4C16A

E-selectin lectin, egf-like and two scr domains complexed with glycomimetic antagonist
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
280
structure length
280
Chain Sequence
WSYNTSTEAMTYDEASAYCQQRYTHLVAIQNKEEIEYLNSILSYSPSYYWIGIRKVNNVWVWVGTQKPLTEEAKNWAPGEPNNRQKDEDCVEIYIKREKDVGMWNDERCSKKKLALCYTAACTNTSCSGHGECVETINNYTCKCDPGFSGLKCEQIVNCTALESPEHGSLVCSHPLGNFSYNSSCSISCDRGYLPSSMETMQCMSSGEWSAPIPACNVVECDAVTNPANGFVECFQNPGSFPWNTTCTFDCEEGFELMGAQSLQCTSSGNWDNEKPTCKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords E-SELECTIN
publication title E-Selectin Ligand Complexes Adopt an Extended High-Affinity Conformation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
total genus 58
structure length 280
sequence length 280
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-08-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00008 EGF EGF-like domain
A PF00059 Lectin_C Lectin C-type domain
A PF00084 Sushi Sushi repeat (SCR repeat)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.25.10 Mainly Beta Ribbon Laminin Laminin 4c16A02
2.10.70.10 Mainly Beta Ribbon Complement Module; domain 1 Complement Module, domain 1 4c16A04
2.10.70.10 Mainly Beta Ribbon Complement Module; domain 1 Complement Module, domain 1 4c16A03
3.10.100.10 Alpha Beta Roll Mannose-Binding Protein A; Chain A Mannose-Binding Protein A, subunit A 4c16A01
1KWUA 1W7XL 4Y76B 2IZ3A 5IKQA 1KG0C 3PBFA 2EI6B 3P5IA 3K9XA 2PHBB 5CKQA 4D0EA 2XWBF 4KZVA 4ZRVA 4AYMA 3CDGE 3N8YA 2XRBA 5F19A 3CS7L 2Y7XB 2UWLB 4Y6DB 1YUGA 2CJIB 2J4IB 1KZA1 4O02B 3ALUA 3RS1A 3CENL 4JYUL 1KX0A 1GK5A 3SOQA 1DY2A 1EGGA 1O7CT 1N7DA 1UMRA 1F0SB 1EPGA 1Q4GA 4JZDL 4LOSA 1URKA 2ZIBA 1DX5I 3HS7A 4Y7AB 5I46L 1SZBA 4M1GA 2VH6B 3OLTA 4UXMA 1C3AA 2Y5HL 1DVAL 2UWPB 3SW0X 2VUZA 1CQEA 2W3KB 5JBAE 3INBC 2MHPA 1RDL1 3C22A 4IOPA 1P9JA 1UZKA 2GD4A 5IKRA 3HO3A 4N37A 1IQJL 1X7AL 2YHFA 3G81A 1KZB1 2WYGB 1KX1A 1FJSL 3IU3I 1IXXA 1SB2A 1EQHA 3KCGL 3N8WB 4N33A 1IQEL 