4C16A

E-selectin lectin, egf-like and two scr domains complexed with glycomimetic antagonist
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
280
structure length
280
Chain Sequence
WSYNTSTEAMTYDEASAYCQQRYTHLVAIQNKEEIEYLNSILSYSPSYYWIGIRKVNNVWVWVGTQKPLTEEAKNWAPGEPNNRQKDEDCVEIYIKREKDVGMWNDERCSKKKLALCYTAACTNTSCSGHGECVETINNYTCKCDPGFSGLKCEQIVNCTALESPEHGSLVCSHPLGNFSYNSSCSISCDRGYLPSSMETMQCMSSGEWSAPIPACNVVECDAVTNPANGFVECFQNPGSFPWNTTCTFDCEEGFELMGAQSLQCTSSGNWDNEKPTCKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title E-Selectin Ligand Complexes Adopt an Extended High-Affinity Conformation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
molecule keywords E-SELECTIN
total genus 58
structure length 280
sequence length 280
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-08-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00008 EGF EGF-like domain
A PF00059 Lectin_C Lectin C-type domain
A PF00084 Sushi Sushi repeat (SCR repeat)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.25.10 Mainly Beta Ribbon Laminin Laminin 4c16A02
2.10.70.10 Mainly Beta Ribbon Complement Module; domain 1 Complement Module, domain 1 4c16A04
2.10.70.10 Mainly Beta Ribbon Complement Module; domain 1 Complement Module, domain 1 4c16A03
3.10.100.10 Alpha Beta Roll Mannose-Binding Protein A; Chain A Mannose-Binding Protein A, subunit A 4c16A01
4B2RA 4ZH8B 1BYFA 3OLTA 1G2LB 2ZIBA 5B1WA 3CFWA 4YZUB 3DEMA 1IODB 1FIFA 3WH3A 4K12A 1JA3A 4LQFA 2OYEP 2VVVL 3P7HA 2CG7A 1OB1C 1OK9A 1ATAA 3ERBA 2UWOB 4N34A 1H2QP 2MGRA 2IT6A 1ATBA 4BDXA 1QDDA 2Y38A 1PW9A 1UMRC 4ZXXL 1ATEA 1IODA 1UEXA 4PP8A 1J9CL 3HS5A 1P4LD 2ZWKA 4J6MA 2B5ID 2NPRA 1MQ5L 4N35A 4N36A 3P5HA 3ZD1A 4AYEA 2M94A 1NFXB 1HCGB 1O7BT 1MPUA 3NCWA 2YBYA 1IJKB 3P5EA 3P5DA 3ZHGA 1BJ3A 3KZJA 1GZ2A 4AYIA 4WR9A 4RUTA 2XRBA 3PGHA 2BPDA 3ZYIB 1KWYA 4X8TL 2LS8A 3WBRA 2H9EL 2OS9A 4QKJA 1LQDA 2I9BA 2P26A 2UWLB 1BNLA 4AYMA 1OK2A 1UKMB 2RIEA 3KQCL 1JBUL 1GKNA 4PH9A 3QCWA 5EGMB 2N40A 1QFKL 3WSRA 1X2WA 4Y76B 2VWNL 3SW0X 3KK6A 2Y7ZB 1LPGA 2WPIE 4S0UA 3PAQA 1HQ8A 1MUQA 5HYTB 1V7PA 2LOJA 1G2MB 1H2PP 5HZPB 3V65B 1O5DL 2WPKE 2IZ4A 2RKYA 4J38B 1KZB1 3ALUA 2P95L 3ELAL 4IOPB 2K2TA 2VVUL 3P5BL 4Z0LA 4O02B 3TBDA 5L2YL 1RTM1 2YGOA 3FF9A 2BQWA 2B7DL 1FIHA 3BX4B 5JVYA 1GHQB 5HYUB 3M7PA 2H2TB 3PAKA 3OLUA 1YPOA 4RS0A 3P7GA 1QO6A 2W2NE 2XQWC 4ISIL 4E1GA 4IOPA 3ALSA 2WYJB 5IKVA 1HCCA 4M18A 3N8WA 5IKTA 1IP0A 3L89M 2VH0B 1CQEA 5IKRA 2BQ6A 3GOVA 4J6LA 1KLJL 2CL8A 1UZJA 4MMYB 3N8YB 3NTGA 2ORKA 3Q3KB 5K0HB 1YUGA 5F19A 1P0SL 2AYLA 1V3XB 1F0SB 3NFPI 5JPMG 1WMYA 2KB9A 1BV4A 3LC5B 1SL4A 2OX8A 4M10A 3PARA 1BF9A 2RL0A 4ZXYL 2W26B 2OX9A 3C8JA 2H2RA 1R13A 2J94B 2P28B 1FE2A 1EMOA 3FBYA 1UV0A 2Y5FL 3ZYGA 2GO0A 3SOVA 5LGKE 1KMB1 2RIDA 2CG6A 2XR6A 2Q1JB 2QY0A 4X8VL 1EGFA 1XKAL 3H5CB 2M74A 2ZQKA 3LTGD 4XL1A 1G1RA 4IGDA 3CALA 2KL7A 1ELVA 4J6KA 3WBPA 1RDM1 1SRZA 1NQLB 3GPRC 3ASIA 5JBAE 3M36L 4N32A 2OYUP 2G00L 2WPME 3CADA 3DBZA 2W2QE 1F02I 2G7IA 4WRFA 1HT8A 5FO8C 1WHEA 1EPIA 2P94L 3N8VA 5KIRA 5CISA 1IXXB 2RIBA 2D1JB 1E87A 3WWKC 1DY1A 2ORJA 2FZZL 4LOTA 4M1GA 1LITA 3BX4A 4KZWA 4LU5A 1C1ZA 5E8DA 1IQIL 3CENL 2F9BL 1E5GA 3PBFA 3SOBB 2XWBF 4ZETA 4YMDA 3G81A 1U0NC 2BQ7A 3KRKA 2KV3A 4YT7L 3BT2A 1YUFA 2XRDA 3QH0A 2W2PE 1JZNA 2IT5A 5F2QA 3TVJA 2KV4A 1KSNB 4XLWA 4RRZA 2RKZA 1CCVA 1H8UA 4J6PA 3BPSE 1TPGA 3RR3A 2WG3C 1PTHA 4WJG2 4CUDA 1IQFL 3GCXE 3UBUB 3WHDA 3LC3B 3TK5B 4ZRVA 3LIWB 3OP8A 4DN8A 1FFMA 4G9AA 1NFUB 1XDTR 1SB2B 2P93L 1BCH1 1EQGA 4N38A 2A55A 2PUQL 3ALTA 1KZD1 1UMRA 3LN1A 1NFYB 1I0UA 2WPHE 1MD7A 1X7AL 4Y7BB 3ZYJB 4NA9L 1DIYA 4CUEA 1C3AA 1FVUB 2XBYL 2GD4A 5FFSA 1O9AA 4EZMG 2ERJA 1AUTL 5CKQA 5F1AA 1JWIB 4D0FA 5FFRA 1HJ7A 1Q4GA 1V7PB 1F0RB 2VWMK 1Z6CA 3P5FA 5L30L 1XFEA 1ADXA 3O8EB 2VRPA 2J2UB 1IVOC 3TZIA 2Y82B 4LORA 3KQBL 1COUA 1GPZA 2VUVA 2J38B 2Y7XB 2VRPB 1YXKA 3VLGA 4X8UL 2CJIB 1J34A 3BDWB 1TOZA 3KCGL 1J35A 1KX1A 4TGFA 3HUPA 1V4LA 3HS7A 1IOXA 3GISX 3CDGF 1KG0C 1NPEB 1YPUA 5FDQA 4WRCA 1SL6A 2MTIA 3CDGE 1BJ3B 1WU1B 1CX2A 3LTFB 4F4OC 2W81A 4GJ0A 4Y79B 4GKOG 2PR3B 5M62A 1EBVA 4WCOA 3ZHGD 2UWPB 2I9AA 1QO3C 3M37L 1UZQA 1B08A 1SB2A 3NCXA 3MQEA 2P3FN 3G83A 1EPJA 2WFXB 1IQJL 3SOQA 1H04P 1IGZA 2BZ6L 4OTYA 4WUXA 3HO5A 1KCGA 1KLIL 1QUBA 2WPJE 1Q3XA 1DY2A 1RDN1 3MQLA 1PRHA 4Z6AL 2W80A 1LY2A 2BPEA 5J6GG 1PPQA 4E52A 3M9ZA 3P5GA 1E5UI 1KZA1 1OJWA 4B2SA 1FVUA 1KWZA 1XPHA 2C6UA 2FLGA 3KXVA 3R62A 1G4FA 4QKIA 1CKLA 2ADXA 1W8BL 1GKGA 3GCWE 2Y5GL 1U5MA 2I83A 1H03P 3G84A 4Y71B 3FF8C 2JGXA 1FF7A 2E3XB 2MCZA 1TN3A 2RIAA 1OZ7B 1MSBA 1FAKL 2KMB1 1KIGL 3HO3A 1WT9A 3T3AA 1LMJA 1M1XB 2YGPA 4LMFA 5KTHA 2J95B 1RDO1 3SW2A 1VVDA 4QKHA 1CVWL 1JL9A 3V64C 1DQBA 1OJVA 1J35B 1HAFA 2W3KB 3F6UL 4JZFL 1IXXA 4NG9L 1UKMA 3CCKA 3N8WB 4J6NA 4WREA 1EZQB 2RA0L 1NZIA 4CUFA 2Y80B 1HFIA 1HTNA 2BRSA 1QGBA 4C9FA 4N37A 2RLPA 1PFXL 2XBWL 2JGWA 1UEXB 4Y6DB 2EI7B 3FCSB 4J6JA 4D0EA 1YPQA 1KZC1 4QKGA 4WQQA 1B6EA 2AFPA 2XC4L 1EMNA 3ZD2A 4ZRWA 2E3XC 3POYA 1NFWB 5JW1A 2W3IB 2WYGB 1W7XL 4G1MB 5CKMA 1FBRA 1OK1A 1HYRA 3WWKB 1X2TB 2PHBB 2GGUA 1PXXA 1TDQB 5FFTA 1AFD1 5K8YA 2BOHA 2VH6B 1YTTA 2VVCK 3GPRA 5JB9E 1L5GB 4RRXA 1NT0A 4AK8A 1C5MF 2EI8B 3VPPA 1RDI1 3HS6A 1Y17B 3G8KA 1Z92B 2VWLL 3C22A 2WG4B 3TGFA 4BTTA 4M17A 4WUWA 1SZBA 4BXWA 4KKDA 5COXA 4CSYA 1P9JA 1J34B 3BT1A 1HAEA 1OZ7A 3P5IA 1IQHL 1WK1A 4ZESA 3KQEL 1DDXA 1ZJKA 5JB8E 2GGXA 2BPHA 1FM5A 4CAJA 1IOEL 1FAXL 2UWNA 1TLEA 1RJHA 2XR5A 2BOKL 2J34B 4UWWA 3U7UG 2XBVL 4UXMA 2J4IB 1K9IA 2BO2A 3NTBA 3IKNA 1DVAL 1UOSA 5JBCE 3INBC 1E8BA 1KWXA 1IGXA 2PF5A 1RDL1 4PZ5A 4X8SL 4Y7AB 3OEDC 4YT6L 3IKQA 3EGFA 1WHFA 4AQTA 1E88A 3IKPA 3IKRA 1BCJ1 5IKQA 1G1QA 3NJPC 1YO8A 2RHPA 1HT5A 6COXA 5JVZA 3UBUA 2MGPA 1UOTP 4RRWA 1PGEA 3N8YA 3ENSA 2KMSA 1UOSB 3WH2A 1UZPA 4G96A 4AYDA 2MHPA 3FFGL 4GI0A 3WWKA 3KMB1 3K9XA 2EI6B 2YHFA 4Z0KB 1E8IA 4GJXA 3N8ZA 1DY0A 3VYKA 1F7MA 1CEJA 1P1ZD 1CVUA 1G4GA 3EJHA 4DJZA 1L3YA 3RS1A 1JV2B 3C9AC 