 3ASZA 2E87A 3CX6A 3L0SA 2W0SA 4TSFA 1HEIA 2BMFA 5IK2A 4PANA 3GMTA 2XTNA 5DIFA 3DOFA 1ESNA 2DWQA 2Q3FA 3VR3A 3ZLJA 1RZ3A 2OILA 4PC2A 2AFHE 4B44A 1P2UA 1NI3A 2D3WA 2JJ8A 1IN8A 1WCV1 4B6EA 1Q3HA 5JS8A 1DVRA 1KNXA 4TMXA 5CIWA 1Z0FA 5BWMA 4YMWA 4LHXA 1P72A 2QPOA 4A82A 2R65A 3EPHA 2CCGA 3B1YA 2QTFA 1AK2A 2GF9A 4PAOA 3QBVA 4E03A 3H84A 1KJWA 1OHHD 1SKQA 1D9ZA 5EZ6B 3LRPA 3U3JA 3RC3A 2J1LA 4C7OA 1NP6A 1OXUA 2EFGA 3A1VA 2RGNA 2WPDD 3HJNA 1BMFA 4UQOA 1KI9A 4N0EA 1OXSC 4BUJA 3VKWA 1E79D 2XJ4A 2FFHA 1U2RA 3KFVA 1JXMA 2CXXA 2WBLC 2HXYA 4M1YA 4PO1A 3A58B 5KDDA 1FOEB 1KGDA 3KJHA 5L3SA 1Q21A 2DY1A 4LYAA 3X1YA 4AI6A 2JLRA 4PPNA 2GZDA 1AQUA 4NYJQ 4ERNA 5EZ5A 3QEOA 3AVQA 3M6AA 4ZIRB 4IDPA 2CK3D 3GFOA 2ERXA 5P21A 2ZI5A 5KUTA 1S9DA 1BOFA 3UMRA 2ZTSA 3QSYA 3P20A 5FUWA 3VHXA 2QG6A 3TIFA 3ZYCA 4ZDKA 1KMQA 4TTQA 3IQWA 4HUQB 1UAAA 4BPBA 1XX6A 1T8TA 4OQFA 4F4JA 1SHKA 4M1WA 3U7GA 4G01B 4NBSA 4TL7A 5JZVA 3QVVA 3LO5A 4DLWA 1DTSA 4C7OB 2Q9CA 1AKYA 2A5DA 4ESHA 4EUNA 2HV8A 4Q7KA 2PMDA 2NPIA 2NO7A 2WWIA 3I8SA 4Q66C 1FZQA 4DLVA 4KSCA 4K8OA 4KFSA 2QN6A 2GJKA 2XOKA 2J45A 2YC4C 3KX2A 2QGNA 3U3KA 2A7QA 2ERYA 2GCOA 5KSYA 5E7JA 2VEDA 4HLUC 4LJ8A 3PEWA 2Z0MA 4M1TA 2RH5A 3WBKA 5JLJA 4EJSA 1YZTA 4KJZA 4ZCLA 2X2EA 1II8B 3FE2A 5GJWC 3VR1A 5SZJA 4L8GA 4QGAA 3AEZA 3NXSA 1IJFA 4BFYA 2G9NA 2WJGA 2GK7A 3CRRA 4C2UA 3CF0A 2WMOB 2FN4A 2Q3MA 1M7GA 2ZR7A 3X1ZA 1H65A 2QENA 2PZGA 2WHXA 3VKGA 2VHQA 3RS7A 121PA 4P33A 4JBWA 5EP3A 4C30A 4A9AA 2QY9A 4UXIA 5J5CA 5SZIA 4HAXA 2ZAMA 2FSGA 2N1BA 2P6RA 4B47A 3PCRB 5FR2A 3QE0A 3DPUA 3OFNA 4CZ2A 5JI3E 1Z08A 2CVHA 4JLKA 4TTRA 1EX7A 2CNWA 2YWEA 1GWNA 4ZDIA 4PSVA 2P0EA 4J0QA 5D3MB 4A0HA 4M21A 2V8OA 2Y8EA 2EW1A 1N5KA 1M7HA 1VCOA 5HCNA 1ZC3A 3QJYA 1JALA 1G6OA 3QNUA 2B7BA 2ZJAA 4LJ9A 2ZRFA 1MRNA 1Z22A 5IRCD 3WXMA 1DS6A 4ZPXA 2YJTD 2I3BA 4DEXA 3W6OA 1W44A 5K8UA 4JJKA 3RS2A 4I1OA 2GWHA 3KB1A 2QP4A 3BBPA 3FWYA 1SVMA 1ETUA 3SEAA 1II9A 1TQ2A 4NCHA 2JJ2D 5L3QA 3B13B 4DCUA 1OB5A 1ZJ6A 4KVGA 2V3CC 1R0XA 4G0NA 3PUXA 2ZS8A 1KO8A 4BFUA 1Q44A 4JIMA 3I8XA 4LYJA 4TLEA 2HYIC 2GCPA 2PLRA 3KQHA 4A8JC 1GL9B 3CH4B 3UMSA 4WW0A 2CBZA 2OT3B 5D3MA 4B43A 4FCVA 5CLLA 2REOA 1T4GA 3P32A 3RYTC 3LQQA 3AP3A 3CNOA 1KI3A 4XSGA 5A0FA 2QPAA 4UXHA 2V54A 1XTRA 4Q4HB 1XMSA 2J59A 2VF7A 4RCYA 4BE7B 1QF9A 3KL4A 5KDLA 4NTZA 2QU8A 2FPMA 3MD0A 1NN0A 1RYFA 3N5CA 3CNLA 2F3TA 4OI2A 2FF7A 3PUZA 4PZZA 1NN3A 2HT6A 1KNQA 1E2EA 1ZM9A 2D2FA 2JLUA 1EFCA 4QOSA 1KO1A 1X1SA 3IBYA 1KJYA 1VYUA 2WKQA 3TW4A 1OW3B 4EFMA 1SQ5A 3T1QA 4FINA 2ZREA 3G5UA 3QOFA 4WIAA 3EPKA 1GKIA 3ZD7A 1P61B 1NY5A 2LKCA 5BYKA 2FDCA 1X3SA 2ZI4A 3S1AA 1GVNB 4D81A 4BLTA 2JEOA 3HP1A 1QZXA 3P26A 3PENA 3WRXC 4Q7MB 3AVPA 1D2NA 3T1VA 5G53C 4Q4AB 3BERA 5TMPA 3AVTA 3BFKA 2ZYUX 4B2LA 1Q57A 3OEEA 