2F9BL 4LQFA 1W8BL 3HUPA 3P5FA 3P5HA 1K36A 1GHQB 3ALSA 3TGFA 1HREA 1KZE1 3KK6A 4A5WB 1KOEA 1O7BT 1OK9A 2VVUL 1A3PA 3PGHA 1RDI1 3BX4A 4AYEA 2XBXL 4FM5A 2VRPA 1DV8A 2RA0L 1L5GB 1RDM1 1PTHA 2DDUA 1R13A 2J94B 3LN1A 4WUXA 1WT9B 2BO2A 1DY1A 3KXVA 4ZESA 5JBBE 4QKJA 2RKZA 1XFEA 1PFXL 1X2TB 3SW2A 3F1SB 4DN8A 4WUWA 2WPJE 1U0OA 1YO8A 1LMJA 1UZJA 1G4GA 4MUCA 1BJ3B 1Q3XA 1R14A 4WJG2 1TDQB 1DY0A 2WIIC 2E3XB 5EGMB 2RIDA 3BT1A 1KIGL 3CFWA 3RJ3D 5J6GG 4BTUA 2P28B 5JBCE 1H04P 2Y80B 4OTYA 1E5UI 1U0NB 1U67A 2H2RA 1MPUA 1HTNA 1J9CL 1F0RB 1PXXA 2GGUA 1WHFA 3ZYGA 1V7PA 3NT1A 4XLWA 3N8YB 2W2QE 1SS2A 4JYVL 4CUDA 2RNLA 1GKNA 1KWZA 4ISHL 2NPRA 4J6LA 3ZYIB 3HO5A 1UEXA 1N1IA 1OK2A 5FFSA 3OEDC 2P3UA 1PGEA 2RHPA 1LQDA 1JBUL 4PZ5A 1IJQA 2PF5A 3ASIA 3T3AA 1K37A 4JZEL 1XDTR 1KMB1 5L2ZL 3ZRZA 4Y71B 2J34B 3HS5A 1G4FA 1C3AB 2RLQA 1IQNL 1HYRA 1K9JA 5KTHA 2JKHL 4LOTA 3LC5B 3OLUA 4MMZB 1YPQA 3KL6B 4RRXA 1MOXC 3GXEA 3UBUB 1RDJ1 4X8TL 1ELVA 4X8SL 2BZMA 1MD7A 3WWKB 1SL6A 1J35A 1NFXB 1IODB 5FO8C 4IGDA 2OX8A 3FF7C 3FBYA 3H5CB 1KWVA 1F02I 1SB2B 4X8UL 1EBVA 3CCKA 1ATBA 2BPDA 4BTIA 1APOA 3WBRA 1QO3C 4AQTA 1PWBA 1IJKB 1WT9A 2H2TB 1JWIB 3FF9A 3FFGL 3FD4A 2PUQL 2UWOB 2BOUA 3EJHA 1AFA1 3MDLA 1X2TA 2RL0A 3KMB1 5CKMA 1BV4A 2BZ6L 5B1XA 1KLOA 2WG3C 5F2QA 2VRPB 4PP8A 1BJ3A 3GPRB 4J6PA 2WYJB 2VH0B 4ONTD 1TLEA 2RICA 2WPLE 3QH0A 1T8DA 4CUEA 4KKDA 2K2TA 1DQBA 1UOTP 2C6UA 4N38A 2W2ME 5FFRA 3NJPC 1NPEB 3T5OA 1MQ5L 4RRWA 4Z6AL 2CG6A 1FF7A 1H2PP 2WPHE 1NWVA 3IKRA 1OK1A 2MGRA 4S0UA 1CCVA 5E8DA 1U0OB 3C8JA 1LPKA 1H8UA 4QKGA 4RRYA 3U73A 1YPUA 1YUFA 1HRFA 1AFB1 4WR9A 1EPIA 3KZJA 1ATAA 1UZPA 4ZHAB 1G1QA 3N8ZA 2XR5A 4C9FA 1E88A 3SOBB 2J95B 3PARA 4BDXA 5FFTA 3IJEB 1U5MA 1YPOA 4B2RA 3ERBA 3R62A 4N35A 1EMOA 1V7PB 2VWMK 4ZH8B 1EAIC 3M37L 4JZFL 1GZ2A 2VWLL 2XQWC 3UBUA 1NQLB 1FVUA 3G8KA 1XKBA 2B7DL 3IX0A 1UEXB 2IT6A 1OJVA 3WWKA 4M18A 1EMNA 1NFWB 4E1GA 2JGWA 1F00I 3CA7A 2JGXA 1IODA 2XBVL 1CEJA 1RJHA 1OZ7A 1UMRC 4X8VL 1RDK1 1M1XB 4COXA 1JA3A 2P3FN 3FF8C 1HAEA 1ATEA 