4C0RA

Molecular and structural basis of glutathione import in gram-positive bacteria via gsht and the cystine abc importer tcybc of streptococcus mutans.
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
239
structure length
239
Chain Sequence
MDKTVTLATVGTTNPFSYEKKGKLTGYDIEVAKEVFKASDKYDVKYQKTEWTSIFSGLDSDKYQIGANNISYTKERANKYLYSNPTASNPLVLVVPKDSDIKSYNDIAGHSTQVVQGNTTVPMLQKFNKNHENNQVKLNFTSEDLAHQIRNVSDGKYDFKIFEKISAETIIKEQGLDNLKVIDLPSDQKPYVYFIFAQDQKDLQKFVNKRLKKLYENGTLEKLSKKYLGGSYLPDKKDM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular and Structural Basis of Glutathione Import in Gram-Positive Bacteria Via Gsht and the Cystine Abc Importer Tcybc of Streptococcus Mutans.
pubmed doi rcsb
source organism Streptococcus mutans
molecule tags Transport protein
molecule keywords PUTATIVE AMINO ACID BINDING PROTEIN
total genus 79
structure length 239
sequence length 239
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-08-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00497 SBP_bac_3 Bacterial extracellular solute-binding proteins, family 3
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4c0rA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4c0rA02
1FQBA 1B5JA 4Q30B 2V3UA 1B0HA 3SEVA 3TYHA 5CMKA 4F22A 1RYOA 3EN3A 1RYXA 5I56A 3IB1A 4ZECA 2CMOA 2DE2A 3WAFA 1B46A 1H44A 1LCFA 3Q26A 3PMWA 4H67A 2DP8A 4R6YA 1LFHA 2QS3A 4I62A 1URGA 3RT6B 5JTYB 5DYHA 4YICA 4DXUA 1B4HA 1Z7NE 1MPDA 1BKAA 2DSFA 3H6WA 3MP6A 4NWCA 4ZZEA 1ZKBA 3V83A 2RCAA 3IOTA 1O63A 3OXNA 3QIMA 1T0KA 4LP2B 4GVOA 1JW1A 2YJPA 3KEIA 4HCWA 5AA3A 2DXRA 4IB2A 3BFTA 1PDAA 1QW0A 3IL1B 5A5XA 3ZKLA 3JZJA 5ISUA 1MPBA 1FQDA 4PFYA 4F31B 4ZEKA 2ZNUA 2I4CA 1M5EA 4ELOA 1PC3A 3T93B 5F7VA 2UYEA 5AA1A 1B7ZA 2GHBA 3T9HB 5AA2D 1MY1A 1RKMA 5I2KA 3ILTB 4H6DA 2H9BA 1VR5A 1N84A 3N6UA 4Z7EA 5AA4B 1UQWA 1PBPA 1HSEA 3EQ1A 1LFIA 1N76A 1P1NA 2OBGA 3FIRA 3C9HA 3HHGA 3PUWE 3QYTA 4R75A 5DEXA 1XHYA 4GRKA 4R2FA 3M8UA 1FW0A 1Y1ZA 4RK2A 4TLLB 3C36A 5EHSA 3PMXA 5FHNA 3G3JA 2NWJA 5L9SA 3IOVA 3M3KA 1ZLQA 5H8HA 1B1XA 3MZ9A 3E13X 3LUYA 5B7DA 3TUSA 4OYVA 4LVQA 1H3DA 3ODBA 4QSDA 3MP8A 3C35A 1D3KA 1N04A 3H6TA 3PUXE 2ZYNA 4MBPA 4YAHX 3E4RA 4P0GA 3FVGA 3IK6B 3SDFA 2Y7RA 3K00A 3D4CA 4OEUA 1MQGA 2AL5A 2REJA 1VE4A 2UVGA 1SYIA 3E3KA 3MBPA 4I1DA 3RY3A 5DVJA 2H99A 1B0LA 2I3VA 1H43A 2Z22A 1JVXA 1O7TA 2VOZA 1M5DA 3MJNA 4HTGA 4O3CA 3RGYA 4F1UA 4FIMA 3PPRA 4OVJA 3MC2A 4NF8B 2AL4A 5CC2A 1JNFA 3RUMA 3VV5A 3U93A 4Q5TA 2Y7WA 1EZ9A 3Q29A 3OO7A 1I6BA 3HPIA 3K02A 1B3FA 4QFOA 3C34A 4RPNA 2A5SA 3FV2A 4BLAA 3PGFA 3TFLA 5CBRA 3K2DA 5HM4B 1JEUA 3TQWA 4QHQA 3O29A 4OERA 1SBPA 2H98A 3U92A 4N6PA 5I84A 2XX9A 3H7MA 4GL0A 4BDQA 3RTFB 1IXHA 3HSTA 3SESA 4E0WA 3LR1A 3VLUA 1ZJLA 3TEPA 4Q0CA 1ELJA 2VD2A 5AA4A 1SDXA 3QSLA 1IXCA 3FXUA 4I9DA 1ZMGA 3KGCA 5CMMA 3IORA 4R6HA 3MVZA 4H0WA 4OFOA 2OWTA 4XXUA 1MY2A 3R7XA 3SKPA 4Q8RA 4LZ7A 1IXIA 2I49A 2REGA 1YTVA 1B5IA 4G8MA 4U4SA 3N5LA 4GF8A 3QUFA 2AYSA 2XXUA 3PMVA 4G2ZA 4ELPA 3KSXA 2HAUA 5CI5A 3LC8A 4EQBA 2UXAA 3V5AA 1H76A 3MQ9A 5EYFA 4XKQA 3CSGA 1ZU0A 1ANFA 1A8FA 3PPPA 1PB8A 1Y9UA 4KFQA 4RYAA 2Y7KA 4RY1A 3TAJA 4F2QA 3TTNA 1DSNA 3K01A 1P1OA 5KDTB 3CFLA 3B6WA 3DELB 1MY0A 4IO5A 2XXXA 4FECA 4U23A 3T66A 4BDOA 5I56B 1MQHA 2XXIA 3IAZA 2F7BA 4RK9A 2E1SA 5FHOA 3S4UA 4YB5A 1P1WA 3BBRA 3IX1A 3KN7A 4IO6A 1UTHA 3TCGA 3KFMA 4LONB 1FTOA 2A5TA 1I6QA 2PX1A 2ZYMA 1N7XA 3IOWA 3RN8A 3W9VA 1Y4CA 4G8NA 3G3GA 4FAJA 3I5OA 3HN0A 4U22A 4QFPA 3L6GA 1A55A 1Z7ME 3UIFA 4NF5A 3H03A 1MQIA 2IA4A 4QSEA 3SEUA 1N3WA 4BDLA 4KD5A 2ZMBA 1P1UA 4YKKA 3TDJA 3B6TA 4EQ7A 5TPAA 1QJMA 3K1NA 4O3BA 2B65A 1WODA 4ELRA 1SYHA 3U72A 1GGGA 2G29A 1SQYA 4NF6B 1B52A 2UVJA 3O9PA 4WEPA 3IB2A 3O28A 2V3QA 4PFUA 4OESA 3LSLA 3O66A 4RJZA 5I58B 2M8CA 3VXBA 4PETA 1PBQA 3MAMA 5KCJA 5LOMA 3CI8A 3H6UA 3EF7A 3I3VA 2X7QA 1Y1MA 3ZSFA 1GR2A 5JEIA 1BIYA 2ALUA 5I2KB 4HS7A 2DVZA 2FA7A 4KCDA 1ZBMA 3T96B 3WAEA 2DE4A 2ESNA 4HCYA 4G8HA 3KJTA 4YB6A 3TELA 5I57B 4F3BA 1WDNA 4F18A 2GH9A 1EZOA 3TMGA 2O84X 4ZEDA 5I57A 2HXWA 2YPNA 3K1PA 3KOTA 3LSXA 4OENA 3L6HA 4U1ZA 2QJEA 2F7CA 1S7YA 2PBWA 1AIVA 4RXLA 2NOOA 3T22A 2F8DA 1HSLA 3H6VA 2DQVA 3LSWA 3PPOA 4JWXA 5H8FB 4H8JA 2H5YA 3TQLA 3JV9A 3VFJA 2Q9TA 3M3FA 3G3FA 3ILUB 1NNTA 1OVTA 2PYYA 4R6KA 1IQ7A 1B9JA 3EHTA 4OWDA 3K1MA 3U8QA 3IO6A 3UORA 3PPQA 4LUBA 3I6VA 2NXOA 4GOTA 4MFIA 4PE5B 4DXCA 2VD3A 4F19A 2HAVA 3KG2A 1N7WA 3O2AA 3OMBA 1J1NA 1S50A 1POTA 2H4IA 4OEVA 5K2XA 1ZTYA 5CMBA 2XXVA 4EXKA 3OELA 3TTLA 3PD8A 4OHNA 4HW8A 2H25A 1DOTA 3U1OA 4BDRA 4KPTA 1B3HA 3O6GA 4WXJA 5CRYA 4ZE8A 3ECRA 5I2NA 1B40A 5M2VA 5CBSA 1B3LA 4UA8A 5DVFA 2F6PA 3A3CA 3S2VA 3USDA 3K6WA 2R71A 3ZKKA 1OQHA 1B3GA 1OVBA 2O68A 1MQJA 3OENA 4THIA 5BWJA 1SW1A 3B7DA 2OK2A 3FJ7A 1WVJA 1VSOA 2DWIA 2QS4A 4FJPA 4XKRA 4ZZAA 4DLDA 2PT2A 1MDP1 3LSFB 5ICQA 1FTMA 4N07A 3B6QA 3PUYE 3AXFA 4QF9A 4R74A 2O69A 4KQPA 1SW5A 2W7YA 1MS7A 2HQ0A 3VE1B 1IEJA 2BJJX 4OQOA 1B1HA 3OSQA 1S9TA 3FXQA 5TU0A 1B4ZA 3THIA 1NNKA 3G3IA 2VP1A 3FASA 1NH8A 4TLMB 3V8XB 2ABHA 4GWOA 1LB8A 4EF1A 1Y20A 2CZLA 3IJXB 3CFXA 4GLIA 3PD9A 1SD3A 3FVOA 3FXRA 2HEUA 3R26A 4NEDA 3QAXA 3GZGA 3SERA 1A7LA 3QK6A 1JEVA 4JSOA 3IB0A 1MG1A 2RCBA 3KZGA 3RPWA 2QMXA 1NL5A 1TXFA 2E0SA 2QMWA 3FUZA 3IO4A 3MPLA 4QFLA 2P1SA 2RINA 4ISUA 3H3GA 4ELQA 1QUIA 4OZ9A 2I0BA 4E0XA 3MZ1A 4R2BA 5H8SA 3K0VA 4JDFA 2HZLA 1LAFE 5JK4A 3UGWA 2I3WA 4NF5B 3MVYA 3MZBA 1UTHB 3HHFA 3OO9A 1AMFA 4H5GA 4ZEBA 3FZVA 5IKBA 1OMPA 2RF1A 3TCHA 5I59A 4R9GA 4POWA 4JSDA 1PEBA 2F35A 4KYEA 3MWBA 4X1DA 4F1YA 2ZYOA 4EXLA 2DS9A 4KCCA 2I58A 4OETA 1LB9A 1N0TA 3CG3A 3SEXA 4GD5A 3G3KA 1ZIUA 5H8FA 3H06B 1BP5A 2XX8A 5L8DA 3VLVA 1B2HA 3EHSA 1LAHE 1YCJA 2AIXA 3FJGA 3OOAA 1Y3QA 2D21A 4H8IA 4PQJA 4XTCQ 1QKBA 2DE3A 1MY4A 1NNFA 3S9NC 1OLAA 4JB7A 3FD3A 5AA2A 1B5HA 2F6GA 4H65A 4IY5A 4U2RA 1POY1 5HBCA 3RLFE 4GXSB 2VGQA 5DEXB 2Z8EA 1LBBA 2O1LA 4AQ4A 4GL8A 3S9EA 5A5XB 4YKPA 1AL3A 2PT1A 4IGTA 1QULA 4C1TA 4ZE9A 1MH4A 1D4NA 5FTIA 3QXMA 4TQUQ 2F34A 4G77A 3PUVE 3K6VA 4LZ8A 3VDFA 3C32A 4XKNA 1R9QA 2R6GE 4YKJA 2OCUA 4NF4A 4RPOA 4GFRA 5CM6A 1M5CA 3Q27A 1GV8A 2UVIA 3TZAA 4AB6A 4AB5A 4K3FA 3OSRA 2OJTA 4ZS9A 1A99A 1YPNA 1II5A 3PUZE 4GIZA 4X9TA 3VXCA 3CVGA 5H8HB 1BLFA 4DE8A 4BDMA 1XT8A 2P2AA 3A09A 1EZPA 1MRPA 1TT1A 3FVKA 5CMCA 1L5TA 1D9VA 4UACA 1MXWA 1NH7A 2ONSA 1VFDA 2XXWA 2Y7PA 3EHUA 1XOCA 1IIWA 1MXZA 2P0SA 2XXRA 3C33A 4LA9A 3TTMA 4LQ2A 5H8NA 4YMAA 5DVIA 4FEDA 1PB9A 4U21A 1B32A 1N3XA 2O7UA 2Q2AA 1JW5A 1O64A 4KR5A 3TCFA 5AE4A 3CR9A 1NMUA 4NF4B 3W15C 2I0CA 3G7WA 1R6ZA 1URSA 1YAEA 3LBSA 4M1VA 4POXA 1Q1KA 5I2NB 4DCXA 1SVXB 2ONKE 1GTKA 3GBBA 1MM6A 1AH5A 5H8QB 4EDPA 4YMBA 1FTLA 4ND9A 3UN6A 4G68B 5H8QA 1Y3NA 3PV0E 2QS2A 3BKIB 5KZTA 3S9LC 4G68A 1FQAA 2HZKA 2RC9A 1D9YA 3MPKA 2ZNSA 2I4BA 1B6HA 1PB7A 4OMBA 2QS1A 4MLVA 3D4GA 4NTLA 2DVCA 4XKPA 1B7HA 2DWJA 1MXVA 2KLFA 4MF3A 4ZEIA 3W9WA 1IXGA 4G4PA 4G68C 1NNPA 3K6XA 4YB7A 4Z0IA 2OZZA 3DLNA 4F2OA 1FQEA 3SEYA 1FTKA 4GQOA 2QPQA 1OIBA 2THIA 4IGRA 2RKMA 1CE2A 4QSCA 1DPEA 3ZS6A 1P1QA 5I59B 3ONMA 1LAXA 4DXBA 2B3FA 4I8CA 4IO3A 1CB6A 4QFNA 3FVNA 4LATA 3FATA 1XVYA 1QUJA 1SI0A 3T9XB 5H8NB 1Q35A 1MY3A 2DWHA 1B51A 3DP4A 4IO2A 4M4GA 4MLQA 3TPAA 3E9XA 1EU8A 4JWOA 4P0IA 2HCAA 3K4UA 5KDTA 1TFDA 3KSJA 2QRYA 1USYE 1LLSA 4QFKA 1UIUA 1B58A 5K2YA 3DM0A 3R6UA 3MUQA 5TP9B 3CFZA 2XXHA 2IEEA 1MXUA 3O97A 2Q88A 2Q2CA 3U94A 3HCQA 3N94A 5AA2B 1US5A 1UTBB 1JW4A 1MXXA 3QUJA 3F11A 4XIGQ 3GBAA 5J1DA 4YU0A 3PU5A 1DTZA 4IY6A 3N26A 3DP6A 2RC8A 4X48A 3Q25A 1ATGA 3S9MC 1TWYA 4U1OA 2I6EA 2HFBA 2V25A 2ANJA 3MP1A 3TODA 1A54A 3CIJA 3T9VA 1AOVA 1I6AA 5ELVA 1LSTA 3VVFA 2GHAA 2RC7A 3OO8A 3VVDA 3MW0A 3OEKA 4YKIA 2A5TB 3M3LA 2F36A 3KN8A 3RT8A 1QUKA 4FORA 4LQ5A 2XXTA 2D3IA 1IITA 2DOJA 4OFJA 5ITPA 4LZ5A 2XXYA 1QVSA 4DDDA 4ESWA 2ZNTA 2DXYA 3O6IA 5HPQA 2OLBA 1GVCA 1Y3PA 5JTYA 1FTJA 2DYXA 1JQFA 3MVXA 2WKYA 1A8EA 2QL3A 5KCJB 3OD7A 4IO7A 3DP8A 3TKDA 5BUUA 1SI1A 4OTEA 4TOZA 1LAGE 4F3PA 4NF6A 4RA1A 2ZXTA 4GXAA 4N13A 1FQFA 1MQDA 4DZ1A 1H45A 4U4XA 2Y84A 1R9LA 4H5FA 3VLWA 4FATA 1P99A 2Q8JA 1M5FA 2X7PA 2F78A 1OQGA 2O7IA 2PVUA 1LCTA 5L9OA 3C4MA 2XD2A 3IOUA 3IR1A 4OFLA 2Q89A 1SW2A 2XX7A 3GLBA 3KOSA 4ZDMA 3VVEA 5IAIA 2UVHA 3RNNA 4NWDA 4RNSA 3SETA 3HV1A 3BFUA 5F1QA 1F9BA 3HO7A 3PPNA 3KBRA 3O6HA 4KI0E 1B05A 1IZ1A 3H4ZA 1UIVA 1EH3A 1MXYA 2YLNA 3CSBA 4PFTA 2Z8FA 1OLCA 4F29A 4X1BA 2B3BA 3GXAA 1US4A 3UA8A 3V89B 4DIGA 4EUOA 4KHZE 1B3EA 1MPCA 2O51A 1FCKA 4NF8A 2XHDA 3SEWA 1XS5A 5ITOA 3Q28A 1M5BA 3TTKA 5L9MA 4PFWA 2NUVA 1DPPA 4P11A 1A40A 2D5WA 2O1MA 4JBZA 2R9JA 4F1VA 3FGSA 3G3HA 4MH5A 5DT6A 2ZYKA 1MDQA 1XVXA 4YZZA 1Y4TA 2V93A 5FTHA 2O6AA 5B70A 5DTBA 1I69A 1BTJA 3A3UA 4C0RA 2GRVA 2QSXA 1XC1A 3P7IA 1MM7A 2F5XA 3IJOB 2FNCA 4IO4A 2GFEA 3N6TA 1LFGA 4NE4A 4O3AA 3JYRA 4L17A 2Z8DA 3UP9A 1JETA 1JVYA 2ONRA 3CRBA 1MH3A 1USYH 4R9FA 1NFTA 3EPEA 1IUDA 1SW4A 4F3SA 2PMSA 2VHAA 4WKMA 5EHMA 4F3GA 5I58A 3C31A 3TTRA 1HSJA 4NMYA 4EQ9A 2F97A 2LAOA 3MVWA 4FEBA 4H1XA 2NVUB 3KJ7A 4ZEFA 4ESXA 2XXPA 4JWYA 1KWHA 4JXIA 4F39A 1URDA 2FYIA 2G93A 2F7AA 2UYFA 2DWAA 3CG1A 3FV1A 3OO6A 3OEMA 2X26A 3K6UA 4ECFA 4EF2A 3RTWB 2I48A 4KYSA 4PP0A 1QKAA 3T9UA 3FJMA 2XD3A 1R1NA 4C1UA 5TPAB 4KYDA 3RQTA 1FQCA 3KN3A 4BDNA 1B7UA 1TFAA 4R72A 1LGBC 1NKXA 1DTGA 4WEDA 1VFEA 1DMBA 5ICTA 4QRZA 2V84A 2Z23A 4ONYA 3UK4A 5TP9A 2XXQA 5FHMA 2Y7IA 4FE8A 4OXVA 1UTBA 2OWSA 1LBCA 2V3TA 4DCYA 4R73A