3VYJA 3GPRB 2BZMA 4MUCA 2EHFA 1LPKA 1LPZA 1EGGA 1G1SA 1FSBA 4BDWA 4COXA 1HREA 4A5WB 1K9JA 2K2SB 1XARA 1Y17A 3BDWA 3QMOA 3GPRD 1KLOA 4PDCA 2Y5HL 1APOA 2VJ3A 2XWJI 1EQHA 2P3UA 3HPTA 1ZAQA 4OTJA 5I46L 3CS7L 1F7EA 1AFA1 1KWWA 4GK1A 1KX0A 1AFB1 1YUKB 1DV8A 3P7FA 3TK6B 3ZRZA 1RDJ1 1YXJA 1TLGA 2RICA 2YRAA 3L9JC 1VVCA 1URKA 2XC0L 1UZKA 3R05A 4M11A 3Q7DA 5KTIA 2RNLA 1GK5A 2PY2A 1IQKL 2KRIA 1IQNL 1K37A 1X2TA 1PWBA 1CCFA 3CA7A 1ESLA 1FJSL 1N1IA 4N33A 1HX2A 3G8LA 2WFTA 3T5OA 2W2OE 1HUPA 2FD6A 2P16L 3IITB 1XKBA 2BOUA 1A3PA 4LOSA 1U0NB 4O1ZA 3C8KD 2VUZA 1OK3A 3FD4A 1HRFA 2BOXA 3IJEB 3K7BA 2FLBL 3N8XA 3MDLA 3U73A 1OJYA 2JRAA 1KZE1 5B1RA 1RDK1 4ZHAB 4MMXB 2Y81B 1HFHA 1EPHA 1TPMA 2XC5L 2W2ME 5I0QB 4MMZB 3FF7C 1YGCL 2VWOL 4C16A 1T8DA 1U0OB 1T8CA 2XBXL 1WT9B 4KZVA 4A7IA 1RFNB 1JWIA 3OXUD 2W86A 4YNXA 5B1XA 4JYUL 4RRYA 1F00I 4JZEL 2TGFA 4ZAEB 3WBQA 1R14A 1EGIA 2MSBA 1C3AB 3KQDL 3TH3L 3HO4A 4ISHL 4JHSA 2IZ3A 1TPNA 1IQLL 3KQGA 3IX0A 3RJ3D 1ATDA 4MTHA 1IQML 4BTIA 5L2ZL 1SS2A 1CWVA 5JBBE 2V8EA 1BUUA 2EC3A 5KN5C 4ZH1D 1V4LB 1MD8A 1EPGA 1B9WA 1SL5A 1KWVA 4KMB1 1IJQA 1EAIC 1NWVA 2FLRL 5CKNA 3F1SB 4KI1E 4J6QA 1G1TA 3IU3I 1MOXC 2JKHL 4FM5A 1IQEL 4JZDL 1X2WB 1O7CT 2DDUA 1IQGL 2WIIC 1K36A 2MCYA 2O39C 2CKUA 4JYVL 2RLQA 4FXGG 4ONTD 5HYPA 1KWUA 4YLIA 2P3TA 1U67A 2P3FL 1KWTA 1WMZA 4NGAL 4XBMA 4BXSA 1IJKC 1KOEA 1MQ6L 4D90A 1Z6EL 2BMGA 3LAQA 2WPLE 1U8CB 1HZ8A 1APQA 3LN0A 3GXEA 1N7DA 1U0OA 1DX5I 3NT1A 4BTUA 3KL6B
chains in the Genus database with same CATH superfamily
4B2RA 4ZH8B 1BYFA 3OLTA 1G2LB 2ZIBA 5B1WA 3CFWA 4YZUB 3DEMA 1IODB 1FIFA 3WH3A 4K12A 2ZYCA 1JA3A 4LQFA 3FGTA 2OYEP 2VVVL 3P7HA 2CG7A 1OB1C 1OK9A 1ATAA 3ERBA 2BT8A 2UWOB 4N34A 1H2QP 2MGRA 2IT6A 1ATBA 4BDXA 1QDDA 2Y38A 1PW9A 1UMRC 4ZXXL 1ATEA 1IODA 1UEXA 4PP8A 1J9CL 3HS5A 1P4LD 2ZWKA 4J6MA 2B5ID 2NPRA 1MQ5L 4N35A 4N36A 3P5HA 3ZD1A 4AYEA 2M94A 1NFXB 1HCGB 1O7BT 1MPUA 3NCWA 2YBYA 1IJKB 3P5EA 3P5DA 3ZHGA 1BJ3A 3KZJA 1GZ2A 4AYIA 4WR9A 2H9EC 4RUTA 2XRBA 3PGHA 2BPDA 3ZYIB 1KWYA 4X8TL 2LS8A 3WBRA 2H9EL 2OS9A 4QKJA 1LQDA 2I9BA 2P26A 2UWLB 1BNLA 4AYMA 1OK2A 1UKMB 2RIEA 3KQCL 1JBUL 1GKNA 4PH9A 3QCWA 5EGMB 2N40A 1QFKL 3WSRA 1X2WA 4Y76B 2VWNL 3SW0X 3KK6A 2Y7ZB 1LPGA 2WPIE 4S0UA 3PAQA 1HQ8A 1MUQA 5HYTB 1V7PA 2LOJA 1G2MB 1H2PP 5HZPB 3V65B 1O5DL 2WPKE 2IZ4A 2RKYA 4J38B 4MSLA 1KZB1 3ALUA 2P95L 3ELAL 4IOPB 2K2TA 2VVUL 3P5BL 4Z0LA 4O02B 3TBDA 5L2YL 4BWCA 1RTM1 2YGOA 3FF9A 2BQWA 2B7DL 1FIHA 3BX4B 5JVYA 1GHQB 5HYUB 3M7PA 2H2TB 3PAKA 3OLUA 1YPOA 4RS0A 3P7GA 1QO6A 2W2NE 2XQWC 4ISIL 4E1GA 4IOPA 3ALSA 2WYJB 5IKVA 1HCCA 4M18A 3N8WA 5IKTA 1IP0A 3L89M 2Y8TA 2VH0B 1CQEA 5IKRA 3NJAA 2BQ6A 3GOVA 4QKIA 4J6LA 1KLJL 2CL8A 1UZJA 4MMYB 3N8YB 3NTGA 2ORKA 3Q3KB 3F6KA 5K0HB 1YUGA 5F19A 1P0SL 2AYLA 1V3XB 1F0SB 3NFPI 5JPMG 1WMYA 2KB9A 1BV4A 3LC5B 1SL4A 2OX8A 4M10A 3PARA 1BF9A 2RL0A 4ZXYL 2W26B 2OX9A 3C8JA 2H2RA 1R13A 2J94B 2P28B 1FE2A 1EMOA 3FBYA 1UV0A 2Y5FL 3ZYGA 2GO0A 3SOVA 5LGKE 1KMB1 2BT7A 2RIDA 2CG6A 2XR6A 2Q1JB 2QY0A 4X8VL 1EGFA 1XKAL 3H5CB 2M74A 2ZQKA 3LTGD 4XL1A 1G1RA 4IGDA 3CALA 2KL7A 1ELVA 4J6KA 3WBPA 1RDM1 1SRZA 1NQLB 3GPRC 3ASIA 5JBAE 3M36L 4PO7A 4N32A 5DN4A 2OYUP 2G00L 2WPME 3CADA 3DBZA 2W2QE 1F02I 2G7IA 4WRFA 1HT8A 5FO8C 1WHEA 1EPIA 2P94L 3N8VA 5KIRA 5CISA 1IXXB 2RIBA 1KKEA 2D1JB 1E87A 3WWKC 1DY1A 2ORJA 3K3TA 4N7EA 2FZZL 4LOTA 4M1GA 1LITA 3BX4A 4KZWA 4LU5A 1C1ZA 5E8DA 1IQIL 3CENL 2F9BL 1E5GA 3PBFA 3SOBB 2XWBF 4ZETA 4YMDA 3G81A 1U0NC 2BQ7A 3KRKA 2KV3A 4YT7L 3BT2A 1YUFA 2XRDA 3QH0A 2W2PE 1JZNA 2IT5A 5F2QA 3TVJA 2KV4A 1KSNB 4XLWA 4RRZA 2RKZA 1CCVA 1H8UA 4J6PA 3BPSE 1TPGA 3RR3A 2WG3C 1PTHA 4WJG2 4CUDA 1IQFL 3GCXE 3UBUB 3WHDA 4GU4A 3LC3B 3TK5B 4ZRVA 3LIWB 3OP8A 4DN8A 1FFMA 4G9AA 1NFUB 1XDTR 1SB2B 2P93L 1BCH1 1EQGA 4N38A 2A55A 2PUQL 3ALTA 1KZD1 1UMRA 3LN1A 1NFYB 1I0UA 2WPHE 1MD7A 1X7AL 4Y7BB 3ZYJB 4NA9L 1DIYA 4CUEA 1C3AA 1FVUB 2XBYL 2GD4A 5FFSA 1O9AA 4EZMG 2ERJA 1AUTL 5CKQA 5F1AA 1JWIB 4D0FA 5FFRA 1HJ7A 1Q4GA 1V7PB 1F0RB 2VWMK 1Z6CA 3P5FA 5L30L 1XFEA 1ADXA 3O8EB 2VRPA 2J2UB 1IVOC 3TZIA 2Y82B 4LORA 3KQBL 1COUA 1GPZA 2VUVA 2J38B 2Y7XB 2VRPB 1YXKA 3VLGA 4X8UL 2CJIB 1J34A 3BDWB 1TOZA 3KCGL 1J35A 1KX1A 4TGFA 3HUPA 1V4LA 3HS7A 1IOXA 3GISX 3CDGF 1KG0C 1NPEB 1YPUA 5FDQA 4WRCA 1SL6A 2MTIA 3CDGE 1BJ3B 1WU1B 1CX2A 3LTFB 4F4OC 2W81A 4GJ0A 4Y79B 4GKOG 2PR3B 5M62A 1EBVA 4WCOA 3ZHGD 2UWPB 2I9AA 1QO3C 3M37L 1UZQA 2YGQA 3S6XA 1B08A 3MQEA 1SB2A 3NCXA 2P3FN 3G83A 1EPJA 2WFXB 1IQJL 3SOQA 1H04P 1IGZA 2BZ6L 4OTYA 4WUXA 3HO5A 1KCGA 1KLIL 1QUBA 2WPJE 1Q3XA 1DY2A 1RDN1 3MQLA 1PRHA 4Z6AL 2W80A 1LY2A 2BPEA 5J6GG 1PPQA 4E52A 3M9ZA 3P5GA 1E5UI 1KZA1 1OJWA 4B2SA 1FVUA 1KWZA 1XPHA 2C6UA 2FLGA 3KXVA 3R62A 1V1HA 1G4FA 1CKLA 2ADXA 1W8BL 1GKGA 3GCWE 2Y5GL 1U5MA 2I83A 1H03P 3G84A 4Y71B 3FF8C 2JGXA 1FF7A 2E3XB 2MCZA 1TN3A 2RIAA 1OZ7B 2HORA 1MSBA 1FAKL 2KMB1 1KIGL 2Y8RA 3HO3A 1WT9A 3T3AA 1LMJA 1M1XB 2YGPA 4LMFA 5KTHA 2J95B 1RDO1 3SW2A 1VVDA 4QKHA 1CVWL 1JL9A 3V64C 1DQBA 1OJVA 1J35B 1HAFA 2W3KB 3F6UL 4JZFL 1IXXA 4NG9L 1UKMA 3CCKA 3N8WB 4J6NA 4WREA 1EZQB 2RA0L 1NZIA 4CUFA 2Y80B 1HFIA 1HTNA 2BRSA 1QGBA 4C9FA 4N37A 2BSFA 2RLPA 1PFXL 2XBWL 2JGWA 1UEXB 4Y6DB 2EI7B 3FCSB 4J6JA 4D0EA 1YPQA 1KZC1 4QKGA 4WQQA 1B6EA 2AFPA 2XC4L 1EMNA 3ZD2A 4ZRWA 3ZLDA 4APLA 2E3XC 3POYA 1LK9A 1NFWB 5JW1A 2W3IB 2WYGB 1W7XL 4G1MB 5CKMA 1FBRA 1OK1A 3FGRA 1HYRA 3WWKB 1X2TB 2PHBB 2GGUA 1PXXA 1TDQB 5FFTA 1AFD1 5K8YA 2BOHA 2VH6B 1YTTA 2VVCK 3GPRA 5JB9E 1L5GB 4RRXA 1NT0A 4AK8A 1C5MF 2EI8B 3VPPA 1RDI1 3HS6A 1Y17B 3G8KA 1Z92B 2VWLL 3C22A 2WG4B 3TGFA 4BTTA 4M17A 4WUWA 1SZBA 4BXWA 4KKDA 5COXA 4CSYA 1P9JA 1J34B 3BT1A 1HAEA 1OZ7A 3ZLEA 3P5IA 1IQHL 1WK1A 4ZESA 3CI0J 3KQEL 1DDXA 1ZJKA 5JB8E 2GGXA 2BPHA 1FM5A 4CAJA 1IOEL 1FAXL 2UWNA 1RLHA 1TLEA 3WSYA 1RJHA 2XR5A 2BOKL 2HOXA 2J34B 3U7UG 2Y8SA 4UWWA 2XBVL 4UXMA 2J4IB 1K9IA 2BO2A 3NTBA 3IKNA 1DVAL 1UOSA 5JBCE 3INBC 1E8BA 1KWXA 1IGXA 2PF5A 1RDL1 4PZ5A 4X8SL 4Y7AB 3OEDC 4YT6L 3IKQA 3EGFA 1WHFA 4AQTA 1E88A 