4C0QC

Transportin 3 in complex with ran(q69l)gtp
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
169
structure length
169
Chain Sequence
VQFKLVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGPIKFNVWDTAGLEKFGGLRDGYYIQAQCAIIMFDVTSRVTYKNVPNWHRDLVRVCENIPIVLCGNKVDIKDRKVKAKSIVFHRKKNLQYYDISAKSNYNFEKPFLWLARKLIGDPNLEFV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for Nuclear Import of Splicing Factors by Human Transportin 3.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein/gtp-binding protein
molecule keywords TRANSPORTIN-3
total genus 45
structure length 169
sequence length 169
chains with identical sequence D
ec nomenclature
pdb deposition date 2013-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4c0qC00
1WCV1 1E94E 3BIFA 1VG0B 2J3EA 5UKDA 1FTSA 1M7HA 2FG5A 3CPEA 2V4ZA 1SVWA 2ZRHA 1SVOA 1VECA 2VTKA 4DXAA 4FMDB 2W6ID 2ZU0C 1GDDA 2NPFA 4CEIB 1CLUA 3O8BA 2C2HA 4Q9LA 1Z06A 4CEJB 3K0CA 1CS4C 4TSFD 4BPBA 5CYPA 2F6RA 4JLOA 4X8MA 5FBRB 4PZZA 2V9PA 1FX0B 2QI9C 4L9SA 4LBYA 1A5TA 2ZRIA 1EXMA 2O8FA 3EPLA 1T5LA 5HR5A 1XXHE 1YZGA 5EP1A 2N42A 2XTZA 1NF3A 4JJKA 1XPOA 4CEHB 2XZPA 2XXAA 2C9YA 4N0EA 2A7QA 2I3BA 4KODA 1N0UA 3MFYA 4F7WA 1W36C 3K0FB 2IWRA 4GZLA 2VYFA 2WJGA 3BORA 4JSTA 2WJIA 3VU9B 1NJGA 2MSCB 2CVHA 2OSBA 4HAYA 4PANA 5CM8B 4DLZA 2RHDA 3C15C 2JLXA 1DO2A 2RGDA 3QEJA 1P5ZB 1SXJA 5L3SA 3DDCA 2O0KA 4G5SA 3MMPA 2GXSA 3BS4A 2YC4C 4C30A 3FHTA 4M9ZA 3GLIB 1XEXB 3QIAA 5GVSA 2J5XA 1ZUNB 2ZJAA 4XWAA 3A36A 1NP6A 1W7AA 4MGYR 2V55B 4LBWA 4LJYA 4TYWA 2NO1A 1KDPA 1SXJE 1P2UA 3MWKA 2BM0A 3ZJYA 1L4UA 4B35A 1MABB 4EKDA 4TL6A 1WMSA 1OH6A 2O8EB 5FFMA 2FU5C 5AJWA 4LOAA 1TEVA 1W0KD 3BWDD 2BJWA 3AVPA 5KSZA 5EUQB 3LWNA 4QGAA 4DEYA 3WMGA 3TW4A 4W5WA 1IXZA 4RD2A 4B3DA 3ND9A 5ANRB 4Z8XA 3UKDA 3TNFA 2F3TA 3KL4A 4DDTA 3ADKA 5L3RA 2Z6VA 3VAAA 3LBNA 2OFWA 4BLPA 2QT1A 4GP6A 3L43A 3FKSA 3OIWA 4DEXA 1NVVR 3AB3A 4JLPA 5K8UA 2FA9A 1E2IA 3C8UA 4P4SA 4GSYA 4KLNA 1WQ1R 3RRNA 2Q0HA 3NHBA 1KJWA 2BVNA 2F1IA 3VR6A 3AVQA 4PC1A 4IXNA 1FP6A 4LX0A 2PZGA 3TE6A 4IVPA 2IS1A 4A1FA 2ZIAA 4DLXA 4H9GA 2ZYWX 4OQLA 1B0UA 5C4GB 2HJVA 1KKLA 1VYUA 2WJJA 3QKSA 5IRCD 2CLDX 2GBLA 2HLDA 5FH9A 1WXQA 3HYTA 4POAA 3DMDA 1E4VA 4I1OA 1I2DA 3EIQA 4BGDA 2A5JA 2RGAA 1DO0A 1E1QD 1P3JA 2XEXA 3NC0C 3WMFA 4BFVA 1J8MF 3QE0A 4II7A 3ZIAA 2PEYA 3JZMA 1GVNB 3W8NA 4V0ME 1EFTA 1PUJA 2Q6TA 1P9NA 2G1JA 2O8EA 4NL4H 1G1MA 2LCFA 1T3HA 5FUXA 2VHJA 2ZYTX 4E09A 2QQEA 2ODNA 2QEQA 2WAYA 1OB5A 4C0AC 4Q7JB 2OCPA 2QA5A 4DLYA 4JL8A 1AS2A 1COWD 5DO9A 3SHWA 1RZ3A 4Q7KA 1ZCBA 4Q7LA 3G82C 3LXXA 1T6NA 4DLTA 2BKEA 4M1MA 2ZI4A 1XXHB 3AVUA 1E2HA 5CK4A 1Z8FA 4M1YA 1XF9A 4PC7A 4B74A 4M9XA 3AF2A 4W7SA 1FMLA 1XP8A 3SJCA 4NDZA 4AK9A 3CPHA 5DHAA 1SGWA 1N5JA 4DIDA 4JVLA 1UKYA 4JBXA 5TDHA 1SHKA 2E1RA 1E9FA 1W2HA 2QY9A 2MSEB 1NMYA 5EE1A 1TQ2A 5CIWA 1BIFA 2RHMA 2AKAB 2C98A 4NYMQ 4UXIA 1OKKD 4Y0AA 1BO6A 1SVKA 2CHGA 4NYJR 3ZVRA 1VIYA 2JATA 1U9IA 5FL7D 2EVWX 1CU1A 2IF2A 1OXXK 2H5EA 5HTKA 3W6OA 1GIAA 1M2OB 2GNOA 2ODBA 3PVSA 4DLRA 2IS4A 3C5HA 1K5DA 5DGXA 2XZOA 4Q48A 2BMDA 3B82A 2JIZD 4Z1MD 1EESA 4OQXA 1D2NA 3T1TA 2F55A 3KXLA 5KYKA 4CEHA 4I4LA 1SXJD 4HZUB 2VHUA 2V7QD 3G5UA 5JLJA 3QKRB 4RCYA 1VDZA 4LPSA 4XH9B 2J7PA 4L5BA 1Q57A 2SHKA 1US8A 3D31A 5L3QB 2CMKA 2VP6A 3UMSA 3SYLA 2X77A 1E1RA 2BBWA 1R4AA 3RYTC 1GOTA 4HAUA 1Z0AA 2C5LA 1F60A 2ZRJA 2PMDA 1G6HA 2QG6A 1U0JA 4HLCA 4Q47A 4CW7A 4NE2A 1NSFA 2W2VA 2BWJA 1QHXA 3HPQA 1N5LA 3F8TA 4PZYA 4P33A 4DSOA 5K8TA 2O8DB 1GKUB 4CT5A 1YHNA 3TVDA 1AM4D 2ZI5A 3FHCB 1KZGB 3DOEA 5FI1B 4JBWA 4BUJA 1DADA 2Z5FA 4LHXA 2PZEA 3PEWA 4AY2A 3SJAA 5JHGB 2FNAA 5AWFC 1IN6A 4ZI2A 3DZDA 1F2UB 2RGBA 1G21E 1W2GA 1Z29A 2G3YA 3T1OA 2GXAA 1KI6A 4MRSA 4EPXA 1NKSA 3GLGA 2BMJA 2WOOA 4Q1DA 3THYB 4A8JC 2FX3A 1JPJA 4F4CA 1DEKA 3PUZA 2WIAA 3Q5DA 2OBNA 1HT1E 4LYJA 1E2PA 2ZE6A 2VO1A 4Q00A 2Z4RA 4TYNA 3AKCA 1WDTA 1EGAA 4JLJA 1ZRHA 4HDCA 4JT4A 1NKTA 4HDQB 2R65A 1DAIA 3I92A 5JMTA 4EJSB 4MDEA 2QORA 1JI0A 4OHWA 1G6OA 4OJQA 1BKDR 4Q03A 4AIIA 1IN8A 2BMFA 4P4SB 1R7RA 3EIEA 2VF7A 4BLRA 1NJFA 4BLQA 5DN6D 4Q4JB 2IX3A 3QSYA 1E0SA 2ONJA 3PEVA 3CR7A 1U94A 2O52A 3N5CA 4M1OA 2WWWA 3CW2A 3LX8A 1ELOA 2BDTA 2QMUA 1HE1C 5H70A 2ZE7A 4A8JB 4JS0A 1NN0A 1E0JA 2CEAA 2VQSA 3CWQA 4OK3A 4Q4LA 2IBMA 1T8UA 1QRAA 2EWVA 2GJKA 5CJ2A 4B3BA 2QT0A 4D0NA 2J0QA 4E07A 1XJ0A 3NTUA 2D4HA 1EFRA 1FUUA 2IXEA 3FMOB 5CB6A 3QXJA 1E2FA 2FPLA 4JKIA 5AUOB 1KSJA 1CJUC 3B1WA 4KVAA 5BW8A 3WYAA 2ZSAA 4UNSA 1A7JA 4LJ6A 5JWOA 4KAXA 1Q3TA 3MLEA 4BEBA 2A3RA 3WMEA 2R44A 3X1ZA 2IYYA 1WBDA 1VHTA 1E69A 1G18A 1D2MA 1LVGA 2W0MA 3EA5A 1XJQA 4KHZA 3CX6A 3TQCA 1UEIA 4TLDA 3W8RA 4LJ8A 2CLSA 5H68A 4AI6A 2ZAMA 4Q9HA 4B2LA 2A5DA 4QJ4A 1Z6TA 4QHYA 5JS7A 5JJLA 2J46A 1G3RA 4KYUA 2OXRA 5KDLA 1KSGA 4KYIB 1TF2A 4QKQA 2Q3HA 4TWZA 5GVRA 4TSFA 2Q9CA 2CL0X 1Z07A 4AG5A 2WHXA 1DELA 1E9BA 3SQWA 2FEOA 1GM5A 3O8CA 2BV3A 1RFLA 1II8B 1PUIA 4JLDA 1NBME 2OG2A 1M6NA 4D2IA 2AK3A 2B8WA 1KK2A 1KI3A 2JA1A 2AL7A 2X2EA 3OHMA 2QTVB 3VTKA 3FKQA 3RANA 5P21A 3EPJA 3LV8A 1IN4A 4IFBA 5EZ5A 4HLUC 3EX7C 4P4TA 3A1TA 2EU8A 3B9QA 3PEYA 5K8LA 3VX4A 3AGQA 4PPGA 