1JPJA 4C0JA 3KXLA 2FEOA 2H8KA 3TUJC 4L5BA 2BM1A 1AS0A 4TMVA 4I1SA 1Z2CA 4KHZA 5EE0A 1PZNA 1E4YA 2GTPA 5BN4A 1K8RA 3NBFA 4A36A 1KSHA 1XXHE 3R8CA 3CRVA 4S35A 2CEAA 5EE5B 2UVQA 2I4IA 3U6KA 4XJXA 4JVNA 2QUZA 4A1FA 4YXWD 1EK0A 2V9PA 3W9YA 2AN9A 1G7CA 5CK5A 3BH6A 2WZQA 2PX3A 2YWGA 3C16C 3Q9LA 4L9SA 3BORA 4EJSC 1KSGA 4PPQA 4P32A 4LI0A 4LJ4A 5FTJA 1K5DA 4TT3A 3V9PA 1UKYA 1OPXA 4KLNA 2GXSA 2IA5A 2WMNB 4N1AA 4AC9A 1BH2A 2QM7A 4HZUB 5CIQA 4OI0A 2BMDA 2IHBA 1AN0A 1E2GA 5CDFA 3W8RA 1M1YE 2CLSA 2VP5A 4JYBA 4HAYA 3K0FA 4FN5A 3ZDQA 2ZR0A 4Q47A 2PBRA 3LNCA 2Q0HA 4D0LB 2FU5C 2H7VA 3UKDA 1L4YA 4AYWA 5J4HA 1TUIA 2DHRA 3EWAA 4Q7JB 2DWOA 4LJAA 4OL0A 2ZRHA 5CM9C 1U99A 3OIVA 4BLRA 2WM9B 4R9UC 4GOXA 1G5RA 1BS1A 3AF0A 4TLBA 2FOLA 2NTYC 1XD2B 4C0LA 2F55A 4WOPA 1JQLB 3THWA 5DYGA 4OYHA 421PA 1CTQA 4NHOA 1NG9A 2NMVA 4CF7A 3B78A 3E5HA 3IPYA 1BIFA 4ZI3A 2YOHA 1G3QA 1XPOA 5FBVB 4YQFA 3GLIE 2NQ2C 5HCIA 4URZR 4GBMA 1NBME 2W2XA 4JLVA 4BFVA 1FNNA 1XBTA 2FA9A 2J5XA 1F6BA 1IBRA 1C9KA 2CLDX 2FGKA 1X8LA 4TYPA 1G8HA 3MCAA 4G1UC 3C5CA 4DC9A 3PIRA 5KSOA 1A2KC 3AVUA 3RAPR 1LW7A 4AK9A 3QKRA 1W4RA 1OXTA 1F2UB 4TT3D 1T9HA 1YZNA 2XSZD 1MOZA 4O2RA 1R5BA 4M1MA 2ZXUA 5UKDA 1KIMA 5H68A 3QXSA 1E1RD 4GP7A 4DLXA 1DAMA 1G8GA 1Q1BA 1R7RA 4IDNA 4U7DA 4A8JA 2GAAA 3NDPA 1ZRHA 4Q03A 3FFBA 2YOGA 3K9LA 3QKRB 5JEDA 1AGPA 4MYCA 3X1DA 3C4JA 1XTSA 5H1YA 1N5JA 2WOJA 2NO1A 1E1QD 2W6ID 3U44B 4Z51A 1RJ9B 4G5SA 4D4KA 1K5GA 3X1XA 3K53A 2GZAA 2WWGA 3A4NA 3ZD6A 5HE8A 2ASEA 1A5TA 1NVVR 2J3EA 1MO6A 2FPKA 1MO3A 3ETLA 3R8FA
chains in the Genus database with same CATH superfamily
2EKBA 5DGHA 2JH8A 5TPWB 3BIFA 4MOWA 4YY3B 4AJJA 3L01A 3L9WA 2P9BA 1HX7A 4JT4A 1U9JA 1F8UA 5K0TA 1V95A 2WD8A 4HNAA 3VSAA 4F2WA 1E94E 3HYCA 1W2WB 2CZQA 1KYXA 1JE0A 4YUVA 1G60A 3SHWA 5IZCC 5DVZA 1FYWA 1ZVJA 2IS6A 3KKMA 3UK2A 4OBBA 1PS8A 3M6XA 4S04A 3KWFA 5DN6A 5IM4A 2YFYA 2EWMA 3LHKA 4G56A 4II2A 5ALGA 1SD5A 1DKUA 2RI1A 5C81A 4LUCA 1M9NA 5TDHA 1L7BA 1GKKA 2ANCA 1NWHA 2FZ5A 4IQ4A 4XJSA 1N6PA 2FXVA 3I76A 4Q39A 3R2JA 5GJBA 2J6HA 3GDOA 4QECA 3PI7A 3T9BA 4C88A 3OU6A 4XIIA 1W2HA 2GN4A 2GPYA 3GJ6A 3FPKA 3G88A 2YV4A 3KR9A 4XVRA 4XUEA 1V5FA 1QGUB 4J0HA 4JLNA 2FPRA 5BSGA 1IBKB 1PWYE 1U94A 1YI0A 5HF8A 5T3YA 3GJ7A 1SXJE 2QVYX 3NHWA 2Z2JA 4IMIB 1QIFA 1LVGA 4UQPA 5DNDA 4YPOA 2GESA 3TLAA 2B8NA 4R6WA 2J9XB 1EGHA 1QHHA 1XFDA 4TLDA 4P3XA 1ADGA 2FVXA 4AECA 1IJBA 1K0FA 1OTXA 4MVJE 1GUZA 1A1VA 1NASA 4MGYR 3ZV5A 1S8FA 5DPMA 5C4GB 3MCWA 1CY7A 2DXIA 3FYSA 3PX3A 4JA0A 1OIXA 2ZSHA 3O2SB 3VC2A 3PR3A 1WL8A 4DMRA 1C7ZA 1L7DA 1GCOA 4E2YA 4ZEMA 1G18A 4AQDA 5CVJA 1BHQ1 2PL9A 2IK8A 1CRQA 3WBFA 4PO9A 3QBDA 1P2SA 1YJ5A 3KXPA 5A6VA 1XGKA 4XRRA 1FPMA 1V3UA 3KOYA 3NWJA 4CMKA 1PEKE 2XB8A 1DHRA 3CG0A 3HCRA 4DLSA 4LBYA 4L16A 