3IKPA 3IKRA 1BCJ1 5IKQA 1G1QA 3NJPC 1YO8A 2RHPA 1HT5A 6COXA 5JVZA 3UBUA 2MGPA 1UOTP 4RRWA 1PGEA 3N8YA 3ENSA 2KMSA 1UOSB 3WH2A 1UZPA 4G96A 4AYDA 2MHPA 3FFGL 4GI0A 3WWKA 3KMB1 3K9XA 2EI6B 2YHFA 4Z0KB 1E8IA 4GJXA 3N8ZA 2WZPP 1QIUA 1DY0A 3VYKA 1F7MA 1CEJA 1P1ZD 1CVUA 1G4GA 3EJHA 4DJZA 1L3YA 3RS1A 1JV2B 3C9AC 3VYJA 3GPRB 2BZMA 4MUCA 2EHFA 1LPKA 1LPZA 1EGGA 1G1SA 1FSBA 4BDWA 4COXA 1HREA 4A5WB 4YIZA 2K2SB 1K9JA 1XARA 1Y17A 3QMOA 3BDWA 3VWOA 3GPRD 1KLOA 4PDCA 2Y5HL 1APOA 2VJ3A 2XWJI 1EQHA 2P3UA 3HPTA 1ZAQA 4OTJA 5I46L 3CS7L 1F7EA 4A94C 1AFA1 1KWWA 4GK1A 1KX0A 1AFB1 1YUKB 1DV8A 3P7FA 2VRSA 3TK6B 3ZRZA 1RDJ1 1YXJA 1TLGA 2RICA 2YRAA 3L9JC 1VVCA 1URKA 2XC0L 1UZKA 3R05A 4M11A 3Q7DA 5KTIA 2RNLA 1GK5A 2PY2A 1IQKL 2KRIA 1IQNL 1K37A 1X2TA 1PWBA 1CCFA 5DN5A 3CA7A 1ESLA 1FJSL 1N1IA 4N33A 1HX2A 3G8LA 2WFTA 1LMMA 2W2OE 3T5OA 1HUPA 2FD6A 2P16L 3IITB 1XKBA 2BOUA 1A3PA 4LOSA 1U0NB 4O1ZA 3C8KD 2VUZA 1OK3A 3FD4A 1HRFA 2BOXA 3IJEB 3WSXA 3K7BA 2FLBL 3N8XA 3MDLA 3U73A 1OJYA 2JRAA 1KZE1 5B1RA 1RDK1 4ZHAB 4MMXB 2Y81B 2I2LA 1HFHA 1EPHA 1TPMA 2XC5L 2W2ME 5I0QB 4MMZB 3FF7C 1YGCL 2VWOL 4C16A 1T8DA 1U0OB 1T8CA 2XBXL 1WT9B 4KZVA 4A7IA 1RFNB 1JWIA 3OXUD 2W86A 4YNXA 5B1XA 4JYUL 4RRYA 1F00I 4JZEL 2TGFA 4ZAEB 3WBQA 1R14A 1EGIA 2MSBA 1C3AB 3KQDL 3TH3L 3HO4A 4ISHL 4JHSA 2IZ3A 1TPNA 1IQLL 3KQGA 3IX0A 3RJ3D 1ATDA 2KNIA 4MTHA 1IQML 4BTIA 5L2ZL 2JJLA 1SS2A 1CWVA 5JBBE 2V8EA 1BUUA 2EC3A 5KN5C 4ZH1D 1V4LB 1MD8A 1EPGA 1B9WA 1SL5A 1KWVA 4KMB1 1IJQA 1EAIC 1NWVA 2FLRL 5CKNA 3F1SB 4KI1E 2X2ZA 4J6QA 1G1TA 3IU3I 1MOXC 2JKHL 4FM5A 1IQEL 4JZDL 1X2WB 1O7CT 2DDUA 1IQGL 2WIIC 1K36A 2MCYA 2O39C 2CKUA 4JYVL 2RLQA 4FXGG 4ONTD 5HYPA 1KWUA 4YLIA 2P3TA 1V1IA 1U67A 2P3FL 1KWTA 1WMZA 4NGAL 4XBMA 4BXSA 1IJKC 1KOEA 1MQ6L 4D90A 1Z6EL 2BMGA 3LAQA 4GU3A 2WPLE 1U8CB 1HZ8A 1APQA 3LN0A 3GXEA 1N7DA 1U0OA 1DX5I 3NT1A 4BTUA 3KL6B
chains in the Genus database with same CATH topology
4B2RA 4ZH8B 1BYFA 3OLTA 1G2LB 2ZIBA 5B1WA 3CFWA 4YZUB 3DEMA 1IODB 1FIFA 3WH3A 4K12A 1JA3A 4LQFA 2OYEP 2VVVL 3P7HA 2CG7A 1OB1C 1OK9A 1ATAA 3ERBA 2UWOB 4N34A 1H2QP 2MGRA 2IT6A 1ATBA 4BDXA 1QDDA 2Y38A 1PW9A 1UMRC 4ZXXL 1ATEA 1IODA 1UEXA 4PP8A 1J9CL 3HS5A 1P4LD 2ZWKA 4J6MA 2B5ID 2NPRA 1MQ5L 4N35A 4N36A 3P5HA 3ZD1A 4AYEA 2M94A 1NFXB 1HCGB 1O7BT 1MPUA 3NCWA 2YBYA 1IJKB 3P5EA 3P5DA 3ZHGA 1BJ3A 3KZJA 1GZ2A 4AYIA 4WR9A 2H9EC 4RUTA 2XRBA 3PGHA 2BPDA 3ZYIB 1KWYA 4X8TL 2LS8A 3WBRA 2H9EL 2OS9A 4QKJA 1LQDA 2I9BA 2P26A 2UWLB 1BNLA 4AYMA 1OK2A 1UKMB 2RIEA 3KQCL 1JBUL 1GKNA 4PH9A 3QCWA 5EGMB 2N40A 1QFKL 3WSRA 1X2WA 4Y76B 2VWNL 3SW0X 3KK6A 2Y7ZB 1LPGA 2WPIE 4S0UA 3PAQA 1HQ8A 1MUQA 5HYTB 1V7PA 2LOJA 1G2MB 1H2PP 5HZPB 3V65B 1O5DL 2WPKE 2IZ4A 2RKYA 4J38B 1KZB1 3ALUA 2P95L 3ELAL 4IOPB 2K2TA 2VVUL 3P5BL 4Z0LA 4O02B 3TBDA 5L2YL 1RTM1 2YGOA 3FF9A 2BQWA 2B7DL 1FIHA 3BX4B 5JVYA 1GHQB 5HYUB 3M7PA 2H2TB 3PAKA 3OLUA 1YPOA 4RS0A 3P7GA 1QO6A 2W2NE 2XQWC 4ISIL 4E1GA 4IOPA 3ALSA 2WYJB 5IKVA 1HCCA 4M18A 3N8WA 5IKTA 1IP0A 3L89M 2VH0B 1CQEA 5IKRA 2BQ6A 3GOVA 4J6LA 1KLJL 2CL8A 1UZJA 4MMYB 3N8YB 3NTGA 2ORKA 3Q3KB 5K0HB 1YUGA 5F19A 1P0SL 2AYLA 1V3XB 1F0SB 3NFPI 5JPMG 1WMYA 2KB9A 1BV4A 3LC5B 1SL4A 2OX8A 4M10A 3PARA 1BF9A 2RL0A 4ZXYL 2W26B 2OX9A 3C8JA 2H2RA 1R13A 2J94B 2P28B 1FE2A 1EMOA 3FBYA 1UV0A 2Y5FL 3ZYGA 2GO0A 3SOVA 5LGKE 1KMB1 2RIDA 2CG6A 2XR6A 2Q1JB 2QY0A 4X8VL 1EGFA 1XKAL 3H5CB 2M74A 2ZQKA 3LTGD 4XL1A 1G1RA 4IGDA 3CALA 2KL7A 1ELVA 4J6KA 3WBPA 1RDM1 1SRZA 1NQLB 3GPRC 3ASIA 5JBAE 3M36L 4N32A 2OYUP 2G00L 2WPME 3CADA 3DBZA 2W2QE 1F02I 2G7IA 4WRFA 1HT8A 5FO8C 1WHEA 1EPIA 2P94L 3N8VA 5KIRA 5CISA 1IXXB 2RIBA 2D1JB 1E87A 3WWKC 1DY1A 2ORJA 2FZZL 4LOTA 4M1GA 1LITA 3BX4A 4KZWA 4LU5A 1C1ZA 5E8DA 1IQIL 3CENL 2F9BL 1E5GA 3PBFA 3SOBB 2XWBF 4ZETA 4YMDA 3G81A 1U0NC 2BQ7A 3KRKA 2KV3A 4YT7L 3BT2A 1YUFA 2XRDA 3QH0A 2W2PE 1JZNA 2IT5A 5F2QA 3TVJA 2KV4A 1KSNB 4XLWA 4RRZA 2RKZA 1CCVA 1H8UA 4J6PA 3BPSE 1TPGA 3RR3A 2WG3C 1PTHA 4WJG2 4CUDA 1IQFL 3GCXE 3UBUB 3WHDA 3LC3B 3TK5B 4ZRVA 3LIWB 3OP8A 4DN8A 1FFMA 4G9AA 1NFUB 1XDTR 1SB2B 2P93L 1BCH1 1EQGA 4N38A 2A55A 2PUQL 3ALTA 1KZD1 1UMRA 3LN1A 1NFYB 1I0UA 2WPHE 1MD7A 1X7AL 4Y7BB 3ZYJB 4NA9L 1DIYA 4CUEA 1C3AA 1FVUB 2XBYL 2GD4A 5FFSA 1O9AA 4EZMG 2ERJA 1AUTL 5CKQA 5F1AA 1JWIB 4D0FA 5FFRA 1HJ7A 1Q4GA 1V7PB 1F0RB 2VWMK 1Z6CA 3P5FA 5L30L 1XFEA 1ADXA 3O8EB 2VRPA 2J2UB 1IVOC 3TZIA 2Y82B 4LORA 3KQBL 1COUA 1GPZA 2VUVA 2J38B 2Y7XB 2VRPB 1YXKA 3VLGA 4X8UL 2CJIB 1J34A 3BDWB 1TOZA 3KCGL 1J35A 1KX1A 4TGFA 3HUPA 1V4LA 3HS7A 1IOXA 3GISX 3CDGF 1KG0C 1NPEB 1YPUA 5FDQA 4WRCA 1SL6A 2MTIA 3CDGE 1BJ3B 1WU1B 1CX2A 3LTFB 4F4OC 2W81A 4GJ0A 4Y79B 4GKOG 2PR3B 5M62A 1EBVA 4WCOA 3ZHGD 2UWPB 2I9AA 1QO3C 3M37L 1UZQA 2YGQA 3S6XA 1B08A 3MQEA 1SB2A 3NCXA 2P3FN 3G83A 1EPJA 2WFXB 1IQJL 3SOQA 1H04P 1IGZA 2BZ6L 4OTYA 4WUXA 3HO5A 1KCGA 1KLIL 1QUBA 2WPJE 1Q3XA 1DY2A 1RDN1 3MQLA 1PRHA 4Z6AL 2W80A 1LY2A 2BPEA 5J6GG 1PPQA 4E52A 3M9ZA 3P5GA 1E5UI 1KZA1 1OJWA 4B2SA 1FVUA 1KWZA 1XPHA 2C6UA 2FLGA 3KXVA 3R62A 1G4FA 4QKIA 1CKLA 2ADXA 1W8BL 1GKGA 3GCWE 2Y5GL 1U5MA 2I83A 1H03P 3G84A 4Y71B 3FF8C 2JGXA 1FF7A 2E3XB 2MCZA 1TN3A 2RIAA 1OZ7B 1MSBA 1FAKL 2KMB1 1KIGL 3HO3A 1WT9A 3T3AA 1LMJA 1M1XB 2YGPA 4LMFA 5KTHA 2J95B 1RDO1 3SW2A 1VVDA 4QKHA 1CVWL 1JL9A 3V64C 1DQBA 1OJVA 1J35B 1HAFA 2W3KB 3F6UL 4JZFL 1IXXA 4NG9L 1UKMA 3CCKA 3N8WB 4J6NA 4WREA 1EZQB 2RA0L 1NZIA 4CUFA 2Y80B 1HFIA 1HTNA 2BRSA 1QGBA 4C9FA 4N37A 2RLPA 1PFXL 2XBWL 2JGWA 1UEXB 4Y6DB 2EI7B 3FCSB 4J6JA 4D0EA 1YPQA 1KZC1 4QKGA 4WQQA 1B6EA 2AFPA 2XC4L 1EMNA 3ZD2A 4ZRWA 2E3XC 3POYA 1NFWB 5JW1A 2W3IB 2WYGB 1W7XL 4G1MB 5CKMA 1FBRA 1OK1A 1HYRA 3WWKB 1X2TB 2PHBB 2GGUA 1PXXA 1TDQB 5FFTA 1AFD1 5K8YA 2BOHA 2VH6B 1YTTA 2VVCK 3GPRA 5JB9E 1L5GB 4RRXA 1NT0A 4AK8A 1C5MF 2EI8B 3VPPA 1RDI1 3HS6A 1Y17B 3G8KA 1Z92B 2VWLL 3C22A 2WG4B 3TGFA 4BTTA 4M17A 4WUWA 1SZBA 4BXWA 4KKDA 5COXA 4CSYA 1P9JA 1J34B 3BT1A 1HAEA 1OZ7A 3P5IA 1IQHL 1WK1A 4ZESA 3KQEL 1DDXA 1ZJKA 5JB8E 2GGXA 2BPHA 1FM5A 4CAJA 1IOEL 