chains in the Genus database with same CATH superfamily
2CEYA 1RYOA 2HHMA 3WAFA 3Q26A 4JVDA 2DP8A 3RT6B 5DYHA 1Z7NE 2DSFA 3V83A 1IMAA 4HCWA 5AA3A 3JZJA 5ISUA 4PFYA 3RPLB 4ZEKA 2ZNUA 5AA1A 1VR5A 3N6UA 1PBPA 2OBGA 4GRKA 5EHSA 1Y1ZA 4TLLB 3G3JA 1H3DA 3H6TA 3SDFA 3E4RA 4N91A 3IK6B 3K00A 5I58B 3MBPA 5DVJA 1B0LA 1O7TA 1M5DA 3RGYA 4NF8B 1IMFA 3VV5A 2B4MA 4Q5TA 3OO7A 4MNPA 3FV2A 4BLAA 3PGFA 1JEUA 3TQWA 4OERA 1SBPA 3U92A 4N6PA 2XX9A 3H7MA 1IXHA 4E0WA 3TEPA 3QSLA 4GWYA 3FXUA 4I9DA 1ZMGA 4OFOA 4XXUA 1EYKA 2I49A 1B5IA 1DCUA 2XXUA 3PMVA 5CI5A 3LC8A 2UXAA 1G0IA 3CSGA 1A8FA 3PPPA 1PB8A 1Y9UA 4RY1A 3RPLA 5KDTB 3TTNA 1P1OA 3B6WA 1MY0A 4HE1A 2XXXA 3T66A 4RK9A 1I6QA 3W9VA 1N7XA 3G3GA 1A55A 3H03A 2IA4A 4KD5A 5IZ3A 2G29A 2UVJA 4PFUA 1FBHA 3LSLA 4RJZA 5LOMA 3EF7A 1GR2A 1BIYA 2ALUA 5I2KB 1ZBMA 2ESNA 3TELA 4JVCA 5I57B 4F3BA 4F18A 4ZEDA 3QMFA 3L6HA 1AIVA 2NOOA 3LSWA 1HSLA 2H5YA 3M3FA 1OVTA 4R6KA 4OWDA 3U8QA 2P3VA 3I6VA 4OEVA 1ZTYA 4GWSA 3OELA 3PD8A 3U1OA 1IMEA 3KBZA 2VPNA 5I2NA 1SPIA 1B3LA 3USDA 5CBSA 1OQHA 1B3GA 3OENA 3B7DA 3FJ7A 1VSOA 2QS4A 5ICQA 1FTMA 3B6QA 3AXFA 1NV0A 4R74A 4KQPA 1SW5A 2W7YA 2HQ0A 4OQOA 1B4ZA 1NNKA 3V8XB 2FBPA 1FPBA 3ROJA 4EF1A 3PD9A 2WBDA 2HEUA 4I3EA 3QAXA 3SERA 1A7LA 1YXIA 1JP4A 1TXFA 3B50A 3K0VA 3UGWA 2I3WA 4NF5B 1UTHB 3OO9A 4ZEBA 3TCHA 5I59A 4R9GA 4O8MA 3MWBA 2DS9A 2I58A 1N0TA 4GD5A 1ZIUA 4MIJA 3H06B 3OOAA 1YCJA 3FJGA 4PQJA 4H8IA 4XTCQ 4OANA 1QKBA 3FD3A 5AA2A 4H65A 4GX6A 3RLFE 4GXSB 4AQ4A 1IMBA 1NV1A 4IGTA 4MNIA 1D4NA 3QXMA 4TQUQ 2F34A 4XEQA 4LZ8A 3C32A 4NF4A 3Q27A 1GV8A 3OSRA 2QFLA 4ZS9A 1L5TA 2Y5LA 1DK4A 1D9VA 2ONSA 5F1QA 3EHUA 2XXRA 4YMAA 5I84A 1N3XA 1JW5A 5LTCA 3G7WA 4POXA 1YAEA 1SVXB 1GTKA 1MM6A 4ND9A 4G68B 5H8QA 3BKIB 5KZTA 3E79A 3MPKA 4PAFA 4OMBA 2ZNSA 1PB7A 3D4GA 1B7HA 2DWJA 2KLFA 1IXGA 4G68C 4Z0IA 2OZZA 3DLNA 4IGRA 2THIA 3LV0A 3ZS6A 5ET8A 5I59B 4DXBA 4I8CA 4QFNA 1FBEA 3SZPA 1EU8A 1USYE 3DM0A 4GWWA 2XXHA 4DI3D 5AA2B 1K9YA 4XIGQ 3QUJA 3PU5A 5A5LA 4IY6A 3LUZA 3TODA 3T9VA 3GYYA 2RC7A 4YKIA 3KN8A 3RT8A 4LQ5A 2XXTA 5ITPA 4DDDA 5HPQA 2ZNTA 2DXYA 2OLBA 1GVCA 2DYXA 1JQFA 5EYGA 2QL3A 1FPEA 3DP8A 3TKDA 1SI1A 4N13A 4DZ1A 4H5FA 3VLWA 1P99A 1NUZA 2X7PA 4PAKA 2XX7A 2UVHA 4NWDA 1F9BA 3HO7A 3PPNA 1EYIA 1UIVA 1EH3A 2Z8FA 4GWXA 3V89B 4EUOA 1MPCA 3SEWA 4MEVA 2FIEA 4PF6A 2XWKA 2NUVA 4H46A 1A40A 2O1MA 2WX9A 2R9JA 3FGSA 5DT6A 2ZYKA 1XVXA 1Y4TA 2V93A 1LEVA 5B70A 5DTBA 1I69A 4PDHA 2QSXA 1MM7A 2F5XA 4IO4A 3RYDA 4DI4B 1SW4A 2KQZA 4EQ9A 4OVQA 4ESXA 2XXPA 4JXIA 2FYIA 3K6UA 4EF2A 1NUWA 3FJMA 4C1UA 1FQCA 1NV3A 1TFAA 1LGBC 1VFEA 1DMBA 5ICTA 4ONYA 3HFUA 3IFCA 4DCYA 2OWSA 1LBCA 1B5JA 3SEVA 4F22A 2CMOA 2DE2A 1B46A 1H44A 4JVIA 4I62A 1QGXA 1BKAA 3MP6A 1ZKBA 2RCAA 1O63A 4LP2B 1JW1A 3BFTA 3ZKLA 4F31B 2I4CA 4P1EA 1MY1A 1N76A 3PUWE 5DEXA 5AA4A 4R2FA 4RK2A 3E13X 3TUSA 4OYVA 4PC9A 4YAHX 4MBPA 5ET6A 3B8BA 3FVGA 5H8NB 3D4CA 4OEUA 1MQGA 2AL5A 4I1DA 4N8YA 2Z22A 4O3CA 2VOZA 4HTGA 5CC2A 4OVJA 1FRPA 1FPIA 2Y7WA 3C34A 1RDZA 4RPNA 3TFLA 2PFYA 5HM4B 4QHQA 3O29A 2OWZA 4P3LA 1FBFA 3RTFB 1ZJLA 4MX6A 4NN3A 2VD2A 4MMPA 4PCDA 2KR0A 4R6HA 1K9ZA 5DW8A 2OWTA 4LZ7A 1YTVA 4U4SA 4G2ZA 3KSXA 3MQ9A 3ISPA 5EYFA 1ZU0A 1ANFA 3TAJA 4RYAA 2Y7KA 3K01A 3CFLA 4IO5A 4FECA 4U23A 2F7BA 4AS5A 2E1SA 1P1WA 3BBRA 3IX1A 3TCGA 1FTOA 2XWOA 2PX1A 1Y4CA 4FAJA 4U22A 4NF5A 4QSEA 1N3WA 4BDLA 2ZMBA 4EQ7A 3K1NA 4O3BA 2B65A 1WODA 3E78A 4N17A 4O94A 5I7IA 1B52A 1FJ9A 4WEPA 5IM2A 3O66A 1PBQA 5KCJA 5T3JA 1FPJA 2ZZXA 2DVZA 3WAEA 4YB6A 1WDNA 4MHFA 1EZOA 2O84X 2YPNA 4P9KA 1FBDA 1S7YA 3T22A 3H6VA 2DQVA 3TQLA 3VFJA 1NNTA 3EHTA 3CHGA 2NXOA 4GOTA 3D1RA 3OMBA 1N7WA 3KG2A 1S50A 2H4IA 1POTA 2ZZWA 5CMBA 2H25A 2B4LA 4WXJA 3T1BA 5CRYA 5DVFA 3S2VA 3K6WA 5BWJA 2OK2A 4FJPA 1AWBA 5IZZA 2PT2A 1MDP1 4N07A 4QF9A 4GBWA 1MS7A 4XFEA 1IEJA 2BJJX 3OSQA 3FXQA 4TLMB 1NH8A 2ABHA 3IJXB 3CFXA 3R26A 3GZGA 3QK6A 4GWZA 4O7IA 5IGAA 3IB0A 1MG1A 3KZGA 2QMXA 1NL5A 2E0SA 3IO4A 2RINA 3T0JA 4ELQA 1QUIA 3MZ1A 4JDFA 3MVYA 3HHFA 4P47A 4EXLA 1B2HA 2AIXA 3S9NC 1MY4A 1NNFA 1OLAA 1B5HA 2F6GA 1LBBA 4G61A 5A5XB 1AL3A 1QULA 4ZE9A 1MH4A 4YKJA 4RPOA 4GFRA 1M5CA 2UVIA 3TZAA 4AB5A 4K3FA 2OJTA 2FIXA 1YPNA 1II5A 3VXCA 4X9TA 4I40A 1BLFA 4BDMA 1EZPA 1MRPA 4UACA 2Y7PA 2XXWA 3C33A 4PGPA 4FEDA 1PB9A 4U21A 1XI6A 4U4XA 4NF4B 3W15C 1R6ZA 2ONKE 4YMBA 1FTLA 3UN6A 1Y3NA 1D9YA 5TPAA 1B6HA 4MLVA 4XKPA 4GX4A 3W9WA 4G4PA 3K6XA 1FTKA 4GQOA 2RKMA 3ONMA 2B3FA 3FVNA 1XVYA 4N6KA 3DP4A 4MLQA 4JWOA 2HCAA 1TFDA 5K2YA 5TP9B 3CFZA 3U94A 3O97A 2Q88A 3HCQA 1UTBB 4MCOA 1RDXA 3GBAA 5J1DA 4YU0A 3DP6A 1FBPA 2RC8A 1ATGA 3S9MC 3KC0A 4U1OA 2V25A 3MP1A 2ANJA 1A54A 3CIJA 3MW0A 2F36A 1IITA 1QVSA 1Y3PA 1LBWA 4H45A 1A8EA 1NV6A 3BIHA 2JJKA 1H45A 2F78A 2PVUA 4OFLA 1SW2A 3GLBA 3KOSA 4ZDMA 3VVEA 1NV7A 4KI0E 3H4ZA 1MXYA 2VT5A 3CSBA 4PFTA 2B3BA 4KHZE 2XHDA 5J16A 5ITOA 3Q28A 4MAGA 1DPPA 4P11A 4F1VA 4X8RA 2L5VA 1Q9DA 1BTJA 1XC1A 2FNCA 3N6TA 4NE4A 1FBGA 1MH3A 1IUDA 1LBVA 5EHMA 4F3GA 2Y5KA 3C31A 4NMYA 3IFAA 4FEBA 3MVWA 2NVUB 4ZEFA 2WYKA 1URDA 1LBXA 2G93A 3CG1A 3OO6A 2X26A 2I48A 4KYSA 1QKAA 1R1NA 5TPAB 2CZHA 4BDNA 4R72A 4WEDA 2V84A 3UK4A 4P1LA 2XXQA 5FHMA 4FE8A 1NI9A 4R73A 1INPA 1FQBA 4Q30B 2V3UA 5CMKA 1VDWA 3EN3A 4ZECA 1LFHA 2QS3A 5JTYB 4DXUA 4YICA 1B4HA 2PFZA 3QIMA 4GVOA 2YJPA 1FBCA 4IB2A 1PDAA 1QW0A 3IL1B 1FQDA 1BK4A 1M5EA 1PC3A 3T9HB 2UYEA 1B7ZA 2GHBA 3ILTB 3PTYA 4H6DA 1N84A 1UQWA 5F7VA 3QYTA 3HHGA 3C9HA 3M8UA 1FW0A 5H8HA 3LUYA 4LVQA 3ODBA 4QSDA 3C35A 1D3KA 2ZYNA 4YB5A 2UVGA 1VE4A 3RY3A 2H99A 1H43A 1JVXA 3RUMA 1EZ9A 3Q29A 1I6BA 3HPIA 3K02A 5EQAA 5CBRA 4BDQA 3HSTA 3SESA 3LR1A 3VLUA 4Q0CA 1ELJA 5CMMA 3MVZA 3SKPA 4Q8RA 3R7XA 2REGA 4GF8A 3QUFA 4OVRA 4EQBA 3V5AA 4KFQA 3DELB 1MQHA 3S4UA 3IAZA 4HXVA 3KN7A 3KFMA 2A5TA 4PE3A 4G8NA 3UIFA 1MQIA 3SEUA 4YKKA 3TDJA 1G0HA 1QJMA 4GBVA 4NF6B 3O9PA 4XF5A 4OESA 5F24A 3VXBA 4PETA 3MSTA 3MAMA 3CI8A 3H6UA 3NOHA 2X7QA 3ZSFA 5JEIA 4HS7A 4KCDA 3T96B 1KZ8A 4HCYA 3TMGA 5I57A 3KOTA 3LSXA 4OENA 2F3BA 4U1ZA 2F7CA 4RXLA 2F8DA 5H8FB 4JWXA 4H8JA 2V4CA 2Q9TA 3ILUB 2PYYA 3UORA 1B9JA 3K1MA 4PBQA 4PE5B 4DXCA 4MFIA 4F19A 4UABA 3O2AA 1YZ0A 2XXVA 4HW8A 4OHNA 1DOTA 4KPTA 1B3HA 2FHYA 3ECRA 2GQ1A 4UA8A 1OVBA 2O68A 1SW1A 4ZZAA 4XKRA 4DLDA 4N4UA 2XXKA 5TU0A 3THIA 3G3IA 2VP1A 3FASA 3EKIA 4I3YA 4GWOA 1LB8A 1Y20A 2CZLA 1NV5A 1SD3A 1JEVA 4QFLA 3FUZA 4ISUA 3H3GA 4OZ9A 4R2BA 5H8SA 1LAFE 5JK4A 3MZBA 1AMFA 4H5GA 5IKBA 1FPDA 2RF1A 4F1YA 4POWA 4JSDA 1PEBA 4KYEA 4X1DA 2ZYOA 4OETA 1LB9A 3CG3A 5H8FA 3G3KA 1BP5A 2XX8A 5L8DA 2D21A 4IY5A 1POY1 1FJ6A 2VGQA 2Z8EA 2O1LA 4GL8A 2CZKA 4YKPA 1FPKA 2PT1A 3K6VA 2XWIA 2R6GE 2OCUA 4AB6A 1XT8A 2P2AA 2WEFA 3FVKA 2P3NA 5CMCA 1MXWA 1NH7A 5A5XA 1XOCA 3TTMA 4LA9A 4HE2A 4LQ2A 5H8NA 3TCFA 1B32A 2O7UA 2Q2AA 1O64A 1NV4A 3LBSA 1URSA 4M1VA 1Q1KA 4DCXA 3GBBA 5H8QB 4EDPA 4PFIA 2QS2A 3S9LC 4G68A 4PFRA 1FQAA 2HZKA 4NG7A 2HXRA 2QS1A 2DVCA 1MXVA 1NV2A 4YB7A 4F2OA 3SEYA 1OIBA 4QSCA 1P1QA 1LAXA 4IO3A 1CB6A 1D9QA 4LATA 3FATA 1SI0A 1Q35A 3TPAA 1B51A 4C0RA 3E9XA 4P0IA 5KDTA 3K4UA 4FBPA 3KSJA 5EQ9A 1LLSA 4QFKA 1B58A 5EQ8A 3R6UA 1MXUA 4OVSA 3F11A 1NUYA 5FBPA 4X48A 1NUXA 2XA5A 3Q25A 1TWYA 1AOVA 1I6AA 5ELVA 1LSTA 3VVFA 2GHAA 4FORA 4OA4A 2DOJA 2PCRA 2XXYA 5JTYA 1FTJA 3OD7A 4IO7A 1RDYA 4OTEA 4TOZA 5LDZA 2ZXTA 4GXAA 1FQFA 1MQDA 2Y84A 4FATA 1M5FA 1LCTA 3KBRA 3O6HA 1B05A 2MKZA 3MYUA 4X1BA 1US4A 3UA8A 4DIGA 4NF8A 2O51A 1FCKA 1M5BA 3TTKA 5L9MA 4PFWA 1YYZA 1MDQA 5FTHA 4PDDA 3A3UA 3P7IA 2GFEA 4L17A 4MJOA 3FBPA 3UP9A 