1PPQA 2GO0A 4MMYB 1JL9A 3HO4A 1UZQA 3MQEA 1HFIA 5JW1A 3VPPA 1JWIA 3GPRD 4KI1E 4ISIL 2B5ID 2VVVL 4RRZA 4BDWA 4J38B 3HPTA 2WFTA 3WWKC 1K9IA 4LORA 3P5GA 1J35B 2P3FL 3SOVA 3GPRA 2BOKL 4Z0KB 1P0SL 3WSRA 4Y7BB 1HJ7A 4MMXB 1IQKL 1CKLA 1E8IA 2W2NE 2W2PE 1IQGL 1HCCA 1PRHA 1KLJL 2I9AA 2P93L 4G9AA 3VLGA 4YZUB 1OJWA 1VVCA 3FCSB 1B08A 1IJKC 3EGFA 3M9ZA 1YGCL 4K12A 1EZQB 1IQIL 1NZIA 4ZXYL 3M36L 2ORJA 2J2UB 4O1ZA 3N8VA 1P1ZD 2MSBA 4UWWA 2VWOL 2MCZA 1JZNA 3PAKA 3P5DA 1G2LB 2LOJA 2XBWL 1MUQA 2M74A 1G1SA 1TLGA 1DDXA 1KLIL 1GKGA 4J6QA 2BOHA 2P94L 5IKVA 1B9WA 3LTGD 5HYUB 2YRAA 1WU1B 1Y17B 1FM5A 1XKAL 3IKNA 4ZAEB 4WREA 3TBDA 1O5DL 1NFYB 4DJZA 1TPMA 5JVYA 2TGFA 3Q7DA 3P5EA 4KMB1 1SRZA 4D90A 1UOSB 2BOXA 1CVWL 1FFMA 2WPKE 1BNLA 2VJ3A 1HAFA 4WQQA 2FD6A 3L89M 2OYEP 1IOXA 2ERJA 4YLIA 1IQLL 4D0FA 2LS8A 2I9BA 3GOVA 4CSYA 3R05A 1FVUB 6COXA 5KIRA 2Y5FL 3LTFB 1XARA 2I83A 2CL8A 2RLPA 1IQML 3QMOA 2W3IB 4YNXA 2KRIA 5CISA 1B6EA 3LIWB 1BCJ1 1QGBA 1OZ7B 4GK1A 2BRSA 3K7BA 3CDGF 1OB1C 2ZQKA 2O39C 3PAQA 1BCH1 1T8CA 1RDO1 5KTIA 3NCWA 2Y7ZB 3TVJA 3L9JC 1BF9A 4QKIA 1EGIA 1TOZA 2BQ7A 4LMFA 1EPHA 1E5GA 3TK6B 1CWVA 3P7FA 2J38B 1C5MF 1KWXA 4PH9A 1GPZA 1TPNA 3WH2A 1EGFA 2KV3A 2FLBL 4KZWA 2Y81B 2BQWA 2FLRL 1KWTA 4AYDA 4XBMA 2WPIE 1OJYA 5COXA 1YXJA 1CCFA 4XL1A 2BPHA 1V4LB 1EQGA 4QKHA 4RS0A 2XBYL 4BTTA 4J6MA 2MCYA 1RDN1 5JB9E 2V8EA 3ZYJB 3BDWA 4GI0A 1P4LD 3WHDA 2OX9A 1X2WB 4J6JA 1ATDA 2CG7A 2RIBA 4A7IA 1G1TA 3DBZA 5K8YA 1HT8A 1UKMA 1Y17A 4GJ0A 4TGFA 4ZXXL 3P7GA 1AUTL 2WPME 4G1MB 2BQ6A 2JRAA 2XC5L 2AFPA 1IQHL 5JPMG 2E3XC 1QDDA 2W26B 2RIAA 2VVCK 2Y82B 3POYA 3IKPA 1UOSA 1HCGB 1HFHA 1U0NC 3RR3A 1F7EA 1RTM1 4C16A 4ZETA 4YT6L 3QCWA 2FLGA 2W2OE 3BT2A 3NFPI 2IT5A 1YXKA 5FDQA 3TZIA 3ZHGD 1JV2B 2PY2A 3N8XA 1V3XB 1O9AA 3G8LA 4CAJA 4NG9L 2RIEA 3LN0A 1AFD1 4B2SA 2YGOA 1Z6EL 2AYLA 3ZHGA 3V64C 3GISX 2EC3A 1LPZA 1IVOC 1HT5A 3NCXA 2EI8B 1FIFA 2KB9A 1FBRA 1Z6CA 2WFXB 1APQA 3NTGA 1WMZA 1WMYA 2D1JB 4LU5A 1IGZA 2PR3B 2VWNL 2IZ4A 2A55A 3CADA 1QFKL 1EPJA 4E52A 