1YSCA 1KJ9A 2IU3A 2XB4A 4BIMA 4IVRA 5HBRA 4BLOA 5A4AA 1SZPA 3KCNA 1QJCA 5EY5B 4B2IA 4DV3B 2O14A 1UBCA 2JFBA 4D8TA 3DPIA 4G5XA 1OIVA 2HPHA 1BXGA 3KHKA 1NXQA 1I4OA 3N8GA 1SKBA 4KAJA 5EXEA 3U2QA 2I55A 4EIWA 4ESEA 1K97A 1Q84A 1NW8A 3UAXA 3JCZA 3NS7A 4OJKA 4QNMA 2IHUA 3QIVA 1I6LA 1KBOA 1S3GA 4PGAA 1WIWA 2BGNA 1WZNA 1DAOA 2X8AA 4NJOA 1YI8A 5HZKA 3QXHA 2C8LA 2VF8A 2GVNA 1FRNA 4CFYA 1RQRA 3ET4A 3H9UA 1YE5A 4RW0A 1NF2A 3D6AA 5I7RA 1H9AA 1S5PA 2QN3A 2WYIA 3AXTA 1U28A 3OUZA 2YWFA 3ZZUA 5CLFA 3RK0A 3ECAA 10MHA 2O2IA 1FJXA 5ECDA 5FBLB 5CFLA 1IY2A 3GCGA 3KYCA 3PUHA 3P2IA 4YRDA 2P6NA 5JNVA 4GLOA 4ZO8A 5AVTA 3MT0A 4TWZA 5KEIA 2C5BA 2O1WA 3DDNA 1YZFA 2P6PA 3HJAA 5LUAA 4G0YA 3HDQA 3PVSA 4UJ5A 1DC5A 3K9CA 5JY6A 4B8YA 5LB2A 2FSPA 1NW5A 3WYAA 2LV8A 1V6SA 4EF5A 4LTDA 2RAPA 2J33A 5A05A 4JBHA 3NBYC 1FNMA 2H9IA 3TQTA 2GCNA 1NRXA 1T2DA 1CF4A 5E6SB 3SQXA 4FFVA 4FQ5A 2ZTLA 1DAPA 4JI0B 2RK3A 1F0KA 1CE8B 3BWEA 4CCYA 1SG9A 2CFTA 1RI3A 3IP3A 3I3SR 1J5PA 1L5QA 4JLDA 3NDRA 2RMKA 3VMFA 3CXRA 3EXAA 3U5ZB 1XTKA 2AN4A 5DSTA 3V00A 2VYQA 4TVBA 4ZAFA 3U4AA 1W4AA 3AF5A 1IATA 4AKSA 4ACBA 5K6AA 1BA3A 2XITA 2YN4A 3M6UA 5CX1A 1KI2A 5CYFA 3K9NA 4OREX 5T4HA 3LD9A 4E5SA 5KYYB 5CTAA 5BRNA 3FNBA 1EP3B 1E58A 3KYIB 3ZVMA 2QMUA 4JUDX 2F1RA 1N9ZA 4TS3A 3K2IA 1Z5PA 1VMAA 1J1IA 3B9BA 2ORWA 3H2SA 4FGWA 4I14A 4AWBA 3HEMA 4U0KA 1X7GA 2A94A 3WYGA 4BVAA 1OU4A 2W4QA 1LJ8A 1GG9A 3QPBA 1LDGA 1KKUA 4ZAXA 3VHQA 5AVVA 3G6WA 3NNNA 4Z7JA 1POXA 3JZDA 3SYKA 1M34B 3RLIA 1NV8A 3FPEA 5B64A 2C9OA 1Z4KA 4X1KA 4UU0A 4J3NA 1PJ8A 1A71A 3UWPA 2VL7A 1JG7A 3ROXA 2ZRLA 1C3JA 3RKUA 1X8XA 2R8YA 2ZAYA 4FNGA 5B1YA 4W9RA 2C2XA 2DU8A 3G5TA 4AZSA 1P2DA 1NATA 1V8PA 2JGNA 3HO8A 3CVOA 1ADCA 3EGXB 4JI1B 3BIWA 1WPQA 1ZNQO 2ADMA 4AG5A 3VXKA 3JQCA 2PMBA 4DJDC 5HUQA 5FL3A 3VJKA 1OHHA 3B9PA 3T3OA 4UDOA 4AN0A 3O3CA 2PKEA 4WK2B 2X3UA 2Q4OA 4OKNA 4DA4A 1QO0A 4KYVA 4FMBB 1I0LA 3A4TA 4YPFA 1O6FA 1XZJA 4JS0A 4M0KA 4HSEA 1UPBA 2PY6A 4XFJA 3EUFA 1TMKA 4ON9A 2AN3A 1CBUA 4JBNA 1MNQA 1AD2A 3GJYA 4ZWNA 5THKA 2XZLA 3R5XA 4JLBA 3WY9A 4KIGA 4C1NA 4XYBA 2IYZA 2QPLA 4Q9HA 3FMFA 2A1UB 3WG9A 1SUSA 3B6EA 3KSRA 1RPZA 1WBDA 4K03A 2RHBA 4YMSA 4K05A 1LSSA 3ROTA 1HYEA 1YONA 3GRAA 4CFZA 3ROGA 2Y1CA 1HM5A 2BFBB 3EXEA 3OE4A 4NU6A 3KEQA 1ESDA 1PWEA 4A0RA 2MTBA 3L3BA 1JHOA 2NSDA 1NQUA 3KVOA 4NH4A 4DGQA 1TD9A 3H2IA 4X1YA 3SNHA 1KE2A 3OLZA 5IXSA 5FA5A 4YJDA 3K70D 1G16A 5TT1A 1V1RB 1JVNA 3C4QA 3AB3A 3VZPA 1PR3A 4EVQA 1R27A 2R1TB 1TF7A 1L0BA 2JFQA 2QZ4A 4FKMA 4EW2A 1MX9A 1UK8A 4KBFA 1P62B 3ZWAA 1R2QA 5T4FA 3HKEA 3QU7A 4I5GA 2JJ1D 4KO4S 2VCYA 1AVTA 2NZYA 2PK3A 3AIKA 3G1UA 1FXUA 1D2GA 3VPSA 3I2HA 4EYSA 2R8PA 3M4NA 5KX5F 3SC3A 3SX4A 4TXJA 2MOKA 1Y0BA 3LTNC 2JASA 3L0CA 4L78A 2V7UA 3C1OA 1UWKA 1Y9DA 5ES4B 2OM2A 4QOHA 