1JETA 2ONRA 4R9FA 3EPEA 4WKMA 1HSJA 2LAOA 4IR8A 4GX3A 4H1XA 3KJ7A 4F39A 4JWYA 1KWHA 2F7AA 2UYFA 4QBAA 3FV1A 4ECFA 2CZIA 4KYDA 3RQTA 1FPGA 1B7UA 1NKXA 4QRZA 5I5PA 5TP9A 2Y7IA 4OXVA 1UTBA 4N8GA 2V3TA 4NAPA 3TYHA 1B0HA 1RYXA 3IB1A 1LCFA 3PMWA 4H67A 4R6YA 1URGA 1MPDA 3H6WA 4NWCA 4ZZEA 1T0KA 3IOTA 3OXNA 3KEIA 4PAIA 2DXRA 1MPBA 4ELOA 3T93B 5I56A 5AA2D 5EQ7A 1RKMA 5I2KA 2H9BA 4Z7EA 5AA4B 1HSEA 3EQ1A 1LFIA 1P1NA 3FIRA 4R75A 1XHYA 2NWJA 3C36A 5FHNA 3PMXA 5L9SA 3IOVA 3M3KA 1ZLQA 1B1XA 3MZ9A 5B7DA 1KA1A 4KXPA 1KA0A 3MP8A 1N04A 3PUXE 4F2QA 4P0GA 2Y7RA 4X04A 2OX3A 3E3KA 2REJA 1SYIA 2I3VA 3MJNA 4F1UA 4FIMA 3PPRA 3MC2A 2AL4A 1JNFA 2QVVA 3U93A 2ZZVA 4QFOA 1B3FA 2A5SA 3K2DA 2H98A 4GL0A 1DBZA 1SDXA 1IXCA 3KGCA 3IORA 2QVUA 4H0WA 1MY2A 1IXIA 4PBHA 4AS4A 4G8MA 3N5LA 2AYSA 4ELPA 2HAUA 4NQ8A 1H76A 4XKQA 4PFBA 1DSNA 5I56B 2CEXA 4BDOA 5I3SA 2XXIA 5FHOA 4IO6A 1UTHA 4LONB 2Q8MA 2ZYMA 3IOWA 3RN8A 3I5OA 3HN0A 4QFPA 3L6GA 1Z7ME 1P1UA 3B6TA 4ELRA 1SYHA 3KC1A 3U72A 1GGGA 1SQYA 4OVTA 3IB2A 3O28A 2V3QA 2VPOA 2M8CA 3I3VA 1Y1MA 2FA7A 2DE4A 4G8HA 3KJTA 2GH9A 4PF8A 2HXWA 3K1PA 2QJEA 2PBWA 4PTKA 4NX1A 3PPOA 2DDKA 3JV9A 3G3FA 5ET7A 1IQ7A 3IO6A 3PPQA 4LUBA 2VD3A 2HAVA 1J1NA 2FVZA 5K2XA 4EXKA 2R8TA 3TTLA 4BDRA 4HE0A 3O6GA 4ZE8A 1B40A 5M2VA 2F6PA 3A3CA 3ZKKA 2R71A 1MQJA 4THIA 1WVJA 2DWIA 3LSFB 3PUYE 4LN5A 2O69A 3VE1B 1B1HA 1S9TA 4GLIA 3FVOA 3FXRA 4NEDA 4JSOA 4P8BA 2RCBA 3RPWA 2QMWA 3MPLA 2P1SA 2I0BA 4E0XA 2HZLA 3FZVA 1OMPA 2F35A 5IZ3B 4KCCA 3SEXA 3VLVA 2Q74A 3EHSA 1LAHE 5HBCA 1Y3QA 2DE3A 4JB7A 4U2RA 5DEXB 4N81A 3S9EA 4PGNA 5ESYA 4C1TA 5FTIA 4G77A 3PUVE 3VDFA 5CM6A 4XKNA 1R9QA 1FTAA 3BIGA 4N6DA 1A99A 4GIZA 3PUZE 3CVGA 5H8HB 4DE8A 3A09A 1TT1A 1VFDA 1IIWA 1MXZA 2P0SA 4P56A 5DVIA 2QVRA 4KR5A 2XWVA 5AE4A 3CR9A 1NMUA 2I0CA 5I2NB 1AH5A 1IMDA 3A29A 3PV0E 1FPLA 4NGUA 5EYHA 5ET5A 2RC9A 2I4BA 4NTLA 4ZEIA 4NF0A 4MF3A 2BJIA 1NNPA 1FQEA 2QPQA 1CE2A 1DPEA 5IZ1A 3T9XB 1QUJA 1MY3A 2DWHA 4M4GA 4IO2A 4NHBA 2QRYA 1UIUA 3MUQA 3FXBA 2IEEA 1FSAA 2Q2CA 3N94A 1US5A 3U65A 1JW4A 1MXXA 2HPGA 1DTZA 1LBZA 3N26A 2WYPA 2I6EA 2HFBA 3OO8A 3VVDA 3OEKA 2A5TB 3M3LA 1QUKA 2D3IA 4OFJA 4LZ5A 4ESWA 3O6IA 1FPFA 3MVXA 2WKYA 5KCJB 5BUUA 1LAGE 4F3PA 4NF6A 4RA1A 1LBYA 1R9LA 2Q8JA 1OQGA 2O7IA 4N15A 5L9OA 3C4MA 2XD2A 3IOUA 3IR1A 5IAIA 2Q89A 3RNNA 3SETA 4RNSA 3HV1A 3BFUA 1IZ1A 2YLNA 1OLCA 4F29A 3GXAA 1B3EA 1XS5A 2WBBA 2D5WA 4JBZA 1EYJA 3G3HA 4MH5A 4GWUA 4YZZA 2O6AA 2GRVA 3IJOB 1LFGA 4O3AA 3JYRA 1IMCA 4QXDA 2Z8DA 1JVYA 3CRBA 1USYH 1NFTA 4F3SA 2PMSA 2VHAA 5I58A 4O7MA 3TTRA 2F97A 4OVPA 2DWAA 3OEMA 3RTWB 1CNQA 2F3DA 4PP0A 3T9UA 2XD3A 3KN3A 1DTGA 2Z23A 4MNCA
chains in the Genus database with same CATH topology
1FQBA 1B5JA 4Q30B 2V3UA 1B0HA 3SEVA 3TYHA 5CMKA 4F22A 1RYOA 3EN3A 1RYXA 5I56A 3IB1A 4ZECA 2CMOA 2DE2A 3WAFA 1B46A 1H44A 1LCFA 3Q26A 3PMWA 4H67A 2DP8A 4R6YA 1LFHA 2QS3A 4I62A 1URGA 3RT6B 5JTYB 5DYHA 4YICA 4DXUA 1B4HA 1Z7NE 1MPDA 1BKAA 2DSFA 3H6WA 3MP6A 4NWCA 4ZZEA 1ZKBA 3V83A 2RCAA 3IOTA 1O63A 3OXNA 3QIMA 1T0KA 4LP2B 4GVOA 1JW1A 2YJPA 3KEIA 4HCWA 5AA3A 2DXRA 4IB2A 3BFTA 1PDAA 1QW0A 3IL1B 5A5XA 3ZKLA 3JZJA 5ISUA 1MPBA 1FQDA 4PFYA 4F31B 4ZEKA 2ZNUA 2I4CA 1M5EA 4ELOA 1PC3A 3T93B 5F7VA 2UYEA 5AA1A 1B7ZA 2GHBA 3T9HB 5AA2D 1MY1A 1RKMA 5I2KA 3ILTB 4H6DA 2H9BA 1VR5A 1N84A 3N6UA 4Z7EA 5AA4B 1UQWA 1PBPA 1HSEA 3EQ1A 1LFIA 1N76A 1P1NA 2OBGA 3FIRA 3C9HA 3HHGA 3PUWE 3QYTA 4R75A 5DEXA 1XHYA 4GRKA 4R2FA 3M8UA 1FW0A 1Y1ZA 4RK2A 4TLLB 3C36A 5EHSA 3PMXA 5FHNA 3G3JA 2NWJA 5L9SA 3IOVA 3M3KA 1ZLQA 5H8HA 1B1XA 3MZ9A 3E13X 3LUYA 5B7DA 3TUSA 4OYVA 4LVQA 1H3DA 3ODBA 4QSDA 3MP8A 3C35A 1D3KA 1N04A 3H6TA 3PUXE 2ZYNA 4MBPA 4YAHX 3E4RA 4P0GA 3FVGA 3IK6B 3SDFA 2Y7RA 3K00A 3D4CA 4OEUA 1MQGA 2AL5A 2REJA 1VE4A 2UVGA 1SYIA 3E3KA 3MBPA 4I1DA 3RY3A 5DVJA 2H99A 1B0LA 2I3VA 1H43A 2Z22A 1JVXA 1O7TA 2VOZA 1M5DA 3MJNA 4HTGA 4O3CA 3RGYA 4F1UA 4FIMA 3PPRA 4OVJA 3MC2A 4NF8B 2AL4A 5CC2A 1JNFA 3RUMA 3VV5A 3U93A 4Q5TA 2Y7WA 1EZ9A 3Q29A 3OO7A 1I6BA 3HPIA 3K02A 1B3FA 4QFOA 3C34A 4RPNA 2A5SA 3FV2A 4BLAA 3PGFA 3TFLA 5CBRA 3K2DA 5HM4B 1JEUA 3TQWA 4QHQA 3O29A 4OERA 1SBPA 2H98A 3U92A 4N6PA 5I84A 2XX9A 3H7MA 4GL0A 4BDQA 3RTFB 1IXHA 3HSTA 3SESA 4E0WA 3LR1A 3VLUA 1ZJLA 3TEPA 4Q0CA 1ELJA 2VD2A 5AA4A 1SDXA 3QSLA 1IXCA 3FXUA 4I9DA 1ZMGA 3KGCA 5CMMA 3IORA 4R6HA 3MVZA 4H0WA 4OFOA 2OWTA 4XXUA 1MY2A 3R7XA 3SKPA 4Q8RA 4LZ7A 1IXIA 2I49A 2REGA 1YTVA 1B5IA 4G8MA 4U4SA 3N5LA 4GF8A 3QUFA 2AYSA 2XXUA 3PMVA 4G2ZA 4ELPA 3KSXA 2HAUA 5CI5A 3LC8A 4EQBA 2UXAA 3V5AA 1H76A 3MQ9A 5EYFA 4XKQA 3CSGA 1ZU0A 1ANFA 1A8FA 3PPPA 1PB8A 1Y9UA 4KFQA 4RYAA 2Y7KA 4RY1A 3TAJA 4F2QA 3TTNA 1DSNA 3K01A 1P1OA 5KDTB 3CFLA 3B6WA 3DELB 1MY0A 4IO5A 2XXXA 4FECA 4U23A 3T66A 4BDOA 5I56B 1MQHA 2XXIA 3IAZA 2F7BA 4RK9A 2E1SA 5FHOA 3S4UA 4YB5A 1P1WA 3BBRA 3IX1A 3KN7A 4IO6A 1UTHA 3TCGA 3KFMA 4LONB 1FTOA 2A5TA 1I6QA 2PX1A 2ZYMA 1N7XA 3IOWA 3RN8A 3W9VA 1Y4CA 4G8NA 3G3GA 4FAJA 3I5OA 3HN0A 4U22A 4QFPA 3L6GA 1A55A 1Z7ME 3UIFA 4NF5A 3H03A 1MQIA 2IA4A 4QSEA 3SEUA 1N3WA 4BDLA 4KD5A 2ZMBA 1P1UA 4YKKA 3TDJA 3B6TA 4EQ7A 5TPAA 1QJMA 3K1NA 4O3BA 2B65A 1WODA 4ELRA 1SYHA 3U72A 1GGGA 2G29A 1SQYA 4NF6B 1B52A 2UVJA 3O9PA 4WEPA 3IB2A 3O28A 2V3QA 4PFUA 4OESA 3LSLA 3O66A 4RJZA 5I58B 2M8CA 3VXBA 4PETA 1PBQA 3MAMA 5KCJA 5LOMA 3CI8A 3H6UA 3EF7A 3I3VA 2X7QA 1Y1MA 3ZSFA 1GR2A 5JEIA 1BIYA 2ALUA 5I2KB 4HS7A 2DVZA 2FA7A 4KCDA 1ZBMA 3T96B 3WAEA 2DE4A 2ESNA 4HCYA 4G8HA 3KJTA 4YB6A 3TELA 5I57B 4F3BA 1WDNA 4F18A 2GH9A 1EZOA 3TMGA 2O84X 4ZEDA 5I57A 2HXWA 2YPNA 3K1PA 3KOTA 3LSXA 4OENA 3L6HA 4U1ZA 2QJEA 2F7CA 1S7YA 2PBWA 1AIVA 4RXLA 2NOOA 3T22A 2F8DA 1HSLA 3H6VA 2DQVA 3LSWA 3PPOA 4JWXA 5H8FB 4H8JA 2H5YA 3TQLA 3JV9A 3VFJA 2Q9TA 3M3FA 3G3FA 3ILUB 1NNTA 1OVTA 2PYYA 4R6KA 1IQ7A 1B9JA 3EHTA 4OWDA 3K1MA 3U8QA 3IO6A 3UORA 3PPQA 4LUBA 3I6VA 2NXOA 4GOTA 4MFIA 4PE5B 4DXCA 2VD3A 4F19A 2HAVA 3KG2A 1N7WA 3O2AA 3OMBA 1J1NA 1S50A 1POTA 2H4IA 4OEVA 5K2XA 1ZTYA 5CMBA 2XXVA 4EXKA 3OELA 3TTLA 3PD8A 4OHNA 4HW8A 2H25A 1DOTA 3U1OA 4BDRA 4KPTA 1B3HA 3O6GA 4WXJA 5CRYA 4ZE8A 3ECRA 5I2NA 1B40A 5M2VA 5CBSA 1B3LA 4UA8A 5DVFA 2F6PA 3A3CA 3S2VA 3USDA 3K6WA 2R71A 3ZKKA 1OQHA 1B3GA 1OVBA 2O68A 1MQJA 3OENA 4THIA 5BWJA 1SW1A 3B7DA 2OK2A 3FJ7A 1WVJA 1VSOA 2DWIA 2QS4A 4FJPA 4XKRA 4ZZAA 4DLDA 2PT2A 1MDP1 3LSFB 5ICQA 1FTMA 4N07A 3B6QA 3PUYE 3AXFA 4QF9A 4R74A 2O69A 4KQPA 1SW5A 2W7YA 1MS7A 2HQ0A 3VE1B 1IEJA 2BJJX 4OQOA 1B1HA 3OSQA 1S9TA 3FXQA 5TU0A 1B4ZA 3THIA 1NNKA 3G3IA 2VP1A 3FASA 1NH8A 4TLMB 3V8XB 2ABHA 4GWOA 1LB8A 4EF1A 1Y20A 2CZLA 3IJXB 3CFXA 4GLIA 3PD9A 1SD3A 3FVOA 3FXRA 2HEUA 3R26A 4NEDA 3QAXA 3GZGA 3SERA 1A7LA 3QK6A 1JEVA 4JSOA 3IB0A 1MG1A 2RCBA 3KZGA 3RPWA 2QMXA 1NL5A 1TXFA 2E0SA 2QMWA 3FUZA 3IO4A 3MPLA 4QFLA 2P1SA 2RINA 4ISUA 3H3GA 4ELQA 1QUIA 4OZ9A 2I0BA 4E0XA 3MZ1A 4R2BA 5H8SA 3K0VA 4JDFA 2HZLA 1LAFE 5JK4A 3UGWA 2I3WA 4NF5B 3MVYA 3MZBA 1UTHB 3HHFA 3OO9A 1AMFA 4H5GA 4ZEBA 3FZVA 5IKBA 1OMPA 2RF1A 3TCHA 5I59A 4R9GA 4POWA 4JSDA 1PEBA 2F35A 4KYEA 3MWBA 4X1DA 4F1YA 2ZYOA 4EXLA 2DS9A 4KCCA 2I58A 4OETA 1LB9A 1N0TA 3CG3A 3SEXA 4GD5A 3G3KA 1ZIUA 5H8FA 3H06B 1BP5A 2XX8A 5L8DA 3VLVA 1B2HA 3EHSA 1LAHE 1YCJA 2AIXA 3FJGA 3OOAA 1Y3QA 2D21A 4H8IA 4PQJA 4XTCQ 1QKBA 2DE3A 1MY4A 1NNFA 3S9NC 1OLAA 4JB7A 3FD3A 5AA2A 1B5HA 2F6GA 4H65A 4IY5A 4U2RA 1POY1 5HBCA 3RLFE 4GXSB 2VGQA 5DEXB 2Z8EA 1LBBA 2O1LA 4AQ4A 4GL8A 3S9EA 5A5XB 4YKPA 1AL3A 2PT1A 4IGTA 1QULA 4C1TA 4ZE9A 1MH4A 1D4NA 5FTIA 3QXMA 4TQUQ 2F34A 4G77A 3PUVE 3K6VA 4LZ8A 3VDFA 3C32A 4XKNA 1R9QA 2R6GE 4YKJA 2OCUA 4NF4A 4RPOA 4GFRA 5CM6A 1M5CA 3Q27A 1GV8A 2UVIA 3TZAA 4AB6A 4AB5A 4K3FA 3OSRA 2OJTA 4ZS9A 1A99A 1YPNA 1II5A 3PUZE 4GIZA 4X9TA 3VXCA 3CVGA 5H8HB 1BLFA 4DE8A 4BDMA 1XT8A 2P2AA 3A09A 1EZPA 1MRPA 1TT1A 3FVKA 5CMCA 1L5TA 1D9VA 4UACA 1MXWA 1NH7A 2ONSA 1VFDA 2XXWA 2Y7PA 3EHUA 1XOCA 1IIWA 1MXZA 2P0SA 2XXRA 3C33A 4LA9A 3TTMA 4LQ2A 5H8NA 4YMAA 5DVIA 4FEDA 1PB9A 4U21A 1B32A 1N3XA 2O7UA 2Q2AA 1JW5A 1O64A 4KR5A 3TCFA 5AE4A 3CR9A 1NMUA 4NF4B 3W15C 2I0CA 3G7WA 1R6ZA 1URSA 1YAEA 3LBSA 4M1VA 4POXA 1Q1KA 5I2NB 4DCXA 1SVXB 2ONKE 1GTKA 3GBBA 1MM6A 1AH5A 5H8QB 4EDPA 4YMBA 1FTLA 4ND9A 3UN6A 4G68B 5H8QA 1Y3NA 3PV0E 2QS2A 3BKIB 5KZTA 3S9LC 4G68A 1FQAA 2HZKA 2RC9A 1D9YA 3MPKA 2ZNSA 2I4BA 1B6HA 1PB7A 4OMBA 2QS1A 4MLVA 3D4GA 4NTLA 2DVCA 4XKPA 1B7HA 2DWJA 1MXVA 2KLFA 4MF3A 4ZEIA 3W9WA 1IXGA 4G4PA 4G68C 1NNPA 3K6XA 4YB7A 4Z0IA 2OZZA 3DLNA 4F2OA 1FQEA 3SEYA 1FTKA 4GQOA 2QPQA 