2H18A 3BB3A 4WZBE 3H86A 3P26A 5AJYA 4G5OA 3KDSE 4NCHA 2F43B 3K70C 2ZSDA 4JIMA 1UBCA 2IW3A 3QENA 1IXRC 3FFAA 3HU1A 3VKWA 1HH4A 1ZAKA 1XCGB 5FPKA 2GCOB 4IEEA 2OM2A 4OHYA 2KB0A 1I4TD 2O8FB 4A0HA 2DWQA 4RKFA 1JR3E 2OCAA 1G8YA 1ZM7A 2IUTA 4HI0E 2WPDA 3GLGE 4JBYA 3U7HB 3AGPA 3R9XA 4Q7MB 3RS5A 4LYAA 1Z22A 3KJIA 3VKGA 1GFIA 3A1VA 4U7DA 1EX7A 3SHFA 2QRNA 3IO3A 5FPYA 2GK6A 1IQPA 4M9SA 2IYQA 4RFSB 2FGKA 3ZVLA 4EPWA 2QBYA 4HB0A 4Q4AB 1CRQA 2ZRDA 2YWGA 2EYQA 1IHUA 2IYTA 2WV9A 2ZR9A 3QVUA 4TMTA 4NBSA 1Q20A 1N6IA 4XJXA 3AM1A 4FMCF 1YZUA 2JDID 2GVDC 1ZP6A 1ZU4A 2W58A 2WIBA 4Q4JA 3K70B 3R9WA 1XB2A 5B58C 2G9NA 2XSZD 1ZNZA 1R0ZA 4V0KA 1CR0A 1F2UA 3WBKA 4LV6A 2IYVA 5FOUA 4C4PA 1HV8A 3GLHA 4ESVA 2OHFA 3NWJA 5FOWA 4DDUA 1EFUA 2JEOA 2YV5A 1OT3A 3SDZA 3SC3A 4DVGA 1NLYA 2ZUCA 4Z8YA 4ZKDA 1G4AE 3MGCA 3SU8A 2IUUA 2ZQ5A 1W1WA 2QP3A 3IBGA 3FGNA 3BFXA 3TUIC 3ZZTA 2CE7A 4RCZA 2FFBA 4D4KA 5DSZA 3SBEA 3AVOA 3MD0A 4KI0A 4EUNA 2ZRKA 4ZI3A 5C2JB 1WA5A 2GAOA 4PC6A 1BMFD 1JAIA 4UJ5A 5J47A 3M1IA 5J5CA 1ZMXA 3LVRE 1OXTA 1TF7A 3K9NA 2OILA 3HYRA 3N2IA 5LPNA 2F9LA 4HEJA 4RZXA 4X8OA 2ZSFA 3VR4A 1CBUA 1XCPA 2PJZA 4JJZA 2QMOA 3ZS9A 2QPAA 5EXPA 2OZEA 1G9XA 2ZYUX 4MGKR 1L4YA 1NI3A 1N2CE 1ZYUA 2REXB 3AEZA 3UIEA 1NNEA 1A4RA 3GMTA 5KNBA 1TTTA 2JCSA 1N25A 5EP3A 5KU1A 1OB2A 2KWIA 3ONWA 5JSZB 2FSFA 2IF0A 1A2KC 3EAQA 2XB4A 1XX6A 2FDCA 1YR8A 2ECKA 3QKUA 3K70D 1JECA 3M4YA 4LV5B 4XWKA 2NIPA 2NO9A 1ZD8A 1RW4A 2PT7A 3ETLA 2DCUA 1NVWQ 1MOZA 5LBIA 4E5UA 4DKXA 2GTPA 1WE2A 4ZO4A 4US2R 4D4LA 2VP0A 2QQ0A 2GCPA 4OI1A 3HR7A 2XZLA 2XTNA 3GJ7A 4TYYA 1YR6A 4RY2A 4D0GA 3TUZC 2GCNA 4Y0VA 3BE4A 5BYKA 4TYQA 1D6JA 4N1AA 1A1VA 1Z6AA 2A78A 2CL6X 1AZTA 4XD7D 3EARA 1UKEA 4QGFA 2C04A 3U3OA 3I73A 4CVNA 4URWR 1I2MA 1HA3A 1E9SA 4B44A 2QROA 1RRGA 4DWJA 4KITB 2OE2A 2PX3A 3ZZUA 1U98A 3KB1A 2IWHA 3OEEA 3RNLA 1Z5ZA 3QXXA 4M1KA 3I1FA 1GP2A 2JJ8A 2QAGA 1E3MA 2IUSA 2P6RA 2IC5A 2Q9BA 3SYNA 3T35A 2IYRA 1QHIA 3HPRA 4HAWA 2QRZA 2ZJ8A 2QAJA 2D3WA 4KBFA 5BYJA 2YYZA 2G77B 1GKYA 1UFQA 1VG1A 3UG7A 5F3WB 2JASA 1OSNA 1H8HD 2JJ1D 421PA 4P3YA 4V0NA 3GEHA 2R62A 2KBFA 2ZETA 3LDAA 4GDFA 2AWOA 3KQUA 1GSIA 4BRWA 1E9RA 1XCMA 4ACAA 1N5IA 4B3GA 3ASZA 2DBYA 2PLRA 5C18A 3KKMA 4GOKA 5AJZA 2O8CA 4PHTA 1MO4A 2CCGA 1K8RA 1ODFA 4GRAA 1W36D 4TMXA 4JLVA 2WMOB 2WSSD 3UATA 1EWRA 1C4OA 1T0HB 4LI0A 4U02A 3K8YA 3QXCA 2NO7A 2O8CB 1G4UR 4URXR 4TMKA 1HQYE 2GDJA 3K09A 1GILA 3WNBA 121PA 4FMCB 2RKOA 2Q9AA 4PX9A 3GJ5A 2PCJA 4PAOA 4KFRA 4LRWA 3R7WA 3VNUA 2LWIA 5EE0A 1NIPA 2GA8A 1W36B 2A2ZA 5E3HA 1IM2A 3REGA 2HDNB 4GNKA 3FTQA 4MYHA 3M6AA 2CL7X 4ZV4A 4B75A 1D8TA 3K9LA 1FQJA 1KSFX 3UMFA 1NVXQ 3GCGA 1CJMA 4C0QC 4CIDA 2ZJZA 5JZVA 1Q12A 3W9YA 4JZKA 2V1UA 3PQCA 5JJKA 3IQXA 2AFHE 3ZDQA 4C0BA 1TQ6A 3CRW1 1E99A 4OHZA 1XWIA 1XU4A 3CWZA 3P1JA 4LV8B 4HZUA 3AF1A 3OE7A 1W4BA 4MGZR 3TBKA 3OIYA 1HYQA 2H16A 5JJIA 1KK3A 1QHHB 3THXA 5HPYB 1BYUA 2BBOA 2X1VA 1U0HC 5FL7A 3NIBA 4UJ3A 4US0R 4A4DA 3LBIA 4PPFA 5E7IA 3B2EA 3KKNA 3I62A 4QHTA 3N2EA 5AJXA 1EK0A 2JLQA 4NYIQ 3I5XA 2CDNA 1VG9B 2IYXA 3C14C 5IT5A 1NN5A 3U44B 1FOEB 1KSHA 3IHWA 5HCIA 3P4XA 3SZRA 3ZD7A 1JNYA 2FN4A 1Z0JA 3WXMA 2R6AA 3MWLA 5FUVA 1WP9A 4S35A 3NEYA 1G291 2IEZA 2OESA 4PC3A 3BJIC 1N3BA 3DMNA 4MH0R 3REFA 4PAMA 5FTJA 1QHHA 2WWYA 4D4JA 3THXB 2EWWA 3CNNA 3AVYA 1YQTA 2J87A 2DPXA 4Q5IA 3QF4B 1N6RA 3PCRB 1YZNA 4L9WA 1AS0A 4TN1A 1RRPA 3NBFA 3FWYA 2EFEB 4RD6A 3V9PA 2ZJBA 2ZUBA 3AF0A 1W5SA 4NTZA 2ZRFA 4PO9A 2J0UB 1OE0A 4PQRA 5AUNB 2YWHA 5HCNA 5BWMA 2RMKA 5FBQB 4BLSA 221PA 3E5HA 2FMXA 4PC2A 4PR0A 1UAAA 1DTSA 3WRXC 1N6NA 4A0RA 3BFVA 3E2IA 3TH5A 3QF7A 3RVBA 4MRNA 3ADCA 3U7EB 1IBRA 3ZQJA 1CJKC 3T12A 2WVJA 4ZCIA 4WXRA 4BECA 4FWTA 3W90A 3CRVA 5FTMA 2HCJB 2AKYA 3CPJB 5FL3A 3FMPB 4QOSA 4EPTA 5JRZA 1Z0DA 2ZRPA 3L0PA 1ZNXA 2CK3D 1N6PA 3L82B 3ZLJA 4DCTA 4LWZA 2H7VA 3FMIA 3NDBB 3CIOA 2YHSA 5FTLA 2IK8A 1RKBA 2RGEA 2QTFA 1G20E 1R2QA 1NBMA 3AP3A 4AKGA 2YOFA 4YLGA 2OFXA 1E2MA 1FL9A 4OQFA 5DHFA 1JEDA 2ASEA 3KB2A 3LBHA 2ZRCA 1FMJA 3Q85A 2ONKA 3QEOA 4S2EA 3VHXA 2V6IA 2N1BA 2L0XA 1LTQA 1T4GA 1KI9A 2D06A 2WTUA 4XIGS 1HQCA 4OHVA 4EQ6A 5G3YA 4QGHA 2EW1A 2GCOA 1IY0A 1YRBA 1QHYA 4LHWA 3U4QA 2VP2A 2AR7A 4YMWA 3B7GA 4FW9A 5ELXA 1E9DA 5K8IA 2LKDA 5EUMA 2ORVA 1N6KA 3U2QA 2IXGA 2ZM5A 4MDFA 4OBEA 4O0MA 1EG7A 1QDEA 3TMKA 1VCOA 2R6CA 1Z3IX 5L8VA 2W2TA 4I99A 3RS3A 5DI3A 2WM9B 2AFIE 5A5GA 2G1KA 1XMVA 2ZRNA 4R2HA 4NCJA 2H1LA 2ZVPX 4DIEA 2UVQA 2YJTD 3FFBA 4CZ2A 2V6JA 3H4MA 2J7KA 2WWGA 2OV2A 1KO7A 1MH1A 5LD2B 3QF4A 1DAHA 2HYDA 2PMKA 2FPMA 1EFRD 3BK7A 1XTIA 3CRQA 1TUIA 4DCVA 1U8YA 2GF0A 5GJBA 3UANA 3BAFA 5KSPA 1IN7A 1S2MA 2GVZC 1DE0A 2E87A 2JGNA 1T9HA 3Q7PA 4CYMA 1G41A 4TZ6A 4C0LA 2P6NA 5KPDA 2NG1A 1VMAA 1MR3F 2AN9A 1XEWX 2VLIA 3D7MA 4MKIA 1TEXA 1G3IA 3LVQE 3Q9LA 2JLZA 2QM8A 3PUVA 4BE7B 1TF5A 3UXMA 1N0WA 2ATXA 1AIPA 1XZQA 3AUYA 4RSGA 3FB4A 3VX3A 4FD2A 3OFNA 3KTAA 3ASYA 3EWSA 3W6NA 1C9KA 2FZ4A 1C1YA 5DYGA 3EIHA 4DRZA 1LB1B 1U99A 4MKGA 3CF2A 3VQTA 4TQUS 5IF9A 1S0UA 4V0LA 5FOTA 2NOAA 3AP2A 1DAGA 4XSGA 2NPIA 5EXSA 4RKEA 4PXAA 3LD9A 4WOPA 1G5RA 1M8PA 5GJVC 1GNRA 4B6EA 2IYSA 3NVAA 1LF5A 5J4HA 1G8GA 