1FAXL 2UWNA 1TLEA 1RJHA 2XR5A 2BOKL 2J34B 4UWWA 3U7UG 2XBVL 4UXMA 2J4IB 1K9IA 2BO2A 3NTBA 3IKNA 1DVAL 1UOSA 5JBCE 3INBC 1E8BA 1KWXA 1IGXA 2PF5A 1RDL1 4PZ5A 4X8SL 4Y7AB 3OEDC 4YT6L 3IKQA 3EGFA 1WHFA 4AQTA 1E88A 3IKPA 3IKRA 1BCJ1 5IKQA 1G1QA 3NJPC 1YO8A 2RHPA 1HT5A 6COXA 5JVZA 3UBUA 2MGPA 1UOTP 4RRWA 1PGEA 3N8YA 3ENSA 2KMSA 1UOSB 3WH2A 1UZPA 4G96A 4AYDA 2MHPA 3FFGL 4GI0A 3WWKA 3KMB1 3K9XA 2EI6B 2YHFA 4Z0KB 1E8IA 4GJXA 3N8ZA 2WZPP 1DY0A 3VYKA 1F7MA 1CEJA 1P1ZD 1CVUA 1G4GA 3EJHA 4DJZA 1L3YA 3RS1A 1JV2B 3C9AC 3VYJA 3GPRB 2BZMA 4MUCA 2EHFA 1LPKA 1LPZA 1EGGA 1G1SA 1FSBA 4BDWA 4COXA 1HREA 4A5WB 1K9JA 2K2SB 1XARA 1Y17A 3BDWA 3QMOA 3GPRD 1KLOA 4PDCA 2Y5HL 1APOA 2VJ3A 2XWJI 1EQHA 2P3UA 3HPTA 1ZAQA 4OTJA 5I46L 3CS7L 1F7EA 4A94C 1AFA1 1KWWA 4GK1A 1KX0A 1AFB1 1YUKB 1DV8A 3P7FA 3TK6B 3ZRZA 1RDJ1 1YXJA 1TLGA 2RICA 2YRAA 3L9JC 1VVCA 1URKA 2XC0L 1UZKA 3R05A 4M11A 3Q7DA 5KTIA 2RNLA 1GK5A 2PY2A 1IQKL 2KRIA 1IQNL 1K37A 1X2TA 1PWBA 1CCFA 3CA7A 1ESLA 1FJSL 1N1IA 4N33A 1HX2A 3G8LA 2WFTA 1LMMA 2W2OE 3T5OA 1HUPA 2FD6A 2P16L 3IITB 1XKBA 2BOUA 1A3PA 4LOSA 1U0NB 4O1ZA 3C8KD 2VUZA 1OK3A 3FD4A 1HRFA 2BOXA 3IJEB 3K7BA 2FLBL 3N8XA 3MDLA 3U73A 1OJYA 2JRAA 1KZE1 5B1RA 1RDK1 4ZHAB 4MMXB 2Y81B 1HFHA 1EPHA 1TPMA 2XC5L 2W2ME 5I0QB 4MMZB 3FF7C 1YGCL 2VWOL 4C16A 1T8DA 1U0OB 1T8CA 2XBXL 1WT9B 4KZVA 4A7IA 1RFNB 1JWIA 3OXUD 2W86A 4YNXA 5B1XA 4JYUL 4RRYA 1F00I 4JZEL 2TGFA 4ZAEB 3WBQA 1R14A 1EGIA 2MSBA 1C3AB 3KQDL 3TH3L 3HO4A 4ISHL 4JHSA 2IZ3A 1TPNA 1IQLL 3KQGA 3IX0A 3RJ3D 1ATDA 2KNIA 4MTHA 1IQML 4BTIA 5L2ZL 1SS2A 1CWVA 5JBBE 2V8EA 1BUUA 2EC3A 5KN5C 4ZH1D 1V4LB 1MD8A 1EPGA 1B9WA 1SL5A 1KWVA 4KMB1 1IJQA 1EAIC 1NWVA 2FLRL 5CKNA 3F1SB 4KI1E 4J6QA 1G1TA 3IU3I 1MOXC 2JKHL 4FM5A 1IQEL 4JZDL 1X2WB 1O7CT 2DDUA 1IQGL 2WIIC 1K36A 2MCYA 2O39C 2CKUA 4JYVL 2RLQA 4FXGG 4ONTD 5HYPA 1KWUA 4YLIA 2P3TA 1U67A 2P3FL 1KWTA 1WMZA 4NGAL 4XBMA 4BXSA 1IJKC 1KOEA 1MQ6L 4D90A 1Z6EL 2BMGA 3LAQA 2WPLE 1U8CB 1HZ8A 1APQA 3LN0A 3GXEA 1N7DA 1U0OA 1DX5I 3NT1A 4BTUA 3KL6B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4B2R A;  4ZH8 B;  1BYF A;  3OLT A;  1G2L B;  2ZIB A;  5B1W A;  3CFW A;  4YZU B;  3DEM A;  1IOD B;  1FIF A;  3WH3 A;  4K12 A;  1JA3 A;  4LQF A;  2OYE P;  2VVV L;  3P7H A;  2CG7 A;  1OB1 C;  1OK9 A;  1ATA A;  3ERB A;  2UWO B;  4N34 A;  1H2Q P;  2MGR A;  2IT6 A;  1ATB A;  4BDX A;  1QDD A;  2Y38 A;  1PW9 A;  1UMR C;  4ZXX L;  1ATE A;  1IOD A;  1UEX A;  4PP8 A;  1J9C L;  3HS5 A;  1P4L D;  2ZWK A;  4J6M A;  2B5I D;  2NPR A;  1MQ5 L;  4N35 A;  4N36 A;  3P5H A;  3ZD1 A;  4AYE A;  2M94 A;  1NFX B;  1HCG B;  1O7B T;  1MPU A;  3NCW A;  2YBY A;  1IJK B;  3P5E A;  3P5D A;  3ZHG A;  1BJ3 A;  3KZJ A;  1GZ2 A;  4AYI A;  4WR9 A;  4RUT A;  2XRB A;  3PGH A;  2BPD A;  3ZYI B;  1KWY A;  4X8T L;  2LS8 A;  3WBR A;  2H9E L;  2OS9 A;  4QKJ A;  1LQD A;  2I9B A;  2P26 A;  2UWL B;  1BNL A;  4AYM A;  1OK2 A;  1UKM B;  2RIE A;  3KQC L;  1JBU L;  1GKN A;  4PH9 A;  3QCW A;  5EGM B;  2N40 A;  1QFK L;  3WSR A;  1X2W A;  4Y76 B;  2VWN L;  3SW0 X;  3KK6 A;  2Y7Z B;  1LPG A;  2WPI E;  4S0U A;  3PAQ A;  1HQ8 A;  1MUQ A;  5HYT B;  1V7P A;  2LOJ A;  1G2M B;  1H2P P;  5HZP B;  3V65 B;  1O5D L;  2WPK E;  2IZ4 A;  2RKY A;  4J38 B;  1KZB 1;  3ALU A;  2P95 L;  3ELA L;  4IOP B;  2K2T A;  2VVU L;  3P5B L;  4Z0L A;  4O02 B;  3TBD A;  5L2Y L;  1RTM 1;  2YGO A;  3FF9 A;  2BQW A;  2B7D L;  1FIH A;  3BX4 B;  5JVY A;  1GHQ B;  5HYU B;  3M7P A;  2H2T B;  3PAK A;  3OLU A;  1YPO A;  4RS0 A;  3P7G A;  1QO6 A;  2W2N E;  2XQW C;  4ISI L;  4E1G A;  4IOP A;  3ALS A;  2WYJ B;  5IKV A;  1HCC A;  4M18 A;  3N8W A;  5IKT A;  1IP0 A;  3L89 M;  2VH0 B;  1CQE A;  5IKR A;  2BQ6 A;  3GOV A;  4J6L A;  1KLJ L;  2CL8 A;  1UZJ A;  4MMY B;  3N8Y B;  3NTG A;  2ORK A;  3Q3K B;  5K0H B;  1YUG A;  5F19 A;  1P0S L;  2AYL A;  1V3X B;  1F0S B;  3NFP I;  5JPM G;  1WMY A;  2KB9 A;  1BV4 A;  3LC5 B;  1SL4 A;  2OX8 A;  4M10 A;  3PAR A;  1BF9 A;  2RL0 A;  4ZXY L;  2W26 B;  2OX9 A;  3C8J A;  2H2R A;  1R13 A;  2J94 B;  2P28 B;  1FE2 A;  1EMO A;  3FBY A;  1UV0 A;  2Y5F L;  3ZYG A;  2GO0 A;  3SOV A;  5LGK E;  1KMB 1;  2RID A;  2CG6 A;  2XR6 A;  2Q1J B;  2QY0 A;  4X8V L;  1EGF A;  1XKA L;  3H5C B;  2M74 A;  2ZQK A;  3LTG D;  4XL1 A;  1G1R A;  4IGD A;  3CAL A;  2KL7 A;  1ELV A;  4J6K A;  3WBP A;  1RDM 1;  1SRZ A;  1NQL B;  3GPR C;  3ASI A;  5JBA E;  3M36 L;  4N32 A;  2OYU P;  2G00 L;  2WPM E;  3CAD A;  3DBZ A;  2W2Q E;  1F02 I;  2G7I A;  4WRF A;  1HT8 A;  5FO8 C;  1WHE A;  1EPI A;  2P94 L;  3N8V A;  5KIR A;  5CIS A;  1IXX B;  2RIB A;  2D1J B;  1E87 A;  3WWK C;  1DY1 A;  2ORJ A;  2FZZ L;  4LOT A;  4M1G A;  1LIT A;  3BX4 A;  4KZW A;  4LU5 A;  1C1Z A;  5E8D A;  1IQI L;  3CEN L;  2F9B L;  1E5G A;  3PBF A;  3SOB B;  2XWB F;  4ZET A;  4YMD A;  3G81 A;  1U0N C;  2BQ7 A;  3KRK A;  2KV3 A;  4YT7 L;  3BT2 A;  1YUF A;  2XRD A;  3QH0 A;  2W2P E;  1JZN A;  2IT5 A;  5F2Q A;  3TVJ A;  2KV4 A;  1KSN B;  4XLW A;  4RRZ A;  2RKZ A;  1CCV A;  1H8U A;  4J6P A;  3BPS E;  1TPG A;  3RR3 A;  2WG3 C;  1PTH A;  4WJG 2;  4CUD A;  1IQF L;  3GCX E;  3UBU B;  3WHD A;  3LC3 B;  3TK5 B;  4ZRV A;  3LIW B;  3OP8 A;  4DN8 A;  1FFM A;  4G9A A;  1NFU B;  1XDT R;  1SB2 B;  2P93 L;  1BCH 1;  1EQG A;  4N38 A;  2A55 A;  2PUQ L;  3ALT A;  1KZD 1;  1UMR A;  3LN1 A;  1NFY B;  1I0U A;  2WPH E;  1MD7 A;  1X7A L;  4Y7B B;  3ZYJ B;  4NA9 L;  1DIY A;  4CUE A;  1C3A A;  1FVU B;  2XBY L;  2GD4 A;  5FFS A;  1O9A A;  4EZM G;  2ERJ A;  1AUT L;  5CKQ A;  5F1A A;  1JWI B;  4D0F A;  5FFR A;  1HJ7 A;  1Q4G A;  1V7P B;  1F0R B;  2VWM K;  1Z6C A;  3P5F A;  5L30 L;  1XFE A;  1ADX A;  3O8E B;  2VRP A;  2J2U B;  1IVO C;  3TZI A;  2Y82 B;  4LOR A;  3KQB L;  1COU A;  1GPZ A;  2VUV A;  2J38 B;  2Y7X B;  2VRP B;  1YXK A;  3VLG A;  4X8U L;  2CJI B;  1J34 A;  3BDW B;  1TOZ A;  3KCG L;  1J35 A;  1KX1 A;  4TGF A;  3HUP A;  1V4L A;  3HS7 A;  1IOX A;  3GIS X;  3CDG F;  1KG0 C;  1NPE B;  