1OIBA 2THIA 4IGRA 2RKMA 1CE2A 4QSCA 1DPEA 3ZS6A 1P1QA 5I59B 3ONMA 1LAXA 4DXBA 2B3FA 4I8CA 4IO3A 1CB6A 4QFNA 3FVNA 4LATA 3FATA 1XVYA 1QUJA 1SI0A 3T9XB 5H8NB 1Q35A 1MY3A 2DWHA 1B51A 3DP4A 4IO2A 4M4GA 4MLQA 3TPAA 3E9XA 1EU8A 4JWOA 4P0IA 2HCAA 3K4UA 5KDTA 1TFDA 3KSJA 2QRYA 1USYE 1LLSA 4QFKA 1UIUA 1B58A 5K2YA 3DM0A 3R6UA 3MUQA 5TP9B 3CFZA 2XXHA 2IEEA 1MXUA 3O97A 2Q88A 2Q2CA 3U94A 3HCQA 3N94A 5AA2B 1US5A 1UTBB 1JW4A 1MXXA 3QUJA 3F11A 4XIGQ 3GBAA 5J1DA 4YU0A 3PU5A 1DTZA 4IY6A 3N26A 3DP6A 2RC8A 4X48A 3Q25A 1ATGA 3S9MC 1TWYA 4U1OA 2I6EA 2HFBA 2V25A 2ANJA 3MP1A 3TODA 1A54A 3CIJA 3T9VA 1AOVA 1I6AA 5ELVA 1LSTA 3VVFA 2GHAA 2RC7A 3OO8A 3VVDA 3MW0A 3OEKA 4YKIA 2A5TB 3M3LA 2F36A 3KN8A 3RT8A 1QUKA 4FORA 4LQ5A 2XXTA 2D3IA 1IITA 2DOJA 4OFJA 5ITPA 4LZ5A 2XXYA 1QVSA 4DDDA 4ESWA 2ZNTA 2DXYA 3O6IA 5HPQA 2OLBA 1GVCA 1Y3PA 5JTYA 1FTJA 2DYXA 1JQFA 3MVXA 2WKYA 1A8EA 2QL3A 5KCJB 3OD7A 4IO7A 3DP8A 3TKDA 5BUUA 1SI1A 4OTEA 4TOZA 1LAGE 4F3PA 4NF6A 4RA1A 2ZXTA 4GXAA 4N13A 1FQFA 1MQDA 4DZ1A 1H45A 4U4XA 2Y84A 1R9LA 4H5FA 3VLWA 4FATA 1P99A 2Q8JA 1M5FA 2X7PA 2F78A 1OQGA 2O7IA 2PVUA 1LCTA 5L9OA 3C4MA 2XD2A 3IOUA 3IR1A 4OFLA 2Q89A 1SW2A 2XX7A 3GLBA 3KOSA 4ZDMA 3VVEA 5IAIA 2UVHA 3RNNA 4NWDA 4RNSA 3SETA 3HV1A 3BFUA 5F1QA 1F9BA 3HO7A 3PPNA 3KBRA 3O6HA 4KI0E 1B05A 1IZ1A 3H4ZA 1UIVA 1EH3A 1MXYA 2YLNA 3CSBA 4PFTA 2Z8FA 1OLCA 4F29A 4X1BA 2B3BA 3GXAA 1US4A 3UA8A 3V89B 4DIGA 4EUOA 4KHZE 1B3EA 1MPCA 2O51A 1FCKA 4NF8A 2XHDA 3SEWA 1XS5A 5ITOA 3Q28A 1M5BA 3TTKA 5L9MA 4PFWA 2NUVA 1DPPA 4P11A 1A40A 2D5WA 2O1MA 4JBZA 2R9JA 4F1VA 3FGSA 3G3HA 4MH5A 5DT6A 2ZYKA 1MDQA 1XVXA 4YZZA 1Y4TA 2V93A 5FTHA 2O6AA 5B70A 5DTBA 1I69A 1BTJA 3A3UA 4C0RA 2GRVA 2QSXA 1XC1A 3P7IA 1MM7A 2F5XA 3IJOB 2FNCA 4IO4A 2GFEA 3N6TA 1LFGA 4NE4A 4O3AA 3JYRA 4L17A 2Z8DA 3UP9A 1JETA 1JVYA 2ONRA 3CRBA 1MH3A 1USYH 4R9FA 1NFTA 3EPEA 1IUDA 1SW4A 4F3SA 2PMSA 2VHAA 4WKMA 5EHMA 4F3GA 5I58A 3C31A 3TTRA 1HSJA 4NMYA 4EQ9A 2F97A 2LAOA 3MVWA 4FEBA 4H1XA 2NVUB 3KJ7A 4ZEFA 4ESXA 2XXPA 4JWYA 1KWHA 4JXIA 4F39A 1URDA 2FYIA 2G93A 2F7AA 2UYFA 2DWAA 3CG1A 3FV1A 3OO6A 3OEMA 2X26A 3K6UA 4ECFA 4EF2A 3RTWB 2I48A 4KYSA 4PP0A 1QKAA 3T9UA 3FJMA 2XD3A 1R1NA 4C1UA 5TPAB 4KYDA 3RQTA 1FQCA 3KN3A 4BDNA 1B7UA 1TFAA 4R72A 1LGBC 1NKXA 1DTGA 4WEDA 1VFEA 1DMBA 5ICTA 4QRZA 2V84A 2Z23A 4ONYA 3UK4A 5TP9A 2XXQA 5FHMA 2Y7IA 4FE8A 4OXVA 1UTBA 2OWSA 1LBCA 2V3TA 4DCYA 4R73A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FQB A;  1B5J A;  4Q30 B;  2V3U A;  1B0H A;  3SEV A;  3TYH A;  5CMK A;  4F22 A;  1RYO A;  3EN3 A;  1RYX A;  5I56 A;  3IB1 A;  4ZEC A;  2CMO A;  2DE2 A;  3WAF A;  1B46 A;  1H44 A;  1LCF A;  3Q26 A;  3PMW A;  4H67 A;  2DP8 A;  4R6Y A;  1LFH A;  2QS3 A;  4I62 A;  1URG A;  3RT6 B;  5JTY B;  5DYH A;  4YIC A;  4DXU A;  1B4H A;  1Z7N E;  1MPD A;  1BKA A;  2DSF A;  3H6W A;  3MP6 A;  4NWC A;  4ZZE A;  1ZKB A;  3V83 A;  2RCA A;  3IOT A;  1O63 A;  3OXN A;  3QIM A;  1T0K A;  4LP2 B;  4GVO A;  1JW1 A;  2YJP A;  3KEI A;  4HCW A;  5AA3 A;  2DXR A;  4IB2 A;  3BFT A;  1PDA A;  1QW0 A;  3IL1 B;  5A5X A;  3ZKL A;  3JZJ A;  5ISU A;  1MPB A;  1FQD A;  4PFY A;  4F31 B;  4ZEK A;  2ZNU A;  2I4C A;  1M5E A;  4ELO A;  1PC3 A;  3T93 B;  5F7V A;  2UYE A;  5AA1 A;  1B7Z A;  2GHB A;  3T9H B;  5AA2 D;  1MY1 A;  1RKM A;  5I2K A;  3ILT B;  4H6D A;  2H9B A;  1VR5 A;  1N84 A;  3N6U A;  4Z7E A;  5AA4 B;  1UQW A;  1PBP A;  1HSE A;  3EQ1 A;  1LFI A;  1N76 A;  1P1N A;  2OBG A;  3FIR A;  3C9H A;  3HHG A;  3PUW E;  3QYT A;  4R75 A;  5DEX A;  1XHY A;  4GRK A;  4R2F A;  3M8U A;  1FW0 A;  1Y1Z A;  4RK2 A;  4TLL B;  3C36 A;  5EHS A;  3PMX A;  5FHN A;  3G3J A;  2NWJ A;  5L9S A;  3IOV A;  3M3K A;  1ZLQ A;  5H8H A;  1B1X A;  3MZ9 A;  3E13 X;  3LUY A;  5B7D A;  3TUS A;  4OYV A;  4LVQ A;  1H3D A;  3ODB A;  4QSD A;  3MP8 A;  3C35 A;  1D3K A;  1N04 A;  3H6T A;  3PUX E;  2ZYN A;  4MBP A;  4YAH X;  3E4R A;  4P0G A;  3FVG A;  3IK6 B;  3SDF A;  2Y7R A;  3K00 A;  3D4C A;  4OEU A;  1MQG A;  2AL5 A;  2REJ A;  1VE4 A;  2UVG A;  1SYI A;  3E3K A;  3MBP A;  4I1D A;  3RY3 A;  5DVJ A;  2H99 A;  1B0L A;  2I3V A;  1H43 A;  2Z22 A;  1JVX A;  1O7T A;  2VOZ A;  1M5D A;  3MJN A;  4HTG A;  4O3C A;  3RGY A;  4F1U A;  4FIM A;  3PPR A;  4OVJ A;  3MC2 A;  4NF8 B;  2AL4 A;  5CC2 A;  1JNF A;  3RUM A;  3VV5 A;  3U93 A;  4Q5T A;  2Y7W A;  1EZ9 A;  3Q29 A;  3OO7 A;  1I6B A;  3HPI A;  3K02 A;  1B3F A;  4QFO A;  3C34 A;  4RPN A;  2A5S A;  3FV2 A;  4BLA A;  3PGF A;  3TFL A;  5CBR A;  3K2D A;  5HM4 B;  1JEU A;  3TQW A;  4QHQ A;  3O29 A;  4OER A;  1SBP A;  2H98 A;  3U92 A;  4N6P A;  5I84 A;  2XX9 A;  3H7M A;  4GL0 A;  4BDQ A;  3RTF B;  1IXH A;  3HST A;  3SES A;  4E0W A;  3LR1 A;  3VLU A;  1ZJL A;  3TEP A;  4Q0C A;  1ELJ A;  2VD2 A;  5AA4 A;  1SDX A;  3QSL A;  1IXC A;  3FXU A;  4I9D A;  1ZMG A;  3KGC A;  5CMM A;  3IOR A;  4R6H A;  3MVZ A;  4H0W A;  4OFO A;  2OWT A;  4XXU A;  1MY2 A;  3R7X A;  3SKP A;  4Q8R A;  4LZ7 A;  1IXI A;  2I49 A;  2REG A;  1YTV A;  1B5I A;  4G8M A;  4U4S A;  3N5L A;  4GF8 A;  3QUF A;  2AYS A;  2XXU A;  3PMV A;  4G2Z A;  4ELP A;  3KSX A;  2HAU A;  5CI5 A;  3LC8 A;  4EQB A;  2UXA A;  3V5A A;  1H76 A;  3MQ9 A;  5EYF A;  4XKQ A;  3CSG A;  1ZU0 A;  1ANF A;  1A8F A;  3PPP A;  1PB8 A;  1Y9U A;  4KFQ A;  4RYA A;  2Y7K A;  4RY1 A;  3TAJ A;  4F2Q A;  3TTN A;  1DSN A;  3K01 A;  1P1O A;  5KDT B;  3CFL A;  3B6W A;  3DEL B;  1MY0 A;  4IO5 A;  2XXX A;  4FEC A;  4U23 A;  3T66 A;  4BDO A;  5I56 B;  1MQH A;  2XXI A;  3IAZ A;  2F7B A;  4RK9 A;  2E1S A;  5FHO A;  3S4U A;  4YB5 A;  1P1W A;  3BBR A;  3IX1 A;  3KN7 A;  4IO6 A;  1UTH A;  3TCG A;  3KFM A;  4LON B;  1FTO A;  2A5T A;  1I6Q A;  2PX1 A;  2ZYM A;  1N7X A;  3IOW A;  3RN8 A;  3W9V A;  1Y4C A;  4G8N A;  3G3G A;  4FAJ A;  3I5O A;  3HN0 A;  4U22 A;  4QFP A;  3L6G A;  1A55 A;  1Z7M E;  3UIF A;  4NF5 A;  3H03 A;  1MQI A;  2IA4 A;  4QSE A;  3SEU A;  1N3W A;  4BDL A;  4KD5 A;  2ZMB A;  1P1U A;  4YKK A;  3TDJ A;  3B6T A;  4EQ7 A;  5TPA A;  1QJM A;  3K1N A;  4O3B A;  2B65 A;  1WOD A;  4ELR A;  1SYH A;  3U72 A;  1GGG A;  2G29 A;  1SQY A;  4NF6 B;  1B52 A;  2UVJ A;  3O9P A;  4WEP A;  3IB2 A;  3O28 A;  2V3Q A;  4PFU A;  4OES A;  3LSL A;  3O66 A;  4RJZ A;  5I58 B;  2M8C A;  3VXB A;  4PET A;  1PBQ A;  3MAM A;  5KCJ A;  5LOM A;  3CI8 A;  3H6U A;  3EF7 A;  3I3V A;  2X7Q A;  1Y1M A;  3ZSF A;  1GR2 A;  5JEI A;  1BIY A;  2ALU A;  5I2K B;  4HS7 A;  2DVZ A;  2FA7 A;  4KCD A;  1ZBM A;  3T96 B;  3WAE A;  2DE4 A;  2ESN A;  4HCY A;  4G8H A;  3KJT A;  4YB6 A;  3TEL A;  5I57 B;  4F3B A;  1WDN A;  4F18 A;  2GH9 A;  1EZO A;  3TMG A;  2O84 X;  4ZED A;  5I57 A;  2HXW A;  2YPN A;  3K1P A;  3KOT A;  3LSX A;  4OEN A;  3L6H A;  4U1Z A;  2QJE A;  2F7C A;  1S7Y A;  2PBW A;  1AIV A;  4RXL A;  2NOO A;  3T22 A;  2F8D A;  1HSL A;  3H6V A;  2DQV A;  3LSW A;  3PPO A;  4JWX A;  5H8F B;  4H8J A;  2H5Y A;  3TQL A;  3JV9 A;  3VFJ A;  2Q9T A;  3M3F A;  3G3F A;  3ILU B;  1NNT A;  1OVT A;  2PYY A;  4R6K A;  1IQ7 A;  1B9J A;  3EHT A;  4OWD A;  3K1M A;  3U8Q A;  3IO6 A;  3UOR A;  3PPQ A;  4LUB A;  3I6V A;  2NXO A;  4GOT A;  4MFI A;  4PE5 B;  4DXC A;  2VD3 A;  4F19 A;  2HAV A;  3KG2 A;  1N7W A;  3O2A A;  3OMB A;  1J1N A;  1S50 A;  1POT A;  2H4I A;  4OEV A;  5K2X A;  1ZTY A;  5CMB A;  2XXV A;  4EXK A;  3OEL A;  3TTL A;  3PD8 A;  4OHN A;  4HW8 A;  2H25 A;  1DOT A;  3U1O A;  4BDR A;  4KPT A;  1B3H A;  3O6G A;  4WXJ A;  5CRY A;  4ZE8 A;  3ECR A;  5I2N A;  1B40 A;  5M2V A;  5CBS A;  1B3L A;  4UA8 A;  5DVF A;  2F6P A;  3A3C A;  3S2V A;  3USD A;  3K6W A;  2R71 A;  3ZKK A;  1OQH A;  1B3G A;  1OVB A;  2O68 A;  1MQJ A;  3OEN A;  4THI A;  5BWJ A;  1SW1 A;  3B7D A;  2OK2 A;  3FJ7 A;  1WVJ A;  1VSO A;  2DWI A;  2QS4 A;  4FJP A;  4XKR A;  4ZZA A;  4DLD A;  2PT2 A;  1MDP 1;  3LSF B;  5ICQ A;  1FTM A;  4N07 A;  3B6Q A;  3PUY E;  3AXF A;  4QF9 A;  4R74 A;  2O69 A;  4KQP A;  1SW5 A;  2W7Y A;  1MS7 A;  2HQ0 A;  3VE1 B;  1IEJ A;  2BJJ X;  4OQO A;  1B1H A;  3OSQ A;  1S9T A;  3FXQ A;  5TU0 A;  1B4Z A;  3THI A;  1NNK A;  3G3I A;  2VP1 A;  3FAS A;  1NH8 A;  4TLM B;  3V8X B;  2ABH A;  4GWO A;  1LB8 A;  4EF1 A;  1Y20 A;  2CZL A;  3IJX B;  3CFX A;  4GLI A;  3PD9 A;  1SD3 A;  3FVO A;  3FXR A;  2HEU A;  3R26 A;  4NED A;  3QAX A;  3GZG A;  3SER A;  1A7L A;  3QK6 A;  1JEV A;  4JSO A;  3IB0 A;  1MG1 A;  2RCB A;  3KZG A;  3RPW A;  2QMX A;  