4LY6A 4NH0A 3AF4A 2CLCX 1OIWA 1XZPA 1PZNA 3I32A 4KBGA 1EWQA 3HU3A 2RGNA 1VCIA 3U3JA 1HURA 3AKDA 5IK2D 5FI0B 5CDFA 2ZJOA 3K0AA 3QBVA 3I4LA 1R5NA 3EZFA 1P72A 2QMHA 4HB2A 2NO0A 2ZRAA 2ZYVX 2N46A 3ADBA 1UBFA 3THOA 1EFHA 3VMFA 4GMXA 3K9HA 3U61B 4XOIA 4PHFA 4TLBA 3TKLA 1DS6A 2OAQ1 2P5SA 3I8SA 1KGDA 4LJ7A 2A5GA 4CEJA 3PITA 1XPUA 1X3SA 2GXQA 1QG2A 1E6CA 5SZJA 3J81k 4RZ3A 3T61A 4PHHA 4JLMA 2Z83A 5JS8A 3VFDA 2FFQA 4KXFB 4QM6A 2QP4A 1ZNWA 1KO4A 3BD9A 4B76A 1IAQA 4FMDF 1XMIA 2A5YB 4M4SA 2B6HA 4ZCLA 2W6JD 1P61B 1TPZA 3QXHA 1MO6A 1IN5A 2V7QA 4FIDA 3R9IA 2JLUA 4HYYA 3QNUA 3MWYW 1ZD1A 2ORIA 2D2FA 3PR1A 4HAZA 5DIFA 1YJ5A 1ZNYA 2QAGC 4LCBA 1SVMA 2PX0A 3IEUA 2Q3FA 5E4FA 2AD5A 3B6EA 1IY2A 1K5GA 4CT4B 4LSGA 1XTSA 2WWIA 1Q22A 3L8YA 4RZUA 4C7OB 1KI1A 2RGNC 1ZUHA 3OF5A 4PPQA 4ILEA 3GLFA 1JBKA 1G7CA 4MRVA 3X1XA 1UJ2A 2YWFA 1UDWA 1X8LA 2CHQA 2YINC 5AUPB 2XTMA 1IXSB 1E2JA 4A15A 4MKHA 4B3CA 3FE2A 1IJEA 1RVDA 3GLGB 2ZRGA 1PLLA 3L0IB 2GAAA 1ZC4A 4Q1EA 1KMQA 1OXVA 1OYWA 1B23P 2XNDA 1E2GA 1OYYA 3NBZC 4FCWA 1AN0A 2QENA 1Z0IA 2ZTSA 2QAGB 2QGZA 2XOKD 3IHLA 4DBLC 4AKHA 1F2TA 3GLIA 2O8BA 1RYFA 4P32A 2AWNA 4K46A 4ZDKA 2FFHA 4GOXA 2FPKA 3B1YA 2DWPA 2ODEA 2G0NA 2OEPA 3B85A 6Q21A 2XAUA 4DCNA 1II9A 1W48A 4Q9JA 2R9VA 2FSIA 1J7KA 1KO1A 4NKRA 5E95A 1UADA 3N70A 2AXNA 2GILA 4EFNA 4WIAA 4URZR 1QG4A 1WF3A 2WKQA 2JLRA 5FOSA 1TQ4A 1Z2AA 1KNQA 2FF7A 2ZU6A 4WBSA 5B57C 3AV0B 3PIRA 4NCNA 4K8OA 3TSZA 3KQKA 1Q44A 4ACBA 3DZ8A 3ZS8A 3UK6A 2GKSA 2HF9A 3I8XA 4ZIRB 2P65A 4AKEA 5J4VA 2REOA 4NHOA 1OH7A 2GXUA 2VIIA 3EZ2A 4C3ZA 1MO5A 3OIVA 3B1VA 4OKSA 1G8PA 4ASUD 1GL7A 2XITA 3WHLA 1P4SA 3HJNA 1R5BA 3X1DA 4F91B 2ZE5A 1RE0A 3OEED 4R71A 1XPRA 2HLDD 2W00A 4JLAA 4OJKA 5BXQC 5JHHB 3TSOA 1TADA 1CJTC 3LQRA 2E9SA 1KY3A 3U44A 1W49A 4AYTA 2ODWA 3T15A 4A8JA 3K0FA 3MCAA 2D7CA 3AF3A 1KKMA 4XD7A 3K9GA 4OI0A 2GJ8A 3CB4A 3L2OB 2IL1A 3OESA 4G5RA 5EE3A 3CUEF 3RRMA 721PA 4G5QA 4KCGA 2RCNA 3SNHA 5DYIA 2V8OA 4F92B 2GJSA 5KNCA 1XNJA 4DLUA 4D80A 3FKSD 2JLVA 3U4QB 2W2XA 3AVVA 4OYHA 4A36A 3GEEA 3RWMB 3WHKA 2BOVA 1S9DA 2H92A 2OBLA 1NVUQ 2XNDD 4J0QA 5EE5B 4EFLA 1E79D 3GJXC 4WZAE 2NO6A 1Z6XA 4GFDA 3PV0A 1HTWA 4C9BA 5EXTA 1N0VC 4B73A 5CLQA 4MRRA 2J7PD 3SFZA 5EXXA 1RRCA 4YONB 1G16A 1H8ED 1G8FA 2IYZA 2ZREA 1P7CA 3SYKA 3KUDA 4EPRA 5HE9A 4LHVA 4Q02A 4OQMA 4YMSA 2JAQA 2JLWA 2C9CA 2WKPA 4OK5A 5EJEA 4EJSA 4EQ6B 2X2FA 4Q21A 5EQTA 1ZW6A 3EW9A 1OIXA 3X2SA 2OCYC 3TQFA 1GRNA 3IIKA 1KHTA 1U9IC 1KOFA 3IUYA 3K0CC 5TMPA 1PVOA 1JR3D 1KMHB 2GEVA 1U90A 2VHQA 1OKKA 1GUAA 2Q3MA 2F1HA 4L16A 2VA8A 4Q1BA 2V3CC 1M1YE 1XFAA 2QPTA 2ANCA 2GRJA 4A9AA 4YDHB 1LS6A 2BIFA 3DEFA 1NSTA 4G01B 4BLOA 3BB4A 3FYHA 2IYWA 2EFGA 4JL6A 5DN6A 2HUPA 3LXRA 2HXYA 4JYBA 4MQBA 5CM9C 4LZZA 2W0SA 5DE3A 2EFCB 1XD8A 2VRWA 2C96A 3EC2A 5CJPA 4A0GA 2OBMA 4D4MA 2C9OA 3TW8B 3U3RA 3B60A 1GITA 4QBHA 5FR1A 3FPAA 4M22A 1W46A 3W6PA 1KDRA 4BEJA 2EFDB 2ZI6A 1ZBDA 5KOYA 4MYTA 5BN4A 3NG1A 4B47A 4OHXA 4DCSA 1T3SA 1KNXA 1LW7A 3OZXA 4Q1FA 4X8LA 4UXHA 1LF0A 3W34A 5L3QA 3R8CA 5LD2C 1H8HA 2FE4A 2JJ1A 1OH5A 1J2JA 3WP1B 1XTQA 3Q3JB 3BH7A 2QE7D 2YOHA 4W5JA 2CK3A 3DM9B 4OL0A 2FSHA 4UKDA 4NCKA 4ASUA 5D3MB 1PLJA 2X8AA 3SOPA 4D25A 1FTNA 3ZIAD 4A6XA 4AYWA 3E70C 4ITRC 4QJ3A 2XJ9A 1UEJA 2C99A 3EASA 3GFPA 3CRRA 1TX4B 2VHCA 2PLFA 2QN6A 3I72A 2RGGA 1UM8A 3DOFA 4ERNA 2DY1A 3GJ0A 4KJZA 4YMVA 4ARZB 1DPFA 2VF8A 3JZAA 2XJ4A 2IYLD 2JLSA 2FGJA 1R5OA 1Z28A 4JLBA 5JWRA 1E1RD 4QGGA 4DZZA 1BS1A 4R7ZA 2ZVQX 1MRSA 4RJLA 3F3YA 5FUYA 5FOVA 3RWOA 2J0SA 2P2LA 5KSOA 1YRAA 4BFZA 4XVRA 4NPHA 4WVFA 5G3ZA 1GAJA 1OH8A 1F5NA 1M7GA 2I4IA 5KO2A 3RC3A 5F9FA 5BN3A 3UWKA 521PA 1XEWY 4IFEA 2H57A 4TLEA 5CITA 3IPXA 2V1XA 4MITA 4RFSA 4YC7A 4Z51A 3AUXA 1U2RA 1JEEA 1W47A 4HZIA 1JXOA 3CNOA 2GWHA 1XD9A 4Q18A 3GLIE 1QZXA 1Z0FA 1KI8A 2D2EA 5L3VA 3CBQA 1U81A 3SBDA 1RYHA 3ZH9B 1NLFA 3A1UA 4GT1A 4PO8A 1VPLA 2CJWA 4ZKEA 2GF9A 1NY5A 4AKIA 4IDNA 4Q4HB 2A30A 1IJFA 3WNDA 2ZS8A 4UNRA 4LJAA 1U8AA 2CE2X 2PBRA 2QGNA 5JI2E 5TVKA 3V4FA 3L0SA 4BQSA 2YNMA 3C4JA 4LK2A 3LX5A 3GJ3A 1Y3AA 2Z4SA 4JT2A 5JECA 4Q19A 3IKJA 3NBYC 4GBMA 4TMZA 4TZ0A 5KUTA 2H17A 3DPUA 4IVQA 4RD3A 1P2SA 3GQBA 5SZHB 4F93B 3FMFA 3TAUA 3X1YA 4MA4A 5JWHA 5TY0A 1KO5A 3UMRA 1GTVA 2REBA 2F43A 1GRRA 2I1VB 3O47A 2O5VA 4BFXA 2IHYA 1L7VC 2WAXA 3C7KA 1XEFA 4NP6A 1GRQA 3BFKA 3SQXA 2RH5A 5LDDC 1S1MA 4I1UA 2JJ2D 1Z47A 4ABYA 2W6JA 2WKRA 3PUXA 1MT0A 5CYOA 3AQ4A 5HKKA 1V43A 1MO3A 4NMMA 1ESNA 3BGWA 3RAPR 1COWA 1LY1A 3NC1C 4FINA 5FTNA 1P75A 2BJVA 3X1WA 2FFAA 1VHLA 1NN3A 1II8A 1X6VA 3PG5A 4NCIA 1WB9A 5FOXA 4ZIRA 3U5ZB 4AYXA 3K0AB 3LAWA 1EX6A 2G88A 4PZLA 2WOJA 1VCMA 1W0JD 2PZFA 4QRHA 2ZE8A 1G7RA 2ZXUA 1FZQA 5JCPA 2HF8A 5F2EA 1E2NA 1NL3A 1R0XA 3IQWA 5EZ6B 1SVIA 2EYUA 5CB8A 2OO7A 3KXIA 1V5WA 4HAXA 4YMUA 5TXGA 3W3ZB 4B2PA 1S3GA 1SVLA 2EQBA 3Q8XB 3AVWA 4DLVA 5G40A 1ONBA 3BOSA 1R0WA 1Z6GA 3O8DA 5CIQA 4PAQA 1JR6A 2DHRA 2MMGA 4L15A 4Q9KA 1ZCAA 4DJTA 2WZQA 2FWRA 4QG7A 5KDDA 2VEDA 1P60A 4TMWA 2R6GA 4GMDA 4D26A 1J8YF 3B1ZA 3GLHE 5M04A 3CZQA 3U7GA 2PCLA 4LHYA 3BXZA 3LLMA 3QY0A 1G3MA 4A82A 4AG6A 1BOFA 1FX0A 4B2IA 3UWOA 5JI3E 1ZM9A 1AGPA 2MMCA 4BASA 