1QIMA 3M9XA 4O02B 5CDHA 4FGKA 2Y1XA 4ZVMA 4D5EA 2MMGA 3PFIA 4XGQA 3PR2B 3KSZO 4XTRA 3ZIUA 2ROQA 2NZWA 4OYRA 2CHEA 3EH1A 4PLYA 4B3FX 5HOQA 3PFGA 5EEHA 2ZJZA 2ZB2A 3GX1A 4NFYA 3RC2A 3IT1A 3HFRA 4UZSA 4INOA 3W5IA 2GMWA 4D8VA 1QP7A 3KYDA 5AR1A 4CL8A 5IZCA 4B09A 4ROTA 2QF7A 5AP9A 5LN1A 1XEWY 2H17A 1RRVA 3LL4A 4DT1B 3H5NA 2JCSA 5AUNB 5BWNA 2FPGB 5JS7A 3BXHA 3GB9A 3QFCA 1R4MA 1RHKA 2CMGA 3BILA 4UTZA 3EDCA 3LDAA 3RG2A 3WLOA 1VI5A 3ANSA 1W94A 4OSEA 2GHTA 4ID9A 3UMBA 4BLUA 1TU0A 1E7QA 2XYQA 1AZWA 4Y2YA 3I9V6 1RQPA 4BFCA 3KZVA 4GOMD 3VTKA 5ICCA 4AP9A 2EFCB 4EG7A 4NS4A 4WGGA 1KAHA 3ETDA 2CYCA 4K46A 3ZK7A 1Z12A 1MF7A 1U4OA 4C05A 5MF6A 2NZ8A 5LWQA 1T2FA 1TJPB 2CLMB 2R47A 3CUTA 3SFVA 2O7NA 2VDOB 3FF4A 3L79A 3SHOA 3EZ7A 4CODB 3H2HA 3NEAA 3W06A 3OM9A 4UJ3A 5K0FA 2B34A 4C6TA 3DH0A 3CNNA 1TFUA 4D6PA 1HNXB 2F48A 1BEZA 4IS3A 2IHYA 5KYYA 2B94A 1E2LA 1EZZA 3KR2A 1EK1A 1DL5A 3L0PA 5EERA 1KEVA 2SBTA 2VDPB 4FDUA 4LJ7A 1FFWA 4QUGA 1L1EA 4F9TA 4Z1MD 2GA9A 4R2XA 4HLCA 4RS3A 1I4WA 4B1FA 2FPIA 4H7HA 3N76A 3WDMA 1XPRA 1GPBA 2JGKA 4BJ3A 1CQPA 2GDJA 2G08A 1E6LA 3PFNA 1X2EA 1XB2A 4YLEA 2O54A 3PL5A 1N2CB 4U2FA 4KYTA 1WZEA 3E4CA 4I5DA 4YRFA 3TW8B 2VJCA 5IN4A 4RL6A 1DC7A 2H1CA 3EVFA 2RB5A 3MF4A 5CX4A 2AIRA 2R6HA 4P86A 3F2IA 1P91A 2YMQA 1CJCA 4ZZIA 3SDZA 3SHVA 3LT2A 5EWLA 4Q1BA 1SBCA 3GLRA 4M60A 5CGZA 1FYDA 1M0SA 1OFIA 3EAGA 4BZZA 3QKSB 3AF3A 2J0UA 5F7OA 5TQ0A 4KVAA 2WJPA 5HVNA 2ZVQX 1Y8RA 2ACWA 1TZMA 2R1VB 2JATA 2BFMA 3DBHA 1M76A 2G06A 4KO1S 3L6DA 4XDYA 1TM1E 2GB4A 4FEYA 4HQKA 4C0HA 1MB4A 3I62A 1XLTC 2NQTA 1G8SA 1TZ2A 1NZJA 3A6ZA 1Y82A 5E1MA 1Y6ZA 4JC5A 5I7UA 5KQLA 1JNXX 2MYPA 3LCRA 4C76A 3W5JA 4G84A 1ZD8A 3EOBI 4LKRA 4IOLA 2QOEA 4URFA 4DDWA 1ULSA 3QVMA 1WU7A 1YZKA 4IUCS 4RF5A 3RGWS 1VLHA 2NXCA 5H8WA 1O9BA 3C48A 2R8BA 1GDDA 4OXQA 4BMSA 1EJ0A 2G4VA 4FFRA 4F3YA 2PUDA 5F3WB 4N49A 3NVMB 3QBJA 3W78A 4Y1RA 1YJCA 1E7YA 1T26A 2NSYA 4M9XA 4QARA 3UAZA 4XB1A 5KJ1A 1KEPA 3B6ZA 4IDQA 3USCS 1WAMA 4F12A 4IZIA 4UARA 3RF7A 1K7EB 5TJ9A 1Q2UA 4EPXA 1Z8HA 2K87A 4Y0AA 4IEIA 3BEOA 3GD7A 1KO5A 1E1RA 3H2KA 4RHCA 5FADA 5CEEA 4G0WA 3L8DA 3II6X 4NH0A 3GCXA 1CNEA 2WVHA 1XEAA 1P45A 1GZ3A 1C0IA 3HXTA 1Y8RB 2R1VA 4NAUA 4TPKA 4DA6A 2VATA 4U00A 3ECSA 3GFQA 3PRYA 4OU5A 2PRZA 5AKKA 1FMJA 4ACAA 1V2HE 3LVFO 3F98A 2PUGA 1RBQA 1XYGA 3DKVA 3BTVA 3DNPA 4IVQA 5I9BA 3PXGA 1OWMA 2YICA 1FJGB 4IHQA 5JWHA 2EP8A 4ZCTA 2VHWA 3FI0A 4Y67A 4HGRA 1PAUA 3EXIB 4YRBA 3GA5A 3G0BA 2IS4A 3KM0A 2YNMA 3A4IA 4RJJA 3ZKAA 2ZM5A 3THYB 1J07A 1W4LA 1K0UA 1S2DA 4RNDB 5KZMB 3WLHA 2WKPA 1KWKA 5BWOA 2VG8A 1N3IA 2NIPA 3LMKA 4UUMA 2EDCA 1DB3A 2XUFA 1NLZA 2HPAA 4JBLA 1WTAA 4WXRA 3R5TA 1BDHA 1O58A 2NO6A 1IZYA 2Z43A 4W7SA 521PA 4WXPA 4EI9A 1W48A 3MRSA 2DMRA 3WB2A 1TPZA 5EXSA 3RVOA 1QK4A 