4C16A

E-selectin lectin, egf-like and two scr domains complexed with glycomimetic antagonist
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
280
structure length
280
Chain Sequence
b'WSYNTSTEAMTYDEASAYCQQRYTHLVAIQNKEEIEYLNSILSYSPSYYWIGIRKVNNVWVWVGTQKPLTEEAKNWAPGEPNNRQKDEDCVEIYIKREKDVGMWNDERCSKKKLALCYTAACTNTSCSGHGECVETINNYTCKCDPGFSGLKCEQIVNCTALESPEHGSLVCSHPLGNFSYNSSCSISCDRGYLPSSMETMQCMSSGEWSAPIPACNVVECDAVTNPANGFVECFQNPGSFPWNTTCTFDCEEGFELMGAQSLQCTSSGNWDNEKPTCKA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords E-SELECTIN
publication title E-Selectin Ligand Complexes Adopt an Extended High-Affinity Conformation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
total genus 58
structure length 280
sequence length 280
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-08-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00008 EGF EGF-like domain
A PF00059 Lectin_C Lectin C-type domain
A PF00084 Sushi Sushi repeat (SCR repeat)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.25.10 Mainly Beta Ribbon Laminin Laminin 4c16A02
2.10.70.10 Mainly Beta Ribbon Complement Module; domain 1 Complement Module, domain 1 4c16A04
2.10.70.10 Mainly Beta Ribbon Complement Module; domain 1 Complement Module, domain 1 4c16A03
3.10.100.10 Alpha Beta Roll Mannose-Binding Protein A; Chain A Mannose-Binding Protein A, subunit A 4c16A01
1ZAQA 3N8WB 1B08A 3KMB1 3R62A 2ERJA 2RLQA 1K37A 1UEXA 2N40A 1C3AB 2P16L 4RRZA 4BDXA 1WHFA 4LQFA 3LIWB 5KIRA 2OX8A 4JZFL 3WBPA 1NFXB 3NT1A 1IJKC 3ZRZA 1HZ8A 2XWJI 2XR6A 5K8YA 1CCFA 3P5DA 4PP8A 2EI8B 1SZBA 4YNXA 3N8VA 2RIDA 3H5CB 2GGUA 2CL8A 3ALUA 3WWKB 2WPKE 4A7IA 3GPRC 4ZXYL 3G83A 2RICA 3MQEA 2Y80B 4RUTA 3PAQA 4MTHA 2BPHA 4S0UA 3KQEL 2GO0A 2YGPA 3IJEB 1G1RA 3LTGD 4Z0KB 2ADXA 2YGOA 5FFSA 3V65B 1FFMA 2Y7XB 4ZXXL 2JGWA 1IQFL 3ELAL 3SOBB 1RDL1 4JHSA 5F2QA 2W2OE 3CS7L 2PUQL 1F0RB 3V64C 2XRDA 2M74A 1G1QA 3NTGA 4J6PA 2XC4L 4LORA 4CUEA 1YUFA 4YMDA 3G8LA 3KCGL 1U67A 3WBRA 1IQIL 2UWLB 1ZJKA 2BOXA 3FCSB 1UZKA 2Y81B 1GK5A 3F1SB 1ESLA 3TK6B 4GKOG 1YUKB 1V4LB 1E88A 2B7DL 1E8BA 2RKYA 1B6EA 1G1SA 3P5EA 4UWWA 2B5ID 3FD4A 1F7MA 3UBUB 1QO3C 1LMJA 1HAEA 1EGIA 4AYEA 1IGZA 1FVUB 2PF5A 2EI6B 5B1XA 1EZQB 1QFKL 3HS6A 2WG4B 3BT1A 4JYVL 4Y7AB 4IGDA 4GJXA 5F1AA 4XLWA 1ATEA 3K9XA 1EAIC 2A55A 2VJ3A 4Y7BB 1GHQB 2EHFA 1R13A 4J6MA 1UV0A 4EZMG 1PFXL 4MMYB 4X8VL 2IT5A 3OXUD 1KSNB 1I0UA 4Y71B 2IZ4A 5COXA 2RNLA 4COXA 3U7UG 4WR9A 1KWYA 3ZD2A 1SL6A 1KWZA 2YHFA 3Q7DA 3HS5A 5LGKE 1O9AA 1E5GA 3BDWA 1RDI1 1OJVA 4KI1E 5HYTB 3NCWA 2XC5L 1J35A 3QMOA 1KWVA 1IQEL 1OK3A 3WBQA 4GJ0A 2I83A 2FD6A 5IKQA 3FF9A 1Q4GA 2MGPA 2D1JB 2F9BL 1SB2B 1K9JA 1XKBA 2E3XB 1H8UA 4O1ZA 1VVDA 2BOKL 3N8XA 1P9JA 3KL6B 3BPSE 1L3YA 2GGXA 3M9ZA 2W3IB 4KMB1 1G2MB 3ALTA 3M36L 1U5MA 1BJ3B 1BUUA 1V7PA 1F0SB 5E8DA 3SW2A 1MUQA 1IQHL 1J34A 5M62A 3O8EB 2VVUL 4X8SL 1UKMA 1IQGL 1HFHA 1KZA1 2EC3A 4N37A 1MPUA 4M18A 2XRBA 5CKMA 4G9AA 1PPQA 1UEXB 3PARA 1UZJA 2PY2A 1UMRC 2I9AA 1NQLB 1UOTP 1E87A 3EGFA 1DDXA 1KLOA 2Y82B 1TPGA 3CENL 5JVYA 1EGGA 5I0QB 1DY1A 4LU5A 4ZRWA 2EI7B 1MD7A 1EBVA 2FLGA 1ATDA 4ISIL 2LS8A 4N35A 2VUVA 5J6GG 4KKDA 1EPGA 3KK6A 3C8KD 3IKQA 2K2TA 4GK1A 2P3TA 1XKAL 2BMGA 2CG7A 3IU3I 1KZE1 1P0SL 1H03P 2VH6B 2YBYA 1FIFA 3ZYIB 4NG9L 3P5IA 1CVWL 4YT7L 1LPKA 5KTHA 1F7EA 1ELVA 1G2LB 5JW1A 2CG6A 1X2WA 1OJWA 1NZIA 3P7FA 1LY2A 3RJ3D 3TBDA 1G4FA 5L2ZL 1FAKL 3DEMA 1TPNA 4RRXA 3HO3A 2WPIE 3N8YA 1EPJA 2UWPB 2WPME 4MMXB 2XBWL 2AYLA 3GCWE 2J2UB 1CVUA 1U0NC 2J34B 1JV2B 3M7PA 3C8JA 2P3FN 4C9FA 3INBC 4OTJA 4AYIA 2W2NE 2P94L 1EMOA 4IOPA 4DJZA 5I46L 1EPHA 1X2TA 5F19A 2MHPA 3M37L 5IKTA 2ZIBA 3BX4A 3CCKA 3FBYA 3FF8C 1VVCA 4G96A 1KLJL 3TZIA 3GPRA 2WG3C 3IITB 4A5WB 4Y79B 1T8CA 3VPPA 4ZRVA 5JB8E 1WK1A 1JL9A 1W7XL 1YPQA 1C5MF 2UWNA 4RS0A 1N1IA 1RTM1 3BT2A 3KZJA 4OTYA 1J9CL 2P3UA 2W26B 3TK5B 2VWOL 4CSYA 3KQCL 2WYJB 1PWBA 3ZYGA 3GCXE 2RA0L 4BTTA 1KIGL 1OK2A 4ZH1D 3C9AC 1KLIL 2GD4A 1A3PA 2XQWC 1KWTA 2BZ6L 3LAQA 4J6NA 1TDQB 1T8DA 2PR3B 5CKQA 3T5OA 1O7BT 1OB1C 1JWIA 3WH2A 2KL7A 1P4LD 1SL5A 3BDWB 1P1ZD 1HRFA 1MSBA 1YXJA 1CX2A 1C1ZA 3N8ZA 1J35B 3TGFA 3CDGF 4WRCA 4X8UL 4Y6DB 4QKHA 2RIBA 1BCJ1 1HT5A 4NA9L 3ALSA 3P5BL 1NWVA 3C22A 1COUA 1TN3A 1FIHA 1JBUL 2J95B 3CFWA 1HQ8A 4N36A 3RR3A 2Y5FL 1RDO1 2KMB1 4Z6AL 3KRKA 3IX0A 2QY0A 1Z92B 2LOJA 1V7PB 2KB9A 1FSBA 3ZD1A 5KN5C 2BO2A 1J34B 5FDQA 1UOSB 4DN8A 1KG0C 1EQHA 4M1GA 1KWWA 2H9EL 3TVJA 3WWKC 4AQTA 1G1TA 2G00L 4AK8A 3GPRD 1RDJ1 2K2SB 1RJHA 3KQGA 3IKNA 1E5UI 1HT8A 3GXEA 1XPHA 3P5FA 1TLEA 3TH3L 3OP8A 1Q3XA 2BQWA 5JPMG 2NPRA 5L2YL 2WIIC 1IXXA 4ZETA 3F6UL 3DBZA 4AYMA 3SW0X 1BF9A 3P5HA 4G1MB 4F4OC 1R14A 3IKRA 1SRZA 4TGFA 5IKVA 1KZC1 4K12A 4M17A 5KTIA 4N32A 3POYA 4FM5A 1YPUA 1IQLL 2J4IB 4M11A 2YRAA 1K9IA 1V4LA 1JA3A 1X2WB 2Y5HL 1QDDA 2OX9A 1KZB1 1HCGB 3QH0A 4JZEL 1HFIA 2MCZA 1RDK1 3LC3B 1WT9A 1YPOA 2XC0L 1YTTA 2RIEA 1CKLA 2VRPB 1H2QP 3KQBL 2FLRL 2XBVL 3OLUA 4WQQA 1IJQA 1X7AL 1UMRA 2BOUA 1N7DA 4KZVA 2MGRA 1FE2A 1L5GB 3G8KA 1V3XB 5EGMB 2JKHL 1FBRA 1OZ7A 1U0OA 5FFTA 4E52A 1WU1B 2KV3A 1KCGA 1X2TB 4JZDL 1Z6CA 1CQEA 4O02B 1IQJL 3BX4B 1RFNB 1YXKA 5JBCE 4KZWA 1NFUB 4QKJA 3GPRB 4WJG2 3LC5B 2WYGB 1QUBA 1MQ6L 4QKGA 2ORJA 1E8IA 4N38A 3WHDA 3FF7C 4B2RA 3LTFB 2VUZA 1NT0A 1XARA 3OLTA 4ZHAB 2KMSA 1AFA1 4E1GA 1Y17A 2W80A 3HUPA 2FLBL 4MMZB 2DDUA 3NFPI 3CADA 2P3FL 2C6UA 4J6JA 2E3XC 1IGXA 1MOXC 2VVCK 2CKUA 3WH3A 3PGHA 1IODA 5IKRA 3OEDC 2J94B 3LN0A 1JWIB 2MSBA 6COXA 1DVAL 2W3KB 4BTIA 1M1XB 4M10A 1APQA 2G7IA 2Y5GL 2KV4A 2W2PE 1HAFA 5B1RA 3K7BA 1BNLA 1FAXL 4CUDA 4D0EA 1H2PP 4ISHL 1F00I 4FXGG 2H2TB 1PTHA 3NTBA 3VYKA 1W8BL 4BXWA 3L89M 1DY0A 2J38B 1DY2A 2VWNL 1FM5A 1HTNA 4ONTD 4PDCA 2P95L 3ZHGA 2WPHE 1XDTR 1O5DL 3CA7A 1YUGA 1UZQA 4C16A 2V8EA 1EQGA 1XFEA 2O39C 2MTIA 3R05A 5JBBE 2WPJE 1GKNA 3NCXA 4J6KA 4BXSA 2VRPA 4J6QA 2OYEP 3VYJA 1IQKL 2WPLE 5K0HB 1LQDA 1RDN1 5JB9E 2VWMK 4RRYA 4Y76B 4UXMA 4ZAEB 1GPZA 5JBAE 2Q1JB 1SL4A 3T3AA 1KWUA 4WUXA 