2UZIR 4CGZA 1I4LD 4EPVA 1ESMA 4DUGD 2DB3A 2QZ4A 3EA0A 4QXAA 4E03A 1D2EA 3R7WB 3ZVNA 3RRYA 1SZPA 3K53A 3KUCA 1G17A 5FBWB 3RABA 2J1LA 2FOLA 1OIVA 1QF9A 3SS8A 1GKIA 3EZ6A 4DSUA 1E9EA 3BBPA 4XWOA 3NH6A 2ZRMA 3TRFA 4HAVA 4M1TA 1AK2A 4IRUB 2D74A 4RVCA 3C41J 4M8NE 1JR3A 4A92A 3RS2A 4GOJA 4LGMA 1KIMA 1NLZA 3ADDA 4U5XA 1KJYA 3IIMA 1T3LA 1Z0KA 3TLXA 3AKYA 3VNVA 1OF1A 3NDPA 1UPTA 1J99A 2BCGY 4W9MC 1P73A 2ANBA 1KMHA 3CR8A 2CNWA 4Q9IA 4TTPA 5GJCA 3KZ1E 3KX2A 1P2VA 3BB1A 4TQ9A 4Z54A 2D7DA 2DFTA 4TTQA 1VKJA 1I4DD 1ZU5A 2QMEA 3H2YA 3BC1A 3C16C 3GPLA 1NG9A 1F48A 3L8ZA 3I61A 4KLZA 1HT2E 2F3RA 4B34A 1Q1QA 3U60B 4D82A 5HZHA 2IXFA 3QBTA 4P4UA 1TL7C 4UXJA 4DB2A 2HCBA 3IIJA 1VG8A 3DVLA 4KV9A 2XB2A 4CDGA 5DI3B 1VYTA 2P5TB 4M0LA 1RJ9A 2BMEA 5JCZA 5C46F 1MRNA 1HUQA 1ANKA 1JJ7A 1E2QA 4OQNA 1BMFA 2C78A 4HATA 4BZXA 4X8HA 2AD1A 4TQAA 3TK1A 4PSAA 5EE9A 3D6TB 4TTRA 1JB1A 1YR9A 3UPUA 2W6IA 1OXSC 4QNMA 1YZKA 3LFUA 3VR1A 4QJ5A 3HP1A 1R0YA 3WP0A 1GNQA 1VIAA 4URUR 1ZM4A 2DFNA 1N5KA 2P67A 1CTQA 4QL3A 2CCKA 2WPDD 5FPHA 1OW3B 3KFVA 2GZDA 4QM7A 3GLFE 4DLSA 3NBXX 3QJYA 4DUGA 4HUTA 2XSZA 4M1SA 4AC9A 1AKYA 4KFUA 3KFXA 3AVXA 5TV2A 5DLQC 1XTJA 3OEHD 3LH5A 1FPMA 2WSMA 1OHHD 3A4LA 4FCVA 1ZVQA 2WWXA 3GJ8A 3PEUA 4V0MA 1P9RA 2BC9A 4OI4A 1D5CA 4YQFA 5DNYB 2OCBA 2J9RA 2OUKA 1DG1G 4PSKA 1RPZA 2OFOA 3OAAD 4EIWA 2ZPTX 3SJZA 2VHTA 2B8TA 3B78A 1UKZA 3DKVA 1U8ZA 4YXWD 4JMPA 4L4UA 3SJBA 4PSVA 2PL3A 3NHAA 4XSHA 2B7CA 1AS3A 3MRSA 1CR4A 1AGRA 1E4YA 2ZITA 1NIJA 3NKVA 1R6BX 2FSGA 4HLQB 2JLYA 3T1VA 1JQJC 3CO5A 4UNPA 2PJRA 4IDOA 4RD1A 5AK0A 3B13B 1Q1BA 5FBLB 1O87A 5KHOC 1CEEA 1E32A 2FH5B 1Y63A 4XTCS 2VSXA 4TL7A 4C2UA 4JVMA 4MRPA 5F9HA 2GK7A 1X8JA 1O3YA 2WBLC 3KJHA 4OK6A 3OFND 4A2QA 3DL0A 2QM7A 5BQ5A 1F6BA 4AWXA 2FZLA 4IXMA 1MV5A 1E2DA 1IY1A 5CDFE 2CVFA 1QHGA 3PUWA 3VU9A 3V4RA 5KPJA 1NY6A 4IW3B 1G64A 1ZM3A 1ZIPA 4B32A 3QI2A 3WBJA 3IGFA 2IS6A 5KTYA 3EZ7A 2YC2C 2HJGA 4IEIA 4LC1A 4DSTA 2J0VA 1CP2A 2Z0MA 4KU4A 2FJUA 4Q4AA 4LYHA 4WAUA 2QL6A 1DBSA 5D3QA 1R8SA 4Z1MA 2GEUA 1W4RA 4D81A 1KZ7B 1Z2CA 1ZUIA 4B6FA 5B30A 3P27A 4IDQA 4Q1AA 2IS2A 1XJCA 1CR2A 4NU0A 5AJVB 1U0LA 1SKYE 2ZAOA 1NVVQ 2KBEA 2PEZA 3NEJA 3GLHB 4HUQA 3KJEA 4B33A 2QU8A 4EDHA 5EP2A 1OFHA 2DFKB 1W5TA 3CONA 4WA7A 3RDPA 4UNQA 3TUJC 1GZSA 4NYMR 3ZD6A 3D8BA 3TSWA 2G0TA 1JAHA 4I1VA 1G5TA 5KNDA 1DAEA 4LPKA 1VCNA 4FI3C 4RZ2A 2X19A 5FBVB 5TB5A 3ZZ0A 4KO8A 1S96A 4O25A 1XMJA 1CF4A 3THWA 1Z63A 2PT5A 3CX7A 2HV8A 3HDTA 3Q5EA 4L8GA 1E2LA 4PPNA 4F4IA 3B5JA 1JXMA 1SULA 3T5DA 4N3NA 1FUKA 4A0FA 1KDOA 3KKPA 4IKEA 4Q4HA 4MYCA 1SXJC 5JEDA 2WJYA 5JEEA 1CULC 1YU9A 3GLFB 1G3UA 3ZGXA 2YZ2A 2WJHA 1YZTA 1HEIA 1DARA 1Q1ZA 5FPTA 4EPYA 2HT6A 2QPOA 5IK2A 2QNRA 2J41A 4MKFA 4PHGA 3THYA 4JL5A 4LC0A 2VPPA 3U3MA 3B1XA 2Y8EA 2AXPA 1NBMD 2B21A 3KXKA 4JVNA 4V03A 1US8B 3CH5A 2AK2A 4KSCA 5EP4A 4LHZA 4DB4A 1QVAA 1JQLB 4YDSA 1XDBA 3TR5A 1GNPA 3A58B 4EAQA 4URVR 2GEDA 1CJVC 4BRUA 1W44A 1E2KA 1XTRA 2NZ8A 4HLUA 4HUQB 1A2BA 1E1QA 1SQ5A 5LB4A 3CF6R 1QBKC 4ESHA 2IA5A 1S3SA 4LYFA 1N6LA 3FHOA 3RS7A 2PH1A 3V00A 4B3FX 2ZSEA 2C95A 2NZJA 5J4LA 3PUYA 4GZMA 3LW8A 3PXGA 1ZM2A 4FWIB 3HU2A 3CX8A 4BFTA 4B43A 1NMXA 3A6PC 3Q72A 4BZPA 3U6KA 1P62B 2ZUDA 4KFSA 1E9CA 1QHSA 3Q7QA 3SE0A 2P6UA 4CF7A 3D3QA 3P20A 2HYIC 5B64A 1F3OA 2JJ2A 4GI7A 4KSBA 3RLFA 4TLAA 3GFTA 1TUEA 4TT3A 1G8HA 1CXZA 4CEIA 4IOLA 3WY9A 3VKHA 1XEXA 3RRZA 1LFDB 4A6PA 2OXCA 2XOKA 4BWYA 3RC8A 1KJZA 2GZHA 2BKUA 1YKSA 1VYVA 4ARZA 3E1SA 2BEKA 1YR7A 2BHRA 3ICEA 3ZYCA 3OIUA 3QPVA 3SR0A 3DKPA 2CCJA 3QKTA 3LY5A 4M2LA 5J40A 1W0KA 2VP4A 3ECCA 3IO5A 1K6MA 1VTKA 2BEJA 2KJQA 2XXAB 2CHVA 2A5FA 3UG6A 1NRJB 2ZI9A 1S9HA 2OLKA 3NXSA 3IBYA 3M0EA 3TAHA 4AURA 1E96A 2DYKA 1OFUX 2GESA 2WWFA 4G1UC 3VR2A 1KAGA 2VSOA 3EPKA 3ICQB 1FNMA 1X1RA 1XRJA 1OPXA 3OE7D 3BERA 1FP7A 3A4MA 4IOKA 4UNNA 1M7BA 1SHZA 4Q01A 1GWNA 1KYIA 2BBTA 3IDQA 4MUBA 1S4QA 4HB4A 1OFIA 4UQOA 4PO1A 3MAAC 2ZS7A 3CLVA 1OV4A 4PQFA 3A1SA 1G19A 4QBIA 3CF0A 5DI9A 1T0JB 4RD4A 3RS4A 5JRJA 1QVRA 2H8KA 4A2PA 1DAKA 2A9KA 4M21A 4A2WA 1IONA 1S1CA 3I5YA 3U6BA 4LUCA 4Q66C 3U7FB 3DM5A 2NMVA 2UZ3A 3B8HA 3AVTA 1TQDA 3NH9A 3QPUA 4IDPA 4LJ9A 2AX4A 2V54A 4PQYA 4LBVA 5G53C 4TLCA 2FV8A 4NZYA 4O2LA 5H8WA 1XBTA 2WSSA 4QNRA 3SEAA 4HB3A 4Q1CA 1RJ9B 4RD0A 1E2EA 4FCTA 1D9ZA 1Z6YA 4I1SA 2YKGA 3IEVA 1NG1A 2BM1A 4FXPA 4IVRA 3G0HA 1AKEA 1KK0A 5SZIA 3QKRA 4I81A 4GPTA 1E9AA 1EFCA 1UKVY 2F1RA 4JYCA 1AA9A 3AH8A 4BFWA 4QBFA 3KQHA 3R8FA 2ZI3A 2P3SA 4DLWA 1FQKA 1SKYB 1W4AA 3CRMA 4IHQA 5J4YA 3KKQA 4IDHA 4MYUA 2GBLC 3QG5A 4R9UC 5JFGA 4F38A 2DWOA 3CZPA 1Q3HA 4DHEA 3A1WA 1ZC3A 4G5GA 1PV4A 1PLKA 4HLDA 1LNZA 4V02A 1QHNA 2DFLA 2I1QA 3KKOA 4NONA 3MJHA 3R20A 2ATVA 2O0HA 5D3MA 1G7SA 2QE7A 1G3QA 2C77A 2TMKA 5G41A 5B2ZA 3QQ5A 1TU3A 2IYUA 2HXSA 4QBGB 3VR5A 2B7BA 2VH5R 4ON9A 621PA 2MSDB 1R8QA 4JLNA 5IDVA 4B71A 5HZKA 1G7TA 3TGPA 1DOAA 5FTKA 2ZI7A 1TMKA 5DISB 5LB2A 2ZRBA 2UKDA 4C0JA 4OI2A 4YMTA 3KTAB 1JPNA 2ZR0A 3AP1A 2OT3B 1TNDA 5E7MA 2XX3A 1M34E 2D62A 1J90A 3A4NA 4D6PA 2XNSA 4BFYA 1IOZA 3CH4B 2JIZA 1WRBA 3WYFA 3GD7A 3WRYC 4KFTA 4FMBB 4M9QA 4WW0A 1NMZA 4C0KA 2J0UA 2VSFA 3GFOA 1SVSA 