1YPU A;  5FDQ A;  4WRC A;  1SL6 A;  2MTI A;  3CDG E;  1BJ3 B;  1WU1 B;  1CX2 A;  3LTF B;  4F4O C;  2W81 A;  4GJ0 A;  4Y79 B;  4GKO G;  2PR3 B;  5M62 A;  1EBV A;  4WCO A;  3ZHG D;  2UWP B;  2I9A A;  1QO3 C;  3M37 L;  1UZQ A;  1B08 A;  1SB2 A;  3NCX A;  3MQE A;  2P3F N;  3G83 A;  1EPJ A;  2WFX B;  1IQJ L;  3SOQ A;  1H04 P;  1IGZ A;  2BZ6 L;  4OTY A;  4WUX A;  3HO5 A;  1KCG A;  1KLI L;  1QUB A;  2WPJ E;  1Q3X A;  1DY2 A;  1RDN 1;  3MQL A;  1PRH A;  4Z6A L;  2W80 A;  1LY2 A;  2BPE A;  5J6G G;  1PPQ A;  4E52 A;  3M9Z A;  3P5G A;  1E5U I;  1KZA 1;  1OJW A;  4B2S A;  1FVU A;  1KWZ A;  1XPH A;  2C6U A;  2FLG A;  3KXV A;  3R62 A;  1G4F A;  4QKI A;  1CKL A;  2ADX A;  1W8B L;  1GKG A;  3GCW E;  2Y5G L;  1U5M A;  2I83 A;  1H03 P;  3G84 A;  4Y71 B;  3FF8 C;  2JGX A;  1FF7 A;  2E3X B;  2MCZ A;  1TN3 A;  2RIA A;  1OZ7 B;  1MSB A;  1FAK L;  2KMB 1;  1KIG L;  3HO3 A;  1WT9 A;  3T3A A;  1LMJ A;  1M1X B;  2YGP A;  4LMF A;  5KTH A;  2J95 B;  1RDO 1;  3SW2 A;  1VVD A;  4QKH A;  1CVW L;  1JL9 A;  3V64 C;  1DQB A;  1OJV A;  1J35 B;  1HAF A;  2W3K B;  3F6U L;  4JZF L;  1IXX A;  4NG9 L;  1UKM A;  3CCK A;  3N8W B;  4J6N A;  4WRE A;  1EZQ B;  2RA0 L;  1NZI A;  4CUF A;  2Y80 B;  1HFI A;  1HTN A;  2BRS A;  1QGB A;  4C9F A;  4N37 A;  2RLP A;  1PFX L;  2XBW L;  2JGW A;  1UEX B;  4Y6D B;  2EI7 B;  3FCS B;  4J6J A;  4D0E A;  1YPQ A;  1KZC 1;  4QKG A;  4WQQ A;  1B6E A;  2AFP A;  2XC4 L;  1EMN A;  3ZD2 A;  4ZRW A;  2E3X C;  3POY A;  1NFW B;  5JW1 A;  2W3I B;  2WYG B;  1W7X L;  4G1M B;  5CKM A;  1FBR A;  1OK1 A;  1HYR A;  3WWK B;  1X2T B;  2PHB B;  2GGU A;  1PXX A;  1TDQ B;  5FFT A;  1AFD 1;  5K8Y A;  2BOH A;  2VH6 B;  1YTT A;  2VVC K;  3GPR A;  5JB9 E;  1L5G B;  4RRX A;  1NT0 A;  4AK8 A;  1C5M F;  2EI8 B;  3VPP A;  1RDI 1;  3HS6 A;  1Y17 B;  3G8K A;  1Z92 B;  2VWL L;  3C22 A;  2WG4 B;  3TGF A;  4BTT A;  4M17 A;  4WUW A;  1SZB A;  4BXW A;  4KKD A;  5COX A;  4CSY A;  1P9J A;  1J34 B;  3BT1 A;  1HAE A;  1OZ7 A;  3P5I A;  1IQH L;  1WK1 A;  4ZES A;  3KQE L;  1DDX A;  1ZJK A;  5JB8 E;  2GGX A;  2BPH A;  1FM5 A;  4CAJ A;  1IOE L;  1FAX L;  2UWN A;  1TLE A;  1RJH A;  2XR5 A;  2BOK L;  2J34 B;  4UWW A;  3U7U G;  2XBV L;  4UXM A;  2J4I B;  1K9I A;  2BO2 A;  3NTB A;  3IKN A;  1DVA L;  1UOS A;  5JBC E;  3INB C;  1E8B A;  1KWX A;  1IGX A;  2PF5 A;  1RDL 1;  4PZ5 A;  4X8S L;  4Y7A B;  3OED C;  4YT6 L;  3IKQ A;  3EGF A;  1WHF A;  4AQT A;  1E88 A;  3IKP A;  3IKR A;  1BCJ 1;  5IKQ A;  1G1Q A;  3NJP C;  1YO8 A;  2RHP A;  1HT5 A;  6COX A;  5JVZ A;  3UBU A;  2MGP A;  1UOT P;  4RRW A;  1PGE A;  3N8Y A;  3ENS A;  2KMS A;  1UOS B;  3WH2 A;  1UZP A;  4G96 A;  4AYD A;  2MHP A;  3FFG L;  4GI0 A;  3WWK A;  3KMB 1;  3K9X A;  2EI6 B;  2YHF A;  4Z0K B;  1E8I A;  4GJX A;  3N8Z A;  1DY0 A;  3VYK A;  1F7M A;  1CEJ A;  1P1Z D;  1CVU A;  1G4G A;  3EJH A;  4DJZ A;  1L3Y A;  3RS1 A;  1JV2 B;  3C9A C;  3VYJ A;  3GPR B;  2BZM A;  4MUC A;  2EHF A;  1LPK A;  1LPZ A;  1EGG A;  1G1S A;  1FSB A;  4BDW A;  4COX A;  1HRE A;  4A5W B;  1K9J A;  2K2S B;  1XAR A;  1Y17 A;  3BDW A;  3QMO A;  3GPR D;  1KLO A;  4PDC A;  2Y5H L;  1APO A;  2VJ3 A;  2XWJ I;  1EQH A;  2P3U A;  3HPT A;  1ZAQ A;  4OTJ A;  5I46 L;  3CS7 L;  1F7E A;  1AFA 1;  1KWW A;  4GK1 A;  1KX0 A;  1AFB 1;  1YUK B;  1DV8 A;  3P7F A;  3TK6 B;  3ZRZ A;  1RDJ 1;  1YXJ A;  1TLG A;  2RIC A;  2YRA A;  3L9J C;  1VVC A;  1URK A;  2XC0 L;  1UZK A;  3R05 A;  4M11 A;  3Q7D A;  5KTI A;  2RNL A;  1GK5 A;  2PY2 A;  1IQK L;  2KRI A;  1IQN L;  1K37 A;  1X2T A;  1PWB A;  1CCF A;  3CA7 A;  1ESL A;  1FJS L;  1N1I A;  4N33 A;  1HX2 A;  3G8L A;  2WFT A;  3T5O A;  2W2O E;  1HUP A;  2FD6 A;  2P16 L;  3IIT B;  1XKB A;  2BOU A;  1A3P A;  4LOS A;  1U0N B;  4O1Z A;  3C8K D;  2VUZ A;  1OK3 A;  3FD4 A;  1HRF A;  2BOX A;  3IJE B;  3K7B A;  2FLB L;  3N8X A;  3MDL A;  3U73 A;  1OJY A;  2JRA A;  1KZE 1;  5B1R A;  1RDK 1;  4ZHA B;  4MMX B;  2Y81 B;  1HFH A;  1EPH A;  1TPM A;  2XC5 L;  2W2M E;  5I0Q B;  4MMZ B;  3FF7 C;  1YGC L;  2VWO L;  4C16 A;  1T8D A;  1U0O B;  1T8C A;  2XBX L;  1WT9 B;  4KZV A;  4A7I A;  1RFN B;  1JWI A;  3OXU D;  2W86 A;  4YNX A;  5B1X A;  4JYU L;  4RRY A;  1F00 I;  4JZE L;  2TGF A;  4ZAE B;  3WBQ A;  1R14 A;  1EGI A;  2MSB A;  1C3A B;  3KQD L;  3TH3 L;  3HO4 A;  4ISH L;  4JHS A;  2IZ3 A;  1TPN A;  1IQL L;  3KQG A;  3IX0 A;  3RJ3 D;  1ATD A;  4MTH A;  1IQM L;  4BTI A;  5L2Z L;  1SS2 A;  1CWV A;  5JBB E;  2V8E A;  1BUU A;  2EC3 A;  5KN5 C;  4ZH1 D;  1V4L B;  1MD8 A;  1EPG A;  1B9W A;  1SL5 A;  1KWV A;  4KMB 1;  1IJQ A;  1EAI C;  1NWV A;  2FLR L;  5CKN A;  3F1S B;  4KI1 E;  4J6Q A;  1G1T A;  3IU3 I;  1MOX C;  2JKH L;  4FM5 A;  1IQE L;  4JZD L;  1X2W B;  1O7C T;  2DDU A;  1IQG L;  2WII C;  1K36 A;  2MCY A;  2O39 C;  2CKU A;  4JYV L;  2RLQ A;  4FXG G;  4ONT D;  5HYP A;  1KWU A;  4YLI A;  2P3T A;  1U67 A;  2P3F L;  1KWT A;  1WMZ A;  4NGA L;  4XBM A;  4BXS A;  1IJK C;  1KOE A;  1MQ6 L;  4D90 A;  1Z6E L;  2BMG A;  3LAQ A;  2WPL E;  1U8C B;  1HZ8 A;  1APQ A;  3LN0 A;  3GXE A;  1N7D A;  1U0O A;  1DX5 I;  3NT1 A;  4BTU A;  3KL6 B; 
#chains in the Genus database with same CATH topology