3RS1A 2VWLL 3HO5A 3N8WA 4Z0LA 1OK1A 3KXVA 4YT6L 3P7GA 1IXXB 1C3AA 1YO8A 1IOEL 4CAJA 1SS2A 4MUCA 1TLGA 3P7HA 1BCH1 2XBYL 2BRSA 3HPTA 1MD8A 3ERBA 1BV4A 4RRWA 1HJ7A 1NFYB 2IT6A 2RIAA 4WRFA 1UKMB 2WFTA 2AFPA 1IQML 1EPIA 1B9WA 1ATAA 1DQBA 3WWKA 3CALA 1DV8A 2PHBB 1WT9B 5L30L 2JGXA 2RHPA 2W2QE 4PZ5A 1IP0A 2P26A 1KMB1 4QKIA 4XBMA 3G81A 3ZHGD 1HREA 1Z6EL 1GKGA 1OZ7B 1U0OB 4BDWA 3CDGE 1HUPA 3WSRA 1ADXA 1IVOC 1QGBA 2P28B 1HYRA 1WMYA 2RL0A 4YZUB 3EJHA 4JYUL 1QO6A 3ENSA 1PW9A 1WMZA 4YLIA 3MQLA 1RDM1 2WFXB 3SOVA 1APOA 3L9JC 2FZZL 1URKA 3U73A 1UZPA 4X8TL 4WUWA 4NGAL 3IKPA 3HS7A 1KZD1 1GZ2A 1U8CB 2BOHA 2VVVL 1AUTL 1YGCL 1Y17B 5FFRA 2OYUP 3UBUA 1LPGA 1LPZA 1IJKB 4GI0A 3KQDL 3N8YB 1FVUA 1DIYA 2ORKA 1U0NB 3HO4A 2RLPA 1BYFA 1LITA 4N34A 1IOXA 4D0FA 1IODB 1CEJA 1O7CT 4BTUA 2W81A 3G84A 1FJSL 4WREA 4IOPB 5B1WA 2XBXL 4B2SA 1FF7A 1EGFA 1TOZA 2JRAA 2M94A 1CCVA 4ZESA 2RKZA 4AYDA 1UOSA 4ZH8B 4PH9A 1H04P 2BQ6A 2Y38A 1PXXA 3GISX 2KRIA 1PGEA 5CISA 1CWVA 2BZMA 2XR5A 3ASIA 4J38B 2VH0B 1TPMA 5FO8C 1HX2A 1G4GA 1KWXA 2CJIB 2W2ME 1KX1A 1DX5I 1K36A 4J6LA 1F02I 2OS9A 1MQ5L 1OK9A 2BQ7A 4N33A 3PBFA 1HCCA 5CKNA 4LOTA 1ATBA 1IQNL 1SB2A 4D90A 2ZQKA 1PRHA 3PAKA 1KOEA 2TGFA 1WHEA 5HYUB 1EMNA 3SOQA 3ZYJB 5HYPA 2BPDA 2XWBF 5HZPB 1NPEB 2P93L 2BPEA 2MCYA 1NFWB 2W86A 4XL1A 1BJ3A 2H2RA 3VLGA 4LOSA 5JVZA 3NJPC 2IZ3A 3MDLA 3P5GA 2Y7ZB 1JZNA 3LN1A 3FFGL 4CUFA 1OJYA 1AFD1 2ZWKA 4LMFA 1KX0A 2UWOB 4WCOA 2I9BA 3QCWA 3GOVA 3Q3KB 1AFB1
chains in the Genus database with same CATH superfamily
1ZAQA 3N8WB 1B08A 3KMB1 3R62A 2ERJA 2RLQA 1K37A 1UEXA 2N40A 1C3AB 2P16L 4RRZA 4BDXA 1WHFA 4LQFA 3LIWB 5KIRA 2OX8A 4JZFL 3WBPA 1NFXB 3NT1A 1IJKC 3ZRZA 1HZ8A 2XWJI 2XR6A 5K8YA 1CCFA 5DN4A 3P5DA 4PP8A 2EI8B 1SZBA 4YNXA 3N8VA 2RIDA 3H5CB 2GGUA 2CL8A 3ALUA 3WWKB 2WPKE 4A7IA 3GPRC 4ZXYL 3G83A 2RICA 3MQEA 2Y80B 4RUTA 3PAQA 4MTHA 2BPHA 4S0UA 3KQEL 2GO0A 2YGPA 3IJEB 1G1RA 3LTGD 4Z0KB 2ADXA 2YGOA 5FFSA 3WSXA 3V65B 1FFMA 2Y7XB 4ZXXL 2JGWA 1IQFL 3ELAL 3SOBB 1RDL1 4JHSA 5F2QA 2W2OE 3F6KA 3CS7L 2PUQL 1F0RB 3V64C 2XRDA 2M74A 1G1QA 3NTGA 4J6PA 2XC4L 4LORA 4CUEA 1YUFA 4YMDA 3G8LA 3KCGL 1U67A 3WBRA 1IQIL 2UWLB 1ZJKA 2BOXA 3FCSB 1UZKA 2Y81B 1GK5A 3F1SB 1ESLA 3TK6B 4GKOG 1YUKB 1V4LB 1E88A 2B7DL 1E8BA 2RKYA 1B6EA 1G1SA 3P5EA 2JJLA 4UWWA 2B5ID 3FD4A 1F7MA 3UBUB 1QO3C 1LMJA 1HAEA 1EGIA 4AYEA 1IGZA 2Y8TA 1FVUB 2PF5A 2EI6B 5B1XA 1EZQB 1QFKL 3HS6A 2WG4B 3BT1A 4JYVL 4Y7AB 2ZYCA 4IGDA 4GJXA 5F1AA 4XLWA 1ATEA 3K9XA 1EAIC 2A55A 2VJ3A 4Y7BB 1GHQB 2EHFA 1R13A 4J6MA 1UV0A 4EZMG 1PFXL 4MMYB 4X8VL 2IT5A 3OXUD 1KSNB 1I0UA 4Y71B 2IZ4A 5COXA 2RNLA 3VWOA 4COXA 3U7UG 4WR9A 1KWYA 3ZD2A 1SL6A 1KWZA 2YHFA 3Q7DA 3HS5A 5LGKE 1O9AA 1E5GA 3BDWA 1RDI1 1OJVA 4KI1E 5HYTB 3NCWA 2XC5L 1J35A 3QMOA 1KWVA 1IQEL 1OK3A 3WBQA 4GJ0A 2I83A 2FD6A 5IKQA 3FF9A 1Q4GA 2MGPA 2D1JB 2F9BL 2HOXA 1K9JA 1XKBA 1SB2B 2E3XB 1H8UA 4O1ZA 1VVDA 2BOKL 3N8XA 1P9JA 3KL6B 2BT7A 3BPSE 1L3YA 2GGXA 3M9ZA 2W3IB 4KMB1 1G2MB 3ALTA 3M36L 1U5MA 1BJ3B 1BUUA 1V7PA 1F0SB 5E8DA 3SW2A 1MUQA 1IQHL 1J34A 5M62A 3O8EB 2VVUL 4X8SL 1UKMA 1IQGL 1HFHA 1KZA1 2EC3A 4N37A 1MPUA 4PO7A 4M18A 2XRBA 5CKMA 4G9AA 1PPQA 1UEXB 3PARA 1UZJA 2PY2A 3S6XA 1UMRC 2I9AA 1NQLB 1UOTP 4N7EA 1E87A 3EGFA 1DDXA 1KLOA 2Y82B 1TPGA 3CENL 5JVYA 1EGGA 5I0QB 1DY1A 4LU5A 4ZRWA 2VRSA 2EI7B 1MD7A 1EBVA 2FLGA 1ATDA 4ISIL 2LS8A 4N35A 2VUVA 5J6GG 4KKDA 1EPGA 3KK6A 3C8KD 3IKQA 2K2TA 4GK1A 2P3TA 1XKAL 2BMGA 2CG7A 2BSFA 3IU3I 1KZE1 1P0SL 1H03P 2VH6B 2YBYA 1FIFA 3ZYIB 4NG9L 3P5IA 1CVWL 4YT7L 1LPKA 4GU3A 1F7EA 1ELVA 1G2LB 5JW1A 2CG6A 1X2WA 5KTHA 1OJWA 1NZIA 3P7FA 1LY2A 3RJ3D 3TBDA 1G4FA 5L2ZL 1FAKL 3DEMA 1TPNA 4RRXA 3HO3A 2WPIE 3N8YA 1EPJA 2UWPB 2WPME 4MMXB 2XBWL 2AYLA 3GCWE 2J2UB 1CVUA 1U0NC 2J34B 2X2ZA 1JV2B 3M7PA 3C8JA 2P3FN 4C9FA 3INBC 4OTJA 4AYIA 2W2NE 2P94L 1EMOA 4IOPA 4DJZA 5I46L 3CI0J 1EPHA 1X2TA 3ZLEA 5F19A 2MHPA 3M37L 5IKTA 2ZIBA 3BX4A 3CCKA 3FBYA 3FF8C 1VVCA 4G96A 1KLJL 3TZIA 3GPRA 2WG3C 3IITB 4A5WB 4Y79B 1T8CA 3VPPA 4ZRVA 5JB8E 1WK1A 1JL9A 1W7XL 1YPQA 1C5MF 2UWNA 4RS0A 1N1IA 1RTM1 3BT2A 3KZJA 4OTYA 1J9CL 2P3UA 2W26B 3TK5B 2VWOL 4CSYA 3KQCL 2WYJB 1PWBA 3ZYGA 3GCXE 2RA0L 4BTTA 1KIGL 1OK2A 4ZH1D 3C9AC 1KLIL 2GD4A 1A3PA 2XQWC 1KWTA 2BZ6L 3LAQA 4J6NA 1TDQB 1T8DA 2PR3B 5CKQA 3T5OA 3NJAA 1OB1C 1JWIA 1O7BT 3WH2A 2KL7A 1P4LD 1SL5A 3BDWB 1P1ZD 1HRFA 1MSBA 1YXJA 1CX2A 1C1ZA 3N8ZA 1J35B 3TGFA 3CDGF 4WRCA 4X8UL 4Y6DB 4QKHA 2RIBA 1BCJ1 1HT5A 4NA9L 3ALSA 3P5BL 1NWVA 3C22A 1COUA 1TN3A 1FIHA 1JBUL 2J95B 3CFWA 1HQ8A 4N36A 3RR3A 2Y5FL 1RDO1 2KMB1 4Z6AL 3KRKA 3IX0A 2QY0A 1Z92B 2LOJA 1V7PB 2KB9A 1FSBA 3ZD1A 5KN5C 2BO2A 1J34B 5FDQA 1UOSB 4DN8A 1KG0C 1EQHA 4M1GA 1KWWA 2H9EL 3TVJA 3WWKC 4AQTA 1G1TA 2G00L 4AK8A 3GPRD 1RDJ1 2K2SB 1RJHA 3KQGA 3IKNA 1E5UI 1HT8A 3GXEA 1XPHA 3P5FA 3FGTA 1TLEA 3TH3L 3OP8A 1Q3XA 2BQWA 5JPMG 2NPRA 5L2YL 2WIIC 1IXXA 4ZETA 3F6UL 3DBZA 4GU4A 4AYMA 3SW0X 1BF9A 3P5HA 4G1MB 4F4OC 2KNIA 1R14A 3IKRA 1SRZA 4TGFA 5IKVA 4APLA 1KZC1 4K12A 4M17A 5KTIA 4N32A 3POYA 4FM5A 1YPUA 1IQLL 2J4IB 4M11A 2YRAA 1K9IA 1V4LA 1LK9A 1JA3A 2Y5HL 1QDDA 1X2WB 2OX9A 1KZB1 1HCGB 3QH0A 4JZEL 1HFIA 2MCZA 1RDK1 3LC3B 1WT9A 1YPOA 2XC0L 1YTTA 2Y8RA 1CKLA 2RIEA 1H2QP 2VRPB 3KQBL 2FLRL 2XBVL 3OLUA 4WQQA 1IJQA 1X7AL 1UMRA 2BOUA 1N7DA 4KZVA 4A94C 2MGRA 1FE2A 1L5GB 3G8KA 1V3XB 5EGMB 2JKHL 1FBRA 1OZ7A 1U0OA 5FFTA 4E52A 1WU1B 1RLHA 2KV3A 1KCGA 1X2TB 4JZDL 1Z6CA 1CQEA 4O02B 1IQJL 3BX4B 1RFNB 1YXKA 5JBCE 4KZWA 1NFUB 4QKJA 1V1IA 3GPRB 4WJG2 2BT8A 3LC5B 2WYGB 1QUBA 1MQ6L 4QKGA 2ORJA 1E8IA 4N38A 3WHDA 3FF7C 4YIZA 4B2RA 3LTFB 2VUZA 1NT0A 1XARA 3OLTA 4ZHAB 2KMSA 1AFA1 4E1GA 1Y17A 2W80A 3HUPA 2FLBL 4MMZB 2DDUA 3NFPI 3CADA 2P3FL 2C6UA 4J6JA 2E3XC 1IGXA 1MOXC 2VVCK 2CKUA 3WH3A 3PGHA 1IODA 5IKRA 2Y8SA 2J94B 3OEDC 3LN0A 1JWIB 2MSBA 6COXA 1DVAL 2W3KB 4BTIA 1M1XB 4M10A 1APQA 2G7IA 2Y5GL 2KV4A 2HORA 1HAFA 2W2PE 5B1RA 1QIUA 3K7BA 1BNLA 1FAXL 4CUDA 4D0EA 1H2PP 4ISHL 1F00I 4FXGG 2H2TB 1PTHA 3NTBA 3VYKA 1W8BL 4BXWA 3L89M 1DY0A 