1OFTA 1CKEA 5C4MA 1L8QA 4O2RA 3QG1A 3T06B 3I3SR 1KI2A 2RGXA 3HR8A 3IILA 2ERYA 1XTKA 1KO8A 4ZPXA 2RB4A 1CR1A 2WJVA 3MG9A 3TVTA 4CRWB 1P6XA 3RS0A 5FPSA 1YVDA 3ZVMA 1YZQA 2J59A 1Q0UA 4RFVA 3AKEA 1LS1A 3LNCA 4GL2A 3LO5A 1X86B 2CNWD 5SZKB 2ORWA 2WWHA 1II0A 3GJ4A 1CIPA 4M53A 3TR0A 3W5JA 2KSQA 4C0HA 2F9MA 3QKSB 4HDOB 4K81B 2HEIA 2Z43A 3EC1A 5DH9A 4ZDWA 4TL8A 4TT3D 2GHIA 1Z08A 1YE8A 2VL7A 2GETA 2LKCA 1X8KA 2ZANA 4URYR 3VHLB 3BH6A 4C7OA 2C03A 3TJZA 1KI4A 2NTYC 3SI7A 2XGJA 4D0LB 2G6BA 2QSZA 1P2TA 3B9PA 4QFMA 1ETUA 3S1AA 1L2TA 1X1SA 3P4YA 4MGIR 2GJ9A 3IPYA 3C5CA 4DC9A 2ZSBA 4H1VA 4W5HA 5A4JA 4BLTA 5JBQA 3H1TA 2WICA 4BZQA 2R2AA 1JJVA 2R6DA 3FDIA 2ZJYA 4KVGA 2QBYB 3EXAA 2YOGA 4MUAA 3GJ6A 2CJWB 1ZIOA 2OAP1 2EFHB 1DAMA 4LDJA 3FOZA 5A0FA 2G83A 3LA6A 4EFMA 4QC2A 4DT1A 1ZD9A 4TYPA 1AJEA 4LJ5A 1TAGA 5TARA 3O8RA 2F1JA 1MABA 4XVQA 2C8VA 4F4JA 2BBSA 3W5IA 3WNCA 2RGCA 2B92A 1E98A 3LRPA 2BCJQ 3S1AB 2IHBA 2FEMA 2NGRA 3BRWD 1YZLA 3F5FA 3GEIA 1J70A 4B3XA 4C0SA 3KQLA 4N0DA 3SN6A 4XVUA 1AQUA 4NYIR 821PA 5J4KA 1RRFA 1KK1A 2CXXA 2ZJ5A 3CM0A 3K0SA 2RAPA 3LW7A 2QP9X 2R6FA 2QUZA 2KE5A 3RSLA 2O0JA 4R2IA 1SXJB 3CNLA 1P9WA 3JVUA 2ZR7A 4JLKA 5L3SB 1CRPA 4DCUA 5GADl 2J45A 4US1R 3OEHA 4WZ6A 2NQ2C 2IEYA 1M74A 4M1WA 1W0JA 3DHWC 4JVSB 4H1UA 5FR2A 2IT1A 3RSOA 3H0KA 5KSYA 3EG5A 1GL6A 4IOMA 2VBCA 4ZCMA 4GP7A 2ZS9A 3EPHA 1HE8B 4FN5A 3MUFA 3QPWA 4PTLA 3BH0A 4XTRA 3T5GA 2KI5A 1BH2A 5HKKD 3SFVA 2O8DA 4QHSA 1D9XA 3EWAA 1N6HA 1XD2B 2W83A 1R10A 1RIFA 2ZROA 3EZ9A 2GJAA 2QSYA 3MWJA 4TMVA 1ZJ6A 2VP5A 5CLLA 1E0KA 1ZINA 2AHOA 3T1QA 4P0TA 1XD2A 4O3MA 2WMNB 1E0AA 3U3KA 5C1BA 3JVVA 3PJRA 1GL9B 3P32A 4LBZA 5KDOA 1KY2A 1T5IA 1KDTA 2F7SA 1F2TB 5HE8A 5BN5A 3LQQA 3QOFA 2O8BB 1N6OA 2DR3A 4BFSA 4BFUA 1OLOA 3A8TA 3ZQ6A 1H8EA 3K09C 3K1JA 1W4CA 1RC8A 3F0TA 4TL9A 1UF9A 3LLUA 5E7JA 4LJ4A 5AUQA 1T91A 3H84A 1UBGA 1HY3A 4NYJQ 4PFSA 3RHFA 2HT1A 1AQYA 1DG3A 2GZAA 1E79A 3VR3A 8OHMA 3WYGA 3CKLA 3TIFA 2R8RA 3FVQA 4JSYA 1FNNA 1JALA 2Q21A 1KAOA 2K5UA 1NN1A 5JSZA 1KI7A 4IJMA 1FFHA 4U00A 1Q1EA 1MKYA 4R98A 3K0EA 5FUWA 1OXUA 5F98A 3DO6A 4DT1B 4AD8A 2JDIA 3PENA 3A37A 5H1YA 1A82A 4DSNA 3QXSA 3THWB 1GG2A 2OLJA 1KI6B 2ZEJA 4ZDIA 1WBBA 1T8TA 1UDXA 5AR1A 4EJSC 1SKQA 2YVUA 3HWSA 4DDVA 3KQNA 2QTHA 3L0OA 4V0OA 1S8FA 3MSXA 1FW6A 2ERXA 2P0EA 4YXWA 4G3XA 1UBEA 4WXPA 3OAAA 3PFIA 1LV7A 4DDWA 3ND8A 3W3AA 4P31A 1XXHA 2YWEA 5GJWC 4ZDJA 1Z83A 1AZSC 2VP9A 1OJLA 4G0NA 1TU4A 1BYIA 3QVVA 2ZJ2A 1H65A 4C2TA 1OHHA 5CK5A 4B48A 3T34A 3GP8A 3KJGA 4IOJA 1PJRA 1DAFA 1KTVA 3MJRA 2CBZA 1XMSA 3QUSA 1G5PA 4E22A 4JKYA 2ZRLA 1Q21A 4HSEA 1DVRA 5IHPA
chains in the Genus database with same CATH superfamily
4QTUB 3IEPA 2J3EA 2O23A 3D8UA 3QVXA 2FG5A 4RHFA 5KVQA 4PHCA 3WSWA 3BCUA 2AW5A 1KYZA 3PLAE 4DXAA 4FMDB 4UDXX 4INZA 1Y5NA 1DZIA 2NPFA 3VAZA 3FUVA 4CEIB 3MJSA 1G9TA 4L95C 1OBOA 5JPCA 2R5WA 4XDHA 3BSSA 3H11B 2GAIA 2F6RA 1P29A 3DGFC 4TZTA 3LLSA 5DYTA 2SBTA 2V9PA 3B52X 1JX6A 3DXFA 4JWTA 4X6UA 3NQ41 4LBYA 3B3FA 3BMCA 3NU1A 3G5TA 4WN9A 3TB4A 3HJCA 1NXOA 2Q3LA 3BCSA 1BNCA 3MILA 4JT8A 3QEMB 1T5LA 1LVHA 5AK5A 3TTTA 1DKMA 2WZDA 5EP1A 4KYVA 5C1DA 4M0EA 5K7SA 2XTZA 3M70A 4ZN6A 3D7KA 3KLMX 4JJKA 2PN1A 1YU6A 4HDSB 1WMDA 2XZPA 4IYRA 4CEHB 2ZSIA 1TXGA 4KODA 1Z0ZA 4EVSA 4B7UA 1KR2A 5JO9A 1YZ3A 3ME5A 4GZLA 4Z4GA 1E1KA 1X0VA 2WJGA 2WD7B 4DABA 3UXHA 2MSCB 5EKUA 1XC7A 3OU6A 4HAYA 2VOJA 5CM8B 5KZMB 5L51A 4YA6A 1YONA 4QULA 4CGYA 3QEJA 1P5ZB 1DXQA 1HFJA 1PFVA 1USGA 4GR5A 1XNQB 2VUUA 4NG5A 5DSTA 4FFNA 4EUHA 3FRJA 3GP3A 4AJHA 4DG9A 3VZCA 2NP7A 2QLJA 4IHAA 3CJTA 4C29A 2P9CA 5C7OO 1R37A 4E33A 3BHIA 3I1JA 5GVSA 3KR0A 1ZOSA 1ZUNB 2ZJAA 5F4BA 2JBAA 4UPDA 1FFYA 4B6GA 3O2QB 4BNLA 1W7AA 5KAMA 1J7JA 1VLLA 4HPWA 1D2CA 3NMUF 4MGYR 2V55B 4LBWA 4TYWA 2HXGA 5FLXA 1A7KA 1N7IA 1X7GA 3ZJYA 1L4UA 4TL6A 1WMSA 4QPJC 1UPCA 5GIPE 1FP4A 1H23A 4MQLA 2VRBA 1SUAA 5IM5A 1TEVA 2C4VA 2ENUA 2R8BA 4QEDA 3MWEA 3AVPA 1QQ5A 4NPCA 4DR3B 2HA0A 5AKEA 3VPSA 3WMGA 3TW4A 1I33A 4RD2A 1AMUA 3HJAA 1PZMA 3LVFO 3ND9A 4Z4EA 2AG0A 2OG1A 3EHEA 3ADKA 1UOPA 4DDTA 2Z6VA 4HNVA 2J0EA 3GFSA 4G1VA 3DLAA 4JUIA 3LCVB 3VAAA 3DYVA 4BLPA 2QT1A 3L43A 3FKSA 3OIWA 4J0KA 5I3CA 3UBTA 2JHPA 4R1OA 1O9HA 4E2XA 1A9RA 2ILVA 3G0BA 3MC1A 1CUAA 2FA9A 5J58A 3K1YA 4PN7A 2QR5A 2Q99A 3NTXA 2WABA 4ME6A 3RRNA 5CB4F 1KJWA 2VHVA 3KP1A 3VR6A 4I2VA 4DMKA 3IEIA 4IXNA 3I01A 5MFZA 1RAGA 3TE6A 1GA1A 3RREA 2DVMA 4AN1A 4BNWA 2E1PA 2NZVG 3FVVA 3ROZA 4B4OA 4Y6OA 4A1FA 2DSNA 3TWOA 5I8WA 1Z4QA 1M0EA 2HJWA 2LP4Y 3WK6A 1HYEA 2CXSA 3BXOA 1DOZA 2CUZA 4F5YA 2GBLA 1OTXA 1T13A 4MUEA 2AZTA 2XT9A 4QYIB 4POAA 3DMDA 3PJFA 3D3JA 3F1KA 4BGDA 5A2GA 1WEKA 1FJHA 1N9ZA 3EEQA 4LVOA 5IH3A 3UT0A 1JDBC 3CNQS 2D7JA 3WI7A 1L1RA 1O89A 4TS3A 3ZIAA 4Y2JA 4KKXB 4JWKA 5I45A 3QYFA 3W8NA 4WBNF 4OHFA 3IUSA 1T2CA 2HNKA 1PUJA 2VJBA 3O2NA 5ER6A 2EOAA 2YRXA 2O8EA 4IXWA 3H5LA 4N7RA 4QASA 2CLIB 2LCFA 2I1LA 1DWPA 2ZYTX 5LQJA 3FYUA 4NOLA 2PRJA 5EJFA 1BCRA 2AH5A 1OGJA 2NV0A 4WXEA 2VAMA 1UBMS 1Z7BA 1C29B 4IDEA 1YQWA 3EK2A 3WXBA 4Q7QA 4JBNA 1UZAA 1R6UA 1SG6A 4MNTA 4BNHA 2Y93A 1FYEA 1GPAA 3JR3A 3G82C 2QRJA 1VKOA 4FZVA 5I4CA 3AUFA 4DLTA 