 4B2R A;  4ZH8 B;  1BYF A;  3OLT A;  1G2L B;  2ZIB A;  5B1W A;  3CFW A;  4YZU B;  3DEM A;  1IOD B;  1FIF A;  3WH3 A;  4K12 A;  2ZYC A;  1JA3 A;  4LQF A;  3FGT A;  2OYE P;  2VVV L;  3P7H A;  2CG7 A;  1OB1 C;  1OK9 A;  1ATA A;  3ERB A;  2BT8 A;  2UWO B;  4N34 A;  1H2Q P;  2MGR A;  2IT6 A;  1ATB A;  4BDX A;  1QDD A;  2Y38 A;  1PW9 A;  1UMR C;  4ZXX L;  1ATE A;  1IOD A;  1UEX A;  4PP8 A;  1J9C L;  3HS5 A;  1P4L D;  2ZWK A;  4J6M A;  2B5I D;  2NPR A;  1MQ5 L;  4N35 A;  4N36 A;  3P5H A;  3ZD1 A;  4AYE A;  2M94 A;  1NFX B;  1HCG B;  1O7B T;  1MPU A;  3NCW A;  2YBY A;  1IJK B;  3P5E A;  3P5D A;  3ZHG A;  1BJ3 A;  3KZJ A;  1GZ2 A;  4AYI A;  4WR9 A;  2H9E C;  4RUT A;  2XRB A;  3PGH A;  2BPD A;  3ZYI B;  1KWY A;  4X8T L;  2LS8 A;  3WBR A;  2H9E L;  2OS9 A;  4QKJ A;  1LQD A;  2I9B A;  2P26 A;  2UWL B;  1BNL A;  4AYM A;  1OK2 A;  1UKM B;  2RIE A;  3KQC L;  1JBU L;  1GKN A;  4PH9 A;  3QCW A;  5EGM B;  2N40 A;  1QFK L;  3WSR A;  1X2W A;  4Y76 B;  2VWN L;  3SW0 X;  3KK6 A;  2Y7Z B;  1LPG A;  2WPI E;  4S0U A;  3PAQ A;  1HQ8 A;  1MUQ A;  5HYT B;  1V7P A;  2LOJ A;  1G2M B;  1H2P P;  5HZP B;  3V65 B;  1O5D L;  2WPK E;  2IZ4 A;  2RKY A;  4J38 B;  4MSL A;  1KZB 1;  3ALU A;  2P95 L;  3ELA L;  4IOP B;  2K2T A;  2VVU L;  3P5B L;  4Z0L A;  4O02 B;  3TBD A;  5L2Y L;  4BWC A;  1RTM 1;  2YGO A;  3FF9 A;  2BQW A;  2B7D L;  1FIH A;  3BX4 B;  5JVY A;  1GHQ B;  5HYU B;  3M7P A;  2H2T B;  3PAK A;  3OLU A;  1YPO A;  4RS0 A;  3P7G A;  1QO6 A;  2W2N E;  2XQW C;  4ISI L;  4E1G A;  4IOP A;  3ALS A;  2WYJ B;  5IKV A;  1HCC A;  4M18 A;  3N8W A;  5IKT A;  1IP0 A;  3L89 M;  2Y8T A;  2VH0 B;  1CQE A;  5IKR A;  3NJA A;  2BQ6 A;  3GOV A;  4QKI A;  4J6L A;  1KLJ L;  2CL8 A;  1UZJ A;  4MMY B;  3N8Y B;  3NTG A;  2ORK A;  3Q3K B;  3F6K A;  5K0H B;  1YUG A;  5F19 A;  1P0S L;  2AYL A;  1V3X B;  1F0S B;  3NFP I;  5JPM G;  1WMY A;  2KB9 A;  1BV4 A;  3LC5 B;  1SL4 A;  2OX8 A;  4M10 A;  3PAR A;  1BF9 A;  2RL0 A;  4ZXY L;  2W26 B;  2OX9 A;  3C8J A;  2H2R A;  1R13 A;  2J94 B;  2P28 B;  1FE2 A;  1EMO A;  3FBY A;  1UV0 A;  2Y5F L;  3ZYG A;  2GO0 A;  3SOV A;  5LGK E;  1KMB 1;  2BT7 A;  2RID A;  2CG6 A;  2XR6 A;  2Q1J B;  2QY0 A;  4X8V L;  1EGF A;  1XKA L;  3H5C B;  2M74 A;  2ZQK A;  3LTG D;  4XL1 A;  1G1R A;  4IGD A;  3CAL A;  2KL7 A;  1ELV A;  4J6K A;  3WBP A;  1RDM 1;  1SRZ A;  1NQL B;  3GPR C;  3ASI A;  5JBA E;  3M36 L;  4PO7 A;  4N32 A;  5DN4 A;  2OYU P;  2G00 L;  2WPM E;  3CAD A;  3DBZ A;  2W2Q E;  1F02 I;  2G7I A;  4WRF A;  1HT8 A;  5FO8 C;  1WHE A;  1EPI A;  2P94 L;  3N8V A;  5KIR A;  5CIS A;  1IXX B;  2RIB A;  1KKE A;  2D1J B;  1E87 A;  3WWK C;  1DY1 A;  2ORJ A;  3K3T A;  4N7E A;  2FZZ L;  4LOT A;  4M1G A;  1LIT A;  3BX4 A;  4KZW A;  4LU5 A;  1C1Z A;  5E8D A;  1IQI L;  3CEN L;  2F9B L;  1E5G A;  3PBF A;  3SOB B;  2XWB F;  4ZET A;  4YMD A;  3G81 A;  1U0N C;  2BQ7 A;  3KRK A;  2KV3 A;  4YT7 L;  3BT2 A;  1YUF A;  2XRD A;  3QH0 A;  2W2P E;  1JZN A;  2IT5 A;  5F2Q A;  3TVJ A;  2KV4 A;  1KSN B;  4XLW A;  4RRZ A;  2RKZ A;  1CCV A;  1H8U A;  4J6P A;  3BPS E;  1TPG A;  3RR3 A;  2WG3 C;  1PTH A;  4WJG 2;  4CUD A;  1IQF L;  3GCX E;  3UBU B;  3WHD A;  4GU4 A;  3LC3 B;  3TK5 B;  4ZRV A;  3LIW B;  3OP8 A;  4DN8 A;  1FFM A;  4G9A A;  1NFU B;  1XDT R;  1SB2 B;  2P93 L;  1BCH 1;  1EQG A;  4N38 A;  2A55 A;  2PUQ L;  3ALT A;  1KZD 1;  1UMR A;  3LN1 A;  1NFY B;  1I0U A;  2WPH E;  1MD7 A;  1X7A L;  4Y7B B;  3ZYJ B;  4NA9 L;  1DIY A;  4CUE A;  1C3A A;  1FVU B;  2XBY L;  2GD4 A;  5FFS A;  1O9A A;  4EZM G;  2ERJ A;  1AUT L;  5CKQ A;  5F1A A;  1JWI B;  4D0F A;  5FFR A;  1HJ7 A;  1Q4G A;  1V7P B;  1F0R B;  2VWM K;  1Z6C A;  3P5F A;  5L30 L;  1XFE A;  1ADX A;  3O8E B;  2VRP A;  2J2U B;  1IVO C;  3TZI A;  2Y82 B;  4LOR A;  3KQB L;  1COU A;  1GPZ A;  2VUV A;  2J38 B;  2Y7X B;  2VRP B;  1YXK A;  3VLG A;  4X8U L;  2CJI B;  1J34 A;  3BDW B;  1TOZ A;  3KCG L;  1J35 A;  1KX1 A;  4TGF A;  3HUP A;  1V4L A;  3HS7 A;  1IOX A;  3GIS X;  3CDG F;  1KG0 C;  1NPE B;  1YPU A;  5FDQ A;  4WRC A;  1SL6 A;  2MTI A;  3CDG E;  1BJ3 B;  1WU1 B;  1CX2 A;  3LTF B;  4F4O C;  2W81 A;  4GJ0 A;  4Y79 B;  4GKO G;  2PR3 B;  5M62 A;  1EBV A;  4WCO A;  3ZHG D;  2UWP B;  2I9A A;  1QO3 C;  3M37 L;  1UZQ A;  2YGQ A;  3S6X A;  1B08 A;  3MQE A;  1SB2 A;  3NCX A;  2P3F N;  3G83 A;  1EPJ A;  2WFX B;  1IQJ L;  3SOQ A;  1H04 P;  1IGZ A;  2BZ6 L;  4OTY A;  4WUX A;  3HO5 A;  1KCG A;  1KLI L;  1QUB A;  2WPJ E;  1Q3X A;  1DY2 A;  1RDN 1;  3MQL A;  1PRH A;  4Z6A L;  2W80 A;  1LY2 A;  2BPE A;  5J6G G;  1PPQ A;  4E52 A;  3M9Z A;  3P5G A;  1E5U I;  1KZA 1;  1OJW A;  4B2S A;  1FVU A;  1KWZ A;  1XPH A;  2C6U A;  2FLG A;  3KXV A;  3R62 A;  1V1H A;  1G4F A;  1CKL A;  2ADX A;  1W8B L;  1GKG A;  3GCW E;  2Y5G L;  1U5M A;  2I83 A;  1H03 P;  3G84 A;  4Y71 B;  3FF8 C;  2JGX A;  1FF7 A;  2E3X B;  2MCZ A;  1TN3 A;  2RIA A;  1OZ7 B;  2HOR A;  1MSB A;  1FAK L;  2KMB 1;  1KIG L;  2Y8R A;  3HO3 A;  1WT9 A;  3T3A A;  1LMJ A;  1M1X B;  2YGP A;  4LMF A;  5KTH A;  2J95 B;  1RDO 1;  3SW2 A;  1VVD A;  4QKH A;  1CVW L;  1JL9 A;  3V64 C;  1DQB A;  1OJV A;  1J35 B;  1HAF A;  2W3K B;  3F6U L;  4JZF L;  1IXX A;  4NG9 L;  1UKM A;  3CCK A;  3N8W B;  4J6N A;  4WRE A;  1EZQ B;  2RA0 L;  1NZI A;  4CUF A;  2Y80 B;  1HFI A;  1HTN A;  2BRS A;  1QGB A;  4C9F A;  4N37 A;  2BSF A;  2RLP A;  1PFX L;  2XBW L;  2JGW A;  1UEX B;  4Y6D B;  2EI7 B;  3FCS B;  4J6J A;  4D0E A;  1YPQ A;  1KZC 1;  4QKG A;  4WQQ A;  1B6E A;  2AFP A;  2XC4 L;  1EMN A;  3ZD2 A;  4ZRW A;  3ZLD A;  4APL A;  2E3X C;  3POY A;  1LK9 A;  1NFW B;  5JW1 A;  2W3I B;  2WYG B;  1W7X L;  4G1M B;  5CKM A;  1FBR A;  1OK1 A;  3FGR A;  1HYR A;  3WWK B;  1X2T B;  2PHB B;  2GGU A;  1PXX A;  1TDQ B;  5FFT A;  1AFD 1;  5K8Y A;  2BOH A;  2VH6 B;  1YTT A;  2VVC K;  3GPR A;  5JB9 E;  1L5G B;  4RRX A;  1NT0 A;  4AK8 A;  1C5M F;  2EI8 B;  3VPP A;  1RDI 1;  3HS6 A;  1Y17 B;  3G8K A;  1Z92 B;  2VWL L;  3C22 A;  2WG4 B;  3TGF A;  4BTT A;  4M17 A;  4WUW A;  1SZB A;  4BXW A;  4KKD A;  5COX A;  4CSY A;  1P9J A;  1J34 B;  3BT1 A;  1HAE A;  1OZ7 A;  3ZLE A;  3P5I A;  1IQH L;  1WK1 A;  4ZES A;  3CI0 J;  3KQE L;  1DDX A;  1ZJK A;  5JB8 E;  2GGX A;  2BPH A;  1FM5 A;  4CAJ A;  1IOE L;  1FAX L;  2UWN A;  1RLH A;  1TLE A;  3WSY A;  1RJH A;  2XR5 A;  2BOK L;  2HOX A;  2J34 B;  3U7U G;  2Y8S A;  4UWW A;  2XBV L;  4UXM A;  2J4I B;  1K9I A;  2BO2 A;  3NTB A;  3IKN A;  1DVA L;  1UOS A;  5JBC E;  3INB C;  1E8B A;  1KWX A;  1IGX A;  2PF5 A;  1RDL 1;  4PZ5 A;  4X8S L;  4Y7A B;  3OED C;  4YT6 L;  3IKQ A;  3EGF A;  1WHF A;  4AQT A;  1E88 A;  3IKP A;  3IKR A;  1BCJ 1;  5IKQ A;  1G1Q A;  3NJP C;  1YO8 A;  2RHP A;  1HT5 A;  