2P26A 3OXUD 1KWYA 5JB8E 5L30L 2UWNA 1SL5A 1J34A 1ZAQA 2K2SB 4M17A 3KQGA 1V4LA 1I0UA 2XC0L 2KMB1 2P16L 4Z0LA 1KZC1 3V65B 2EI7B 1IQFL 2W80A 4J6NA 4J6KA 3KRKA 1X2WA 3KQCL 2OS9A 5L2YL 1UV0A 4M11A 4AK8A 4GJXA 3MQLA 2EHFA 1IP0A 1E8BA 2XWJI 1BYFA 1IGXA 1FE2A 3LC3B 1LY2A 3GPRC 5JVZA 1H03P 5B1WA 2YBYA 2ORKA 4N32A 1CVUA 1F7MA 5M62A 3NTBA 1HUPA 1LITA 3BDWB 1E87A 3WBQA 2H9EL 4WRFA 1MD8A 3C8KD 3HS6A 1UKMB 4GKOG 2XRDA 3OP8A 4WRCA 3C9AC 4NGAL 5B1RA 5I0QB 4M10A 4JHSA 2G00L 2YGPA 5LGKE 4CUFA 4WCOA 2Y38A 3F6UL 4ZH1D 2XC4L 1C1ZA 3VYKA 1RFNB 5CKNA 1ADXA 2W86A 1COUA 2G7IA 1BUUA 5IKTA 1NT0A 2BMGA 3WBPA 3ZD2A 1H2QP 2XR6A 3G84A 4BXSA 3IITB 4N36A 4Y79B 1DIYA 1WHEA 1L3YA 3P7HA 1ESLA 1SL4A 2BPEA 3DEMA 2N40A 2Q1JB 3VYJA 4PDCA 1MQ6L 1XPHA 1TN3A 4ZRWA 1NFUB 1FAXL 2FZZL 1QUBA 1HZ8A 3M7PA 2ADXA 1WK1A 4AYIA 1QO6A 3Q3KB 1KCGA 1Z92B 3GCXE 2CKUA 2M94A 3N8WA 2ZWKA 3WH3A 4BXWA 3LAQA 3P5BL 1KZD1 2P3TA 2KMSA 1ZJKA 3ZD1A 3GCWE 1LPGA 4IOPB 2WG4B 5KN5C 1PW9A 1G2MB 4G96A 5F1AA 5K0HB 1J34B 1U8CB 4F4OC 1KWWA 3ENSA 3CALA 3KQDL 5HYTB 2RKYA 1IXXB 2KL7A 3G83A 1G1RA 1FIHA 1OK3A 2MTIA 2VUVA 3BPSE 2W81A 2QY0A 4YT7L 1HQ8A 1FSBA 2OYUP 5HYPA 4FXGG 2KV4A 3TK5B 1YTTA 3KQBL 2MGPA 3ALTA 1VVDA 4YMDA 4EZMG 1KSNB 4N34A 3O8EB 1MSBA 3BX4B 4RUTA 1IOEL 4MTHA 3ELAL 1HX2A 3TH3L 5HZPB 3KQEL 3IKQA 1FAKL 4OTJA 1CX2A 1TPGA 2Y5GL 3U7UG 2GGXA 1YUKB 2P95L 4NA9L
chains in the Genus database with same CATH superfamily
1KWUA 1W7XL 4Y76B 2IZ3A 5IKQA 1KG0C 3PBFA 2EI6B 3P5IA 2BT7A 2PHBB 3K9XA 5CKQA 4D0EA 2XWBF 4KZVA 4AYMA 3CDGE 3N8YA 2XRBA 5F19A 3CS7L 2Y7XB 2UWLB 4Y6DB 1YUGA 2CJIB 2J4IB 1KZA1 4O02B 3ALUA 2KNIA 3RS1A 3CENL 2H9EC 4JYUL 1KX0A 1GK5A 3SOQA 1DY2A 1EGGA 1O7CT 5DN5A 1N7DA 3K3TA 1UMRA 1F0SB 1EPGA 1Q4GA 4JZDL 2X2ZA 1URKA 3NJAA 4LOSA 1DX5I 3HS7A 4Y7AB 1KKEA 5I46L 1SZBA 2ZIBA 4M1GA 2VH6B 3OLTA 4UXMA 1C3AA 2Y5HL 1DVAL 2UWPB 3SW0X 2VUZA 1CQEA 2W3KB 5JBAE 3INBC 2MHPA 1RDL1 3C22A 4IOPA 1P9JA 1UZKA 2GD4A 5IKRA 3HO3A 4N37A 1IQJL 1X7AL 2YHFA 3G81A 1KZB1 2WYGB 1KX1A 