2J38B 1DY2A 2VWNL 1FM5A 1HTNA 4ONTD 4PDCA 2P95L 3K3TA 3ZHGA 2WPHE 1XDTR 1O5DL 3CA7A 1YUGA 1UZQA 4C16A 2I2LA 2V8EA 1EQGA 1XFEA 2O39C 2MTIA 3R05A 5JBBE 2WPJE 1GKNA 3NCXA 4J6KA 4BXSA 2VRPA 4J6QA 2OYEP 3VYJA 1IQKL 2WPLE 5K0HB 1LQDA 1RDN1 5JB9E 2VWMK 4RRYA 4Y76B 4UXMA 4ZAEB 1GPZA 5JBAE 2Q1JB 1SL4A 3T3AA 5DN5A 1KWUA 4WUXA 3RS1A 2VWLL 3HO5A 3N8WA 4Z0LA 1OK1A 3KXVA 4YT6L 3P7GA 1IXXB 1C3AA 1YO8A 1IOEL 4CAJA 1SS2A 4MUCA 1TLGA 3P7HA 1BCH1 2XBYL 2BRSA 3HPTA 1MD8A 3ERBA 1BV4A 2YGQA 4RRWA 1V1HA 1HJ7A 1NFYB 2IT6A 2RIAA 4WRFA 1UKMB 2WFTA 2AFPA 1IQML 1EPIA 1B9WA 1ATAA 1DQBA 3WWKA 3CALA 1DV8A 2PHBB 1WT9B 5L30L 2JGXA 2RHPA 2W2QE 4PZ5A 1IP0A 2P26A 1KMB1 4QKIA 4XBMA 3G81A 3ZHGD 1HREA 1Z6EL 1GKGA 1OZ7B 1U0OB 4BDWA 3CDGE 1HUPA 3WSRA 1ADXA 1IVOC 1QGBA 2P28B 1HYRA 1WMYA 1LMMA 2RL0A 4YZUB 3EJHA 4JYUL 1QO6A 3ENSA 1PW9A 1WMZA 4YLIA 3MQLA 1RDM1 2WFXB 3SOVA 1APOA 3L9JC 2FZZL 1URKA 3U73A 1UZPA 4X8TL 4WUWA 4NGAL 3IKPA 3HS7A 1KZD1 1GZ2A 1U8CB 2BOHA 2VVVL 1AUTL 1YGCL 1Y17B 5FFRA 2OYUP 3UBUA 1LPGA 1LPZA 1IJKB 4GI0A 3KQDL 3N8YB 1FVUA 1DIYA 2ORKA 1U0NB 3HO4A 2RLPA 3FGRA 1BYFA 1LITA 4N34A 1IOXA 4D0FA 2H9EC 1CEJA 1IODB 1O7CT 4BTUA 2W81A 3G84A 1FJSL 4WREA 2WZPP 4IOPB 5B1WA 2XBXL 4B2SA 1FF7A 1EGFA 1TOZA 1KKEA 2JRAA 2M94A 1CCVA 3ZLDA 4ZESA 2RKZA 4AYDA 1UOSA 4ZH8B 4PH9A 1H04P 2BQ6A 2Y38A 1PXXA 3GISX 2KRIA 1PGEA 5CISA 4BWCA 2BZMA 1CWVA 2XR5A 3ASIA 4J38B 2VH0B 1TPMA 5FO8C 1HX2A 1G4GA 1KWXA 2CJIB 2W2ME 1KX1A 1DX5I 1K36A 4J6LA 1F02I 2OS9A 1MQ5L 1OK9A 2BQ7A 4N33A 3PBFA 1HCCA 5CKNA 4LOTA 1ATBA 1IQNL 1SB2A 4D90A 2ZQKA 1PRHA 3PAKA 1KOEA 2TGFA 1WHEA 5HYUB 1EMNA 3SOQA 3ZYJB 4MSLA 5HYPA 2BPDA 2XWBF 5HZPB 1NPEB 2P93L 2BPEA 2MCYA 1NFWB 2W86A 4XL1A 1BJ3A 2H2RA 3VLGA 4LOSA 5JVZA 3NJPC 2IZ3A 3MDLA 3P5GA 2Y7ZB 1JZNA 3LN1A 3FFGL 3WSYA 4CUFA 1OJYA 1AFD1 2ZWKA 4LMFA 1KX0A 2UWOB 4WCOA 2I9BA 3QCWA 3GOVA 3Q3KB 1AFB1
chains in the Genus database with same CATH topology
1ZAQA 3N8WB 1B08A 3KMB1 3R62A 2ERJA 2RLQA 1K37A 1UEXA 2N40A 1C3AB 2P16L 4RRZA 4BDXA 1WHFA 4LQFA 3LIWB 5KIRA 2OX8A 4JZFL 3WBPA 1NFXB 3NT1A 1IJKC 3ZRZA 1HZ8A 2XWJI 2XR6A 5K8YA 1CCFA 3P5DA 4PP8A 2EI8B 1SZBA 4YNXA 3N8VA 2RIDA 3H5CB 2GGUA 2CL8A 3ALUA 3WWKB 2WPKE 4A7IA 3GPRC 4ZXYL 3G83A 2RICA 3MQEA 2Y80B 4RUTA 3PAQA 4MTHA 2BPHA 4S0UA 3KQEL 2GO0A 2YGPA 3IJEB 1G1RA 3LTGD 4Z0KB 2ADXA 2YGOA 5FFSA 3V65B 1FFMA 2Y7XB 4ZXXL 2JGWA 1IQFL 3ELAL 3SOBB 1RDL1 4JHSA 5F2QA 2W2OE 3CS7L 2PUQL 1F0RB 3V64C 2XRDA 2M74A 1G1QA 3NTGA 4J6PA 2XC4L 4LORA 4CUEA 1YUFA 4YMDA 3G8LA 3KCGL 1U67A 3WBRA 1IQIL 2UWLB 1ZJKA 2BOXA 3FCSB 1UZKA 2Y81B 1GK5A 3F1SB 1ESLA 3TK6B 4GKOG 1YUKB 1V4LB 1E88A 2B7DL 1E8BA 2RKYA 1B6EA 1G1SA 3P5EA 4UWWA 2B5ID 3FD4A 1F7MA 3UBUB 1QO3C 1LMJA 1HAEA 1EGIA 4AYEA 1IGZA 1FVUB 2PF5A 2EI6B 5B1XA 1EZQB 1QFKL 3HS6A 2WG4B 3BT1A 4JYVL 4Y7AB 4IGDA 4GJXA 5F1AA 4XLWA 1ATEA 3K9XA 1EAIC 2A55A 2VJ3A 4Y7BB 1GHQB 2EHFA 1R13A 4J6MA 1UV0A 4EZMG 1PFXL 4MMYB 4X8VL 2IT5A 3OXUD 1KSNB 1I0UA 4Y71B 2IZ4A 5COXA 2RNLA 4COXA 3U7UG 4WR9A 1KWYA 3ZD2A 1SL6A 1KWZA 2YHFA 3Q7DA 3HS5A 5LGKE 1O9AA 1E5GA 3BDWA 1RDI1 1OJVA 4KI1E 5HYTB 3NCWA 2XC5L 1J35A 3QMOA 1KWVA 1IQEL 1OK3A 3WBQA 4GJ0A 2I83A 2FD6A 5IKQA 3FF9A 1Q4GA 2MGPA 2D1JB 2F9BL 1SB2B 1K9JA 1XKBA 2E3XB 1H8UA 4O1ZA 1VVDA 2BOKL 3N8XA 1P9JA 3KL6B 3BPSE 1L3YA 2GGXA 3M9ZA 2W3IB 4KMB1 1G2MB 3ALTA 3M36L 1U5MA 1BJ3B 1BUUA 1V7PA 1F0SB 5E8DA 3SW2A 1MUQA 1IQHL 1J34A 5M62A 3O8EB 2VVUL 4X8SL 1UKMA 1IQGL 1HFHA 1KZA1 2EC3A 4N37A 1MPUA 4M18A 2XRBA 5CKMA 4G9AA 1PPQA 1UEXB 3PARA 1UZJA 2PY2A 3S6XA 1UMRC 2I9AA 1NQLB 1UOTP 1E87A 3EGFA 1DDXA 1KLOA 2Y82B 1TPGA 3CENL 5JVYA 1EGGA 5I0QB 1DY1A 4LU5A 4ZRWA 2EI7B 1MD7A 1EBVA 2FLGA 1ATDA 4ISIL 2LS8A 4N35A 2VUVA 5J6GG 4KKDA 1EPGA 3KK6A 3C8KD 3IKQA 2K2TA 4GK1A 2P3TA 1XKAL 2BMGA 2CG7A 3IU3I 1KZE1 1P0SL 1H03P 2VH6B 2YBYA 1FIFA 3ZYIB 4NG9L 3P5IA 1CVWL 4YT7L 1LPKA 5KTHA 1F7EA 1ELVA 1G2LB 5JW1A 2CG6A 1X2WA 1OJWA 1NZIA 3P7FA 1LY2A 3RJ3D 3TBDA 1G4FA 5L2ZL 1FAKL 3DEMA 1TPNA 4RRXA 3HO3A 2WPIE 3N8YA 1EPJA 2UWPB 2WPME 4MMXB 2XBWL 2AYLA 3GCWE 2J2UB 1CVUA 1U0NC 2J34B 1JV2B 3M7PA 3C8JA 2P3FN 4C9FA 3INBC 4OTJA 4AYIA 2W2NE 2P94L 1EMOA 4IOPA 4DJZA 5I46L 1EPHA 1X2TA 5F19A 2MHPA 3M37L 5IKTA 2ZIBA 3BX4A 3CCKA 3FBYA 3FF8C 1VVCA 4G96A 1KLJL 3TZIA 3GPRA 2WG3C 3IITB 4A5WB 4Y79B 1T8CA 3VPPA 4ZRVA 5JB8E 1WK1A 1JL9A 1W7XL 1YPQA 1C5MF 2UWNA 4RS0A 1N1IA 1RTM1 3BT2A 3KZJA 4OTYA 1J9CL 2P3UA 2W26B 3TK5B 2VWOL 4CSYA 3KQCL 2WYJB 1PWBA 3ZYGA 3GCXE 2RA0L 4BTTA 1KIGL 1OK2A 4ZH1D 3C9AC 1KLIL 2GD4A 1A3PA 2XQWC 1KWTA 2BZ6L 3LAQA 4J6NA 1TDQB 1T8DA 2PR3B 5CKQA 3T5OA 1O7BT 1OB1C 1JWIA 3WH2A 2KL7A 1P4LD 1SL5A 3BDWB 1P1ZD 1HRFA 1MSBA 1YXJA 1CX2A 1C1ZA 3N8ZA 1J35B 3TGFA 3CDGF 4WRCA 4X8UL 4Y6DB 4QKHA 2RIBA 1BCJ1 1HT5A 4NA9L 3ALSA 3P5BL 1NWVA 3C22A 1COUA 1TN3A 1FIHA 1JBUL 2J95B 3CFWA 1HQ8A 4N36A 3RR3A 2Y5FL 1RDO1 2KMB1 4Z6AL 3KRKA 3IX0A 2QY0A 1Z92B 2LOJA 1V7PB 2KB9A 1FSBA 3ZD1A 5KN5C 2BO2A 1J34B 5FDQA 1UOSB 4DN8A 1KG0C 1EQHA 4M1GA 1KWWA 2H9EL 3TVJA 3WWKC 4AQTA 1G1TA 2G00L 4AK8A 3GPRD 1RDJ1 2K2SB 1RJHA 3KQGA 3IKNA 1E5UI 1HT8A 3GXEA 1XPHA 3P5FA 1TLEA 3TH3L 3OP8A 1Q3XA 2BQWA 5JPMG 2NPRA 5L2YL 2WIIC 1IXXA 4ZETA 3F6UL 3DBZA 4AYMA 3SW0X 1BF9A 3P5HA 4G1MB 4F4OC 2KNIA 1R14A 3IKRA 1SRZA 4TGFA 5IKVA 1KZC1 4K12A 4M17A 5KTIA 4N32A 3POYA 4FM5A 1YPUA 1IQLL 2J4IB 4M11A 2YRAA 1K9IA 1V4LA 1JA3A 1X2WB 2Y5HL 1QDDA 2OX9A 1KZB1 1HCGB 3QH0A 4JZEL 1HFIA 2MCZA 1RDK1 3LC3B 1WT9A 1YPOA 2XC0L 1YTTA 2RIEA 1CKLA 2VRPB 1H2QP 3KQBL 2FLRL 2XBVL 3OLUA 4WQQA 1IJQA 1X7AL 1UMRA 2BOUA 1N7DA 4KZVA 4A94C 2MGRA 1FE2A 1L5GB 3G8KA 1V3XB 5EGMB 2JKHL 1FBRA 1OZ7A 1U0OA 5FFTA 4E52A 1WU1B 2KV3A 1KCGA 1X2TB 4JZDL 1Z6CA 1CQEA 4O02B 1IQJL 3BX4B 1RFNB 1YXKA 5JBCE 4KZWA 1NFUB 4QKJA 3GPRB 4WJG2 3LC5B 2WYGB 1QUBA 1MQ6L 4QKGA 2ORJA 1E8IA 4N38A 3WHDA 3FF7C 4B2RA 3LTFB 2VUZA 1NT0A 1XARA 3OLTA 4ZHAB 2KMSA 1AFA1 4E1GA 1Y17A 2W80A 3HUPA 2FLBL 4MMZB 2DDUA 3NFPI 3CADA 2P3FL 2C6UA 4J6JA 2E3XC 1IGXA 1MOXC 2VVCK 2CKUA 3WH3A 3PGHA 1IODA 5IKRA 3OEDC 