1P1BA 1TD1A 2GM9A 2BKEA 4PVCA 1TGYA 1P80A 5GMOA 2QVLA 4L50A 1XXHB 5JCXA 1K3FA 3MLBA 4NICA 1H0SA 1LW6E 3VUFA 5FI3A 3WK9A 4C7MA 1WAMA 3TEJA 5K6AC 3JD4A 1WCIB 4RK6A 3QOXA 4GG1A 4IKOA 4RELA 3VC1A 2ZB3A 2GJ4A 2H1WA 3AF2A 3CNBA 3D2BA 4W7SA 4ZVOA 3SJCA 2ARKA 3D7RA 3HY4A 3CPHA 4EM6A 2OKGA 3DTNA 1W93A 4IDGA 2PGNA 1O96A 2OVBA 4O4JB 2O50A 4E5PA 3K16A 1JEQB 2A3NA 3A32A 4JVLA 4KQMA 4MWZA 3BGVA 1E3JA 2IIBA 3O03A 4K5QA 4MWBA 3RVSA 3KYCA 1I13A 3F6YA 1BVYF 1MC5A 1QFSA 2N47A 3M83A 3LLVA 5ALXA 4S1WA 5TDHA 1EXDA 3UK1A 4ETWA 1GR0A 2GTHA 2XCQA 3F6EX 3BEOA 4CMKA 4PN3A 3T1YB 1MW8X 1NMYA 3WIOA 4D56A 3OKAA 3F46A 1TQ2A 5CIWA 4G4GA 1Q7RA 5FFNA 1O95A 2AKAB 2C98A 1VE9A 1SIUA 4MVXA 4N48A 2IX9A 1C9MA 1MGOA 1GZ5A 2WIFA 1K0UA 2A6PA 2J5RA 3PUJA 2JATA 4GEGA 4KNWA 4PYIA 3ZVRA 1QRRA 1KYVA 4HQ0A 5CX1B 1OI2A 3IVAA 4GGMX 2R00A 2YDYA 3GJYA 1OXXK 4HBZA 4P8RA 4F6RA 4HKTA 3W6OA 2ODBA 1M2OB 3B8EA 3ZIDA 4EZBA 2QR2A 3BKXA 5K5EA 1DFIA 2YV2A 1CY8A 3C5HA 1ORDA 3IURA 1Q7EA 4HCJA 3B82A 4MYRA 1U28C 1SXPA 2L2QA 3FOCA 3WLSA 1C9EA 3VPGA 1B0ZA 5GINE 5KYKA 2C0PA 4YUZA 1IQUA 1SXJD 4HZUB 2BDUA 3G5UA 5JLJA 2B8EA 3QKRB 2WVHA 1VDZA 3JYNA 4G5FA 3PE4A 2CFSA 4XH9B 3ISVA 2J7PA 2Y1GA 3FKJA 5DASA 4AKTA 2CMKA 2PM8A 1W85B 2VP6A 3ETCA 1TVCA 5F5XA 3SYLA 3TZBA 4KX5A 2G72A 3DQPA 5IPFA 3VSDA 2ZUFA 3RYTC 4W1PA 1JSCA 3G2PA 4DBLE 2QG6A 3FR8A 2ZBRA 3TFWA 3VR4H 2FPPB 5J43A 2W2VA 3R3WA 1GTJ1 3TOZA 2WSLA 3A10A 1HSOA 3F8TA 3PUKA 4L6CA 4PZYA 4DSOA 3WJ1A 1EP9A 1JKMA 1FP1D 3HO1A 3TVDA 1KZGB 4O4IB 1EDZA 3UHFA 1OC2A 4YRAA 1K4KA 4AY2A 1FFCA 1SEVA 3L8GA 3HU5A 3ED1A 2FNAA 5MFPA 1I7NA 5BT8A 1F2UB 1ICIA 2PAAA 5JATA 1Z29A 2G3YA 3GUCA 5J3JA 1YO6A 2ZQZA 1NKSA 4ZI7A 2RFLA 4Q1DA 2I66A 3FWZA 2P2NA 3F4KA 4TKLA 5ESWA 1SB8A 3S40A 4D9EA 2OHHA 3AL2A 1YS7A 2CJXA 1AT1A 2UYGA 2C2WA 3PUZA 3UV7A 5C81A 3GRRA 1C3EA 5HS4A 1T36B 3H9CA 5HILA 2ZE6A 5M3BA 1CF2O 3MTDA 4A6EA 2VO1A 5B6IA 2P9GA 5EIOA 2AUMA 3AKCA 3O90A 1JEJA 3EMBA 1YCFA 2GDZA 4MRAA 1KJ9A 5JCOC 1N5DA 5IZCC 5JT1A 3UQYS 4JT4A 1NUPA 3L7AA 1VC2A 3HCWA 4HDQB 2BFEA 4UQPA 4CLOA 5BR7A 1Y9AA 2QORA 1XVAA 5T64A 2RB5A 4LHEA 4NZOA 5SICE 3ZW7A 1DGQA 1KDYA 1BKDR 3ZDBA 2BMFA 4PXSA 1R7RA 2QJFA 2AEFA 2VF7A 3EXG2 3NIFB 2RHBA 1NJFA 4DILA 5T6BA 3DE1X 2XMGA 1E0SA 1Y8QB 1C3OB 4FHEA 4RDIA 2PMCA 4HNRA 2W2LA 3CR7A 3R6GA 5CDSA 2N0SA 4M1OA 3G85A 2QUHA 4MVJI 4TRMA 3KJZA 2AB0A 3KQTA 2EDCA 3D0OA 3Q3EA 1YRQA 1RWNA 4ZEWA 3UMJA 4RTRA 4MJLA 1E0JA 2C3UA 3NNDA 3ZWPA 5L45A 1ACJA 4K0KB 4BUCA 2YW9A 4B3BA 2QT0A 4IHJA 4UMVA 5ECYA 2WAAA 1KEZA 3GA7A 1EFRA 1N57A 2P2SA 4FKBA 1ZSVA 3ZHZA 3S2SA 3UJ8A 1XL0A 4L6AA 3OLWA 1NXXA 3B1WA 1VM6A 4YYEA 5F3DA 1TTQB 2ZSHA 4YO7A 2IPLA 2WFZA 3LVBA 2O2GA 3U4HA 3NIDB 1A7JA 1V35A 4KAXA 1G8JA 2O57A 1Z26A 4TLLB 5I7WA 2GPNA 1F51E 4PYRA 4KGVA 2IYYA 4Z53A 1VGVA 1VHTA 3N8KA 4KQIA 4UD2A 4E5KA 1E69A 3M2TA 4EG7A 1AQNA 1YS6A 1B2RA 3BXEA 1VL2A 2YVQA 3KNZA 1SURA 2B5WA 2P5UA 3QU9A 5E6RB 3VR6H 3CJRA 3LKVA 4MJ7A 2PXCA 5J2TF 3KT8A 1MOQA 4LY3A 5H68A 2ZAMA 2WSBA 3S1AA 3KUKA 2A5DA 2HA7A 3QSGA 3QU4A 4G5YA 4Z4HA 3E22A 1WKCA 4BNMA 1QP0A 2LCIA 2B6NA 1G3RA 1O2DA 1C7IA 3DW3X 3GPBA 4IP0A 4OJTA 4UAUA 5KDLA 5KTNA 5LQNA 2AOVA 5JS2A 5KOHB 1N1DA 3OX4A 3LPAA 1E5TA 4MV6A 3V8MA 2WUEA 3DBHB 4CL2A 2AXQA 4DV3B 5GONA 4K9NA 1IUNA 2CHEA 4LW8A 2WQZA 2FEOA 3PPXA 2MIIA 3O8CA 4AZ3B 3QIVA 4J0IA 3JY6A 5DFAA 1Y89A 4YP6A 4HT3B 2OG2A 3L8DA 2Q5JA 4BNNA 1WCXA 4AX4A 4FFOA 4KR2A 4CI9A 3NBQA 1A9ZA 1DDOA 4QREA 4NU6A 4A0QA 1JH9A 3BQ9A 4BY9E 5P21A 1EMDA 5AW7A 3P4UA 3OBIA 1U1CA 3OUTA 4HLUC 1AG9A 1R0LA 3A1TA 1U0GA 2H1IA 3B9QA 3Q3IA 3WV4A 3LA8A 6YASA 1XMOB 3OG9A 3A1NA 1IWPB 4W9NA 2XB6A 2WTXA 3MAGA 4ZRDA 4CL3A 1RXWA 3K6SB 3TD6A 1W29A 2QE6A 5BR8B 2ZSDA 3BL8A 1Y7HA 3QENA 1FFDA 3FFAA 3FCSB 3QUAA 5K3SA 5CCXA 3VMMA 1XCGB 1U0BB 4JELA 2R8YA 4JHLA 1UBJS 2PNFA 2VPIA 3C5EA 3ECAA 2KB0A 3LXMA 4OHYA 3OX3A 4RH0A 4OA8A 3W3AD 4NZZA 2DC1A 4BVAA 3CUYA 5GTDA 2IUTA 2DQYA 2WPDA 2LBPA 3LG2A 4J1NA 1QF7A 1BX3A 3AGPA 3D4PA 3RVRA 3GLGE 4HWRA 4L9RA 4G56A 16PKA 4PE5B 4Q7MB 2XDQB 3RS5A 4LYAA 5CDUA 4K0RA 3C3BA 1E5LA 3VKGA 4D6XA 3SR4A 1XP5A 4BCCA 2NVWA 3JPWA 3SHFA 2QRNA 2IY8A 1IM5A 2QD3A 1YJBA 5FPYA 4C4SA 5JXGA 3AHGA 5J5VA 1ECFA 4M54A 3MQ4A 4QDTA 2FGKA 1OWLA 3ZVLA 2IH5A 4HB0A 3ZI4A 1CRQA 1CNFA 1JKIA 3G79A 2YYAA 4F72A 3QVUA 2YJ5A 4TMTA 4UVIA 1N6IA 4XJTA 3VH2A 1QQAA 3OTOB 5ESXA 1PR2A 4B5KA 1ZP6A 3K4QA 4ER7A 2V0GA 4Q4JA 2DG2A 2WIBA 1MJNA 3DT6A 5B58C 2G9NA 4FSHA 3OU7A 4ZI5A 4FW8A 1R0ZA 1XDSA 4BB9A 2PLAA 3E8SA 1T9BA 3IUMA 3AJ8A 4BN0A 2O07A 1KS9A 2JVIA 3IP1A 4RORA 1HV8A 2OBYA 4GXNA 4H15A 2XNCA 2XYQA 3I2IA 4A03A 5HF8A 5IWAB 1EFUA 3GFRA 4G9GA 4KIUA 2PQMA 2IZ1A 4GX0A 3IE0A 4Z8YA 4EG8A 1ACLA 4ZKDA 3HQ4O 3MGCA 5JALA 2IUUA 3EXHB 5TT1A 4CKZA 1HDCA 2TMDA 5KX5A 4KB5A 3FG9A 4GRDA 1ZITA 4RCZA 4DGQA 3EXEA 4FFMA 1V48A 2C5EA 1G21B 2NYAA 3FVRA 5AW5A 1VMIA 1QH8A 2GAOA 4PC6A 1BMFD 4BJ6A 1JAIA 3DLPX 4R9VA 5J47A 2G09A 3LVRE 2F3PA 1E20A 2HMTA 1NF2A 2OILA 3HYRA 3LSYA 3M33A 3N2IA 4EYOA 1C9NA 5H4HA 4X8OA 2ZSFA 1UK7A 5H5JA 1CBUA 1XG5A 5JU6A 3A2KA 1IDOA 1NXQA 1U7UA 5HCUA 2DKOA 4X24A 3ZZMA 2Y6VA 2VSQA 1IUPA 5EFOA 2E5FA 1G9XA 3OJLA 3R0QA 2HW8A 