5DN4A 1LMMA 1FJSL 3IU3I 1IXXA 1SB2A 1EQHA 3KCGL 4BWCA 3N8WB 4N33A 1IQEL 2F9BL 4LQFA 1W8BL 3HUPA 3P5FA 3P5HA 1K36A 1GHQB 3ALSA 3TGFA 1HREA 1KZE1 3KK6A 4A5WB 1KOEA 1O7BT 1OK9A 2VVUL 1A3PA 3PGHA 1RDI1 3BX4A 4AYEA 2XBXL 4FM5A 2VRPA 1DV8A 2RA0L 1L5GB 1RDM1 1PTHA 2DDUA 1R13A 2J94B 3LN1A 2Y8SA 4WUXA 1WT9B 2BO2A 1DY1A 3KXVA 4ZESA 5JBBE 4QKJA 2RKZA 1LK9A 1PFXL 1XFEA 1X2TB 3SW2A 3F1SB 4DN8A 4WUWA 2WPJE 1U0OA 1YO8A 1LMJA 1UZJA 1G4GA 4MUCA 1BJ3B 1Q3XA 1R14A 4WJG2 1TDQB 1DY0A 2WIIC 2E3XB 5EGMB 2RIDA 3BT1A 1KIGL 3CFWA 3RJ3D 5J6GG 4BTUA 2P28B 5JBCE 1H04P 2Y80B 4OTYA 1E5UI 1U0NB 1U67A 2H2RA 2WZPP 1MPUA 2Y8TA 1J9CL 1F0RB 1PXXA 1HTNA 2GGUA 1WHFA 3ZYGA 1V7PA 3NT1A 4XLWA 3N8YB 2W2QE 1SS2A 4JYVL 2I2LA 4CUDA 2RNLA 1GKNA 1KWZA 4ISHL 2NPRA 4J6LA 3ZYIB 3HO5A 1UEXA 1N1IA 1OK2A 5FFSA 3OEDC 2HORA 2P3UA 1PGEA 2RHPA 4YIZA 1LQDA 1JBUL 4PZ5A 1IJQA 2PF5A 3ASIA 3T3AA 1K37A 4JZEL 1XDTR 1KMB1 4ZRVA 5L2ZL 3ZRZA 4Y71B 2J34B 3HS5A 1G4FA 1C3AB 2RLQA 1IQNL 1HYRA 1K9JA 5KTHA 2JKHL 4LOTA 3LC5B 3OLUA 4MMZB 1YPQA 3KL6B 4RRXA 1MOXC 3GXEA 3UBUB 1RDJ1 4X8TL 1ELVA 4X8SL 2BZMA 1MD7A 3WWKB 1SL6A 1J35A 1NFXB 1IODB 5FO8C 4IGDA 2OX8A 3FF7C 3FBYA 3H5CB 1KWVA 1F02I 1SB2B 4X8UL 1EBVA 3CCKA 1ATBA 2BPDA 4BTIA 1APOA 3WBRA 1QO3C 4AQTA 1PWBA 1IJKB 1WT9A 2H2TB 1JWIB 3FF9A 3FFGL 3FD4A 2PUQL 2UWOB 2BOUA 3EJHA 1AFA1 3MDLA 1X2TA 2RL0A 3KMB1 5CKMA 1BV4A 2BZ6L 5B1XA 1KLOA 2WG3C 3S6XA 5F2QA 2VRPB 4PP8A 1BJ3A 3GPRB 4J6PA 2WYJB 2VH0B 4GU4A 1TLEA 4ONTD 2WPLE 2RICA 3QH0A 1T8DA 4CUEA 4KKDA 2K2TA 1DQBA 1UOTP 2C6UA 4N38A 2W2ME 5FFRA 3NJPC 1NPEB 3T5OA 1MQ5L 4RRWA 4Z6AL 2CG6A 1FF7A 1H2PP 3ZLEA 2WPHE 1NWVA 3IKRA 1OK1A 2MGRA 4S0UA 1CCVA 5E8DA 1U0OB 3C8JA 4PO7A 1LPKA 1H8UA 4QKGA 4RRYA 3U73A 1YPUA 1YUFA 1HRFA 1AFB1 4WR9A 1EPIA 3KZJA 1ATAA 1UZPA 4ZHAB 1G1QA 3N8ZA 2XR5A 4C9FA 1E88A 3SOBB 2J95B 3PARA 4BDXA 5FFTA 3IJEB 1U5MA 1YPOA 4B2RA 3ERBA 3R62A 4N35A 1EMOA 1V7PB 2VWMK 4ZH8B 1EAIC 3M37L 4JZFL 1GZ2A 2VWLL 2XQWC 3UBUA 1NQLB 1FVUA 3G8KA 1XKBA 2B7DL 3IX0A 1UEXB 2IT6A 1OJVA 