2J94B 3LN0A 1JWIB 2MSBA 6COXA 1DVAL 2W3KB 4BTIA 1M1XB 4M10A 1APQA 2G7IA 2Y5GL 2KV4A 2W2PE 1HAFA 5B1RA 3K7BA 1BNLA 1FAXL 4CUDA 4D0EA 1H2PP 4ISHL 1F00I 4FXGG 2H2TB 1PTHA 3NTBA 3VYKA 1W8BL 4BXWA 3L89M 1DY0A 2J38B 1DY2A 2VWNL 1FM5A 1HTNA 4ONTD 4PDCA 2P95L 3ZHGA 2WPHE 1XDTR 1O5DL 3CA7A 1YUGA 1UZQA 4C16A 2V8EA 1EQGA 1XFEA 2O39C 2MTIA 3R05A 5JBBE 2WPJE 1GKNA 3NCXA 4J6KA 4BXSA 2VRPA 4J6QA 2OYEP 3VYJA 1IQKL 2WPLE 5K0HB 1LQDA 1RDN1 5JB9E 2VWMK 4RRYA 4Y76B 4UXMA 4ZAEB 1GPZA 5JBAE 2Q1JB 1SL4A 3T3AA 1KWUA 4WUXA 3RS1A 2VWLL 3HO5A 3N8WA 4Z0LA 1OK1A 3KXVA 4YT6L 3P7GA 1IXXB 1C3AA 1YO8A 1IOEL 4CAJA 1SS2A 4MUCA 1TLGA 3P7HA 1BCH1 2XBYL 2BRSA 3HPTA 1MD8A 3ERBA 1BV4A 2YGQA 4RRWA 1HJ7A 1NFYB 2IT6A 2RIAA 4WRFA 1UKMB 2WFTA 2AFPA 1IQML 1EPIA 1B9WA 1ATAA 1DQBA 3WWKA 3CALA 1DV8A 2PHBB 1WT9B 5L30L 2JGXA 2RHPA 2W2QE 4PZ5A 1IP0A 2P26A 1KMB1 4QKIA 4XBMA 3G81A 3ZHGD 1HREA 1Z6EL 1GKGA 1OZ7B 1U0OB 4BDWA 3CDGE 1HUPA 3WSRA 1ADXA 1IVOC 1QGBA 2P28B 1HYRA 1WMYA 1LMMA 2RL0A 4YZUB 3EJHA 4JYUL 1QO6A 3ENSA 1PW9A 1WMZA 4YLIA 3MQLA 1RDM1 2WFXB 3SOVA 1APOA 3L9JC 2FZZL 1URKA 3U73A 1UZPA 4X8TL 4WUWA 4NGAL 3IKPA 3HS7A 1KZD1 1GZ2A 1U8CB 2BOHA 2VVVL 1AUTL 1YGCL 1Y17B 5FFRA 2OYUP 3UBUA 1LPGA 1LPZA 1IJKB 4GI0A 3KQDL 3N8YB 1FVUA 1DIYA 2ORKA 1U0NB 3HO4A 2RLPA 1BYFA 1LITA 4N34A 1IOXA 4D0FA 2H9EC 1CEJA 1IODB 1O7CT 4BTUA 2W81A 3G84A 1FJSL 4WREA 2WZPP 4IOPB 5B1WA 2XBXL 4B2SA 1FF7A 1EGFA 1TOZA 2JRAA 2M94A 1CCVA 4ZESA 2RKZA 4AYDA 1UOSA 4ZH8B 4PH9A 1H04P 2BQ6A 2Y38A 1PXXA 3GISX 2KRIA 1PGEA 5CISA 1CWVA 2BZMA 2XR5A 3ASIA 4J38B 2VH0B 1TPMA 5FO8C 1HX2A 1G4GA 1KWXA 2CJIB 2W2ME 1KX1A 1DX5I 1K36A 4J6LA 1F02I 2OS9A 1MQ5L 1OK9A 2BQ7A 4N33A 3PBFA 1HCCA 5CKNA 4LOTA 1ATBA 1IQNL 1SB2A 4D90A 2ZQKA 1PRHA 3PAKA 1KOEA 2TGFA 1WHEA 5HYUB 1EMNA 3SOQA 3ZYJB 5HYPA 2BPDA 2XWBF 5HZPB 1NPEB 2P93L 2BPEA 2MCYA 1NFWB 2W86A 4XL1A 1BJ3A 2H2RA 3VLGA 4LOSA 5JVZA 3NJPC 2IZ3A 3MDLA 3P5GA 2Y7ZB 1JZNA 3LN1A 3FFGL 4CUFA 1OJYA 1AFD1 2ZWKA 4LMFA 1KX0A 2UWOB 4WCOA 2I9BA 3QCWA 3GOVA 3Q3KB 1AFB1
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZAQ A;  3N8W B;  1B08 A;  3KMB 1;  3R62 A;  2ERJ A;  2RLQ A;  1K37 A;  1UEX A;  2N40 A;  1C3A B;  2P16 L;  4RRZ A;  4BDX A;  1WHF A;  4LQF A;  3LIW B;  5KIR A;  2OX8 A;  4JZF L;  3WBP A;  1NFX B;  3NT1 A;  1IJK C;  3ZRZ A;  1HZ8 A;  2XWJ I;  2XR6 A;  5K8Y A;  1CCF A;  3P5D A;  4PP8 A;  2EI8 B;  1SZB A;  4YNX A;  3N8V A;  2RID A;  3H5C B;  2GGU A;  2CL8 A;  3ALU A;  3WWK B;  2WPK E;  4A7I A;  3GPR C;  4ZXY L;  3G83 A;  2RIC A;  3MQE A;  2Y80 B;  4RUT A;  3PAQ A;  4MTH A;  2BPH A;  4S0U A;  3KQE L;  2GO0 A;  2YGP A;  3IJE B;  1G1R A;  3LTG D;  4Z0K B;  2ADX A;  2YGO A;  5FFS A;  3V65 B;  1FFM A;  2Y7X B;  4ZXX L;  2JGW A;  1IQF L;  3ELA L;  3SOB B;  1RDL 1;  4JHS A;  5F2Q A;  2W2O E;  3CS7 L;  2PUQ L;  1F0R B;  3V64 C;  2XRD A;  2M74 A;  1G1Q A;  3NTG A;  4J6P A;  2XC4 L;  4LOR A;  4CUE A;  1YUF A;  4YMD A;  3G8L A;  3KCG L;  1U67 A;  3WBR A;  1IQI L;  2UWL B;  1ZJK A;  2BOX A;  3FCS B;  1UZK A;  2Y81 B;  1GK5 A;  3F1S B;  1ESL A;  3TK6 B;  4GKO G;  1YUK B;  1V4L B;  1E88 A;  2B7D L;  1E8B A;  2RKY A;  1B6E A;  1G1S A;  3P5E A;  4UWW A;  2B5I D;  3FD4 A;  1F7M A;  3UBU B;  1QO3 C;  1LMJ A;  1HAE A;  1EGI A;  4AYE A;  1IGZ A;  1FVU B;  2PF5 A;  2EI6 B;  5B1X A;  1EZQ B;  1QFK L;  3HS6 A;  2WG4 B;  3BT1 A;  4JYV L;  4Y7A B;  4IGD A;  4GJX A;  5F1A A;  4XLW A;  1ATE A;  3K9X A;  1EAI C;  2A55 A;  2VJ3 A;  4Y7B B;  1GHQ B;  2EHF A;  1R13 A;  4J6M A;  1UV0 A;  4EZM G;  1PFX L;  4MMY B;  4X8V L;  2IT5 A;  3OXU D;  1KSN B;  1I0U A;  4Y71 B;  2IZ4 A;  5COX A;  2RNL A;  4COX A;  3U7U G;  4WR9 A;  1KWY A;  3ZD2 A;  1SL6 A;  1KWZ A;  2YHF A;  3Q7D A;  3HS5 A;  5LGK E;  1O9A A;  1E5G A;  3BDW A;  1RDI 1;  1OJV A;  4KI1 E;  5HYT B;  3NCW A;  2XC5 L;  1J35 A;  3QMO A;  1KWV A;  1IQE L;  1OK3 A;  3WBQ A;  4GJ0 A;  2I83 A;  2FD6 A;  5IKQ A;  3FF9 A;  1Q4G A;  2MGP A;  2D1J B;  2F9B L;  1SB2 B;  1K9J A;  1XKB A;  2E3X B;  1H8U A;  4O1Z A;  1VVD A;  2BOK L;  3N8X A;  1P9J A;  3KL6 B;  3BPS E;  1L3Y A;  2GGX A;  3M9Z A;  2W3I B;  4KMB 1;  1G2M B;  3ALT A;  3M36 L;  1U5M A;  1BJ3 B;  1BUU A;  1V7P A;  1F0S B;  5E8D A;  3SW2 A;  1MUQ A;  1IQH L;  1J34 A;  5M62 A;  3O8E B;  2VVU L;  4X8S L;  1UKM A;  1IQG L;  1HFH A;  1KZA 1;  2EC3 A;  4N37 A;  1MPU A;  4M18 A;  2XRB A;  5CKM A;  4G9A A;  1PPQ A;  1UEX B;  3PAR A;  1UZJ A;  2PY2 A;  1UMR C;  2I9A A;  1NQL B;  1UOT P;  1E87 A;  3EGF A;  1DDX A;  1KLO A;  2Y82 B;  1TPG A;  3CEN L;  5JVY A;  1EGG A;  5I0Q B;  1DY1 A;  4LU5 A;  4ZRW A;  2EI7 B;  1MD7 A;  1EBV A;  2FLG A;  1ATD A;  4ISI L;  2LS8 A;  4N35 A;  2VUV A;  5J6G G;  4KKD A;  1EPG A;  3KK6 A;  3C8K D;  3IKQ A;  2K2T A;  4GK1 A;  2P3T A;  1XKA L;  2BMG A;  2CG7 A;  3IU3 I;  1KZE 1;  1P0S L;  1H03 P;  2VH6 B;  2YBY A;  1FIF A;  3ZYI B;  4NG9 L;  3P5I A;  1CVW L;  4YT7 L;  1LPK A;  5KTH A;  1F7E A;  1ELV A;  1G2L B;  5JW1 A;  2CG6 A;  1X2W A;  1OJW A;  1NZI A;  3P7F A;  1LY2 A;  3RJ3 D;  3TBD A;  1G4F A;  5L2Z L;  1FAK L;  3DEM A;  1TPN A;  4RRX A;  3HO3 A;  2WPI E;  3N8Y A;  1EPJ A;  2UWP B;  2WPM E;  4MMX B;  2XBW L;  2AYL A;  3GCW E;  2J2U B;  1CVU A;  1U0N C;  2J34 B;  1JV2 B;  3M7P A;  3C8J A;  2P3F N;  4C9F A;  3INB C;  4OTJ A;  4AYI A;  2W2N E;  2P94 L;  1EMO A;  4IOP A;  4DJZ A;  5I46 L;  1EPH A;  1X2T A;  5F19 A;  2MHP A;  3M37 L;  5IKT A;  2ZIB A;  3BX4 A;  3CCK A;  3FBY A;  3FF8 C;  1VVC A;  4G96 A;  1KLJ L;  3TZI A;  3GPR A;  2WG3 C;  3IIT B;  4A5W B;  4Y79 B;  1T8C A;  3VPP A;  4ZRV A;  5JB8 E;  1WK1 A;  1JL9 A;  1W7X L;  1YPQ A;  1C5M F;  2UWN A;  4RS0 A;  1N1I A;  1RTM 1;  3BT2 A;  3KZJ A;  4OTY A;  1J9C L;  2P3U A;  2W26 B;  3TK5 B;  2VWO L;  4CSY A;  3KQC L;  2WYJ B;  1PWB A;  3ZYG A;  3GCX E;  2RA0 L;  4BTT A;  1KIG L;  1OK2 A;  4ZH1 D;  3C9A C;  1KLI L;  2GD4 A;  1A3P A;  2XQW C;  1KWT A;  2BZ6 L;  3LAQ A;  4J6N A;  1TDQ B;  