6COX A;  5JVZ A;  3UBU A;  2MGP A;  1UOT P;  4RRW A;  1PGE A;  3N8Y A;  3ENS A;  2KMS A;  1UOS B;  3WH2 A;  1UZP A;  4G96 A;  4AYD A;  2MHP A;  3FFG L;  4GI0 A;  3WWK A;  3KMB 1;  3K9X A;  2EI6 B;  2YHF A;  4Z0K B;  1E8I A;  4GJX A;  3N8Z A;  2WZP P;  1QIU A;  1DY0 A;  3VYK A;  1F7M A;  1CEJ A;  1P1Z D;  1CVU A;  1G4G A;  3EJH A;  4DJZ A;  1L3Y A;  3RS1 A;  1JV2 B;  3C9A C;  3VYJ A;  3GPR B;  2BZM A;  4MUC A;  2EHF A;  1LPK A;  1LPZ A;  1EGG A;  1G1S A;  1FSB A;  4BDW A;  4COX A;  1HRE A;  4A5W B;  4YIZ A;  2K2S B;  1K9J A;  1XAR A;  1Y17 A;  3QMO A;  3BDW A;  3VWO A;  3GPR D;  1KLO A;  4PDC A;  2Y5H L;  1APO A;  2VJ3 A;  2XWJ I;  1EQH A;  2P3U A;  3HPT A;  1ZAQ A;  4OTJ A;  5I46 L;  3CS7 L;  1F7E A;  4A94 C;  1AFA 1;  1KWW A;  4GK1 A;  1KX0 A;  1AFB 1;  1YUK B;  1DV8 A;  3P7F A;  2VRS A;  3TK6 B;  3ZRZ A;  1RDJ 1;  1YXJ A;  1TLG A;  2RIC A;  2YRA A;  3L9J C;  1VVC A;  1URK A;  2XC0 L;  1UZK A;  3R05 A;  4M11 A;  3Q7D A;  5KTI A;  2RNL A;  1GK5 A;  2PY2 A;  1IQK L;  2KRI A;  1IQN L;  1K37 A;  1X2T A;  1PWB A;  1CCF A;  5DN5 A;  3CA7 A;  1ESL A;  1FJS L;  1N1I A;  4N33 A;  1HX2 A;  3G8L A;  2WFT A;  1LMM A;  2W2O E;  3T5O A;  1HUP A;  2FD6 A;  2P16 L;  3IIT B;  1XKB A;  2BOU A;  1A3P A;  4LOS A;  1U0N B;  4O1Z A;  3C8K D;  2VUZ A;  1OK3 A;  3FD4 A;  1HRF A;  2BOX A;  3IJE B;  3WSX A;  3K7B A;  2FLB L;  3N8X A;  3MDL A;  3U73 A;  1OJY A;  2JRA A;  1KZE 1;  5B1R A;  1RDK 1;  4ZHA B;  4MMX B;  2Y81 B;  2I2L A;  1HFH A;  1EPH A;  1TPM A;  2XC5 L;  2W2M E;  5I0Q B;  4MMZ B;  3FF7 C;  1YGC L;  2VWO L;  4C16 A;  1T8D A;  1U0O B;  1T8C A;  2XBX L;  1WT9 B;  4KZV A;  4A7I A;  1RFN B;  1JWI A;  3OXU D;  2W86 A;  4YNX A;  5B1X A;  4JYU L;  4RRY A;  1F00 I;  4JZE L;  2TGF A;  4ZAE B;  3WBQ A;  1R14 A;  1EGI A;  2MSB A;  1C3A B;  3KQD L;  3TH3 L;  3HO4 A;  4ISH L;  4JHS A;  2IZ3 A;  1TPN A;  1IQL L;  3KQG A;  3IX0 A;  3RJ3 D;  1ATD A;  2KNI A;  4MTH A;  1IQM L;  4BTI A;  5L2Z L;  2JJL A;  1SS2 A;  1CWV A;  5JBB E;  2V8E A;  1BUU A;  2EC3 A;  5KN5 C;  4ZH1 D;  1V4L B;  1MD8 A;  1EPG A;  1B9W A;  1SL5 A;  1KWV A;  4KMB 1;  1IJQ A;  1EAI C;  1NWV A;  2FLR L;  5CKN A;  3F1S B;  4KI1 E;  2X2Z A;  4J6Q A;  1G1T A;  3IU3 I;  1MOX C;  2JKH L;  4FM5 A;  1IQE L;  4JZD L;  1X2W B;  1O7C T;  2DDU A;  1IQG L;  2WII C;  1K36 A;  2MCY A;  2O39 C;  2CKU A;  4JYV L;  2RLQ A;  4FXG G;  4ONT D;  5HYP A;  1KWU A;  4YLI A;  2P3T A;  1V1I A;  1U67 A;  2P3F L;  1KWT A;  1WMZ A;  4NGA L;  4XBM A;  4BXS A;  1IJK C;  1KOE A;  1MQ6 L;  4D90 A;  1Z6E L;  2BMG A;  3LAQ A;  4GU3 A;  2WPL E;  1U8C B;  1HZ8 A;  1APQ A;  3LN0 A;  3GXE A;  1N7D A;  1U0O A;  1DX5 I;  3NT1 A;  4BTU A;  3KL6 B; 
#chains in the Genus database with same CATH homology
 4B2R A;  4ZH8 B;  1BYF A;  3OLT A;  1G2L B;  2ZIB A;  5B1W A;  3CFW A;  4YZU B;  3DEM A;  1IOD B;  1FIF A;  3WH3 A;  4K12 A;  1JA3 A;  4LQF A;  2OYE P;  2VVV L;  3P7H A;  2CG7 A;  1OB1 C;  1OK9 A;  1ATA A;  3ERB A;  2UWO B;  4N34 A;  1H2Q P;  2MGR A;  2IT6 A;  1ATB A;  4BDX A;  1QDD A;  2Y38 A;  1PW9 A;  1UMR C;  4ZXX L;  1ATE A;  1IOD A;  1UEX A;  4PP8 A;  1J9C L;  3HS5 A;  1P4L D;  2ZWK A;  4J6M A;  2B5I D;  2NPR A;  1MQ5 L;  4N35 A;  4N36 A;  3P5H A;  3ZD1 A;  4AYE A;  2M94 A;  1NFX B;  1HCG B;  1O7B T;  1MPU A;  3NCW A;  2YBY A;  1IJK B;  3P5E A;  3P5D A;  3ZHG A;  1BJ3 A;  3KZJ A;  1GZ2 A;  4AYI A;  4WR9 A;  2H9E C;  4RUT A;  2XRB A;  3PGH A;  2BPD A;  3ZYI B;  1KWY A;  4X8T L;  2LS8 A;  3WBR A;  2H9E L;  2OS9 A;  4QKJ A;  1LQD A;  2I9B A;  2P26 A;  2UWL B;  1BNL A;  4AYM A;  1OK2 A;  1UKM B;  2RIE A;  3KQC L;  1JBU L;  1GKN A;  4PH9 A;  3QCW A;  5EGM B;  2N40 A;  1QFK L;  3WSR A;  1X2W A;  4Y76 B;  2VWN L;  3SW0 X;  3KK6 A;  2Y7Z B;  1LPG A;  2WPI E;  4S0U A;  3PAQ A;  1HQ8 A;  1MUQ A;  5HYT B;  1V7P A;  2LOJ A;  1G2M B;  1H2P P;  5HZP B;  3V65 B;  1O5D L;  2WPK E;  2IZ4 A;  2RKY A;  4J38 B;  1KZB 1;  3ALU A;  2P95 L;  3ELA L;  4IOP B;  2K2T A;  2VVU L;  3P5B L;  4Z0L A;  4O02 B;  3TBD A;  5L2Y L;  1RTM 1;  2YGO A;  3FF9 A;  2BQW A;  2B7D L;  1FIH A;  3BX4 B;  5JVY A;  1GHQ B;  5HYU B;  3M7P A;  2H2T B;  3PAK A;  3OLU A;  1YPO A;  4RS0 A;  3P7G A;  1QO6 A;  2W2N E;  2XQW C;  4ISI L;  4E1G A;  4IOP A;  3ALS A;  2WYJ B;  5IKV A;  1HCC A;  4M18 A;  3N8W A;  5IKT A;  1IP0 A;  3L89 M;  2VH0 B;  1CQE A;  5IKR A;  2BQ6 A;  3GOV A;  4J6L A;  1KLJ L;  2CL8 A;  1UZJ A;  4MMY B;  3N8Y B;  3NTG A;  2ORK A;  3Q3K B;  5K0H B;  1YUG A;  5F19 A;  1P0S L;  2AYL A;  1V3X B;  1F0S B;  3NFP I;  5JPM G;  1WMY A;  2KB9 A;  1BV4 A;  3LC5 B;  1SL4 A;  2OX8 A;  4M10 A;  3PAR A;  1BF9 A;  2RL0 A;  4ZXY L;  2W26 B;  2OX9 A;  3C8J A;  2H2R A;  1R13 A;  2J94 B;  2P28 B;  1FE2 A;  1EMO A;  3FBY A;  1UV0 A;  2Y5F L;  3ZYG A;  2GO0 A;  3SOV A;  5LGK E;  1KMB 1;  2RID A;  2CG6 A;  2XR6 A;  2Q1J B;  2QY0 A;  4X8V L;  1EGF A;  1XKA L;  3H5C B;  2M74 A;  2ZQK A;  3LTG D;  4XL1 A;  1G1R A;  4IGD A;  3CAL A;  2KL7 A;  1ELV A;  4J6K A;  3WBP A;  1RDM 1;  1SRZ A;  1NQL B;  3GPR C;  3ASI A;  5JBA E;  3M36 L;  4N32 A;  2OYU P;  2G00 L;  2WPM E;  3CAD A;  3DBZ A;  2W2Q E;  1F02 I;  2G7I A;  4WRF A;  1HT8 A;  5FO8 C;  1WHE A;  1EPI A;  2P94 L;  3N8V A;  5KIR A;  5CIS A;  1IXX B;  2RIB A;  2D1J B;  1E87 A;  3WWK C;  1DY1 A;  2ORJ A;  2FZZ L;  4LOT A;  4M1G A;  1LIT A;  3BX4 A;  4KZW A;  4LU5 A;  1C1Z A;  5E8D A;  1IQI L;  3CEN L;  2F9B L;  1E5G A;  3PBF A;  3SOB B;  2XWB F;  4ZET A;  4YMD A;  3G81 A;  1U0N C;  2BQ7 A;  3KRK A;  2KV3 A;  4YT7 L;  3BT2 A;  1YUF A;  2XRD A;  3QH0 A;  2W2P E;  1JZN A;  2IT5 A;  5F2Q A;  3TVJ A;  2KV4 A;  1KSN B;  4XLW A;  4RRZ A;  2RKZ A;  1CCV A;  1H8U A;  4J6P A;  3BPS E;  1TPG A;  3RR3 A;  2WG3 C;  1PTH A;  4WJG 2;  4CUD A;  1IQF L;  3GCX E;  3UBU B;  3WHD A;  3LC3 B;  3TK5 B;  4ZRV A;  3LIW B;  3OP8 A;  4DN8 A;  1FFM A;  4G9A A;  1NFU B;  1XDT R;  1SB2 B;  2P93 L;  1BCH 1;  1EQG A;  4N38 A;  2A55 A;  2PUQ L;  3ALT A;  1KZD 1;  1UMR A;  3LN1 A;  1NFY B;  1I0U A;  2WPH E;  1MD7 A;  1X7A L;  4Y7B B;  3ZYJ B;  4NA9 L;  1DIY A;  4CUE A;  1C3A A;  1FVU B;  2XBY L;  2GD4 A;  5FFS A;  1O9A A;  4EZM G;  2ERJ A;  1AUT L;  5CKQ A;  5F1A A;  1JWI B;  4D0F A;  5FFR A;  1HJ7 A;  1Q4G A;  1V7P B;  1F0R B;  2VWM K;  1Z6C A;  3P5F A;  5L30 L;  1XFE A;  1ADX A;  3O8E B;  2VRP A;  2J2U B;  1IVO C;  3TZI A;  2Y82 B;  4LOR A;  3KQB L;  1COU A;  1GPZ A;  2VUV A;  2J38 B;  2Y7X B;  2VRP B;  1YXK A;  3VLG A;  4X8U L;  2CJI B;  1J34 A;  3BDW B;  1TOZ A;  3KCG L;  1J35 A;  1KX1 A;  4TGF A;  3HUP A;  1V4L A;  3HS7 A;  1IOX A;  3GIS X;  3CDG F;  1KG0 C;  1NPE B;  1YPU A;  5FDQ A;  4WRC A;  1SL6 A;  2MTI A;  3CDG E;  1BJ3 B;  1WU1 B;  1CX2 A;  3LTF B;  4F4O C;  2W81 A;  4GJ0 A;  4Y79 B;  4GKO G;  2PR3 B;  5M62 A;  1EBV A;  4WCO A;  3ZHG D;  2UWP B;  2I9A A;  1QO3 C;  3M37 L;  1UZQ A;  2YGQ A;  3S6X A;  1B08 A;  3MQE A;  1SB2 A;  3NCX A;  2P3F N;  3G83 A;  1EPJ A;  2WFX B;  1IQJ L;  3SOQ A;  1H04 P;  1IGZ A;  2BZ6 L;  4OTY A;  4WUX A;  3HO5 A;  1KCG A;  1KLI L;  1QUB A;  2WPJ E;  1Q3X A;  1DY2 A;  1RDN 1;  3MQL A;  1PRH A;  4Z6A L;  2W80 A;  1LY2 A;  2BPE A;  5J6G G;  1PPQ A;  4E52 A;  3M9Z A;  3P5G A;  1E5U I;  1KZA 1;  1OJW A;  4B2S A;  1FVU A;  1KWZ A;  1XPH A;  2C6U A;  2FLG A;  3KXV A;  3R62 A;  1G4F A;  4QKI A;  1CKL A;  2ADX A;  1W8B L;  1GKG A;  3GCW E;  2Y5G L;  1U5M A;  2I83 A;  1H03 P;  3G84 A;  4Y71 B;  3FF8 C;  2JGX A;  1FF7 A;  2E3X B;  2MCZ A;  1TN3 A;  2RIA A;  1OZ7 B;  1MSB A;  1FAK L;  2KMB 1;  1KIG L;  3HO3 A;  1WT9 A;  3T3A A;  1LMJ A;  1M1X B;  2YGP A;  4LMF A;  5KTH A;  2J95 B;  1RDO 1;  3SW2 A;  1VVD A;  4QKH A;  1CVW L;  1JL9 A;  3V64 C;  1DQB A;  1OJV A;  1J35 B;  1HAF A;  2W3K B;  3F6U L;  4JZF L;  1IXX A;  4NG9 L;  1UKM A;  3CCK A;  3N8W B;  4J6N A;  4WRE A;  1EZQ B;  2RA0 L;  1NZI A;  4CUF A;  2Y80 B;  1HFI A;  1HTN A;  2BRS A;  1QGB A;  4C9F A;  4N37 A;  2RLP A;  1PFX L;  2XBW L;  2JGW A;  1UEX B;  4Y6D B;  2EI7 B;  3FCS B;  4J6J A;  4D0E A;  1YPQ A;  1KZC 1;  4QKG A;  4WQQ A;  1B6E A;  2AFP A;  2XC4 L;  1EMN A;  3ZD2 A;  4ZRW A;  2E3X C;  3POY A;  1NFW B;  5JW1 A;  2W3I B;  2WYG B;  1W7X L;  4G1M B;  5CKM A;  1FBR A;  1OK1 A;  1HYR A;  3WWK B;  1X2T B;  2PHB B;  2GGU A;  1PXX A;  1TDQ B;  5FFT A;  1AFD 1;  5K8Y A;  2BOH A;  2VH6 B;  1YTT A;  2VVC K;  3GPR A;  5JB9 E;  1L5G B;  4RRX A;  1NT0 A;  4AK8 A;  1C5M F;  2EI8 B;  3VPP A;  1RDI 1;  3HS6 A;  1Y17 B;  3G8K A;  1Z92 B;  2VWL L;  3C22 A;  2WG4 B;  3TGF A;  4BTT A;  4M17 A;  4WUW A;  1SZB A;  4BXW A;  4KKD A;  5COX A;  4CSY A;  1P9J A;  1J34 B;  3BT1 A;  1HAE A;  1OZ7 A;  3P5I A;  1IQH L;  1WK1 A;  4ZES A;  3KQE L;  1DDX A;  1ZJK A;  5JB8 E;  2GGX A;  2BPH A;  1FM5 A;  4CAJ A;  1IOE L;  1FAX L;  2UWN A;  1TLE A;  1RJH A;  2XR5 A;  2BOK L;  2J34 B;  4UWW A;  3U7U G;  2XBV L;  4UXM A;  2J4I B;  1K9I A;  2BO2 A;  3NTB A;  3IKN A;  1DVA L;  1UOS A;  5JBC E;  3INB C;  1E8B A;  1KWX A;  1IGX A;  2PF5 A;  1RDL 1;  4PZ5 A;  4X8S L;  4Y7A B;  3OED C;  4YT6 L;  3IKQ A;  3EGF A;  1WHF A;  4AQT A;  1E88 A;  3IKP A;  3IKR A;  1BCJ 1;  5IKQ A;  1G1Q A;  3NJP C;  1YO8 A;  2RHP A;  1HT5 A;  6COX A;  5JVZ A;  3UBU A;  2MGP A;  1UOT P;  4RRW A;  1PGE A;  3N8Y A;  3ENS A;  2KMS A;  1UOS B;  3WH2 A;  1UZP A;  4G96 A;  4AYD A;  2MHP A;  3FFG L;  4GI0 A;  3WWK A;  3KMB 1;  3K9X A;  2EI6 B;  2YHF A;  4Z0K B;  1E8I A;  4GJX A;  3N8Z A;  2WZP P;  1DY0 A;  3VYK A;  1F7M A;  1CEJ A;  1P1Z D;  1CVU A;  1G4G A;  3EJH A;  4DJZ A;  1L3Y A;  3RS1 A;  1JV2 B;  3C9A C;  3VYJ A;  3GPR B;  2BZM A;  4MUC A;  2EHF A;  1LPK A;  1LPZ A;  1EGG A;  1G1S A;  1FSB A;  4BDW A;  4COX A;  1HRE A;  4A5W B;  1K9J A;  2K2S B;  1XAR A;  1Y17 A;  3BDW A;  3QMO A;  3GPR D;  1KLO A;  4PDC A;  2Y5H L;  1APO A;  2VJ3 A;  2XWJ I;  1EQH A;  2P3U A;  3HPT A;  1ZAQ A;  4OTJ A;  5I46 L;  3CS7 L;  1F7E A;  4A94 C;  1AFA 1;  1KWW A;  4GK1 A;  1KX0 A;  1AFB 1;  1YUK B;  1DV8 A;  3P7F A;  3TK6 B;  3ZRZ A;  1RDJ 1;  1YXJ A;  1TLG A;  2RIC A;  2YRA A;  3L9J C;  1VVC A;  1URK A;  2XC0 L;  1UZK A;  3R05 A;  4M11 A;  3Q7D A;  5KTI A;  2RNL A;  1GK5 A;  2PY2 A;  1IQK L;  2KRI A;  1IQN L;  1K37 A;  1X2T A;  1PWB A;  1CCF A;  3CA7 A;  1ESL A;  1FJS L;  1N1I A;  4N33 A;  1HX2 A;  3G8L A;  2WFT A;  1LMM A;  2W2O E;  3T5O A;  1HUP A;  2FD6 A;  2P16 L;  3IIT B;  1XKB A;  2BOU A;  1A3P A;  4LOS A;  1U0N B;  4O1Z A;  3C8K D;  2VUZ A;  1OK3 A;  3FD4 A;  1HRF A;  2BOX A;  3IJE B;  3K7B A;  2FLB L;  3N8X A;  3MDL A;  3U73 A;  1OJY A;  2JRA A;  1KZE 1;  5B1R A;  1RDK 1;  4ZHA B;  4MMX B;  2Y81 B;  1HFH A;  1EPH A;  1TPM A;  2XC5 L;  2W2M E;  5I0Q B;  4MMZ B;  3FF7 C;  1YGC L;  2VWO L;  4C16 A;  1T8D A;  1U0O B;  1T8C A;  2XBX L;  1WT9 B;  4KZV A;  4A7I A;  1RFN B;  1JWI A;  3OXU D;  2W86 A;  4YNX A;  5B1X A;  4JYU L;  4RRY A;  1F00 I;  4JZE L;  2TGF A;  4ZAE B;  3WBQ A;  1R14 A;  1EGI A;  2MSB A;  1C3A B;  3KQD L;  3TH3 L;  3HO4 A;  4ISH L;  4JHS A;  2IZ3 A;  1TPN A;  1IQL L;  3KQG A;  3IX0 A;  3RJ3 D;  1ATD A;  2KNI A;  4MTH A;  1IQM L;  4BTI A;  5L2Z L;  1SS2 A;  1CWV A;  5JBB E;  2V8E A;  1BUU A;  2EC3 A;  5KN5 C;  4ZH1 D;  1V4L B;  1MD8 A;  1EPG A;  1B9W A;  1SL5 A;  1KWV A;  4KMB 1;  1IJQ A;  1EAI C;  1NWV A;  2FLR L;  5CKN A;  3F1S B;  4KI1 E;  4J6Q A;  1G1T A;  3IU3 I;  1MOX C;  2JKH L;  4FM5 A;  1IQE L;  4JZD L;  1X2W B;  1O7C T;  2DDU A;  1IQG L;  2WII C;  1K36 A;  2MCY A;  2O39 C;  2CKU A;  4JYV L;  2RLQ A;  4FXG G;  4ONT D;  5HYP A;  1KWU A;  4YLI A;  2P3T A;  1U67 A;  2P3F L;  1KWT A;  1WMZ A;  4NGA L;  4XBM A;  4BXS A;  1IJK C;  1KOE A;  1MQ6 L;  4D90 A;  1Z6E L;  2BMG A;  3LAQ A;  2WPL E;  1U8C B;  1HZ8 A;  1APQ A;  3LN0 A;  3GXE A;  1N7D A;  1U0O A;  1DX5 I;  3NT1 A;  4BTU A;  3KL6 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...