1NL5 A;  1TXF A;  2E0S A;  2QMW A;  3FUZ A;  3IO4 A;  3MPL A;  4QFL A;  2P1S A;  2RIN A;  4ISU A;  3H3G A;  4ELQ A;  1QUI A;  4OZ9 A;  2I0B A;  4E0X A;  3MZ1 A;  4R2B A;  5H8S A;  3K0V A;  4JDF A;  2HZL A;  1LAF E;  5JK4 A;  3UGW A;  2I3W A;  4NF5 B;  3MVY A;  3MZB A;  1UTH B;  3HHF A;  3OO9 A;  1AMF A;  4H5G A;  4ZEB A;  3FZV A;  5IKB A;  1OMP A;  2RF1 A;  3TCH A;  5I59 A;  4R9G A;  4POW A;  4JSD A;  1PEB A;  2F35 A;  4KYE A;  3MWB A;  4X1D A;  4F1Y A;  2ZYO A;  4EXL A;  2DS9 A;  4KCC A;  2I58 A;  4OET A;  1LB9 A;  1N0T A;  3CG3 A;  3SEX A;  4GD5 A;  3G3K A;  1ZIU A;  5H8F A;  3H06 B;  1BP5 A;  2XX8 A;  5L8D A;  3VLV A;  1B2H A;  3EHS A;  1LAH E;  1YCJ A;  2AIX A;  3FJG A;  3OOA A;  1Y3Q A;  2D21 A;  4H8I A;  4PQJ A;  4XTC Q;  1QKB A;  2DE3 A;  1MY4 A;  1NNF A;  3S9N C;  1OLA A;  4JB7 A;  3FD3 A;  5AA2 A;  1B5H A;  2F6G A;  4H65 A;  4IY5 A;  4U2R A;  1POY 1;  5HBC A;  3RLF E;  4GXS B;  2VGQ A;  5DEX B;  2Z8E A;  1LBB A;  2O1L A;  4AQ4 A;  4GL8 A;  3S9E A;  5A5X B;  4YKP A;  1AL3 A;  2PT1 A;  4IGT A;  1QUL A;  4C1T A;  4ZE9 A;  1MH4 A;  1D4N A;  5FTI A;  3QXM A;  4TQU Q;  2F34 A;  4G77 A;  3PUV E;  3K6V A;  4LZ8 A;  3VDF A;  3C32 A;  4XKN A;  1R9Q A;  2R6G E;  4YKJ A;  2OCU A;  4NF4 A;  4RPO A;  4GFR A;  5CM6 A;  1M5C A;  3Q27 A;  1GV8 A;  2UVI A;  3TZA A;  4AB6 A;  4AB5 A;  4K3F A;  3OSR A;  2OJT A;  4ZS9 A;  1A99 A;  1YPN A;  1II5 A;  3PUZ E;  4GIZ A;  4X9T A;  3VXC A;  3CVG A;  5H8H B;  1BLF A;  4DE8 A;  4BDM A;  1XT8 A;  2P2A A;  3A09 A;  1EZP A;  1MRP A;  1TT1 A;  3FVK A;  5CMC A;  1L5T A;  1D9V A;  4UAC A;  1MXW A;  1NH7 A;  2ONS A;  1VFD A;  2XXW A;  2Y7P A;  3EHU A;  1XOC A;  1IIW A;  1MXZ A;  2P0S A;  2XXR A;  3C33 A;  4LA9 A;  3TTM A;  4LQ2 A;  5H8N A;  4YMA A;  5DVI A;  4FED A;  1PB9 A;  4U21 A;  1B32 A;  1N3X A;  2O7U A;  2Q2A A;  1JW5 A;  1O64 A;  4KR5 A;  3TCF A;  5AE4 A;  3CR9 A;  1NMU A;  4NF4 B;  3W15 C;  2I0C A;  3G7W A;  1R6Z A;  1URS A;  1YAE A;  3LBS A;  4M1V A;  4POX A;  1Q1K A;  5I2N B;  4DCX A;  1SVX B;  2ONK E;  1GTK A;  3GBB A;  1MM6 A;  1AH5 A;  5H8Q B;  4EDP A;  4YMB A;  1FTL A;  4ND9 A;  3UN6 A;  4G68 B;  5H8Q A;  1Y3N A;  3PV0 E;  2QS2 A;  3BKI B;  5KZT A;  3S9L C;  4G68 A;  1FQA A;  2HZK A;  2RC9 A;  1D9Y A;  3MPK A;  2ZNS A;  2I4B A;  1B6H A;  1PB7 A;  4OMB A;  2QS1 A;  4MLV A;  3D4G A;  4NTL A;  2DVC A;  4XKP A;  1B7H A;  2DWJ A;  1MXV A;  2KLF A;  4MF3 A;  4ZEI A;  3W9W A;  1IXG A;  4G4P A;  4G68 C;  1NNP A;  3K6X A;  4YB7 A;  4Z0I A;  2OZZ A;  3DLN A;  4F2O A;  1FQE A;  3SEY A;  1FTK A;  4GQO A;  2QPQ A;  1OIB A;  2THI A;  4IGR A;  2RKM A;  1CE2 A;  4QSC A;  1DPE A;  3ZS6 A;  1P1Q A;  5I59 B;  3ONM A;  1LAX A;  4DXB A;  2B3F A;  4I8C A;  4IO3 A;  1CB6 A;  4QFN A;  3FVN A;  4LAT A;  3FAT A;  1XVY A;  1QUJ A;  1SI0 A;  3T9X B;  5H8N B;  1Q35 A;  1MY3 A;  2DWH A;  1B51 A;  3DP4 A;  4IO2 A;  4M4G A;  4MLQ A;  3TPA A;  3E9X A;  1EU8 A;  4JWO A;  4P0I A;  2HCA A;  3K4U A;  5KDT A;  1TFD A;  3KSJ A;  2QRY A;  1USY E;  1LLS A;  4QFK A;  1UIU A;  1B58 A;  5K2Y A;  3DM0 A;  3R6U A;  3MUQ A;  5TP9 B;  3CFZ A;  2XXH A;  2IEE A;  1MXU A;  3O97 A;  2Q88 A;  2Q2C A;  3U94 A;  3HCQ A;  3N94 A;  5AA2 B;  1US5 A;  1UTB B;  1JW4 A;  1MXX A;  3QUJ A;  3F11 A;  4XIG Q;  3GBA A;  5J1D A;  4YU0 A;  3PU5 A;  1DTZ A;  4IY6 A;  3N26 A;  3DP6 A;  2RC8 A;  4X48 A;  3Q25 A;  1ATG A;  3S9M C;  1TWY A;  4U1O A;  2I6E A;  2HFB A;  2V25 A;  2ANJ A;  3MP1 A;  3TOD A;  1A54 A;  3CIJ A;  3T9V A;  1AOV A;  1I6A A;  5ELV A;  1LST A;  3VVF A;  2GHA A;  2RC7 A;  3OO8 A;  3VVD A;  3MW0 A;  3OEK A;  4YKI A;  2A5T B;  3M3L A;  2F36 A;  3KN8 A;  3RT8 A;  1QUK A;  4FOR A;  4LQ5 A;  2XXT A;  2D3I A;  1IIT A;  2DOJ A;  4OFJ A;  5ITP A;  4LZ5 A;  2XXY A;  1QVS A;  4DDD A;  4ESW A;  2ZNT A;  2DXY A;  3O6I A;  5HPQ A;  2OLB A;  1GVC A;  1Y3P A;  5JTY A;  1FTJ A;  2DYX A;  1JQF A;  3MVX A;  2WKY A;  1A8E A;  2QL3 A;  5KCJ B;  3OD7 A;  4IO7 A;  3DP8 A;  3TKD A;  5BUU A;  1SI1 A;  4OTE A;  4TOZ A;  1LAG E;  4F3P A;  4NF6 A;  4RA1 A;  2ZXT A;  4GXA A;  4N13 A;  1FQF A;  1MQD A;  4DZ1 A;  1H45 A;  4U4X A;  2Y84 A;  1R9L A;  4H5F A;  3VLW A;  4FAT A;  1P99 A;  2Q8J A;  1M5F A;  2X7P A;  2F78 A;  1OQG A;  2O7I A;  2PVU A;  1LCT A;  5L9O A;  3C4M A;  2XD2 A;  3IOU A;  3IR1 A;  4OFL A;  2Q89 A;  1SW2 A;  2XX7 A;  3GLB A;  3KOS A;  4ZDM A;  3VVE A;  5IAI A;  2UVH A;  3RNN A;  4NWD A;  4RNS A;  3SET A;  3HV1 A;  3BFU A;  5F1Q A;  1F9B A;  3HO7 A;  3PPN A;  3KBR A;  3O6H A;  4KI0 E;  1B05 A;  1IZ1 A;  3H4Z A;  1UIV A;  1EH3 A;  1MXY A;  2YLN A;  3CSB A;  4PFT A;  2Z8F A;  1OLC A;  4F29 A;  4X1B A;  2B3B A;  3GXA A;  1US4 A;  3UA8 A;  3V89 B;  4DIG A;  4EUO A;  4KHZ E;  1B3E A;  1MPC A;  2O51 A;  1FCK A;  4NF8 A;  2XHD A;  3SEW A;  1XS5 A;  5ITO A;  3Q28 A;  1M5B A;  3TTK A;  5L9M A;  4PFW A;  2NUV A;  1DPP A;  4P11 A;  1A40 A;  2D5W A;  2O1M A;  4JBZ A;  2R9J A;  4F1V A;  3FGS A;  3G3H A;  4MH5 A;  5DT6 A;  2ZYK A;  1MDQ A;  1XVX A;  4YZZ A;  1Y4T A;  2V93 A;  5FTH A;  2O6A A;  5B70 A;  5DTB A;  1I69 A;  1BTJ A;  3A3U A;  4C0R A;  2GRV A;  2QSX A;  1XC1 A;  3P7I A;  1MM7 A;  2F5X A;  3IJO B;  2FNC A;  4IO4 A;  2GFE A;  3N6T A;  1LFG A;  4NE4 A;  4O3A A;  3JYR A;  4L17 A;  2Z8D A;  3UP9 A;  1JET A;  1JVY A;  2ONR A;  3CRB A;  1MH3 A;  1USY H;  4R9F A;  1NFT A;  3EPE A;  1IUD A;  1SW4 A;  4F3S A;  2PMS A;  2VHA A;  4WKM A;  5EHM A;  4F3G A;  5I58 A;  3C31 A;  3TTR A;  1HSJ A;  4NMY A;  4EQ9 A;  2F97 A;  2LAO A;  3MVW A;  4FEB A;  4H1X A;  2NVU B;  3KJ7 A;  4ZEF A;  4ESX A;  2XXP A;  4JWY A;  1KWH A;  4JXI A;  4F39 A;  1URD A;  2FYI A;  2G93 A;  2F7A A;  2UYF A;  2DWA A;  3CG1 A;  3FV1 A;  3OO6 A;  3OEM A;  2X26 A;  3K6U A;  4ECF A;  4EF2 A;  3RTW B;  2I48 A;  4KYS A;  4PP0 A;  1QKA A;  3T9U A;  3FJM A;  2XD3 A;  1R1N A;  4C1U A;  5TPA B;  4KYD A;  3RQT A;  1FQC A;  3KN3 A;  4BDN A;  1B7U A;  1TFA A;  4R72 A;  1LGB C;  1NKX A;  1DTG A;  4WED A;  1VFE A;  1DMB A;  5ICT A;  4QRZ A;  2V84 A;  2Z23 A;  4ONY A;  3UK4 A;  5TP9 A;  2XXQ A;  5FHM A;  2Y7I A;  4FE8 A;  4OXV A;  1UTB A;  2OWS A;  1LBC A;  2V3T A;  4DCY A;  4R73 A; 
#chains in the Genus database with same CATH topology
 2CEY A;  1RYO A;  2HHM A;  3WAF A;  3Q26 A;  4JVD A;  2DP8 A;  3RT6 B;  5DYH A;  1Z7N E;  2DSF A;  3V83 A;  1IMA A;  4HCW A;  5AA3 A;  3JZJ A;  5ISU A;  4PFY A;  3RPL B;  4ZEK A;  2ZNU A;  5AA1 A;  1VR5 A;  3N6U A;  1PBP A;  2OBG A;  4GRK A;  5EHS A;  1Y1Z A;  4TLL B;  3G3J A;  1H3D A;  3H6T A;  3SDF A;  3E4R A;  4N91 A;  3IK6 B;  3K00 A;  5I58 B;  3MBP A;  5DVJ A;  1B0L A;  1O7T A;  1M5D A;  3RGY A;  4NF8 B;  1IMF A;  3VV5 A;  2B4M A;  4Q5T A;  3OO7 A;  4MNP A;  3FV2 A;  4BLA A;  3PGF A;  1JEU A;  3TQW A;  4OER A;  1SBP A;  3U92 A;  4N6P A;  2XX9 A;  3H7M A;  1IXH A;  4E0W A;  3TEP A;  3QSL A;  4GWY A;  3FXU A;  4I9D A;  1ZMG A;  4OFO A;  4XXU A;  1EYK A;  2I49 A;  1B5I A;  1DCU A;  2XXU A;  3PMV A;  5CI5 A;  3LC8 A;  2UXA A;  1G0I A;  3CSG A;  1A8F A;  3PPP A;  1PB8 A;  1Y9U A;  4RY1 A;  3RPL A;  5KDT B;  3TTN A;  1P1O A;  3B6W A;  1MY0 A;  4HE1 A;  2XXX A;  3T66 A;  4RK9 A;  1I6Q A;  3W9V A;  1N7X A;  3G3G A;  1A55 A;  3H03 A;  2IA4 A;  4KD5 A;  5IZ3 A;  2G29 A;  2UVJ A;  4PFU A;  1FBH A;  3LSL A;  4RJZ A;  5LOM A;  3EF7 A;  1GR2 A;  1BIY A;  2ALU A;  5I2K B;  1ZBM A;  2ESN A;  3TEL A;  4JVC A;  5I57 B;  4F3B A;  4F18 A;  4ZED A;  3QMF A;  3L6H A;  1AIV A;  2NOO A;  3LSW A;  1HSL A;  2H5Y A;  3M3F A;  1OVT A;  4R6K A;  4OWD A;  3U8Q A;  2P3V A;  3I6V A;  4OEV A;  1ZTY A;  4GWS A;  3OEL A;  3PD8 A;  3U1O A;  1IME A;  3KBZ A;  2VPN A;  5I2N A;  1SPI A;  1B3L A;  3USD A;  5CBS A;  1OQH A;  1B3G A;  3OEN A;  3B7D A;  3FJ7 A;  1VSO A;  2QS4 A;  5ICQ A;  1FTM A;  3B6Q A;  3AXF A;  1NV0 A;  4R74 A;  4KQP A;  1SW5 A;  2W7Y A;  2HQ0 A;  4OQO A;  1B4Z A;  1NNK A;  3V8X B;  2FBP A;  1FPB A;  3ROJ A;  4EF1 A;  3PD9 A;  2WBD A;  2HEU A;  4I3E A;  3QAX A;  3SER A;  1A7L A;  1YXI A;  1JP4 A;  1TXF A;  3B50 A;  3K0V A;  3UGW A;  2I3W A;  4NF5 B;  1UTH B;  3OO9 A;  4ZEB A;  3TCH A;  5I59 A;  4R9G A;  4O8M A;  3MWB A;  2DS9 A;  2I58 A;  1N0T A;  4GD5 A;  1ZIU A;  4MIJ A;  3H06 B;  3OOA A;  1YCJ A;  3FJG A;  4PQJ A;  4H8I A;  4XTC Q;  4OAN A;  1QKB A;  3FD3 A;  5AA2 A;  4H65 A;  4GX6 A;  