1L4YA 1VLVA 3KVYA 3PC8A 1N2CE 2REXB 4K6OA 5CT6A 3AM3A 2VJQA 1JEYB 2MDTA 4G1CA 5ALIA 4I55B 2IRWA 5KNBA 1TTTA 2E4XA 1OB2A 2KWIA 1Y1LA 1DIGA 1PJ2A 4JX9A 2IF0A 3EAQA 3NBUA 3JZFA 1WP4A 2XDYA 2ECKA 1JU9A 3QKUA 4RIGA 1D4OA 1QHFA 4LV5B 3QVMA 2NO9A 1ZD8A 4ZJYA 3OKCA 1WZUA 2DCUA 2LCQA 5HIAA 1JEAA 1NVWQ 2CLEB 3IEKA 3G9XA 3L6UA 4WDQA 5AVVA 5I9IA 4NXMB 3WJ7A 1O96B 2JJYA 4RAOA 4ZO4A 3W1WA 5JC1A 2ISCA 3FSGD 4FGSA 5AOCA 4CHGA 2P77A 4D4LA 4EY4A 1CUZA 1T4DA 2VP0A 3V3TA 1AV7A 4ISBA 4TYYA 1RM5A 4D0GA 3DG9A 1KH1A 5EKTA 3BE4A 3FPGA 4F1WA 1JHPA 1JSLA 4R7TA 3UOAB 1KYWA 2P3QA 4M1ZA 4DNOA 2OYRA 1Y6QA 3O95A 1D6JA 5CHYA 5EC8A 2IZ7A 1A1VA 2D5CA 1RM4A 1XQ1A 1AZTA 4XD7D 4BEVA 4D9FA 3M5WA 2VJMA 3I73A 4LF6B 1BWSA 2Q4DA 3GGPA 3W2IA 4HVLA 3UAVA 2HPZA 1AVTA 3KYDA 4B44A 1NJ6A 4M0MA 3BK2A 1RRGA 4RQAA 4JP8A 3ZG6A 2PGJA 4DWJA 4KITB 2WE8A 5AUOB 4L57A 3AF6A 4YRIA 3TZCA 2A9PA 3FAKA 4GXRA 5HA5A 4DADA 2PV7A 1GYRA 3AY6A 4M1KA 4Y1FA 3I1FA 3BG5A 4WASA 3ZE8A 4KMMA 3ADOA 1C7RA 4MSUA 4QOHA 4LDRA 1VKZA 3GJRA 1A5AB 1V4VA 3OP4A 4K9DA 4KBYA 3T35A 5AM5A 4HDMB 1KEPA 2WLSA 3AB8A 5C31A 1Q77A 3WGKA 4KBFA 5FUBA 1T6XA 3UG7A 1LI5A 4ZTUB 4BX9A 1H8HD 3DP9A 4IIBA 5PGMA 4QVIA 2HLNA 1DI0A 2PZBA 4H18A 2Y2VA 4IKPA 5A9RA 1I2BA 4GDFA 1J2RA 2AWOA 5IVKA 3T3OA 1GSIA 4BRWA 4MLCA 4D02A 1MJFA 1MX3A 3HI4A 1XCMA 4LYEA 1N5IA 4EHDA 1DWUA 1ZDMA 1Y5RA 2G9UA 4G1MB 4RY9A 2HBQA 1DTEA 3GR6A 4NENB 1RSZA 3ER8A 4GOKA 3A1CA 4G63A 2QVZX 4F71A 5C1PA 2J3QA 3EISA 3O74A 3I45A 1CDEA 2CCGA 1K8RA 2K7ZA 1DWQA 4KLRA 1W36D 5CB4B 2WMOB 4LJKA 4F3YA 2D1SA 4M6WB 1EFKA 4KTVE 1H05A 4OQPA 4ND2A 4UULA 1X9GA 2MCFA 3ZIUA 1TUBA 4M0CA 3VAYA 1RRVA 1G4UR 1MC4A 1TU0A 3EGEA 4FQ7A 4IZIA 3BVPA 1G42A 3SDSA 3ZHQA 4YXFA 4H1WA 4BFLA 3O4JA 4PX9A 4RVOA 1NVGA 3IXLA 4E12A 3GW8A 4KFRA 4QYTA 3BMNB 5IW8A 3R7WA 1JFVA 2LWIA 1B1AA 3S2UA 3DLHA 3VNUA 4RJIA 3SM3A 3HLYA 3TLZA 3REGA 2HDNB 4GNKA 4I36A 3UAXA 4B83A 4LE2A 3FTQA 4GKAA 1NVTA 4XCXA 3E27A 2CL7X 4EJ0A 4Y9RA 5KNBD 3URMA 1D8TA 3K9LA 4K9OA 3Q2OA 1KSFX 2X0KA 3H18A 3GCGA 2WC1A 3UMFA 3AEXA 4C0QC 2ZJZA 4S3MA 2XUIA 1QB8A 3W9YA 3PQCA 3ZDQA 3JARB 4C0BA 1JWAB 3A9VA 1GSOA 1O58A 4IS3A 5ILOA 5LNK1 5K09A 3HG7A 1XU4A 3P1JA 3IAS6 4NBLA 3TPZA 1T9GR 2AFRA 4HZUA 3PP8A 2CMDA 3OIYA 2JLAA 3OQ6A 5JJIA 1KK3A 3RVJA 1L7MA 4UUQA 2EBUA 2HA4A 2BBOA 3IA2A 4B0OA 3K3PA 2UV8A 1NFFA 1K6XA 2OXEA 4NNJA 3T99A 1U1EA 4CF5A 3UN1A 1XRRA 4UJ3A 5FL7A 4MWEA 4BFCA 5E7IA 4E88A 5FYDA 1NONA 4ZAZA 4MMZB 1FS5A 4QHTA 1TVMA 5IN4A 2DHQA 4BKPA 3NGLA 3QHQA 3PF8A 1VG9B 2IYXA 2QTVA 5EZYF 2PZKA 5BP7A 5TS2A 5HZGA 1QCZA 3A9SA 1Z68A 3NHZA 4NI5A 3K8QA 1FOEB 2BRUC 2OL4A 4BNZA 4CIAA 5FWNA 3PZBA 1JNYA 3G6KA 4EX7A 1X92A 2H2GA 1EUYA 1G55A 2VNHA 2ZB7A 1MO2A 1ZJ4A 3ESZA 3O4GA 4RVGA 2R6JA 4MUKA 1G291 2VDOB 5JD4A 3EZXA 4WKNA 2IEZA 4AUNA 3HCDA 2XF2A 4JGGA 4YX9A 1LCIA 3A0RB 4DPKA 1SXIA 4PAMA 1L5WA 3EMVA 5JBIA 4D4JA 2EWWA 1U4NA 1YQTA 3CEJA 4FOTA 1U6JA 1ABEA 3PCRB 3QF4B 1C7JA 1NQ5A 1HNWB 4HVTA 3AO0B 3V9PA 1UXKA 3D8TA 1JZSA 2ZUBA 3QTTA 4RETA 3AF0A 3P2EA 4W9NC 3W06A 1W5SA 5KOHA 4NTZA 3C8ZA 1QF6A 4B9AA 1OLXB 5BWMA 4YAUA 2M6KA 3DONA 1BAPA 221PA 3E5HA 4HGYA 1A9SA 4PC2A 3HYCA 5A5EA 2PGAA 4C4TA 1SHUX 2IIQA 3Q6IA 4GGPA 4XCQA 1N6NA 3BA6A 4DA4A 3ZQKA 1IOLA 2IZ5A 2V74B 3E2IA 3QF7A 3RVBA 4TXLA 4GX1A 3ADCA 1IBRA 1NW3A 3WKCA 4B6OA 4YRZA 3OQHA 1NVKA 5HOEA 1CJKC 2J32A 2GEKA 4LY9A 4XZ3A 3LFHA 1SCKA 3U13A 4E14A 3WADA 1RQ2A 1NJ5A 4E6PA 2VYCA 3FMPB 4MWOA 5CT5A 1UOQA 3EN0A 3VO9A 1X42A 1VKNA 5JRZA 3RUHA 3A6DA 1MB2A 1N6PA 3L82B 5HK9A 3VGPA 4WXMA 2H7VA 3OY2A 3FMIA 1C3XA 4G4IA 5DCWA 2ZJ3A 2P27A 2W90A 3N8IA 5CA0A 1RKBA 3ICOA 4P2BA 1CHDA 4AKGA 1NULA 4I5EA 5FWYA 4MW9A 1EFVA 5DHFA 1CJCA 2EGGA 2L42A 2NSYA 1HI9A 1VJGA 3Q7RA 1PT5A 1FMJA 2R3SA 2XCLA 4CL0A 3QEOA 4X97A 2CYAA 2W4QA 2BGMA 1WETA 4CM9D 1ULBA 4OVKA 2R2GA 1T4GA 5KJFA 2GYWA 3R6TA 3M6LA 5CW2A 1QP7A 2DTXA 1HQCA 1B8VA 2OB2A 3LZCA 4OHVA 4AF8A 1NR7A 4EQ6A 4PGAA 3D7NA 3T5CA 2EW1A 1IY0A 3W5AA 1RHKA 5FV4A 1QHYA 4OMUA 3CGGA 3PD7A 4ENQA 2VP2A 1L8OA 1H6DA 4XB2A 5AVUA 1W1IA 3SJ7A 4ZU1X 3VPCA 4OUDA 5AM4A 3SR3A 2H7YA 4GHWA 3N39C 2ZRQA 3EVNA 3UAGA 1I1OA 1LPAB 3JR7A 1TPYA 3V8BA 2Z57A 3LHDA 3UK2A 1H66A 4EB3A 2XYRA 3IAM6 4I99A 1BCSA 2PT6A 1TOAA 5DI3A 1AA6A 4GRIA 1FXWA 1I9GA 3IAM1 4B4VA 5E4TA 2PV0A 1QX3A 2ZRNA 2YFYA 4PINA 1TB4A 2JLCA 2H1LA 2ZVPX 1PG5A 2UVQA 4MIKA 4RQTA 4JI1B 2V6JA 2DTEA 2J7KA 2QRHA 1KU0A 1J4AA 4E2ZA 5LSAA 4MI9A 3DUFB 3CBGA 4LRYA 1T9ZA 2EKQA 2IPNA 3FCXA 5DWVA 2J3HA 4CT0A 4Z0TA 1BG6A 2NT4A 2PMKA 2Q62A 1EFRD 3BK7A 3F6SA 3CRQA 3QA9A 4OQDA 4DCVA 2GF0A 4P80A 3SM9A 3LTEA 3TTXA 5LYJB 3DFKA 4YRGA 3BAFA 1QRDA 3FTPA 1S2MA 2YIVX 5KSPA 3QNMA 5THXA 3LK7A 3P96A 1N4DA 3RTGA 1P0MA 1QZTA 4QO7A 4EKNB 1VMAA 3O4IA 5AIBA 2FTKE 2DUJA 1XMPA 1JZQA 1PU2A 4MKIA 3T0FA 4I55A 3D5EA 3Q9LA 1J07A 5EESA 4CBVA 4XYEA 5CVJA 2P5YA 4H3SA 1RJWA 4V1CA 3PUVA 3QX3A 5EHNA 1PQ4A 4JP3A 3TJMA 4WESB 2YVAA 4TV8A 3IOYA 2J9XB 3GUVA 3VNAA 1XZQA 4Q34A 1Y7LA 4QO8A 1IXYA 1C81A 3VX3A 2ILTA 3N2KB 4ND3A 1HG0A 3KTAA 1KF0A 1DJPA 3EWSA 2RH4A 4MVCA 4NHEA 5DYGA 4LFAB 3RBAA 5J2UF 1UPAA 3GB9A 4DY4A 4AM8A 3VQTA 2FRDA 2GNPA 3CLUD 4TQUS 1JXQA 2HK9A 3LFTA 