1T8D A;  2PR3 B;  5CKQ A;  3T5O A;  1O7B T;  1OB1 C;  1JWI A;  3WH2 A;  2KL7 A;  1P4L D;  1SL5 A;  3BDW B;  1P1Z D;  1HRF A;  1MSB A;  1YXJ A;  1CX2 A;  1C1Z A;  3N8Z A;  1J35 B;  3TGF A;  3CDG F;  4WRC A;  4X8U L;  4Y6D B;  4QKH A;  2RIB A;  1BCJ 1;  1HT5 A;  4NA9 L;  3ALS A;  3P5B L;  1NWV A;  3C22 A;  1COU A;  1TN3 A;  1FIH A;  1JBU L;  2J95 B;  3CFW A;  1HQ8 A;  4N36 A;  3RR3 A;  2Y5F L;  1RDO 1;  2KMB 1;  4Z6A L;  3KRK A;  3IX0 A;  2QY0 A;  1Z92 B;  2LOJ A;  1V7P B;  2KB9 A;  1FSB A;  3ZD1 A;  5KN5 C;  2BO2 A;  1J34 B;  5FDQ A;  1UOS B;  4DN8 A;  1KG0 C;  1EQH A;  4M1G A;  1KWW A;  2H9E L;  3TVJ A;  3WWK C;  4AQT A;  1G1T A;  2G00 L;  4AK8 A;  3GPR D;  1RDJ 1;  2K2S B;  1RJH A;  3KQG A;  3IKN A;  1E5U I;  1HT8 A;  3GXE A;  1XPH A;  3P5F A;  1TLE A;  3TH3 L;  3OP8 A;  1Q3X A;  2BQW A;  5JPM G;  2NPR A;  5L2Y L;  2WII C;  1IXX A;  4ZET A;  3F6U L;  3DBZ A;  4AYM A;  3SW0 X;  1BF9 A;  3P5H A;  4G1M B;  4F4O C;  1R14 A;  3IKR A;  1SRZ A;  4TGF A;  5IKV A;  1KZC 1;  4K12 A;  4M17 A;  5KTI A;  4N32 A;  3POY A;  4FM5 A;  1YPU A;  1IQL L;  2J4I B;  4M11 A;  2YRA A;  1K9I A;  1V4L A;  1JA3 A;  1X2W B;  2Y5H L;  1QDD A;  2OX9 A;  1KZB 1;  1HCG B;  3QH0 A;  4JZE L;  1HFI A;  2MCZ A;  1RDK 1;  3LC3 B;  1WT9 A;  1YPO A;  2XC0 L;  1YTT A;  2RIE A;  1CKL A;  2VRP B;  1H2Q P;  3KQB L;  2FLR L;  2XBV L;  3OLU A;  4WQQ A;  1IJQ A;  1X7A L;  1UMR A;  2BOU A;  1N7D A;  4KZV A;  2MGR A;  1FE2 A;  1L5G B;  3G8K A;  1V3X B;  5EGM B;  2JKH L;  1FBR A;  1OZ7 A;  1U0O A;  5FFT A;  4E52 A;  1WU1 B;  2KV3 A;  1KCG A;  1X2T B;  4JZD L;  1Z6C A;  1CQE A;  4O02 B;  1IQJ L;  3BX4 B;  1RFN B;  1YXK A;  5JBC E;  4KZW A;  1NFU B;  4QKJ A;  3GPR B;  4WJG 2;  3LC5 B;  2WYG B;  1QUB A;  1MQ6 L;  4QKG A;  2ORJ A;  1E8I A;  4N38 A;  3WHD A;  3FF7 C;  4B2R A;  3LTF B;  2VUZ A;  1NT0 A;  1XAR A;  3OLT A;  4ZHA B;  2KMS A;  1AFA 1;  4E1G A;  1Y17 A;  2W80 A;  3HUP A;  2FLB L;  4MMZ B;  2DDU A;  3NFP I;  3CAD A;  2P3F L;  2C6U A;  4J6J A;  2E3X C;  1IGX A;  1MOX C;  2VVC K;  2CKU A;  3WH3 A;  3PGH A;  1IOD A;  5IKR A;  3OED C;  2J94 B;  3LN0 A;  1JWI B;  2MSB A;  6COX A;  1DVA L;  2W3K B;  4BTI A;  1M1X B;  4M10 A;  1APQ A;  2G7I A;  2Y5G L;  2KV4 A;  2W2P E;  1HAF A;  5B1R A;  3K7B A;  1BNL A;  1FAX L;  4CUD A;  4D0E A;  1H2P P;  4ISH L;  1F00 I;  4FXG G;  2H2T B;  1PTH A;  3NTB A;  3VYK A;  1W8B L;  4BXW A;  3L89 M;  1DY0 A;  2J38 B;  1DY2 A;  2VWN L;  1FM5 A;  1HTN A;  4ONT D;  4PDC A;  2P95 L;  3ZHG A;  2WPH E;  1XDT R;  1O5D L;  3CA7 A;  1YUG A;  1UZQ A;  4C16 A;  2V8E A;  1EQG A;  1XFE A;  2O39 C;  2MTI A;  3R05 A;  5JBB E;  2WPJ E;  1GKN A;  3NCX A;  4J6K A;  4BXS A;  2VRP A;  4J6Q A;  2OYE P;  3VYJ A;  1IQK L;  2WPL E;  5K0H B;  1LQD A;  1RDN 1;  5JB9 E;  2VWM K;  4RRY A;  4Y76 B;  4UXM A;  4ZAE B;  1GPZ A;  5JBA E;  2Q1J B;  1SL4 A;  3T3A A;  1KWU A;  4WUX A;  3RS1 A;  2VWL L;  3HO5 A;  3N8W A;  4Z0L A;  1OK1 A;  3KXV A;  4YT6 L;  3P7G A;  1IXX B;  1C3A A;  1YO8 A;  1IOE L;  4CAJ A;  1SS2 A;  4MUC A;  1TLG A;  3P7H A;  1BCH 1;  2XBY L;  2BRS A;  3HPT A;  1MD8 A;  3ERB A;  1BV4 A;  4RRW A;  1HJ7 A;  1NFY B;  2IT6 A;  2RIA A;  4WRF A;  1UKM B;  2WFT A;  2AFP A;  1IQM L;  1EPI A;  1B9W A;  1ATA A;  1DQB A;  3WWK A;  3CAL A;  1DV8 A;  2PHB B;  1WT9 B;  5L30 L;  2JGX A;  2RHP A;  2W2Q E;  4PZ5 A;  1IP0 A;  2P26 A;  1KMB 1;  4QKI A;  4XBM A;  3G81 A;  3ZHG D;  1HRE A;  1Z6E L;  1GKG A;  1OZ7 B;  1U0O B;  4BDW A;  3CDG E;  1HUP A;  3WSR A;  1ADX A;  1IVO C;  1QGB A;  2P28 B;  1HYR A;  1WMY A;  2RL0 A;  4YZU B;  3EJH A;  4JYU L;  1QO6 A;  3ENS A;  1PW9 A;  1WMZ A;  4YLI A;  3MQL A;  1RDM 1;  2WFX B;  3SOV A;  1APO A;  3L9J C;  2FZZ L;  1URK A;  3U73 A;  1UZP A;  4X8T L;  4WUW A;  4NGA L;  3IKP A;  3HS7 A;  1KZD 1;  1GZ2 A;  1U8C B;  2BOH A;  2VVV L;  1AUT L;  1YGC L;  1Y17 B;  5FFR A;  2OYU P;  3UBU A;  1LPG A;  1LPZ A;  1IJK B;  4GI0 A;  3KQD L;  3N8Y B;  1FVU A;  1DIY A;  2ORK A;  1U0N B;  3HO4 A;  2RLP A;  1BYF A;  1LIT A;  4N34 A;  1IOX A;  4D0F A;  1IOD B;  1CEJ A;  1O7C T;  4BTU A;  2W81 A;  3G84 A;  1FJS L;  4WRE A;  4IOP B;  5B1W A;  2XBX L;  4B2S A;  1FF7 A;  1EGF A;  1TOZ A;  2JRA A;  2M94 A;  1CCV A;  4ZES A;  2RKZ A;  4AYD A;  1UOS A;  4ZH8 B;  4PH9 A;  1H04 P;  2BQ6 A;  2Y38 A;  1PXX A;  3GIS X;  2KRI A;  1PGE A;  5CIS A;  1CWV A;  2BZM A;  2XR5 A;  3ASI A;  4J38 B;  2VH0 B;  1TPM A;  5FO8 C;  1HX2 A;  1G4G A;  1KWX A;  2CJI B;  2W2M E;  1KX1 A;  1DX5 I;  1K36 A;  4J6L A;  1F02 I;  2OS9 A;  1MQ5 L;  1OK9 A;  2BQ7 A;  4N33 A;  3PBF A;  1HCC A;  5CKN A;  4LOT A;  1ATB A;  1IQN L;  1SB2 A;  4D90 A;  2ZQK A;  1PRH A;  3PAK A;  1KOE A;  2TGF A;  1WHE A;  5HYU B;  1EMN A;  3SOQ A;  3ZYJ B;  5HYP A;  2BPD A;  2XWB F;  5HZP B;  1NPE B;  2P93 L;  2BPE A;  2MCY A;  1NFW B;  2W86 A;  4XL1 A;  1BJ3 A;  2H2R A;  3VLG A;  4LOS A;  5JVZ A;  3NJP C;  2IZ3 A;  3MDL A;  3P5G A;  2Y7Z B;  1JZN A;  3LN1 A;  3FFG L;  4CUF A;  1OJY A;  1AFD 1;  2ZWK A;  4LMF A;  1KX0 A;  2UWO B;  4WCO A;  2I9B A;  3QCW A;  3GOV A;  3Q3K B;  1AFB 1; 
#chains in the Genus database with same CATH topology