4RZHA 4NMLA 4RCVA 1HYBA 1KEUA 1N9GB 1UCFA 5EP1A 2PWPA 4QO8A 1ZGGA 1XNJA 4UAUA 3G8CA 1N5MA 4HS9A 4UUBA 1QAQA 2FXIA 2PWYA 3PDIA 4W5HA 3WLRA 5EJ7A 1W36D 4JGIA 2O7SA 4MO9A 1QLJA 3DXXA 2GNOA 2WTBA 3KEOA 4L22A 3Q10A 1C4XA 1P6UA 1QE0A 2EJVA 2YWHA 2A86A 3PJGA 3AHEA 1XA3A 1FXWA 1LLCA 1KYIA 3BAZA 3ZQJA 4MS3B 4REOA 4XZ3A 4BP1A 2HHJA 3ELUA 3S2YA 4KMSA 3E5RA 3GELA 1U9IC 4IXTA 1BS9A 2JGLA 4MJXA 5JSKA 5K51A 5LU9A 1OLOA 4MWDA 1RW4A 1OZGA 3PDWA 4LRYA 3E9RA 4O0MA 3NTQA 1W0CA 2PH3A 3ENWA 1H42A 2PO5A 4N7BA 5C5DA 4BPRA 2A5GA 2UZ0A 1CEXA 1G7TA 1T5TA 2YC2C 1IXZA 3HRHA 4YDSA 2Y6VA 2BDUA 2IHVA 2OP1A 3UICA 5C7LO 3S8YA 3ZDBA 3DM5A 1I32A 3FNEA 2M1ZA 3C2QA 1XMOB 1B23P 4Q02A 1Y5NA 3CJTA 3ZWPA 2IEZA 2EZTA 1RWBA 3WP1B 2OD2A 2PS3A 2AJTA 2GYWA 3E7XA 4MYTA 3EZ9A 4N8DA 3UJNA 1LB1B 1ZCJA 3RREA 5THQA 1SU6A 3UMRA 2H4YA 5DYNA 1PJZA 1P6XA 2VBIA 3UG7A 4BEBA 1D1QA 2W8BA 3LT1A 1DDIA 1QLWA 3PQ8A 5IHXA 4YCBA 3ZY5A 2BZ1A 2QAGA 2P2ZA 2RIRA 1SB8A 2R8XA 5JNTA 1Z74A 2REXB 3ERCA 4RAOA 3RC7A 1GN9A 5AJXA 1DIGA 4YA6A 3UM9A 4MYRA 4BKRA 1ULUA 4JP1A 1QG2A 1V6AA 2AKYA 2VHXA 4LJSA 5EJMA 3ZE8A 2MSNA 4L5IA 4YP9A 1GTZA 2J9ZB 3PGLA 4PGMA 5K3AA 1W1UA 1I6KA 2GLXA 1GZVA 2BBOA 1XZKA 2H9AA 1Z25A 2EZ8A 3IVXA 3PPVA 1RSZA 3CLTC 5EMKA 2NUPB 4JR0A 2FHSA 3KCQA 1GM5A 5L9AA 4Q1DA 3T7SA 1RCTE 3ZY2A 1T5LA 5ESWA 3TCNA 1MB9A 5KVVA 3RTDA 3CF4A 2L19A 1BZYA 2PGXA 1BVRA 2OTCA 4DR1B 1UQRA 1VB5A 4CGZA 1PT8A 3S2ZA 1DV1A 1KYTA 2HQOA 2P5UA 2RSLA 3KP1A 4RAQA 4ERXA 1D07A 5HQ3A 3R4CA 3LW8A 5FYDA 2Y9PB 3QLVC 1X80B 1V7QA 3TM5A 1PQ4A 1QNFA 2W4IA 3IOMA 8LDHA 2H2AA 2Q3DA 5JBIA 3ND5A 1WB9A 1M1ZA 1Q5PA 1ZH8A 1ZX1A 3C8HA 1T3GA 2YYYA 5K01A 1KEEA 1WKBA 3T4XA 3WGTA 4YRJA 3KTOA 1RRMA 2B5OA 4FYYA 2VHCA 1RQXA 4AZVA 1GXSA 2G9RA 3A36A 1A9YA 5AKLA 5FPYA 1G3IA 2X0KA 4YRIA 3SX2A 4XX0A 5ICGA 3UPDA 1SG6A 2W6JD 1Z4JA 2E5FA 1AJEA 1XMVA 2BY4A 3AILA 1JA0A 1WXFA 4YMUA 1TLLA 3THYA 5FPTA 1B7GO 2OFOA 4HZIA 5BSHA 4N82A 3HKBB 4A8JB 2Q5HA 1MBZA 1KP9A 1EVYA 4Q1AA 3ZQKA 3JQFA 3VR4D 4GXTA 4I9UA 4B73A 3LCJA 4F56A 2O9JA 2HIMA 4JZKA 2C83A 3TZLA 4CGYA 1W87A 1T25A 3ECCA 5AM4A 1ECLA 3M9LA 1UOQA 4A2CA 4D7AA 5CA1A 2PXXA 4QEZA 2LZ0A 2XHZA 3MIIA 4MDYA 4LXGA 3UBTA 1RRCA 3N2KA 1U0JA 1EDDA 1D2MA 4QJBA 3W3AA 1NBWB 4TMZA 1MO2A 3BH7A 2ISCA 3FB4A 4YT8A 3DZFA 4TYQA 3TZQA 1GGVA 4GWKA 3EW9A 3S7ZA 1CQXA 4DWVA 3DLBA 2JA1A 5JZSA 3WR5A 4JC4A 4PYNA 2JIBA 4MVJM 4RH0A 5IYZA 4HZUA 1SBQA 2Y2VA 3GK3A 2WHRA 3GARA 2Q46A 4MGEA 1JU3A 4HFMA 4NNOA 5TQ2A 4E51A 1RADA 1CZNA 3GVHA 1ZOPA 2Q7XA 3QU9A 3ZWMA 4ZMSA 3QZUA 5BN3B 4IR7A 1SPBS 1X8JA 3VNSA 3O4RA 3I64A 4QLOA 4TV9F 1GZDA 5MN5A 5FLYA 2FX3A 1UL1X 1GKUB 2LNDA 1E9BA 1SVLA 4OSPA 3T9CA 4E5VA 4FS8A 4N7JA 4BYMA 4GVPA 2BJHA 1E6MA 3NFRA 3JZIA 3R6TA 4Q6BA 1YA8A 1RABA 2QBYA 4TQUS 1ADFA 1OYVA 1DOHA 2BFEB 