2R7KA 3AP2A 3E9QA 3KB6A 1Z17A 4XSGA 2NPIA 1XKQA 4HG2A 4YHBA 5AJHA 1X1EA 4HDRA 3TE7A 4RABA 4Z1OA 4PLZA 1TT5A 3O5AA 1ZCZA 4IO1A 4WOPA 4CG3A 4IZOA 4Z9FA 3NATA 2NWQA 4BGEA 3HB5X 1Q7TA 3OM0A 1XZIA 2PTHA 3V5NA 5J4HA 4LY6A 2CLCX 3L05A 4FE7A 1PZNA 5AVOA 1PBTA 1LK5A 1VCIA 1HDIA 1LBQA 1SUIA 3AKDA 1R27A 3LHSA 5FI0B 2DPHA 1Y7IA 1RS0A 2I9PA 2HJHA 4DMCA 3FTEA 3QBVA 3RR2A 3HUEA 3QYAA 1ADGA 2GFQA 2QMHA 4HB2A 3FYSA 2ZYVX 1EP3B 1AB5A 4YROA 2Y05A 1EFHA 4GMXA 1KFEB 5E1BA 4XOIA 4BO2A 4RZIA 2VK4A 5ICCA 2DF8A 2XUDA 1H93A 3DTTA 3IOBA 4GC9A 5LQAA 3ANMA 1EUDB 3UKJA 2IDKA 3LM8A 4CTJA 5KJCA 1TIKA 2Z2ZA 5KYUA 1UT6A 3UAWA 1NGSA 1GUZA 1U3DA 1PSDA 1XZMA 3C3CA 2WIJA 3MZ0A 1IZ0A 4AZ0B 3J81k 3PD0A 4FVTA 1GQOA 4MPTA 5EXEA 1BN7A 1WUKS 2H4YA 2J4FA 4EX6A 1GTG1 1KAQA 3EMKA 1UM9B 3OCYA 4KXFB 1ZNWA 3BD9A 1K27A 2DY0A 2VAPA 2GMWA 3DMYA 5C8YA 1ZN7A 4MWCA 3SXPA 1QCYA 3BQMB 4M4SA 3SX0A 4UM8B 3H17A 2B6HA 4ZCLA 3GQBB 1ZRSA 4OYRA 3QXHA 2UVDA 3C2QA 5BYBA 3VH4A 4HYYA 3QNUA 3MWYW 1JFTA 1EINA 1E3QA 1X7XB 3C6QA 4NS4A 4IIGA 4OBXA 4LCBA 2ODTX 3KB8A 4QJIA 3OECA 4KMRA 4U02A 4WDRA 3VR4D 3FDZB 4ES6A 3CUSA 3UA3A 2FCAA 3UF0A 1S7GA 3PTAA 3DT8A 1RBZA 3EA4A 3OPYA 3PYXA 3HHPA 4H3HB 4RMHA 1YDFA 2RGNC 4PPQA 3OTQA 4ZJZA 1NBEA 5AVSA 5B6PA 4OJYA 2I80A 5CGZA 4B8WA 5HYVA 4MRVA 4HRXA 1ISJA 3A4TA 4BB5A 2YWCA 5CYFA 3GYBA 1K92A 4KQHA 1T1RA 3DFIA 4A15A 1N9GB 1JKFA 4ZI7B 4AAYA 2ZRGA 3PRYA 3J80A 4UZSA 3CPSA 3OQOA 4YI3A 4Q1EA 1KMQA 1B23P 2XNDA 2YWBA 4UUAA 1AN0A 1SNYA 2XD9A 2Q0XA 1EFPB 1O6CA 1O94C 2GR9A 3EJ6A 5J2UB 3HN6A 1XSEA 1ZK0A 4EJFA 5C3MA 1Z0IA 3Q9SA 5INTA 2FEPA 3OQJA 2OZLA 3RROA 4PTZA 4XLLA 3TX6A 1WTCA 4Y9SA 1RYFA 2X2OA 4GPAA 1PT6A 2AWNA 3HFSA 4XIFA 4IBOA 2FFHA 3PR3A 4CKWA 4DR1B 3K9FC 1G2OA 1YMUA 3B1YA 3K0HA 2YV4A 1HFWA 2UZ4A 4INAA 2OEPA 1E0DA 5CT9A 1T4CA 2ASVA 4DCNA 1CUXA 2C7PA 3MPUA 1VLZA 2GHQA 2FSIA 4X95A 1UWVA 5EEGA 1ADYA 4NKRA 5E95A 3I58A 5B5SA 1LPMA 3DEKA 4GI5A 1A8PA 3ORRA 2WJWA 2IYNA 5TJHA 3WLRA 1Q6ZA 1WF3A 3MYRA 3JU3A 2JLRA 2NVUA 4QVKA 3WA7A 1V95A 3IRUA 1G20B 1TQ4A 2XUFA 2ZU6A 4WKCA 5FOSA 5KWIA 1N34B 5BV8A 3TSZA 1MOSA 3KQKA 1FFWA 4ACBA 4F9TA 3DZ8A 2PSEA 1RAFA 2C3OA 1Z75A 4WKGA 4W8HA 2Q5HA 4M83A 4N65A 2P65A 3KJXA 1ZBQA 1ABFA 5DXJA 4NHOA 1OH7A 1XEAA 4H0CA 2VIIA 2G80A 5T4HA 4KQ1A 3LBYA 4OH7A 4ASUD 1E4OA 1MN6A 2Y1WA 2XITA 2G04A 3LGXA 1ZI6A 4H3KB 3LUGA 1N75A 4F91B 1ML4A 4R71A 4K05A 4I46A 1O8BA 4OJKA 1K7XB 4UOQA 1CJTC 1ZD4A 2OA0A 4DC1A 1OZAA 1BROA 2E9SA 1C1XB 3B36A 1P2FA 3TS1A 3DAHA 2JFPA 4BNDA 3CLUC 3ETHA 3D8RA 4K03A 5IF3A 1N5MA 2GZRA 1X15A 5CMLA 1MZVA 3AF3A 3IBSA 3DOHA 4XD7A 4WL0A 5CXQA 4X66B 3OESA 2ZBVA 3S44A 1XZDA 3CUEF 721PA 1ZH8A 2BFOA 3F5QA 4OIMA 1XU7A 3ABRB 2BFCB 5ITVA 1UP7A 1UINA 4F92B 5GPBA 3HB0A 2VF5X 4ZP1A 3MW8A 3U48A 2CSUA 1JHAA 2JIBA 2V7WA 4EGSA 5BQFA 4JXXA 3LCCA 1QAOA 5AHXA 3U4QB 3KT0A 2R96A 4Z3DA 1NBOA 1VLHA 1ZISA 1KKUA 1DFHA 2BOVA 4HNAB 3LCRA 3RT7A 2NO4A 2OBLA 2Y1FA 1NVUQ 1U0NA 1XN1A 2LVBA 3N8HA 4G23A 2BLNA 4J0QA 3MFQA 4UU8A 2RHRA 1KZHA 3RLIA 4EFLA 1KH3A 1OPRA 1DXOA 1BQEA 2NO6A 4TS9A 1L4BA 4F11A 3QFCA 2WLTA 3QOYA 3D4OA 1RADA 3RASA 1HTWA 4X44A 1J22A 5EXTA 4C9BA 4B73A 3LF2A 4CLRA 5CLQA 3WO1A 6AT1A 3U9TA 2J7PD 3SFZA 1DHRA 1PHRA 5EQDA 3Q12A 3FF1A 3I5UA 3G2IA 2EQ5A 3KHUA 1H8ED 2ZREA 3L02A 2H48A 3PL5A 2O7QA 4AWBA 4TXHA 3KUDA 2J3KA 3C3KA 3VHXB 5LZ2A 2GPBA 1MZPA 4LHVA 2C2XA 1E7RA 1A69A 2O2JA 2JAQA 2LXNA 2CDCA 3EVBA 3QUQA 4Z2YA 4AJ1A 4TMYA 1Q0TA 1BVHA 2EHJA 5D00A 4R1TA 3N75A 4A26A 3IKVA 4EJSA 1E1CA 4EQ6B 5EJEA 1D2AA 3RUPA 3V6MA 2CN1A 3EW9A 1EE2A 3ZHTA 1XZEA 4RDCA 2OQRA 4HN9A 1GRNA 3PEFA 4DJAA 1YDHA 2FZCA 1EQUA 1VJ1A 4IDCA 1U9IC 3ULKA 1A98A 4RIFA 3IUYA 4AWAA 1JR3D 3CH6A 2A0WA 4NDAA 4L16A 2C58A 3RS9A 2CV0A 1GFSA 1KEVA 2C29D 2W4MA 1M1YE 4TSKA 2XAAA 4I08A 1AUXA 2CNBA 3SQNA 4CQNA 3ICPA 3CUWA 3TYXA 2BIFA 3DLCA 4RPGA 4UUPA 2Z30A 3KALA 3QVWA 3P7MA 3SF0A 4BLOA 4OQ4A 1GPUA 1OC4A 2VJAA 5HKAA 4FGUA 3FYHA 3TFOA 2VUHB 3R41A 3FPFA 4CN8A 3PGJA 1QZ3A 2GBPA 3PB3A 1JV2B 1T1JA 3ROPA 1D7AA 4I9FA 2W0SA 2X1HA 3FSEA 4XEUA 1VIMA 5CJPA 2VHEA 1YGYA 4CKBB 4HGPA 2H59A 1SHJA 3JWHA 3PS9A 2OHJA 5BRNA 5EWLB 4NMWA 3TW8B 2OR3A 1TJ4A 4ITVA 1JIJA 1GITA 4QBHA 5EMKA 3QEAZ 1JAYA 1TO6A 1FFXB 4M22A 2E6UX 4JK3A 2DLCX 3B9RA 1CY6A 4EZIA 2NX2A 2ZI6A 5KOYA 4OM7A 2A88A 4D44A 2GYVA 3G0GA 5JQGB 4CXMA 3TW8A 3NG1A 4U0JA 4KIWA 3GRAA 3KIPA 1JQBA 1T3SA 4OHXA 3OZXA 4H35A 4MS4A 1T29A 4Q1FA 2JK0A 1LF0A 5EIFA 4JJEA 3A6GA 1FVHA 3FCYA 3R8CA 5LD2C 4HNHA 1OH5A 1XTQA 3Q3JB 3M3HA 4POOA 1T0IA 1IJKA 2XGOA 4J2TA 3FLMA 2CLFB 4J1QA 1N32B 3S27A 3ZKAA 3BHNA 3RF7A 3FNEA 4UKDA 5I3ZA 4HRAA 5D3MB 5FHQA 3DMRA 3L49A 3QGMA 5DPMA 3AETB 3ELBA 4L9AA 3QMMA 4MI6A 3ZIAD 2ONYA 1ODCA 3BWBA 4E31A 5AW1A 5HSGA 3CSSA 2RGGA 1GQQA 4F6RB 3L4KA 1E60A 4AJIA 2PS1A 1DPFA 3QW2A 3DF7A 1E6KA 5JCJD 1FFXA 2YHAA 1KOJA 2IYLD 2QN2A 1SU7A 3Q15C 2FGJA 1R5OA 5A5DA 5DIZA 1PKXA 3DS8A 2OHIA 1LWNA 5DX0A 4TXNA 1NPYA 2P40A 3I12A 1MRSA 2XECA 3F3YA 1FS4A 3UUEA 2V65A 2J0SA 5KSOA 4G0VA 4BFZA 4XR4A 5IHXA 1AURA 3GK3A 4H6XA 5H81A 1YR1A 3HNPA 3QLVA 1LKZA 1BDJA 3DE0X 4R68A 4WVFA 5FCDA 2I2BA 2FWNA 1F5NA 4G1FA 5D3KA 1X1QA 1KY5A 3CZAA 2OOSA