 1ZAQ A;  3N8W B;  1B08 A;  3KMB 1;  3R62 A;  2ERJ A;  2RLQ A;  1K37 A;  1UEX A;  2N40 A;  1C3A B;  2P16 L;  4RRZ A;  4BDX A;  1WHF A;  4LQF A;  3LIW B;  5KIR A;  2OX8 A;  4JZF L;  3WBP A;  1NFX B;  3NT1 A;  1IJK C;  3ZRZ A;  1HZ8 A;  2XWJ I;  2XR6 A;  5K8Y A;  1CCF A;  5DN4 A;  3P5D A;  4PP8 A;  2EI8 B;  1SZB A;  4YNX A;  3N8V A;  2RID A;  3H5C B;  2GGU A;  2CL8 A;  3ALU A;  3WWK B;  2WPK E;  4A7I A;  3GPR C;  4ZXY L;  3G83 A;  2RIC A;  3MQE A;  2Y80 B;  4RUT A;  3PAQ A;  4MTH A;  2BPH A;  4S0U A;  3KQE L;  2GO0 A;  2YGP A;  3IJE B;  1G1R A;  3LTG D;  4Z0K B;  2ADX A;  2YGO A;  5FFS A;  3WSX A;  3V65 B;  1FFM A;  2Y7X B;  4ZXX L;  2JGW A;  1IQF L;  3ELA L;  3SOB B;  1RDL 1;  4JHS A;  5F2Q A;  2W2O E;  3F6K A;  3CS7 L;  2PUQ L;  1F0R B;  3V64 C;  2XRD A;  2M74 A;  1G1Q A;  3NTG A;  4J6P A;  2XC4 L;  4LOR A;  4CUE A;  1YUF A;  4YMD A;  3G8L A;  3KCG L;  1U67 A;  3WBR A;  1IQI L;  2UWL B;  1ZJK A;  2BOX A;  3FCS B;  1UZK A;  2Y81 B;  1GK5 A;  3F1S B;  1ESL A;  3TK6 B;  4GKO G;  1YUK B;  1V4L B;  1E88 A;  2B7D L;  1E8B A;  2RKY A;  1B6E A;  1G1S A;  3P5E A;  2JJL A;  4UWW A;  2B5I D;  3FD4 A;  1F7M A;  3UBU B;  1QO3 C;  1LMJ A;  1HAE A;  1EGI A;  4AYE A;  1IGZ A;  2Y8T A;  1FVU B;  2PF5 A;  2EI6 B;  5B1X A;  1EZQ B;  1QFK L;  3HS6 A;  2WG4 B;  3BT1 A;  4JYV L;  4Y7A B;  2ZYC A;  4IGD A;  4GJX A;  5F1A A;  4XLW A;  1ATE A;  3K9X A;  1EAI C;  2A55 A;  2VJ3 A;  4Y7B B;  1GHQ B;  2EHF A;  1R13 A;  4J6M A;  1UV0 A;  4EZM G;  1PFX L;  4MMY B;  4X8V L;  2IT5 A;  3OXU D;  1KSN B;  1I0U A;  4Y71 B;  2IZ4 A;  5COX A;  2RNL A;  3VWO A;  4COX A;  3U7U G;  4WR9 A;  1KWY A;  3ZD2 A;  1SL6 A;  1KWZ A;  2YHF A;  3Q7D A;  3HS5 A;  5LGK E;  1O9A A;  1E5G A;  3BDW A;  1RDI 1;  1OJV A;  4KI1 E;  5HYT B;  3NCW A;  2XC5 L;  1J35 A;  3QMO A;  1KWV A;  1IQE L;  1OK3 A;  3WBQ A;  4GJ0 A;  2I83 A;  2FD6 A;  5IKQ A;  3FF9 A;  1Q4G A;  2MGP A;  2D1J B;  2F9B L;  2HOX A;  1K9J A;  1XKB A;  1SB2 B;  2E3X B;  1H8U A;  4O1Z A;  1VVD A;  2BOK L;  3N8X A;  1P9J A;  3KL6 B;  2BT7 A;  3BPS E;  1L3Y A;  2GGX A;  3M9Z A;  2W3I B;  4KMB 1;  1G2M B;  3ALT A;  3M36 L;  1U5M A;  1BJ3 B;  1BUU A;  1V7P A;  1F0S B;  5E8D A;  3SW2 A;  1MUQ A;  1IQH L;  1J34 A;  5M62 A;  3O8E B;  2VVU L;  4X8S L;  1UKM A;  1IQG L;  1HFH A;  1KZA 1;  2EC3 A;  4N37 A;  1MPU A;  4PO7 A;  4M18 A;  2XRB A;  5CKM A;  4G9A A;  1PPQ A;  1UEX B;  3PAR A;  1UZJ A;  2PY2 A;  3S6X A;  1UMR C;  2I9A A;  1NQL B;  1UOT P;  4N7E A;  1E87 A;  3EGF A;  1DDX A;  1KLO A;  2Y82 B;  1TPG A;  3CEN L;  5JVY A;  1EGG A;  5I0Q B;  1DY1 A;  4LU5 A;  4ZRW A;  2VRS A;  2EI7 B;  1MD7 A;  1EBV A;  2FLG A;  1ATD A;  4ISI L;  2LS8 A;  4N35 A;  2VUV A;  5J6G G;  4KKD A;  1EPG A;  3KK6 A;  3C8K D;  3IKQ A;  2K2T A;  4GK1 A;  2P3T A;  1XKA L;  2BMG A;  2CG7 A;  2BSF A;  3IU3 I;  1KZE 1;  1P0S L;  1H03 P;  2VH6 B;  2YBY A;  1FIF A;  3ZYI B;  4NG9 L;  3P5I A;  1CVW L;  4YT7 L;  1LPK A;  4GU3 A;  1F7E A;  1ELV A;  1G2L B;  5JW1 A;  2CG6 A;  1X2W A;  5KTH A;  1OJW A;  1NZI A;  3P7F A;  1LY2 A;  3RJ3 D;  3TBD A;  1G4F A;  5L2Z L;  1FAK L;  3DEM A;  1TPN A;  4RRX A;  3HO3 A;  2WPI E;  3N8Y A;  1EPJ A;  2UWP B;  2WPM E;  4MMX B;  2XBW L;  2AYL A;  3GCW E;  2J2U B;  1CVU A;  1U0N C;  2J34 B;  2X2Z A;  1JV2 B;  3M7P A;  3C8J A;  2P3F N;  4C9F A;  3INB C;  4OTJ A;  4AYI A;  2W2N E;  2P94 L;  1EMO A;  4IOP A;  4DJZ A;  5I46 L;  3CI0 J;  1EPH A;  1X2T A;  3ZLE A;  5F19 A;  2MHP A;  3M37 L;  5IKT A;  2ZIB A;  3BX4 A;  3CCK A;  3FBY A;  3FF8 C;  1VVC A;  4G96 A;  1KLJ L;  3TZI A;  3GPR A;  2WG3 C;  3IIT B;  4A5W B;  4Y79 B;  1T8C A;  3VPP A;  4ZRV A;  5JB8 E;  1WK1 A;  1JL9 A;  1W7X L;  1YPQ A;  1C5M F;  2UWN A;  4RS0 A;  1N1I A;  1RTM 1;  3BT2 A;  3KZJ A;  4OTY A;  1J9C L;  2P3U A;  2W26 B;  3TK5 B;  2VWO L;  4CSY A;  3KQC L;  2WYJ B;  1PWB A;  3ZYG A;  3GCX E;  2RA0 L;  4BTT A;  1KIG L;  1OK2 A;  4ZH1 D;  3C9A C;  1KLI L;  2GD4 A;  1A3P A;  2XQW C;  1KWT A;  2BZ6 L;  3LAQ A;  4J6N A;  1TDQ B;  1T8D A;  2PR3 B;  5CKQ A;  3T5O A;  3NJA A;  1OB1 C;  1JWI A;  1O7B T;  3WH2 A;  2KL7 A;  1P4L D;  1SL5 A;  3BDW B;  1P1Z D;  1HRF A;  1MSB A;  1YXJ A;  1CX2 A;  1C1Z A;  3N8Z A;  1J35 B;  3TGF A;  3CDG F;  4WRC A;  4X8U L;  4Y6D B;  4QKH A;  2RIB A;  1BCJ 1;  1HT5 A;  4NA9 L;  3ALS A;  3P5B L;  1NWV A;  3C22 A;  1COU A;  1TN3 A;  1FIH A;  1JBU L;  2J95 B;  3CFW A;  1HQ8 A;  4N36 A;  3RR3 A;  2Y5F L;  1RDO 1;  2KMB 1;  4Z6A L;  3KRK A;  3IX0 A;  2QY0 A;  1Z92 B;  2LOJ A;  1V7P B;  2KB9 A;  1FSB A;  3ZD1 A;  5KN5 C;  2BO2 A;  1J34 B;  5FDQ A;  1UOS B;  4DN8 A;  1KG0 C;  1EQH A;  4M1G A;  1KWW A;  2H9E L;  3TVJ A;  3WWK C;  4AQT A;  1G1T A;  2G00 L;  4AK8 A;  3GPR D;  1RDJ 1;  2K2S B;  1RJH A;  3KQG A;  3IKN A;  1E5U I;  1HT8 A;  3GXE A;  1XPH A;  3P5F A;  3FGT A;  1TLE A;  3TH3 L;  3OP8 A;  1Q3X A;  2BQW A;  5JPM G;  2NPR A;  5L2Y L;  2WII C;  1IXX A;  4ZET A;  3F6U L;  3DBZ A;  4GU4 A;  4AYM A;  3SW0 X;  1BF9 A;  3P5H A;  4G1M B;  4F4O C;  2KNI A;  1R14 A;  3IKR A;  1SRZ A;  4TGF A;  5IKV A;  4APL A;  1KZC 1;  4K12 A;  4M17 A;  5KTI A;  4N32 A;  3POY A;  4FM5 A;  1YPU A;  1IQL L;  2J4I B;  4M11 A;  2YRA A;  1K9I A;  1V4L A;  1LK9 A;  1JA3 A;  2Y5H L;  1QDD A;  1X2W B;  2OX9 A;  1KZB 1;  1HCG B;  3QH0 A;  4JZE L;  1HFI A;  2MCZ A;  1RDK 1;  3LC3 B;  1WT9 A;  1YPO A;  2XC0 L;  1YTT A;  2Y8R A;  1CKL A;  2RIE A;  1H2Q P;  2VRP B;  3KQB L;  2FLR L;  2XBV L;  3OLU A;  4WQQ A;  1IJQ A;  1X7A L;  1UMR A;  2BOU A;  1N7D A;  4KZV A;  4A94 C;  2MGR A;  1FE2 A;  1L5G B;  3G8K A;  1V3X B;  5EGM B;  2JKH L;  1FBR A;  1OZ7 A;  1U0O A;  5FFT A;  4E52 A;  1WU1 B;  1RLH A;  2KV3 A;  1KCG A;  1X2T B;  4JZD L;  1Z6C A;  1CQE A;  4O02 B;  1IQJ L;  3BX4 B;  1RFN B;  1YXK A;  5JBC E;  4KZW A;  1NFU B;  4QKJ A;  1V1I A;  3GPR B;  4WJG 2;  2BT8 A;  3LC5 B;  2WYG B;  1QUB A;  1MQ6 L;  4QKG A;  2ORJ A;  1E8I A;  4N38 A;  3WHD A;  3FF7 C;  4YIZ A;  4B2R A;  3LTF B;  2VUZ A;  1NT0 A;  1XAR A;  3OLT A;  4ZHA B;  2KMS A;  1AFA 1;  4E1G A;  1Y17 A;  2W80 A;  3HUP A;  2FLB L;  4MMZ B;  2DDU A;  3NFP I;  3CAD A;  2P3F L;  2C6U A;  4J6J A;  2E3X C;  1IGX A;  1MOX C;  2VVC K;  2CKU A;  3WH3 A;  3PGH A;  1IOD A;  5IKR A;  2Y8S A;  2J94 B;  3OED C;  3LN0 A;  1JWI B;  2MSB A;  6COX A;  1DVA L;  2W3K B;  4BTI A;  1M1X B;  4M10 A;  1APQ A;  2G7I A;  2Y5G L;  2KV4 A;  2HOR A;  1HAF A;  2W2P E;  5B1R A;  1QIU A;  3K7B A;  1BNL A;  1FAX L;  4CUD A;  4D0E A;  1H2P P;  4ISH L;  1F00 I;  4FXG G;  2H2T B;  1PTH A;  3NTB A;  3VYK A;  1W8B L;  4BXW A;  3L89 M;  1DY0 A;  2J38 B;  1DY2 A;  2VWN L;  1FM5 A;  1HTN A;  4ONT D;  4PDC A;  2P95 L;  3K3T A;  