2NXNA 3HB0A 3R4VA 4DRXB 2PJDA 3WKCA 2CHVA 3PXXA 5C34B 1QWOA 4PYJA 2AEEA 3DR5A 2XMPA 1C3EA 1QGDA 3DD5A 1MJGM 4R2LA 4ALLA 4R9NA 2R7KA 1YS1X 5A3QA 2I7TA 2ZUDA 1FYVA 3E1SA 4HWOA 3UEOA 2GBPA 1MIOA 1SHZA 4H3HB 4WZBE 1Y1PA 5CDUA 5JMOA 3W0LB 2UUBB 4DMHA 2WM3A 1RJFA 4XUDA 2QP9X 1VG1A 2G4LA 2F3RA 4N01A 3LKDA 4RY8A 1T3TA 2QLMA 3KAQA 3T3MB 5KJ6A 2ZQYA 4P6VF 4V38A 3ACCA 3GZNB 4I4NA 3R5KA 4Y1RB 2OXFA 1HSOA 1EGAA 3PSHA 2Y67A 5EJIA 3KKPA 4DA8A 2C07A 5B1IA 1N2EA 3IDZA 2IPAB 3JVVA 3TL6A 2BE7A 2XT6A 1W5TA 2RIPA 4WXEA 4CM8B 1N5LA 4DM4A 3OBIA 4NAVA 4CM4B 3LC7O 4RIIA 4KQXA 4UMVA 4B4VA 2AZ4A 2QSUA 4B6GA 4CMIB 4OIFA 2RGEA 1SKMA 2JIDA 3KEGA 1F4PA 7YASA 1JG2A 3AHCA 1SC1A 2WSBA 1QX3A 1Z4QA 5B7PA 1AA6A 3E1KA 1XPUA 5AKYA 3F8SA 5LXTA 2EX0A 3DEYX 3R7WB 4L15A 4R54A 1S6YA 2IDJA 2RHCA 3BRCA 3WMFA 4HMQA 4Q12A 4Q7QA 5J2UA 1KKMA 2D1RA 4R01A 5L4SA 4AY6A 1BN7A 2PO7A 4G5HA 5H0IA 4IDDA 2PUJA 1K7FB 4OEHA 3L0ZA 2C9CA 4DPMA 5J4YA 1MIOB 3TOXA 1P7WA 4BB5A 4PLFA 2CVOA 4QU8A 4R8MA 3IMFA 2GZSA 4E32A 1QGYA 3SZLA 3FDIA 2DC1A 2WPDA 3EFBA 4UD6A 3SU8A 1VRCA 2WU8A 4QBFA 1SBHA 4C5CA 3FOEC 4Q5IA 2DJIA 2YMPA 3KNZA 1JIJA 1YZYA 1J24A 2N42A 2PMFA 3TZEA 4BYGA 5L51A 3O8RA 3IEIA 3H1AA 2F4VB 3OE1A 3FCOA 1TU4A 3MJHA 3RFCA 1DJLA 4D9CA 1L4GA 5GOTA 3CIOA 3F4BA 3RADC 2JI4A 3HJGA 1A7UA 2JIPA 3DZJA 4QUIA 4BUCA 1PR6A 5JWOA 3H9QA 4G63A 4UKDA 4JY7A 4KIWA 2V0CA 4ZALA 3EFOB 3QITA 1OYWA 1W0KA 3F8TA 2ZJ2A 5BNWA 2VRNA 4KQEA 1KU0A 4GSLA 4R7TA 1L4MA 4IDCA 1Q0QA 4L9WA 5CLHA 4KTTE 2ATVA 1LI7A 4A0GA 3RM3A 4B7UA 3EIEA 2L17A 4MTCA 5CT6A 2I65A 5KKAA 4DR3B 2ZANA 2HDNB 1T3HA 1U5BA 4OJQA 3T3HA 1XFAA 3D1VA 5JUWA 1VL8A 3BE8A 3CN7A 1X7YA 3HJBA 3MWGA 4TUYA 2X23A 4R68A 3UOWA 1YXMA 2A9OA 3VKVA 5K03A 4EI7A 1I7NA 1U98A 1UH5A 2X14A 2JF0A 3FR8A 2O5VA 3H7IA 3OEHD 4PNPA 3QKUA 3FUXA 1DWPA 3GFGA 2AR7A 2E5WA 5C8YB 1T9CA 2ZYRA 3HZZA 3KQPA 3TOSA 1YQGA 4ZC1A 4ZT3A 2HQ1A 3ORFA 4FDAA 3OEWA 4ITRC 3QUBA 4EQ6B 1U4NA 5DHUA 5HKLA 3BCHA 1VSBA 1JFFB 2CJYA 1QQ6A 4TS9A 3BD6A 3JWPA 5TPZD 3RSQA 2QTLA 2ZE8A 4NBVA 2OYCA 4M98A 4ZEWA 1S89A 4GSKA 3LECA 1V0JA 4Q34A 2WVAA 3V1LA 4AW9A 2QTWB 3FMGA 2E1RA 3SIWA 1K6EA 4AS3A 5KYXA 3E9QA 1QFYA 3M6WA 4HVAA 4IJMA 5CK4A 4PZYA 3U4QB 5AHKA 1P0CA 5CNMA 1EXDA 1X77A 4D8WA 1XMPA 2Q27A 3RWOA 4X6LA 1U1EA 5DRYA 3CLKA 2V1XA 4UCWA 5DDIP 2XH8A 1R8QA 3KUXA 4ZYTA 2FR8C 2VBCA 3T5TA 2H4FA 3LQ1A 5F35A 1XCBA 2D1YA 1IXYA 1DKOA 1JIXA 1G5TA 4Z9BA 3VX4A 1D9XA 2C0CA 2HYDA 1AT1A 1JG1A 5KU1A 1PZEA 1NJ2A 1Q7TA 4LX8A 1AKEA 4Y0NA 1TEXA 3ZJ5A 4HH4A 1PZXA 4ZT4A 1MGPA 1OOEA 2WSSD 3SR3A 3MMPA 5CB4B 4TS1A 1KOLA 1L7AA 1A8HA 4LNUB 3RVRA 1SN7A 1ZICA 4LMAA 4YDHB 2JVJA 1Z0UA 3QSGA 3LBAA 4GBGA 4LXYA 4QLAA 3PF9A 1XQXA 3BD7A 1PTJC 1U7ZA 3DEAA 3R0QA 4MWGA 3DPSA 4REQB 1R9NA 2AG1A 3LP5A 3PPYA 4OPMA 4CM7A 