3RLF E;  4GXS B;  4AQ4 A;  1IMB A;  1NV1 A;  4IGT A;  4MNI A;  1D4N A;  3QXM A;  4TQU Q;  2F34 A;  4XEQ A;  4LZ8 A;  3C32 A;  4NF4 A;  3Q27 A;  1GV8 A;  3OSR A;  2QFL A;  4ZS9 A;  1L5T A;  2Y5L A;  1DK4 A;  1D9V A;  2ONS A;  5F1Q A;  3EHU A;  2XXR A;  4YMA A;  5I84 A;  1N3X A;  1JW5 A;  5LTC A;  3G7W A;  4POX A;  1YAE A;  1SVX B;  1GTK A;  1MM6 A;  4ND9 A;  4G68 B;  5H8Q A;  3BKI B;  5KZT A;  3E79 A;  3MPK A;  4PAF A;  4OMB A;  2ZNS A;  1PB7 A;  3D4G A;  1B7H A;  2DWJ A;  2KLF A;  1IXG A;  4G68 C;  4Z0I A;  2OZZ A;  3DLN A;  4IGR A;  2THI A;  3LV0 A;  3ZS6 A;  5ET8 A;  5I59 B;  4DXB A;  4I8C A;  4QFN A;  1FBE A;  3SZP A;  1EU8 A;  1USY E;  3DM0 A;  4GWW A;  2XXH A;  4DI3 D;  5AA2 B;  1K9Y A;  4XIG Q;  3QUJ A;  3PU5 A;  5A5L A;  4IY6 A;  3LUZ A;  3TOD A;  3T9V A;  3GYY A;  2RC7 A;  4YKI A;  3KN8 A;  3RT8 A;  4LQ5 A;  2XXT A;  5ITP A;  4DDD A;  5HPQ A;  2ZNT A;  2DXY A;  2OLB A;  1GVC A;  2DYX A;  1JQF A;  5EYG A;  2QL3 A;  1FPE A;  3DP8 A;  3TKD A;  1SI1 A;  4N13 A;  4DZ1 A;  4H5F A;  3VLW A;  1P99 A;  1NUZ A;  2X7P A;  4PAK A;  2XX7 A;  2UVH A;  4NWD A;  1F9B A;  3HO7 A;  3PPN A;  1EYI A;  1UIV A;  1EH3 A;  2Z8F A;  4GWX A;  3V89 B;  4EUO A;  1MPC A;  3SEW A;  4MEV A;  2FIE A;  4PF6 A;  2XWK A;  2NUV A;  4H46 A;  1A40 A;  2O1M A;  2WX9 A;  2R9J A;  3FGS A;  5DT6 A;  2ZYK A;  1XVX A;  1Y4T A;  2V93 A;  1LEV A;  5B70 A;  5DTB A;  1I69 A;  4PDH A;  2QSX A;  1MM7 A;  2F5X A;  4IO4 A;  3RYD A;  4DI4 B;  1SW4 A;  2KQZ A;  4EQ9 A;  4OVQ A;  4ESX A;  2XXP A;  4JXI A;  2FYI A;  3K6U A;  4EF2 A;  1NUW A;  3FJM A;  4C1U A;  1FQC A;  1NV3 A;  1TFA A;  1LGB C;  1VFE A;  1DMB A;  5ICT A;  4ONY A;  3HFU A;  3IFC A;  4DCY A;  2OWS A;  1LBC A;  1B5J A;  3SEV A;  4F22 A;  2CMO A;  2DE2 A;  1B46 A;  1H44 A;  4JVI A;  4I62 A;  1QGX A;  1BKA A;  3MP6 A;  1ZKB A;  2RCA A;  1O63 A;  4LP2 B;  1JW1 A;  3BFT A;  3ZKL A;  4F31 B;  2I4C A;  4P1E A;  1MY1 A;  1N76 A;  3PUW E;  5DEX A;  5AA4 A;  4R2F A;  4RK2 A;  3E13 X;  3TUS A;  4OYV A;  4PC9 A;  4YAH X;  4MBP A;  5ET6 A;  3B8B A;  3FVG A;  5H8N B;  3D4C A;  4OEU A;  1MQG A;  2AL5 A;  4I1D A;  4N8Y A;  2Z22 A;  4O3C A;  2VOZ A;  4HTG A;  5CC2 A;  4OVJ A;  1FRP A;  1FPI A;  2Y7W A;  3C34 A;  1RDZ A;  4RPN A;  3TFL A;  2PFY A;  5HM4 B;  4QHQ A;  3O29 A;  2OWZ A;  4P3L A;  1FBF A;  3RTF B;  1ZJL A;  4MX6 A;  4NN3 A;  2VD2 A;  4MMP A;  4PCD A;  2KR0 A;  4R6H A;  1K9Z A;  5DW8 A;  2OWT A;  4LZ7 A;  1YTV A;  4U4S A;  4G2Z A;  3KSX A;  3MQ9 A;  3ISP A;  5EYF A;  1ZU0 A;  1ANF A;  3TAJ A;  4RYA A;  2Y7K A;  3K01 A;  3CFL A;  4IO5 A;  4FEC A;  4U23 A;  2F7B A;  4AS5 A;  2E1S A;  1P1W A;  3BBR A;  3IX1 A;  3TCG A;  1FTO A;  2XWO A;  2PX1 A;  1Y4C A;  4FAJ A;  4U22 A;  4NF5 A;  4QSE A;  1N3W A;  4BDL A;  2ZMB A;  4EQ7 A;  3K1N A;  4O3B A;  2B65 A;  1WOD A;  3E78 A;  4N17 A;  4O94 A;  5I7I A;  1B52 A;  1FJ9 A;  4WEP A;  5IM2 A;  3O66 A;  1PBQ A;  5KCJ A;  5T3J A;  1FPJ A;  2ZZX A;  2DVZ A;  3WAE A;  4YB6 A;  1WDN A;  4MHF A;  1EZO A;  2O84 X;  2YPN A;  4P9K A;  1FBD A;  1S7Y A;  3T22 A;  3H6V A;  2DQV A;  3TQL A;  3VFJ A;  1NNT A;  3EHT A;  3CHG A;  2NXO A;  4GOT A;  3D1R A;  3OMB A;  1N7W A;  3KG2 A;  1S50 A;  2H4I A;  1POT A;  2ZZW A;  5CMB A;  2H25 A;  2B4L A;  4WXJ A;  3T1B A;  5CRY A;  5DVF A;  3S2V A;  3K6W A;  5BWJ A;  2OK2 A;  4FJP A;  1AWB A;  5IZZ A;  2PT2 A;  1MDP 1;  4N07 A;  4QF9 A;  4GBW A;  1MS7 A;  4XFE A;  1IEJ A;  2BJJ X;  3OSQ A;  3FXQ A;  4TLM B;  1NH8 A;  2ABH A;  3IJX B;  3CFX A;  3R26 A;  3GZG A;  3QK6 A;  4GWZ A;  4O7I A;  5IGA A;  3IB0 A;  1MG1 A;  3KZG A;  2QMX A;  1NL5 A;  2E0S A;  3IO4 A;  2RIN A;  3T0J A;  4ELQ A;  1QUI A;  3MZ1 A;  4JDF A;  3MVY A;  3HHF A;  4P47 A;  4EXL A;  1B2H A;  2AIX A;  3S9N C;  1MY4 A;  1NNF A;  1OLA A;  1B5H A;  2F6G A;  1LBB A;  4G61 A;  5A5X B;  1AL3 A;  1QUL A;  4ZE9 A;  1MH4 A;  4YKJ A;  4RPO A;  4GFR A;  1M5C A;  2UVI A;  3TZA A;  4AB5 A;  4K3F A;  2OJT A;  2FIX A;  1YPN A;  1II5 A;  3VXC A;  4X9T A;  4I40 A;  1BLF A;  4BDM A;  1EZP A;  1MRP A;  4UAC A;  2Y7P A;  2XXW A;  3C33 A;  4PGP A;  4FED A;  1PB9 A;  4U21 A;  1XI6 A;  4U4X A;  4NF4 B;  3W15 C;  1R6Z A;  2ONK E;  4YMB A;  1FTL A;  3UN6 A;  1Y3N A;  1D9Y A;  5TPA A;  1B6H A;  4MLV A;  4XKP A;  4GX4 A;  3W9W A;  4G4P A;  3K6X A;  1FTK A;  4GQO A;  2RKM A;  3ONM A;  2B3F A;  3FVN A;  1XVY A;  4N6K A;  3DP4 A;  4MLQ A;  4JWO A;  2HCA A;  1TFD A;  5K2Y A;  5TP9 B;  3CFZ A;  3U94 A;  3O97 A;  2Q88 A;  3HCQ A;  1UTB B;  4MCO A;  1RDX A;  3GBA A;  5J1D A;  4YU0 A;  3DP6 A;  1FBP A;  2RC8 A;  1ATG A;  3S9M C;  3KC0 A;  4U1O A;  2V25 A;  3MP1 A;  2ANJ A;  1A54 A;  3CIJ A;  3MW0 A;  2F36 A;  1IIT A;  1QVS A;  1Y3P A;  1LBW A;  4H45 A;  1A8E A;  1NV6 A;  3BIH A;  2JJK A;  1H45 A;  2F78 A;  2PVU A;  4OFL A;  1SW2 A;  3GLB A;  3KOS A;  4ZDM A;  3VVE A;  1NV7 A;  4KI0 E;  3H4Z A;  1MXY A;  2VT5 A;  3CSB A;  4PFT A;  2B3B A;  4KHZ E;  2XHD A;  5J16 A;  5ITO A;  3Q28 A;  4MAG A;  1DPP A;  4P11 A;  4F1V A;  4X8R A;  2L5V A;  1Q9D A;  1BTJ A;  1XC1 A;  2FNC A;  3N6T A;  4NE4 A;  1FBG A;  1MH3 A;  1IUD A;  1LBV A;  5EHM A;  4F3G A;  2Y5K A;  3C31 A;  4NMY A;  3IFA A;  4FEB A;  3MVW A;  2NVU B;  4ZEF A;  2WYK A;  1URD A;  1LBX A;  2G93 A;  3CG1 A;  3OO6 A;  2X26 A;  2I48 A;  4KYS A;  1QKA A;  1R1N A;  5TPA B;  2CZH A;  4BDN A;  4R72 A;  4WED A;  2V84 A;  3UK4 A;  4P1L A;  2XXQ A;  5FHM A;  4FE8 A;  1NI9 A;  4R73 A;  1INP A;  1FQB A;  4Q30 B;  2V3U A;  5CMK A;  1VDW A;  3EN3 A;  4ZEC A;  1LFH A;  2QS3 A;  5JTY B;  4DXU A;  4YIC A;  1B4H A;  2PFZ A;  3QIM A;  4GVO A;  2YJP A;  1FBC A;  4IB2 A;  1PDA A;  1QW0 A;  3IL1 B;  1FQD A;  1BK4 A;  1M5E A;  1PC3 A;  3T9H B;  2UYE A;  1B7Z A;  2GHB A;  3ILT B;  3PTY A;  4H6D A;  1N84 A;  1UQW A;  5F7V A;  3QYT A;  3HHG A;  3C9H A;  3M8U A;  1FW0 A;  5H8H A;  3LUY A;  4LVQ A;  3ODB A;  4QSD A;  3C35 A;  1D3K A;  2ZYN A;  4YB5 A;  2UVG A;  1VE4 A;  3RY3 A;  2H99 A;  1H43 A;  1JVX A;  3RUM A;  1EZ9 A;  3Q29 A;  1I6B A;  3HPI A;  3K02 A;  5EQA A;  5CBR A;  4BDQ A;  3HST A;  3SES A;  3LR1 A;  3VLU A;  4Q0C A;  1ELJ A;  5CMM A;  3MVZ A;  3SKP A;  4Q8R A;  3R7X A;  2REG A;  4GF8 A;  3QUF A;  4OVR A;  4EQB A;  3V5A A;  4KFQ A;  3DEL B;  1MQH A;  3S4U A;  3IAZ A;  4HXV A;  3KN7 A;  3KFM A;  2A5T A;  4PE3 A;  4G8N A;  3UIF A;  1MQI A;  3SEU A;  4YKK A;  3TDJ A;  1G0H A;  1QJM A;  4GBV A;  4NF6 B;  3O9P A;  4XF5 A;  4OES A;  5F24 A;  3VXB A;  4PET A;  3MST A;  3MAM A;  3CI8 A;  3H6U A;  3NOH A;  2X7Q A;  3ZSF A;  5JEI A;  4HS7 A;  4KCD A;  3T96 B;  1KZ8 A;  4HCY A;  3TMG A;  5I57 A;  3KOT A;  3LSX A;  4OEN A;  2F3B A;  4U1Z A;  2F7C A;  4RXL A;  2F8D A;  5H8F B;  4JWX A;  4H8J A;  2V4C A;  2Q9T A;  3ILU B;  2PYY A;  3UOR A;  1B9J A;  3K1M A;  4PBQ A;  4PE5 B;  4DXC A;  4MFI A;  4F19 A;  4UAB A;  3O2A A;  1YZ0 A;  2XXV A;  4HW8 A;  4OHN A;  1DOT A;  4KPT A;  1B3H A;  2FHY A;  3ECR A;  2GQ1 A;  4UA8 A;  1OVB A;  2O68 A;  1SW1 A;  4ZZA A;  4XKR A;  4DLD A;  4N4U A;  2XXK A;  5TU0 A;  3THI A;  3G3I A;  2VP1 A;  3FAS A;  3EKI A;  4I3Y A;  4GWO A;  1LB8 A;  1Y20 A;  2CZL A;  1NV5 A;  1SD3 A;  1JEV A;  4QFL A;  3FUZ A;  4ISU A;  3H3G A;  4OZ9 A;  4R2B A;  5H8S A;  1LAF E;  5JK4 A;  3MZB A;  1AMF A;  4H5G A;  5IKB A;  1FPD A;  2RF1 A;  4F1Y A;  4POW A;  4JSD A;  1PEB A;  4KYE A;  4X1D A;  2ZYO A;  4OET A;  1LB9 A;  3CG3 A;  5H8F A;  3G3K A;  1BP5 A;  2XX8 A;  5L8D A;  2D21 A;  4IY5 A;  1POY 1;  1FJ6 A;  2VGQ A;  2Z8E A;  2O1L A;  4GL8 A;  2CZK A;  4YKP A;  1FPK A;  2PT1 A;  3K6V A;  2XWI A;  2R6G E;  2OCU A;  4AB6 A;  1XT8 A;  2P2A A;  2WEF A;  3FVK A;  2P3N A;  5CMC A;  1MXW A;  1NH7 A;  5A5X A;  1XOC A;  3TTM A;  4LA9 A;  4HE2 A;  4LQ2 A;  5H8N A;  3TCF A;  1B32 A;  2O7U A;  2Q2A A;  1O64 A;  1NV4 A;  3LBS A;  1URS A;  4M1V A;  1Q1K A;  4DCX A;  3GBB A;  5H8Q B;  4EDP A;  4PFI A;  2QS2 A;  3S9L C;  4G68 A;  4PFR A;  1FQA A;  2HZK A;  4NG7 A;  2HXR A;  2QS1 A;  2DVC A;  1MXV A;  1NV2 A;  4YB7 A;  4F2O A;  3SEY A;  1OIB A;  4QSC A;  1P1Q A;  1LAX A;  4IO3 A;  1CB6 A;  1D9Q A;  4LAT A;  3FAT A;  1SI0 A;  1Q35 A;  3TPA A;  1B51 A;  4C0R A;  3E9X A;  4P0I A;  5KDT A;  3K4U A;  4FBP A;  3KSJ A;  5EQ9 A;  1LLS A;  4QFK A;  1B58 A;  5EQ8 A;  3R6U A;  1MXU A;  4OVS A;  3F11 A;  1NUY A;  5FBP A;  4X48 