3ZHG A;  2WPH E;  1XDT R;  1O5D L;  3CA7 A;  1YUG A;  1UZQ A;  4C16 A;  2I2L A;  2V8E A;  1EQG A;  1XFE A;  2O39 C;  2MTI A;  3R05 A;  5JBB E;  2WPJ E;  1GKN A;  3NCX A;  4J6K A;  4BXS A;  2VRP A;  4J6Q A;  2OYE P;  3VYJ A;  1IQK L;  2WPL E;  5K0H B;  1LQD A;  1RDN 1;  5JB9 E;  2VWM K;  4RRY A;  4Y76 B;  4UXM A;  4ZAE B;  1GPZ A;  5JBA E;  2Q1J B;  1SL4 A;  3T3A A;  5DN5 A;  1KWU A;  4WUX A;  3RS1 A;  2VWL L;  3HO5 A;  3N8W A;  4Z0L A;  1OK1 A;  3KXV A;  4YT6 L;  3P7G A;  1IXX B;  1C3A A;  1YO8 A;  1IOE L;  4CAJ A;  1SS2 A;  4MUC A;  1TLG A;  3P7H A;  1BCH 1;  2XBY L;  2BRS A;  3HPT A;  1MD8 A;  3ERB A;  1BV4 A;  2YGQ A;  4RRW A;  1V1H A;  1HJ7 A;  1NFY B;  2IT6 A;  2RIA A;  4WRF A;  1UKM B;  2WFT A;  2AFP A;  1IQM L;  1EPI A;  1B9W A;  1ATA A;  1DQB A;  3WWK A;  3CAL A;  1DV8 A;  2PHB B;  1WT9 B;  5L30 L;  2JGX A;  2RHP A;  2W2Q E;  4PZ5 A;  1IP0 A;  2P26 A;  1KMB 1;  4QKI A;  4XBM A;  3G81 A;  3ZHG D;  1HRE A;  1Z6E L;  1GKG A;  1OZ7 B;  1U0O B;  4BDW A;  3CDG E;  1HUP A;  3WSR A;  1ADX A;  1IVO C;  1QGB A;  2P28 B;  1HYR A;  1WMY A;  1LMM A;  2RL0 A;  4YZU B;  3EJH A;  4JYU L;  1QO6 A;  3ENS A;  1PW9 A;  1WMZ A;  4YLI A;  3MQL A;  1RDM 1;  2WFX B;  3SOV A;  1APO A;  3L9J C;  2FZZ L;  1URK A;  3U73 A;  1UZP A;  4X8T L;  4WUW A;  4NGA L;  3IKP A;  3HS7 A;  1KZD 1;  1GZ2 A;  1U8C B;  2BOH A;  2VVV L;  1AUT L;  1YGC L;  1Y17 B;  5FFR A;  2OYU P;  3UBU A;  1LPG A;  1LPZ A;  1IJK B;  4GI0 A;  3KQD L;  3N8Y B;  1FVU A;  1DIY A;  2ORK A;  1U0N B;  3HO4 A;  2RLP A;  3FGR A;  1BYF A;  1LIT A;  4N34 A;  1IOX A;  4D0F A;  2H9E C;  1CEJ A;  1IOD B;  1O7C T;  4BTU A;  2W81 A;  3G84 A;  1FJS L;  4WRE A;  2WZP P;  4IOP B;  5B1W A;  2XBX L;  4B2S A;  1FF7 A;  1EGF A;  1TOZ A;  1KKE A;  2JRA A;  2M94 A;  1CCV A;  3ZLD A;  4ZES A;  2RKZ A;  4AYD A;  1UOS A;  4ZH8 B;  4PH9 A;  1H04 P;  2BQ6 A;  2Y38 A;  1PXX A;  3GIS X;  2KRI A;  1PGE A;  5CIS A;  4BWC A;  2BZM A;  1CWV A;  2XR5 A;  3ASI A;  4J38 B;  2VH0 B;  1TPM A;  5FO8 C;  1HX2 A;  1G4G A;  1KWX A;  2CJI B;  2W2M E;  1KX1 A;  1DX5 I;  1K36 A;  4J6L A;  1F02 I;  2OS9 A;  1MQ5 L;  1OK9 A;  2BQ7 A;  4N33 A;  3PBF A;  1HCC A;  5CKN A;  4LOT A;  1ATB A;  1IQN L;  1SB2 A;  4D90 A;  2ZQK A;  1PRH A;  3PAK A;  1KOE A;  2TGF A;  1WHE A;  5HYU B;  1EMN A;  3SOQ A;  3ZYJ B;  4MSL A;  5HYP A;  2BPD A;  2XWB F;  5HZP B;  1NPE B;  2P93 L;  2BPE A;  2MCY A;  1NFW B;  2W86 A;  4XL1 A;  1BJ3 A;  2H2R A;  3VLG A;  4LOS A;  5JVZ A;  3NJP C;  2IZ3 A;  3MDL A;  3P5G A;  2Y7Z B;  1JZN A;  3LN1 A;  3FFG L;  3WSY A;  4CUF A;  1OJY A;  1AFD 1;  2ZWK A;  4LMF A;  1KX0 A;  2UWO B;  4WCO A;  2I9B A;  3QCW A;  3GOV A;  3Q3K B;  1AFB 1; 
#chains in the Genus database with same CATH homology
 1ZAQ A;  3N8W B;  1B08 A;  3KMB 1;  3R62 A;  2ERJ A;  2RLQ A;  1K37 A;  1UEX A;  2N40 A;  1C3A B;  2P16 L;  4RRZ A;  4BDX A;  1WHF A;  4LQF A;  3LIW B;  5KIR A;  2OX8 A;  4JZF L;  3WBP A;  1NFX B;  3NT1 A;  1IJK C;  3ZRZ A;  1HZ8 A;  2XWJ I;  2XR6 A;  5K8Y A;  1CCF A;  3P5D A;  4PP8 A;  2EI8 B;  1SZB A;  4YNX A;  3N8V A;  2RID A;  3H5C B;  2GGU A;  2CL8 A;  3ALU A;  3WWK B;  2WPK E;  4A7I A;  3GPR C;  4ZXY L;  3G83 A;  2RIC A;  3MQE A;  2Y80 B;  4RUT A;  3PAQ A;  4MTH A;  2BPH A;  4S0U A;  3KQE L;  2GO0 A;  2YGP A;  3IJE B;  1G1R A;  3LTG D;  4Z0K B;  2ADX A;  2YGO A;  5FFS A;  3V65 B;  1FFM A;  2Y7X B;  4ZXX L;  2JGW A;  1IQF L;  3ELA L;  3SOB B;  1RDL 1;  4JHS A;  5F2Q A;  2W2O E;  3CS7 L;  2PUQ L;  1F0R B;  3V64 C;  2XRD A;  2M74 A;  1G1Q A;  3NTG A;  4J6P A;  2XC4 L;  4LOR A;  4CUE A;  1YUF A;  4YMD A;  3G8L A;  3KCG L;  1U67 A;  3WBR A;  1IQI L;  2UWL B;  1ZJK A;  2BOX A;  3FCS B;  1UZK A;  2Y81 B;  1GK5 A;  3F1S B;  1ESL A;  3TK6 B;  4GKO G;  1YUK B;  1V4L B;  1E88 A;  2B7D L;  1E8B A;  2RKY A;  1B6E A;  1G1S A;  3P5E A;  4UWW A;  2B5I D;  3FD4 A;  1F7M A;  3UBU B;  1QO3 C;  1LMJ A;  1HAE A;  1EGI A;  4AYE A;  1IGZ A;  1FVU B;  2PF5 A;  2EI6 B;  5B1X A;  1EZQ B;  1QFK L;  3HS6 A;  2WG4 B;  3BT1 A;  4JYV L;  4Y7A B;  4IGD A;  4GJX A;  5F1A A;  4XLW A;  1ATE A;  3K9X A;  1EAI C;  2A55 A;  2VJ3 A;  4Y7B B;  1GHQ B;  2EHF A;  1R13 A;  4J6M A;  1UV0 A;  4EZM G;  1PFX L;  4MMY B;  4X8V L;  2IT5 A;  3OXU D;  1KSN B;  1I0U A;  4Y71 B;  2IZ4 A;  5COX A;  2RNL A;  4COX A;  3U7U G;  4WR9 A;  1KWY A;  3ZD2 A;  1SL6 A;  1KWZ A;  2YHF A;  3Q7D A;  3HS5 A;  5LGK E;  1O9A A;  1E5G A;  3BDW A;  1RDI 1;  1OJV A;  4KI1 E;  5HYT B;  3NCW A;  2XC5 L;  1J35 A;  3QMO A;  1KWV A;  1IQE L;  1OK3 A;  3WBQ A;  4GJ0 A;  2I83 A;  2FD6 A;  5IKQ A;  3FF9 A;  1Q4G A;  2MGP A;  2D1J B;  2F9B L;  1SB2 B;  1K9J A;  1XKB A;  2E3X B;  1H8U A;  4O1Z A;  1VVD A;  2BOK L;  3N8X A;  1P9J A;  3KL6 B;  3BPS E;  1L3Y A;  2GGX A;  3M9Z A;  2W3I B;  4KMB 1;  1G2M B;  3ALT A;  3M36 L;  1U5M A;  1BJ3 B;  1BUU A;  1V7P A;  1F0S B;  5E8D A;  3SW2 A;  1MUQ A;  1IQH L;  1J34 A;  5M62 A;  3O8E B;  2VVU L;  4X8S L;  1UKM A;  1IQG L;  1HFH A;  1KZA 1;  2EC3 A;  4N37 A;  1MPU A;  4M18 A;  2XRB A;  5CKM A;  4G9A A;  1PPQ A;  1UEX B;  3PAR A;  1UZJ A;  2PY2 A;  3S6X A;  1UMR C;  2I9A A;  1NQL B;  1UOT P;  1E87 A;  3EGF A;  1DDX A;  1KLO A;  2Y82 B;  1TPG A;  3CEN L;  5JVY A;  1EGG A;  5I0Q B;  1DY1 A;  4LU5 A;  4ZRW A;  2EI7 B;  1MD7 A;  1EBV A;  2FLG A;  1ATD A;  4ISI L;  2LS8 A;  4N35 A;  2VUV A;  5J6G G;  4KKD A;  1EPG A;  3KK6 A;  3C8K D;  3IKQ A;  2K2T A;  4GK1 A;  2P3T A;  1XKA L;  2BMG A;  2CG7 A;  3IU3 I;  1KZE 1;  1P0S L;  1H03 P;  2VH6 B;  2YBY A;  1FIF A;  3ZYI B;  4NG9 L;  3P5I A;  1CVW L;  4YT7 L;  1LPK A;  5KTH A;  1F7E A;  1ELV A;  1G2L B;  5JW1 A;  2CG6 A;  1X2W A;  1OJW A;  1NZI A;  3P7F A;  1LY2 A;  3RJ3 D;  3TBD A;  1G4F A;  5L2Z L;  1FAK L;  3DEM A;  1TPN A;  4RRX A;  3HO3 A;  2WPI E;  3N8Y A;  1EPJ A;  2UWP B;  2WPM E;  4MMX B;  2XBW L;  2AYL A;  3GCW E;  2J2U B;  1CVU A;  1U0N C;  2J34 B;  1JV2 