4CN8A 5K8IA 2JFFA 1W49A 1Y3CE 4JXKA 3TINA 5FAXA 1KSFX 1STOA 3QJ5A 1N8KA 2AMFA 4ZOBA 1AM4D 4YYEA 1U0OC 4CLRB 3A6KA 1I7QB 1PJ3A 3D8HA 1P7PA 4URVR 5IKPA 1PW7A 1ECJA 4FGSA 4JFAA 2WNHA 3EGIA 5DP2A 3HK2A 4MUMA 2H7CA 3GLFA 4EHBA 2P0AA 5L7WA 1H8HA 2FG6C 1HTWA 3C8MA 3VVLA 3TIGA 1BHJA 4NU0A 5J2TB 3NHBA 2FWBA 2L0XA 4G9GA 4HPXB 1FDTA 4DR6B 1WD5A 3HY3A 3LIIA 1HDEA 2G0TA 3B1WA 3DV9A 4G5YA 5E4TA 3B20A 4QREA 3U4HA 2HZBA 4RTPA 1AV7A 2IF2A 4EZBA 3A6DA 3AR4A 1DWQA 4UE3S 1UJCA 3L4SO 3C3AA 2ARKA 1IY9A 3OC0A 5ABPA 3KD3A 4Q4JA 3ZGXA 4PRLA 5TE9A 5IM5A 3D2BA 2DKNA 5F2EA 4IGEA 1R0KA 2P5TB 2YDXA 3L46A 3WNBA 2M9MA 3TE7A 5CFZA 3ZOZA 3NM6B 1PBNA 1R1DA 2JDID 2Y1OA 4NG4A 4NJEA 5F78A 3QMWA 3HDJA 4ZAZA 2XKJE 5I9SA 4QZVA 3N2IA 4N6NA 1BW9B 5BWCA 2ZTHA 4F7WA 2WJ6A 3NJRA 3NOOA 5JYDA 2VUUA 3LUDA 5BNFA 4ZJPA 3BSYA 1CV2A 3DT6A 1R8YA 3PDCA 4ASUD 3IOEA 3A9VA 4L51A 1DE0A 3DE0X 3H1TA 4YP1A 3LH5A 5JU6A 1G6Q1 1GAQA 2I1LA 1UQUA 2G83A 2DGDA 2NGRA 1G5IA 1XZLA 1R0YA 1YRWA 4HLDA 5A9TA 1NNI1 1D6MA 3OZ7A 5IW8A 1EFUA 2YRFA 2ZSUA 3HCAA 1XCMA 3EVBA 2AZDA 2PSJA 4RHXA 4QPDA 2Y4OA 2AOUA 2RCNA 3FWZA 4RMGA 4C3OB 2IIPA 3QPUA 1TK3A 1ZRNA 3ZWOA 1EP2B 1O9HA 1IK6A 1GRCA 2BE9A 3NNSA 3OPQA 1TAUA 4ZCIA 1OYOA 1E59A 3CRMA 5LZ4A 3KUUA 1G42A 5EVCA 2C0PA 4XD7A 2E89A 4K6GA 3H0EA 4LE2A 5AFSA 1J2YA 1PNQA 4R16A 3TFWA 1DINA 1PTJA 3BFPA 4XGRA 3SK0A 3U49A 1IBCA 5D86A 2FR1A 3HBMA 3KZMA 4FR2A 1TU3A 5LXTF 1OUMA 4KPEC 2HRZA 3HPQA 3U13A 4DV5B 3HB9A 1CQIA 1W93A 2FWNA 3SI7A 2SHKA 5HP4A 4D92A 2A5LA 3RBVA 4E31A 2DQKA 4BASA 5BSKA 5KNDA 3C74A 1CY2A 5I4IA 1E77A 1SCJA 1EI9A 3LPAA 5E2AA 4UVEA 3K5WA 4ITVA 5LQUA 1VYTA 4HN2A 1Q7CA 4DA0A 2IJGX 3UC9A 1NSFA 2HQBA 4KGXA 4UAGA 1LS6A 1SOAA 4UHCA 1A7AA 5K3SA 2DG2A 4DWWA 4DR5B 4OLHA 5AI4A 4QULA 1HI9A 3NC1C 3RVDA 5B7QA 1R5NA 1MB0A 4Q1VA 5AI6A 5AESA 4ZCQA 4DDHA 1ONSA 2WJ3A 1VLQA 4D0NA 4TVKA 3OCYA 1OKKA 4D9GA 5J2TA 1YVEI 5KNCH 5IJ0B 1U2GA 2CJPA 3OY2A 2A5YB 1RJEA 4YUYA 1V8FA 3G2MA 5SY4A 1ZH0A 4EMBA 3J81k 1XQ1A 3WJ1A 4E4YA 1AQJA 1VKHA 2HK7A 2VP9A 1G4AE 4M76B 1FTWA 2I78A 1ECCA 4LJKA 5DXAA 3OIGA 4X44A 1PNTA 1MO4A 1DJMA 2RGCA 3G5MA 1IULA 3EIXA 5ALOA 1GSIA 4TRNA 1REQB 5D51S 1TRKA 1M6VA 3OT4A 1NBAA 2IEDA 1U1CA 4HEQA 4W99A 3REGA 3AR5A 1BXRA 3TNFA 1NLFA 3FSGA 4BEWA 1B15A 5IC4A 2BCJQ 3E81A 4IIJF 5FR1A 1GPMA 4GX1A 1CY4A 2ZUSA 4UULA 1N6RA 3W4KA 4ATNA 1HC7A 5CVDA 4MQMA 2Q6KA 3CJRA 5JAZA 1GLVA 1PW5A 1SC3A 5FL7A 4TKUB 3L1IA 4G0ZA 3B1JA 4LS3A 3FD8A 3JQAD 3LT0A 1SGWA 2Z30A 3DCJA 2HLPA 3G1WA 3RAJA 4EPTA 4YCMA 5IEJA 2B92A 3RRJA 3ZWQA 2I9KA 4NCJA 5DH9A 1CW2B 4FB5A 3TIIA 3A3YA 5CA1F 4I50B 5HDBB 4UM9B 3MGBA 4H6WA 1RWXA 1VOTA 4PIMA 4Z0NA 3F90A 4KQKA 4BJ5A 2DUMA 2B2XA 1P3JA 4MARA 1N1MA 1PHPA 2JFPA 5B6JA 1WMFA 4MULA 3C8UA 5BRAA 4Q00A 1B0UA 3GFPA 1RQ7A 4MRAA 