A;  1NUX A;  2XA5 A;  3Q25 A;  1TWY A;  1AOV A;  1I6A A;  5ELV A;  1LST A;  3VVF A;  2GHA A;  4FOR A;  4OA4 A;  2DOJ A;  2PCR A;  2XXY A;  5JTY A;  1FTJ A;  3OD7 A;  4IO7 A;  1RDY A;  4OTE A;  4TOZ A;  5LDZ A;  2ZXT A;  4GXA A;  1FQF A;  1MQD A;  2Y84 A;  4FAT A;  1M5F A;  1LCT A;  3KBR A;  3O6H A;  1B05 A;  2MKZ A;  3MYU A;  4X1B A;  1US4 A;  3UA8 A;  4DIG A;  4NF8 A;  2O51 A;  1FCK A;  1M5B A;  3TTK A;  5L9M A;  4PFW A;  1YYZ A;  1MDQ A;  5FTH A;  4PDD A;  3A3U A;  3P7I A;  2GFE A;  4L17 A;  4MJO A;  3FBP A;  3UP9 A;  1JET A;  2ONR A;  4R9F A;  3EPE A;  4WKM A;  1HSJ A;  2LAO A;  4IR8 A;  4GX3 A;  4H1X A;  3KJ7 A;  4F39 A;  4JWY A;  1KWH A;  2F7A A;  2UYF A;  4QBA A;  3FV1 A;  4ECF A;  2CZI A;  4KYD A;  3RQT A;  1FPG A;  1B7U A;  1NKX A;  4QRZ A;  5I5P A;  5TP9 A;  2Y7I A;  4OXV A;  1UTB A;  4N8G A;  2V3T A;  4NAP A;  3TYH A;  1B0H A;  1RYX A;  3IB1 A;  1LCF A;  3PMW A;  4H67 A;  4R6Y A;  1URG A;  1MPD A;  3H6W A;  4NWC A;  4ZZE A;  1T0K A;  3IOT A;  3OXN A;  3KEI A;  4PAI A;  2DXR A;  1MPB A;  4ELO A;  3T93 B;  5I56 A;  5AA2 D;  5EQ7 A;  1RKM A;  5I2K A;  2H9B A;  4Z7E A;  5AA4 B;  1HSE A;  3EQ1 A;  1LFI A;  1P1N A;  3FIR A;  4R75 A;  1XHY A;  2NWJ A;  3C36 A;  5FHN A;  3PMX A;  5L9S A;  3IOV A;  3M3K A;  1ZLQ A;  1B1X A;  3MZ9 A;  5B7D A;  1KA1 A;  4KXP A;  1KA0 A;  3MP8 A;  1N04 A;  3PUX E;  4F2Q A;  4P0G A;  2Y7R A;  4X04 A;  2OX3 A;  3E3K A;  2REJ A;  1SYI A;  2I3V A;  3MJN A;  4F1U A;  4FIM A;  3PPR A;  3MC2 A;  2AL4 A;  1JNF A;  2QVV A;  3U93 A;  2ZZV A;  4QFO A;  1B3F A;  2A5S A;  3K2D A;  2H98 A;  4GL0 A;  1DBZ A;  1SDX A;  1IXC A;  3KGC A;  3IOR A;  2QVU A;  4H0W A;  1MY2 A;  1IXI A;  4PBH A;  4AS4 A;  4G8M A;  3N5L A;  2AYS A;  4ELP A;  2HAU A;  4NQ8 A;  1H76 A;  4XKQ A;  4PFB A;  1DSN A;  5I56 B;  2CEX A;  4BDO A;  5I3S A;  2XXI A;  5FHO A;  4IO6 A;  1UTH A;  4LON B;  2Q8M A;  2ZYM A;  3IOW A;  3RN8 A;  3I5O A;  3HN0 A;  4QFP A;  3L6G A;  1Z7M E;  1P1U A;  3B6T A;  4ELR A;  1SYH A;  3KC1 A;  3U72 A;  1GGG A;  1SQY A;  4OVT A;  3IB2 A;  3O28 A;  2V3Q A;  2VPO A;  2M8C A;  3I3V A;  1Y1M A;  2FA7 A;  2DE4 A;  4G8H A;  3KJT A;  2GH9 A;  4PF8 A;  2HXW A;  3K1P A;  2QJE A;  2PBW A;  4PTK A;  4NX1 A;  3PPO A;  2DDK A;  3JV9 A;  3G3F A;  5ET7 A;  1IQ7 A;  3IO6 A;  3PPQ A;  4LUB A;  2VD3 A;  2HAV A;  1J1N A;  2FVZ A;  5K2X A;  4EXK A;  2R8T A;  3TTL A;  4BDR A;  4HE0 A;  3O6G A;  4ZE8 A;  1B40 A;  5M2V A;  2F6P A;  3A3C A;  3ZKK A;  2R71 A;  1MQJ A;  4THI A;  1WVJ A;  2DWI A;  3LSF B;  3PUY E;  4LN5 A;  2O69 A;  3VE1 B;  1B1H A;  1S9T A;  4GLI A;  3FVO A;  3FXR A;  4NED A;  4JSO A;  4P8B A;  2RCB A;  3RPW A;  2QMW A;  3MPL A;  2P1S A;  2I0B A;  4E0X A;  2HZL A;  3FZV A;  1OMP A;  2F35 A;  5IZ3 B;  4KCC A;  3SEX A;  3VLV A;  2Q74 A;  3EHS A;  1LAH E;  5HBC A;  1Y3Q A;  2DE3 A;  4JB7 A;  4U2R A;  5DEX B;  4N81 A;  3S9E A;  4PGN A;  5ESY A;  4C1T A;  5FTI A;  4G77 A;  3PUV E;  3VDF A;  5CM6 A;  4XKN A;  1R9Q A;  1FTA A;  3BIG A;  4N6D A;  1A99 A;  4GIZ A;  3PUZ E;  3CVG A;  5H8H B;  4DE8 A;  3A09 A;  1TT1 A;  1VFD A;  1IIW A;  1MXZ A;  2P0S A;  4P56 A;  5DVI A;  2QVR A;  4KR5 A;  2XWV A;  5AE4 A;  3CR9 A;  1NMU A;  2I0C A;  5I2N B;  1AH5 A;  1IMD A;  3A29 A;  3PV0 E;  1FPL A;  4NGU A;  5EYH A;  5ET5 A;  2RC9 A;  2I4B A;  4NTL A;  4ZEI A;  4NF0 A;  4MF3 A;  2BJI A;  1NNP A;  1FQE A;  2QPQ A;  1CE2 A;  1DPE A;  5IZ1 A;  3T9X B;  1QUJ A;  1MY3 A;  2DWH A;  4M4G A;  4IO2 A;  4NHB A;  2QRY A;  1UIU A;  3MUQ A;  3FXB A;  2IEE A;  1FSA A;  2Q2C A;  3N94 A;  1US5 A;  3U65 A;  1JW4 A;  1MXX A;  2HPG A;  1DTZ A;  1LBZ A;  3N26 A;  2WYP A;  2I6E A;  2HFB A;  3OO8 A;  3VVD A;  3OEK A;  2A5T B;  3M3L A;  1QUK A;  2D3I A;  4OFJ A;  4LZ5 A;  4ESW A;  3O6I A;  1FPF A;  3MVX A;  2WKY A;  5KCJ B;  5BUU A;  1LAG E;  4F3P A;  4NF6 A;  4RA1 A;  1LBY A;  1R9L A;  2Q8J A;  1OQG A;  2O7I A;  4N15 A;  5L9O A;  3C4M A;  2XD2 A;  3IOU A;  3IR1 A;  5IAI A;  2Q89 A;  3RNN A;  3SET A;  4RNS A;  3HV1 A;  3BFU A;  1IZ1 A;  2YLN A;  1OLC A;  4F29 A;  3GXA A;  1B3E A;  1XS5 A;  2WBB A;  2D5W A;  4JBZ A;  1EYJ A;  3G3H A;  4MH5 A;  4GWU A;  4YZZ A;  2O6A A;  2GRV A;  3IJO B;  1LFG A;  4O3A A;  3JYR A;  1IMC A;  4QXD A;  2Z8D A;  1JVY A;  3CRB A;  1USY H;  1NFT A;  4F3S A;  2PMS A;  2VHA A;  5I58 A;  4O7M A;  3TTR A;  2F97 A;  4OVP A;  2DWA A;  3OEM A;  3RTW B;  1CNQ A;  2F3D A;  4PP0 A;  3T9U A;  2XD3 A;  3KN3 A;  1DTG A;  2Z23 A;  4MNC A; 
#chains in the Genus database with same CATH homology
 1FQB A;  1B5J A;  4Q30 B;  2V3U A;  1B0H A;  3SEV A;  3TYH A;  5CMK A;  4F22 A;  1RYO A;  3EN3 A;  1RYX A;  5I56 A;  3IB1 A;  4ZEC A;  2CMO A;  2DE2 A;  3WAF A;  1B46 A;  1H44 A;  1LCF A;  3Q26 A;  3PMW A;  4H67 A;  2DP8 A;  4R6Y A;  1LFH A;  2QS3 A;  4I62 A;  1URG A;  3RT6 B;  5JTY B;  5DYH A;  4YIC A;  4DXU A;  1B4H A;  1Z7N E;  1MPD A;  1BKA A;  2DSF A;  3H6W A;  3MP6 A;  4NWC A;  4ZZE A;  1ZKB A;  3V83 A;  2RCA A;  3IOT A;  1O63 A;  3OXN A;  3QIM A;  1T0K A;  4LP2 B;  4GVO A;  1JW1 A;  2YJP A;  3KEI A;  4HCW A;  5AA3 A;  2DXR A;  4IB2 A;  3BFT A;  1PDA A;  1QW0 A;  3IL1 B;  5A5X A;  3ZKL A;  3JZJ A;  5ISU A;  1MPB A;  1FQD A;  4PFY A;  4F31 B;  4ZEK A;  2ZNU A;  2I4C A;  1M5E A;  4ELO A;  1PC3 A;  3T93 B;  5F7V A;  2UYE A;  5AA1 A;  1B7Z A;  2GHB A;  3T9H B;  5AA2 D;  1MY1 A;  1RKM A;  5I2K A;  3ILT B;  4H6D A;  2H9B A;  1VR5 A;  1N84 A;  3N6U A;  4Z7E A;  5AA4 B;  1UQW A;  1PBP A;  1HSE A;  3EQ1 A;  1LFI A;  1N76 A;  1P1N A;  2OBG A;  3FIR A;  3C9H A;  3HHG A;  3PUW E;  3QYT A;  4R75 A;  5DEX A;  1XHY A;  4GRK A;  4R2F A;  3M8U A;  1FW0 A;  1Y1Z A;  4RK2 A;  4TLL B;  3C36 A;  5EHS A;  3PMX A;  5FHN A;  3G3J A;  2NWJ A;  5L9S A;  3IOV A;  3M3K A;  1ZLQ A;  5H8H A;  1B1X A;  3MZ9 A;  3E13 X;  3LUY A;  5B7D A;  3TUS A;  4OYV A;  4LVQ A;  1H3D A;  3ODB A;  4QSD A;  3MP8 A;  3C35 A;  1D3K A;  1N04 A;  3H6T A;  3PUX E;  2ZYN A;  4MBP A;  4YAH X;  3E4R A;  4P0G A;  3FVG A;  3IK6 B;  3SDF A;  2Y7R A;  3K00 A;  3D4C A;  4OEU A;  1MQG A;  2AL5 A;  2REJ A;  1VE4 A;  2UVG A;  1SYI A;  3E3K A;  3MBP A;  4I1D A;  3RY3 A;  5DVJ A;  2H99 A;  1B0L A;  2I3V A;  1H43 A;  2Z22 A;  1JVX A;  1O7T A;  2VOZ A;  1M5D A;  3MJN A;  4HTG A;  4O3C A;  3RGY A;  4F1U A;  4FIM A;  3PPR A;  4OVJ A;  3MC2 A;  4NF8 B;  2AL4 A;  5CC2 A;  1JNF A;  3RUM A;  3VV5 A;  3U93 A;  4Q5T A;  2Y7W A;  1EZ9 A;  3Q29 A;  3OO7 A;  1I6B A;  3HPI A;  3K02 A;  1B3F A;  4QFO A;  3C34 A;  4RPN A;  2A5S A;  3FV2 A;  4BLA A;  3PGF A;  3TFL A;  5CBR A;  3K2D A;  5HM4 B;  1JEU A;  3TQW A;  4QHQ A;  3O29 A;  4OER A;  1SBP A;  2H98 A;  3U92 A;  4N6P A;  5I84 A;  2XX9 A;  3H7M A;  4GL0 A;  4BDQ A;  3RTF B;  1IXH A;  3HST A;  3SES A;  4E0W A;  3LR1 A;  3VLU A;  1ZJL A;  3TEP A;  4Q0C A;  1ELJ A;  2VD2 A;  5AA4 A;  1SDX A;  3QSL A;  1IXC A;  3FXU A;  4I9D A;  1ZMG A;  3KGC A;  5CMM A;  3IOR A;  4R6H A;  3MVZ A;  4H0W A;  4OFO A;  2OWT A;  4XXU A;  1MY2 A;  3R7X A;  3SKP A;  4Q8R A;  4LZ7 A;  1IXI A;  2I49 A;  2REG A;  1YTV A;  1B5I A;  4G8M A;  4U4S A;  3N5L A;  4GF8 A;  3QUF A;  2AYS A;  2XXU A;  3PMV A;  4G2Z A;  4ELP A;  3KSX A;  2HAU A;  5CI5 A;  3LC8 A;  4EQB A;  2UXA A;  3V5A A;  1H76 A;  3MQ9 A;  5EYF A;  4XKQ A;  3CSG A;  1ZU0 A;  1ANF A;  1A8F A;  3PPP A;  1PB8 A;  1Y9U A;  4KFQ A;  4RYA A;  2Y7K A;  4RY1 A;  3TAJ A;  4F2Q A;  3TTN A;  1DSN A;  3K01 A;  1P1O A;  5KDT B;  3CFL A;  3B6W A;  3DEL B;  1MY0 A;  4IO5 A;  2XXX A;  4FEC A;  4U23 A;  3T66 A;  4BDO A;  5I56 B;  1MQH A;  2XXI A;  3IAZ A;  2F7B A;  4RK9 A;  2E1S A;  5FHO A;  3S4U A;  4YB5 A;  1P1W A;  3BBR A;  3IX1 A;  3KN7 A;  4IO6 A;  1UTH A;  3TCG A;  3KFM A;  4LON B;  1FTO A;  2A5T A;  1I6Q A;  2PX1 A;  2ZYM A;  1N7X A;  3IOW A;  3RN8 A;  3W9V A;  1Y4C A;  4G8N A;  3G3G A;  4FAJ A;  3I5O A;  3HN0 A;  4U22 A;  4QFP A;  3L6G A;  1A55 A;  1Z7M E;  3UIF A;  4NF5 A;  3H03 A;  1MQI A;  2IA4 A;  4QSE A;  3SEU A;  1N3W A;  4BDL A;  4KD5 A;  2ZMB A;  1P1U A;  4YKK A;  3TDJ A;  3B6T A;  4EQ7 A;  5TPA A;  1QJM A;  3K1N A;  4O3B A;  2B65 A;  1WOD A;  4ELR A;  1SYH A;  3U72 A;  1GGG A;  2G29 A;  1SQY A;  4NF6 B;  1B52 A;  2UVJ A;  3O9P A;  4WEP A;  3IB2 A;  3O28 A;  2V3Q A;  4PFU A;  4OES A;  3LSL A;  3O66 A;  4RJZ A;  5I58 B;  2M8C A;  3VXB A;  4PET A;  1PBQ A;  3MAM A;  5KCJ A;  5LOM A;  3CI8 A;  3H6U A;  3EF7 A;  3I3V A;  2X7Q A;  1Y1M A;  3ZSF A;  1GR2 A;  5JEI A;  1BIY A;  2ALU A;  5I2K B;  4HS7 A;  2DVZ A;  2FA7 A;  4KCD A;  1ZBM A;  3T96 B;  3WAE A;  2DE4 A;  2ESN A;  4HCY A;  4G8H A;  3KJT A;  4YB6 A;  3TEL A;  5I57 B;  4F3B A;  1WDN A;  4F18 A;  2GH9 A;  1EZO A;  3TMG A;  2O84 X;  4ZED A;  5I57 A;  2HXW A;  2YPN A;  3K1P A;  3KOT A;  3LSX A;  4OEN A;  3L6H A;  4U1Z A;  2QJE A;  2F7C A;  1S7Y A;  2PBW A;  1AIV A;  4RXL A;  2NOO A;  3T22 A;  2F8D A;  1HSL A;  3H6V A;  2DQV A;  3LSW A;  3PPO A;  4JWX A;  5H8F B;  4H8J A;  2H5Y A;  3TQL A;  3JV9 A;  3VFJ A;  2Q9T A;  3M3F A;  3G3F A;  3ILU B;  1NNT A;  1OVT A;  2PYY A;  4R6K A;  1IQ7 A;  1B9J A;  3EHT A;  4OWD A;  3K1M A;  3U8Q A;  3IO6 A;  3UOR A;  3PPQ A;  4LUB A;  3I6V A;  2NXO A;  4GOT A;  4MFI A;  4PE5 B;  4DXC A;  2VD3 A;  4F19 A;  2HAV A;  3KG2 A;  1N7W A;  3O2A A;  3OMB A;  1J1N A;  1S50 A;  1POT A;  2H4I A;  4OEV A;  5K2X A;  1ZTY A;  5CMB A;  2XXV A;  4EXK A;  3OEL A;  3TTL A;  3PD8 A;  4OHN A;  4HW8 A;  2H25 A;  1DOT A;  3U1O A;  4BDR A;  4KPT A;  1B3H A;  3O6G A;  4WXJ A;  5CRY A;  4ZE8 A;  3ECR A;  5I2N A;  1B40 A;  5M2V A;  5CBS A;  1B3L A;  4UA8 A;  5DVF A;  2F6P A;  3A3C A;  3S2V A;  3USD A;  3K6W A;  2R71 A;  3ZKK A;  1OQH A;  1B3G A;  1OVB A;  2O68 A;  1MQJ A;  3OEN A;  4THI A;  5BWJ A;  1SW1 A;  3B7D A;  2OK2 A;  3FJ7 A;  1WVJ A;  1VSO A;  2DWI A;  2QS4 A;  4FJP A;  4XKR A;  4ZZA A;  4DLD A;  2PT2 A;  1MDP 1;  3LSF B;  5ICQ A;  1FTM A;  4N07 A;  3B6Q A;  3PUY E;  3AXF A;  4QF9 A;  4R74 A;  2O69 A;  4KQP A;  1SW5 A;  2W7Y A;  1MS7 A;  2HQ0 A;  3VE1 B;  1IEJ A;  2BJJ X;  4OQO A;  1B1H A;  3OSQ A;  1S9T A;  3FXQ A;  5TU0 A;  1B4Z A;  3THI A;  1NNK A;  3G3I A;  2VP1 A;  3FAS A;  1NH8 A;  4TLM B;  3V8X B;  2ABH A;  4GWO A;  1LB8 A;  4EF1 A;  1Y20 A;  2CZL A;  3IJX B;  3CFX A;  4GLI A;  3PD9 A;  1SD3 A;  3FVO A;  3FXR A;  2HEU A;  3R26 A;  4NED A;  3QAX A;  3GZG A;  3SER A;  1A7L A;  3QK6 A;  1JEV A;  4JSO A;  3IB0 A;  1MG1 A;  2RCB A;  3KZG A;  3RPW A;  2QMX A;  1NL5 A;  1TXF A;  2E0S A;  2QMW A;  3FUZ A;  3IO4 A;  3MPL A;  4QFL A;  2P1S A;  2RIN A;  4ISU A;  3H3G A;  4ELQ A;  1QUI A;  4OZ9 A;  2I0B A;  4E0X A;  3MZ1 A;  4R2B A;  5H8S A;  3K0V A;  4JDF A;  2HZL A;  1LAF E;  5JK4 A;  3UGW A;  2I3W A;  4NF5 B;  3MVY A;  3MZB A;  1UTH B;  3HHF A;  3OO9 A;  1AMF A;  4H5G A;  4ZEB A;  3FZV A;  5IKB A;  1OMP A;  2RF1 A;  3TCH A;  5I59 A;  4R9G A;  4POW A;  4JSD A;  1PEB A;  2F35 A;  4KYE A;  3MWB A;  4X1D A;  4F1Y A;  2ZYO A;  4EXL A;  2DS9 A;  4KCC A;  2I58 A;  4OET A;  1LB9 A;  1N0T A;  3CG3 A;  3SEX A;  4GD5 A;  3G3K A;  1ZIU A;  5H8F A;  3H06 B;  1BP5 A;  2XX8 A;  5L8D A;  3VLV A;  1B2H A;  3EHS A;  1LAH E;  1YCJ A;  2AIX A;  3FJG A;  3OOA A;  1Y3Q A;  2D21 A;  4H8I A;  4PQJ A;  4XTC Q;  1QKB A;  2DE3 A;  1MY4 A;  1NNF A;  3S9N C;  1OLA A;  4JB7 A;  3FD3 A;  5AA2 A;  1B5H A;  2F6G A;  4H65 A;  4IY5 A;  4U2R A;  1POY 1;  5HBC A;  3RLF E;  4GXS B;  2VGQ A;  5DEX B;  2Z8E A;  1LBB A;  2O1L A;  4AQ4 A;  4GL8 A;  3S9E A;  5A5X B;  4YKP A;  1AL3 A;  2PT1 A;  4IGT A;  1QUL A;  4C1T A;  4ZE9 A;  1MH4 A;  1D4N A;  5FTI A;  3QXM A;  4TQU Q;  2F34 A;  4G77 A;  3PUV E;  3K6V A;  4LZ8 A;  3VDF A;  3C32 A;  4XKN A;  1R9Q A;  2R6G E;  4YKJ A;  2OCU A;  4NF4 A;  4RPO A;  4GFR A;  5CM6 A;  1M5C A;  3Q27 A;  1GV8 A;  2UVI A;  3TZA A;  4AB6 A;  4AB5 A;  4K3F A;  3OSR A;  2OJT A;  4ZS9 A;  1A99 A;  1YPN A;  1II5 A;  3PUZ E;  4GIZ A;  4X9T A;  3VXC A;  3CVG A;  5H8H B;  1BLF A;  4DE8 A;  4BDM A;  1XT8 A;  2P2A A;  3A09 A;  1EZP A;  1MRP A;  1TT1 A;  3FVK A;  5CMC A;  1L5T A;  1D9V A;  4UAC A;  1MXW A;  1NH7 A;  2ONS A;  1VFD A;  2XXW A;  2Y7P A;  3EHU A;  1XOC A;  1IIW A;  1MXZ A;  2P0S A;  2XXR A;  3C33 A;  4LA9 A;  3TTM A;  4LQ2 A;  5H8N A;  4YMA A;  5DVI A;  4FED A;  1PB9 A;  4U21 A;  1B32 A;  1N3X A;  2O7U A;  2Q2A A;  1JW5 A;  1O64 A;  4KR5 A;  3TCF A;  5AE4 A;  3CR9 A;  1NMU A;  4NF4 B;  3W15 C;  2I0C A;  3G7W A;  1R6Z A;  1URS A;  1YAE A;  3LBS A;  4M1V A;  4POX A;  1Q1K A;  5I2N B;  4DCX A;  1SVX B;  2ONK E;  1GTK A;  3GBB A;  1MM6 A;  1AH5 A;  5H8Q B;  4EDP A;  4YMB A;  1FTL A;  4ND9 A;  3UN6 A;  4G68 B;  5H8Q A;  1Y3N A;  3PV0 E;  2QS2 A;  3BKI B;  5KZT A;  3S9L C;  4G68 A;  1FQA A;  2HZK A;  2RC9 A;  1D9Y A;  3MPK A;  2ZNS A;  2I4B A;  1B6H A;  1PB7 A;  4OMB A;  2QS1 A;  4MLV A;  3D4G A;  4NTL A;  2DVC A;  4XKP A;  1B7H A;  2DWJ A;  1MXV A;  2KLF A;  4MF3 A;  4ZEI A;  3W9W A;  1IXG A;  4G4P A;  4G68 C;  1NNP A;  3K6X A;  4YB7 A;  4Z0I A;  2OZZ A;  3DLN A;  4F2O A;  1FQE A;  3SEY A;  1FTK A;  4GQO A;  2QPQ A;  1OIB A;  2THI A;  4IGR A;  2RKM A;  1CE2 A;  4QSC A;  1DPE A;  3ZS6 A;  1P1Q A;  5I59 B;  3ONM A;  1LAX A;  4DXB A;  2B3F A;  4I8C A;  4IO3 A;  1CB6 A;  4QFN A;  3FVN A;  4LAT A;  3FAT A;  1XVY A;  1QUJ A;  1SI0 A;  3T9X B;  5H8N B;  1Q35 A;  1MY3 A;  2DWH A;  1B51 A;  3DP4 A;  4IO2 A;  4M4G A;  4MLQ A;  3TPA A;  3E9X A;  1EU8 A;  4JWO A;  4P0I A;  2HCA A;  3K4U A;  5KDT A;  1TFD A;  3KSJ A;  2QRY A;  1USY E;  1LLS A;  4QFK A;  1UIU A;  1B58 A;  5K2Y A;  3DM0 A;  3R6U A;  3MUQ A;  5TP9 B;  3CFZ A;  2XXH A;  2IEE A;  1MXU A;  3O97 A;  2Q88 A;  2Q2C A;  3U94 A;  3HCQ A;  3N94 A;  5AA2 B;  1US5 A;  1UTB B;  1JW4 A;  1MXX A;  3QUJ A;  3F11 A;  4XIG Q;  3GBA A;  5J1D A;  4YU0 A;  3PU5 A;  1DTZ A;  4IY6 A;  3N26 A;  3DP6 A;  2RC8 A;  4X48 A;  3Q25 A;  1ATG A;  3S9M C;  1TWY A;  4U1O A;  2I6E A;  2HFB A;  2V25 A;  2ANJ A;  3MP1 A;  3TOD A;  1A54 A;  3CIJ A;  3T9V A;  1AOV A;  1I6A A;  5ELV A;  1LST A;  3VVF A;  2GHA A;  2RC7 A;  3OO8 A;  3VVD A;  3MW0 A;  3OEK A;  4YKI A;  2A5T B;  3M3L A;  2F36 A;  3KN8 A;  3RT8 A;  1QUK A;  4FOR A;  4LQ5 A;  2XXT A;  2D3I A;  1IIT A;  2DOJ A;  4OFJ A;  5ITP A;  4LZ5 A;  2XXY A;  1QVS A;  4DDD A;  4ESW A;  2ZNT A;  2DXY A;  3O6I A;  5HPQ A;  2OLB A;  1GVC A;  1Y3P A;  5JTY A;  1FTJ A;  2DYX A;  1JQF A;  3MVX A;  2WKY A;  1A8E A;  2QL3 A;  5KCJ B;  3OD7 A;  4IO7 A;  3DP8 A;  3TKD A;  5BUU A;  1SI1 A;  4OTE A;  4TOZ A;  1LAG E;  4F3P A;  4NF6 A;  4RA1 A;  2ZXT A;  4GXA A;  4N13 A;  1FQF A;  1MQD A;  4DZ1 A;  1H45 A;  4U4X A;  2Y84 A;  1R9L A;  4H5F A;  3VLW A;  4FAT A;  1P99 A;  2Q8J A;  1M5F A;  2X7P A;  2F78 A;  1OQG A;  2O7I A;  2PVU A;  1LCT A;  5L9O A;  3C4M A;  2XD2 A;  3IOU A;  3IR1 A;  4OFL A;  2Q89 A;  1SW2 A;  2XX7 A;  3GLB A;  3KOS A;  4ZDM A;  3VVE A;  5IAI A;  2UVH A;  3RNN A;  4NWD A;  4RNS A;  3SET A;  3HV1 A;  3BFU A;  5F1Q A;  1F9B A;  3HO7 A;  3PPN A;  3KBR A;  3O6H A;  4KI0 E;  1B05 A;  1IZ1 A;  3H4Z A;  1UIV A;  1EH3 A;  1MXY A;  2YLN A;  3CSB A;  4PFT A;  2Z8F A;  1OLC A;  4F29 A;  4X1B A;  2B3B A;  3GXA A;  1US4 A;  3UA8 A;  3V89 B;  4DIG A;  4EUO A;  4KHZ E;  1B3E A;  1MPC A;  2O51 A;  1FCK A;  4NF8 A;  2XHD A;  3SEW A;  1XS5 A;  5ITO A;  3Q28 A;  1M5B A;  3TTK A;  5L9M A;  4PFW A;  2NUV A;  1DPP A;  4P11 A;  1A40 A;  2D5W A;  2O1M A;  4JBZ A;  2R9J A;  4F1V A;  3FGS A;  3G3H A;  4MH5 A;  5DT6 A;  2ZYK A;  1MDQ A;  1XVX A;  4YZZ A;  1Y4T A;  2V93 A;  5FTH A;  2O6A A;  5B70 A;  5DTB A;  1I69 A;  1BTJ A;  3A3U A;  4C0R A;  2GRV A;  2QSX A;  1XC1 A;  3P7I A;  1MM7 A;  2F5X A;  3IJO B;  2FNC A;  4IO4 A;  2GFE A;  3N6T A;  1LFG A;  4NE4 A;  4O3A A;  3JYR A;  4L17 A;  2Z8D A;  3UP9 A;  1JET A;  1JVY A;  2ONR A;  3CRB A;  1MH3 A;  1USY H;  4R9F A;  1NFT A;  3EPE A;  1IUD A;  1SW4 A;  4F3S A;  2PMS A;  2VHA A;  4WKM A;  5EHM A;  4F3G A;  5I58 A;  3C31 A;  3TTR A;  1HSJ A;  4NMY A;  4EQ9 A;  2F97 A;  2LAO A;  3MVW A;  4FEB A;  4H1X A;  2NVU B;  3KJ7 A;  4ZEF A;  4ESX A;  2XXP A;  4JWY A;  1KWH A;  4JXI A;  4F39 A;  1URD A;  2FYI A;  2G93 A;  2F7A A;  2UYF A;  2DWA A;  3CG1 A;  3FV1 A;  3OO6 A;  3OEM A;  2X26 A;  3K6U A;  4ECF A;  4EF2 A;  3RTW B;  2I48 A;  4KYS A;  4PP0 A;  1QKA A;  3T9U A;  3FJM A;  2XD3 A;  1R1N A;  4C1U A;  5TPA B;  4KYD A;  3RQT A;  1FQC A;  3KN3 A;  4BDN A;  1B7U A;  1TFA A;  4R72 A;  1LGB C;  1NKX A;  1DTG A;  4WED A;  1VFE A;  1DMB A;  5ICT A;  4QRZ A;  2V84 A;  2Z23 A;  4ONY A;  3UK4 A;  5TP9 A;  2XXQ A;  5FHM A;  2Y7I A;  4FE8 A;  4OXV A;  1UTB A;  2OWS A;  1LBC A;  2V3T A;  4DCY A;  4R73 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...