B;  3M7P A;  3C8J A;  2P3F N;  4C9F A;  3INB C;  4OTJ A;  4AYI A;  2W2N E;  2P94 L;  1EMO A;  4IOP A;  4DJZ A;  5I46 L;  1EPH A;  1X2T A;  5F19 A;  2MHP A;  3M37 L;  5IKT A;  2ZIB A;  3BX4 A;  3CCK A;  3FBY A;  3FF8 C;  1VVC A;  4G96 A;  1KLJ L;  3TZI A;  3GPR A;  2WG3 C;  3IIT B;  4A5W B;  4Y79 B;  1T8C A;  3VPP A;  4ZRV A;  5JB8 E;  1WK1 A;  1JL9 A;  1W7X L;  1YPQ A;  1C5M F;  2UWN A;  4RS0 A;  1N1I A;  1RTM 1;  3BT2 A;  3KZJ A;  4OTY A;  1J9C L;  2P3U A;  2W26 B;  3TK5 B;  2VWO L;  4CSY A;  3KQC L;  2WYJ B;  1PWB A;  3ZYG A;  3GCX E;  2RA0 L;  4BTT A;  1KIG L;  1OK2 A;  4ZH1 D;  3C9A C;  1KLI L;  2GD4 A;  1A3P A;  2XQW C;  1KWT A;  2BZ6 L;  3LAQ A;  4J6N A;  1TDQ B;  1T8D A;  2PR3 B;  5CKQ A;  3T5O A;  1O7B T;  1OB1 C;  1JWI A;  3WH2 A;  2KL7 A;  1P4L D;  1SL5 A;  3BDW B;  1P1Z D;  1HRF A;  1MSB A;  1YXJ A;  1CX2 A;  1C1Z A;  3N8Z A;  1J35 B;  3TGF A;  3CDG F;  4WRC A;  4X8U L;  4Y6D B;  4QKH A;  2RIB A;  1BCJ 1;  1HT5 A;  4NA9 L;  3ALS A;  3P5B L;  1NWV A;  3C22 A;  1COU A;  1TN3 A;  1FIH A;  1JBU L;  2J95 B;  3CFW A;  1HQ8 A;  4N36 A;  3RR3 A;  2Y5F L;  1RDO 1;  2KMB 1;  4Z6A L;  3KRK A;  3IX0 A;  2QY0 A;  1Z92 B;  2LOJ A;  1V7P B;  2KB9 A;  1FSB A;  3ZD1 A;  5KN5 C;  2BO2 A;  1J34 B;  5FDQ A;  1UOS B;  4DN8 A;  1KG0 C;  1EQH A;  4M1G A;  1KWW A;  2H9E L;  3TVJ A;  3WWK C;  4AQT A;  1G1T A;  2G00 L;  4AK8 A;  3GPR D;  1RDJ 1;  2K2S B;  1RJH A;  3KQG A;  3IKN A;  1E5U I;  1HT8 A;  3GXE A;  1XPH A;  3P5F A;  1TLE A;  3TH3 L;  3OP8 A;  1Q3X A;  2BQW A;  5JPM G;  2NPR A;  5L2Y L;  2WII C;  1IXX A;  4ZET A;  3F6U L;  3DBZ A;  4AYM A;  3SW0 X;  1BF9 A;  3P5H A;  4G1M B;  4F4O C;  2KNI A;  1R14 A;  3IKR A;  1SRZ A;  4TGF A;  5IKV A;  1KZC 1;  4K12 A;  4M17 A;  5KTI A;  4N32 A;  3POY A;  4FM5 A;  1YPU A;  1IQL L;  2J4I B;  4M11 A;  2YRA A;  1K9I A;  1V4L A;  1JA3 A;  1X2W B;  2Y5H L;  1QDD A;  2OX9 A;  1KZB 1;  1HCG B;  3QH0 A;  4JZE L;  1HFI A;  2MCZ A;  1RDK 1;  3LC3 B;  1WT9 A;  1YPO A;  2XC0 L;  1YTT A;  2RIE A;  1CKL A;  2VRP B;  1H2Q P;  3KQB L;  2FLR L;  2XBV L;  3OLU A;  4WQQ A;  1IJQ A;  1X7A L;  1UMR A;  2BOU A;  1N7D A;  4KZV A;  4A94 C;  2MGR A;  1FE2 A;  1L5G B;  3G8K A;  1V3X B;  5EGM B;  2JKH L;  1FBR A;  1OZ7 A;  1U0O A;  5FFT A;  4E52 A;  1WU1 B;  2KV3 A;  1KCG A;  1X2T B;  4JZD L;  1Z6C A;  1CQE A;  4O02 B;  1IQJ L;  3BX4 B;  1RFN B;  1YXK A;  5JBC E;  4KZW A;  1NFU B;  4QKJ A;  3GPR B;  4WJG 2;  3LC5 B;  2WYG B;  1QUB A;  1MQ6 L;  4QKG A;  2ORJ A;  1E8I A;  4N38 A;  3WHD A;  3FF7 C;  4B2R A;  3LTF B;  2VUZ A;  1NT0 A;  1XAR A;  3OLT A;  4ZHA B;  2KMS A;  1AFA 1;  4E1G A;  1Y17 A;  2W80 A;  3HUP A;  2FLB L;  4MMZ B;  2DDU A;  3NFP I;  3CAD A;  2P3F L;  2C6U A;  4J6J A;  2E3X C;  1IGX A;  1MOX C;  2VVC K;  2CKU A;  3WH3 A;  3PGH A;  1IOD A;  5IKR A;  3OED C;  2J94 B;  3LN0 A;  1JWI B;  2MSB A;  6COX A;  1DVA L;  2W3K B;  4BTI A;  1M1X B;  4M10 A;  1APQ A;  2G7I A;  2Y5G L;  2KV4 A;  2W2P E;  1HAF A;  5B1R A;  3K7B A;  1BNL A;  1FAX L;  4CUD A;  4D0E A;  1H2P P;  4ISH L;  1F00 I;  4FXG G;  2H2T B;  1PTH A;  3NTB A;  3VYK A;  1W8B L;  4BXW A;  3L89 M;  1DY0 A;  2J38 B;  1DY2 A;  2VWN L;  1FM5 A;  1HTN A;  4ONT D;  4PDC A;  2P95 L;  3ZHG A;  2WPH E;  1XDT R;  1O5D L;  3CA7 A;  1YUG A;  1UZQ A;  4C16 A;  2V8E A;  1EQG A;  1XFE A;  2O39 C;  2MTI A;  3R05 A;  5JBB E;  2WPJ E;  1GKN A;  3NCX A;  4J6K A;  4BXS A;  2VRP A;  4J6Q A;  2OYE P;  3VYJ A;  1IQK L;  2WPL E;  5K0H B;  1LQD A;  1RDN 1;  5JB9 E;  2VWM K;  4RRY A;  4Y76 B;  4UXM A;  4ZAE B;  1GPZ A;  5JBA E;  2Q1J B;  1SL4 A;  3T3A A;  1KWU A;  4WUX A;  3RS1 A;  2VWL L;  3HO5 A;  3N8W A;  4Z0L A;  1OK1 A;  3KXV A;  4YT6 L;  3P7G A;  1IXX B;  1C3A A;  1YO8 A;  1IOE L;  4CAJ A;  1SS2 A;  4MUC A;  1TLG A;  3P7H A;  1BCH 1;  2XBY L;  2BRS A;  3HPT A;  1MD8 A;  3ERB A;  1BV4 A;  2YGQ A;  4RRW A;  1HJ7 A;  1NFY B;  2IT6 A;  2RIA A;  4WRF A;  1UKM B;  2WFT A;  2AFP A;  1IQM L;  1EPI A;  1B9W A;  1ATA A;  1DQB A;  3WWK A;  3CAL A;  1DV8 A;  2PHB B;  1WT9 B;  5L30 L;  2JGX A;  2RHP A;  2W2Q E;  4PZ5 A;  1IP0 A;  2P26 A;  1KMB 1;  4QKI A;  4XBM A;  3G81 A;  3ZHG D;  1HRE A;  1Z6E L;  1GKG A;  1OZ7 B;  1U0O B;  4BDW A;  3CDG E;  1HUP A;  3WSR A;  1ADX A;  1IVO C;  1QGB A;  2P28 B;  1HYR A;  1WMY A;  1LMM A;  2RL0 A;  4YZU B;  3EJH A;  4JYU L;  1QO6 A;  3ENS A;  1PW9 A;  1WMZ A;  4YLI A;  3MQL A;  1RDM 1;  2WFX B;  3SOV A;  1APO A;  3L9J C;  2FZZ L;  1URK A;  3U73 A;  1UZP A;  4X8T L;  4WUW A;  4NGA L;  3IKP A;  3HS7 A;  1KZD 1;  1GZ2 A;  1U8C B;  2BOH A;  2VVV L;  1AUT L;  1YGC L;  1Y17 B;  5FFR A;  2OYU P;  3UBU A;  1LPG A;  1LPZ A;  1IJK B;  4GI0 A;  3KQD L;  3N8Y B;  1FVU A;  1DIY A;  2ORK A;  1U0N B;  3HO4 A;  2RLP A;  1BYF A;  1LIT A;  4N34 A;  1IOX A;  4D0F A;  2H9E C;  1CEJ A;  1IOD B;  1O7C T;  4BTU A;  2W81 A;  3G84 A;  1FJS L;  4WRE A;  2WZP P;  4IOP B;  5B1W A;  2XBX L;  4B2S A;  1FF7 A;  1EGF A;  1TOZ A;  2JRA A;  2M94 A;  1CCV A;  4ZES A;  2RKZ A;  4AYD A;  1UOS A;  4ZH8 B;  4PH9 A;  1H04 P;  2BQ6 A;  2Y38 A;  1PXX A;  3GIS X;  2KRI A;  1PGE A;  5CIS A;  1CWV A;  2BZM A;  2XR5 A;  3ASI A;  4J38 B;  2VH0 B;  1TPM A;  5FO8 C;  1HX2 A;  1G4G A;  1KWX A;  2CJI B;  2W2M E;  1KX1 A;  1DX5 I;  1K36 A;  4J6L A;  1F02 I;  2OS9 A;  1MQ5 L;  1OK9 A;  2BQ7 A;  4N33 A;  3PBF A;  1HCC A;  5CKN A;  4LOT A;  1ATB A;  1IQN L;  1SB2 A;  4D90 A;  2ZQK A;  1PRH A;  3PAK A;  1KOE A;  2TGF A;  1WHE A;  5HYU B;  1EMN A;  3SOQ A;  3ZYJ B;  5HYP A;  2BPD A;  2XWB F;  5HZP B;  1NPE B;  2P93 L;  2BPE A;  2MCY A;  1NFW B;  2W86 A;  4XL1 A;  1BJ3 A;  2H2R A;  3VLG A;  4LOS A;  5JVZ A;  3NJP C;  2IZ3 A;  3MDL A;  3P5G A;  2Y7Z B;  1JZN A;  3LN1 A;  3FFG L;  4CUF A;  1OJY A;  1AFD 1;  2ZWK A;  4LMF A;  1KX0 A;  2UWO B;  4WCO A;  2I9B A;  3QCW A;  3GOV A;  3Q3K B;  1AFB 1; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...