2L69A 1T4CA 1QHHB 3DT9A 3H19A 5HG0A 5NLLA 3EGCA 3SF0A 3T9DA 2J87A 2YJNA 1JDSA 2QYOA 2V55B 2V4UA 4Y98A 5E4FA 5EEGA 3PX7A 2ODTX 5CJJA 3P9NA 4G97A 4OXXA 4L8YA 3IIMA 1J00A 3L4BA 3JARB 3Q5EA 4N5HX 5DE3A 2XNJA 3AEKA 1KS2A 1NVFA 2PD4A 5K4GA 4AN1A 2MCFA 3U4DA 4WN9A 3BFJA 1XTQA 3LLMA 1JH8A 2ZXFA 2V6IA 2D1SA 2N46A 3OPMA 5E6UB 4DWOA 2WWVD 1LPPA 2DPGA 2W93A 1CK4A 4DY4A 1ABBA 2F00A 2JI9A 3RASA 4X95A 5TMBA 3CSSA 4NV3A 3ZY3A 2C7QA 1XJ5A 1WNTA 3Q0TA 4CR7A 4D9IA 1WS6A 2C1ZA 1OAAA 3I6ZA 1IK4A 3CEJA 2FPXA 1BE0A 4RKRA 1LI4A 2KYRA 2MSKA 3I32A 3UPUA 2BEVA 2RB4A 3UMMA 1ZD9A 3O0DA 1XRSB 2Q41A 1Q3KA 3K0BA 1LSUA 3WZLA 3GPIA 3WOHA 1HSZA 4C7MA 2ZRAA 2SKCA 2Z5GA 4FPXA 1FLNA 3IIEA 5DRTA 3RS4A 4CQJA 3RT1A 4Z3OA 1KS9A 4ODIA 1DC4A 4TN5A 2PKRA 3QPDA 4AKEA 3EEYA 1V5WA 4TYMA 3A4MA 1NKSA 1P81A 2JLYA 1YR8A 2LE0A 4HATA 4QHTA 2EU8A 4BKOA 4RSHA 1JHUA 2R11A 1NF3A 2J09A 3JQGA 2GR9A 3VOSA 2QM3A 4F1JA 2QX7A 3C6KA 3WB0A 1OD6A 3EZXA 1O8CA 1DO8A 4OFBA 4GPD1 5JVDA 1ZLYA 2I76A 3QH4A 4WCFB 1YS2X 3HM2A 1WDLA 1YDEA 1ZVKA 3V7FA 3MIZA 5KJCA 2V7WA 1JFVA 3AG5A 3EGDB 1QRUA 5A4JA 1WP9A 1YCFA 2GJAA 4F9GA 3K0CC 5FUVA 3H9BA 1YRHA 4LZWA 5IARA 1IZ0A 3L0IB 5DM60 2QB5A 5BOSB 4IIEA 2J85A 4YXFA 3ML1A 2VHTA 2OSBA 4BQEA 3QPAA 4QYMA 2R6JA 1ZISA 1SA0B 3WV5A 5JRDS 2QE7D 1QHIA 1H5NA 2QU7A 3JVEA 5K1ZA 1A2OA 1G5FA 1U11A 2ZUFA 2XOEA 3EB9A 3FMOB 4UTOA 3ZBQA 1M5UA 4BY9E 4G0PA 1BNCA 2GHQA 3DMPA 4P5DA 3H11A 4NBRA 4XX1A 5ANRB 5A1TA 3AY7A 2Q5CA 4YR7A 1T13A 4G4GA 5CVTA 3A1FA 1XL0A 1N0UA 1QRDA 1ATIA 3Q8XB 1QVRA 3WNDA 3TRDA 1DIOB 4RHFA 4V0MA 4CMIA 2YIJA 5I8WA 5IVHA 2X0DA 4KRFA 4I9GA 1E7MA 2ZIUB 2IGTA 3WOVA 3DE1X 3HVJA 1QYXA 2I1WA 2Z58A 4ALJA 4Z7NB 3U61B 2NV2B 3SCZA 4RA9A 5FA8A 5G40A 1ZOOA 5LQCA 2WF9A 3ZHYA 1NG1A 1GZ5A 4RSRA 3ZDZB 1SXIA 3LA6A 4B4OA 2ERCA 3HJHA 5IAOA 1Z4LA 3WLEA 5HX7A 4D79A 3HFJA 2YXNA 3LGXA 4MUAA 4W5QA 3R1IA 4G5GA 4MWSA 4RJIA 3OZWA 5I4CA 2QTVA 3IIKA 4BNFA 3ZJTA 1XK6A 4YCNA 1SQSA 2CL0X 3OF2A 3IEUA 1T8SA 1Q7BA 4GRIA 1MB3A 2YBDA 3HL0A 4P4TA 3D4IA 1E2MA 2SKEA 3KHTA 1VIDA 1NV9A 5BV2P 5ELMA 4DABA 3SM9A 5KTMA 4TYYA 4H7IA 1II0A 2OLJA 5EIFA 1N0WA 1RAGA 4OQEA 1J33A 2GF0A 4MEJA 5E9JA 1DEHA 3RARA 2WT8A 4ZTBA 4NYIR 5JRZA 4FSDA 3MUEA 2Z6AA 1U0BB 2FX2A 3RSFA 5EIEA 1JEDA 1IDN1 3ZV3A 4BEJA 3MJ4A 4AKHA 2C4NA 2Q29A 2HUNA 4QICA 4Q4AA 4YS6A 4HT3B 1CYDA 3QKSA 1Z63A 1Q0LA 2O1EA 2FOXA 3CMCO 1LPOA 3EQ2A 3HY6A 1S2LA 5ALJA 3BTUA 4R2MA 1U8YA 2WYVA 3FLBA 5TRTA 4AD8A 5ALVA 2O8EB 2IYSA 1VECA 3NTLA 2BELA 3U60B 2GLUA 2ZZKA 1M5RA 4FFWA 2AQ8A 4JCOA 4KU4A 3QBTA 4ZHQF 1WCYA 3U48A 4FJ0A 2Q6IA 4RELA 3D2LA 1F2UA 5AW2A 4A2WA 3ZCSA 4GC9A 3I5YA 1NW4A 4QT0A 4GDMA 5JZ9A 3OJ0A 4RKEA 5HZHA 2GJ4A 3CO5A 4K6OA 3IR5A 4YO8A 4J1TA 5EFOA 3LT5A 2FQ1A 2GARA 3EC1A 2NUBA 4HDNB 4B4WA 1Z4IA 5J4VA 2WZBA 1LWNA