3WWKA 4M18A 1EMNA 1NFWB 4E1GA 2JGWA 1F00I 3CA7A 2JGXA 1IODA 2XBVL 1CEJA 1RJHA 1OZ7A 1UMRC 4X8VL 1RDK1 1M1XB 4COXA 1JA3A 2P3FN 3FF8C 1HAEA 1ATEA 1PPQA 2GO0A 4MMYB 1JL9A 2HOXA 3HO4A 1UZQA 3MQEA 1HFIA 5JW1A 3VPPA 1JWIA 3GPRD 4KI1E 4ISIL 2B5ID 2VVVL 4RRZA 4BDWA 4J38B 3HPTA 2WFTA 3WWKC 1K9IA 4LORA 3P5GA 1J35B 2P3FL 3SOVA 3GPRA 2BOKL 4Z0KB 1P0SL 3WSRA 4Y7BB 1HJ7A 4MMXB 1IQKL 1CKLA 1E8IA 2W2NE 2W2PE 1IQGL 1HCCA 3CI0J 1PRHA 1KLJL 2I9AA 2P93L 4G9AA 3VLGA 4YZUB 1OJWA 1VVCA 3FCSB 1B08A 1IJKC 3EGFA 3M9ZA 1YGCL 4K12A 1EZQB 1IQIL 1NZIA 4ZXYL 3M36L 2ORJA 2J2UB 4O1ZA 3N8VA 1P1ZD 2MSBA 4UWWA 2VWOL 2MCZA 4NA9L 1JZNA 3PAKA 3P5DA 1G2LB 2LOJA 2XBWL 1MUQA 2M74A 1G1SA 1TLGA 1DDXA 1KLIL 1GKGA 4J6QA 2BOHA 2P94L 5IKVA 1B9WA 3LTGD 4GU3A 5HYUB 2YRAA 1WU1B 1Y17B 1V1HA 1FM5A 1XKAL 3IKNA 4ZAEB 4WREA 2BT8A 3TBDA 1O5DL 1NFYB 4DJZA 1TPMA 5JVYA 2TGFA 3Q7DA 3P5EA 3WSXA 4KMB1 1SRZA 4D90A 1UOSB 2BOXA 1CVWL 1FFMA 2WPKE 1BNLA 2VJ3A 1HAFA 4WQQA 2FD6A 3L89M 2OYEP 1IOXA 2ERJA 4YLIA 1IQLL 4D0FA 2LS8A 2I9BA 3GOVA 4CSYA 3ZLDA 3R05A 3VWOA 4MSLA 1FVUB 2Y8RA 6COXA 5KIRA 2Y5FL 3LTFB 1XARA 2I83A 2CL8A 2VRSA 2RLPA 1IQML 3QMOA 2W3IB 4YNXA 2KRIA 5CISA 1B6EA 3LIWB 1BCJ1 1QGBA 1OZ7B 4GK1A 2BRSA 3K7BA 3CDGF 1OB1C 2ZQKA 2O39C 3PAQA 1BCH1 1T8CA 3WSYA 1RDO1 5KTIA 3NCWA 2Y7ZB 3TVJA 3L9JC 1BF9A 4QKIA 1EGIA 1TOZA 2BQ7A 4LMFA 1EPHA 1E5GA 3TK6B 1CWVA 3P7FA 2J38B 1C5MF 1KWXA 4PH9A 1GPZA 1TPNA 3WH2A 1EGFA 2KV3A 2FLBL 4KZWA 4A94C 2Y81B 2BQWA 2FLRL 1KWTA 4AYDA 4XBMA 2WPIE 1OJYA 2JJLA 5COXA 1CCFA 1YXJA 4XL1A 2BPHA 1V4LB 1EQGA 4QKHA 4RS0A 2XBYL 4BTTA 4J6MA 2MCYA 1RDN1 5JB9E 2V8EA 3ZYJB 3BDWA 4GI0A 1P4LD 3WHDA 2OX9A 1X2WB 4J6JA 1ATDA 2CG7A 2RIBA 4A7IA 1G1TA 3DBZA 5K8YA 1HT8A 1UKMA 1Y17A 4GJ0A 4TGFA 4ZXXL 3F6KA 3P7GA 1AUTL 2WPME 4G1MB 2BQ6A 2JRAA 2XC5L 2AFPA 1IQHL 5JPMG 2E3XC 1RLHA 1QDDA 2W26B 2RIAA 2VVCK 2Y82B 3POYA 3IKPA 1UOSA 1HCGB 1HFHA 1U0NC 3RR3A 1F7EA 1RTM1 4C16A 4ZETA 4YT6L 3QCWA 2FLGA 2W2OE 3BT2A 3NFPI 2IT5A 2YGQA 1YXKA 5FDQA 3TZIA 3ZHGD 1JV2B 2PY2A 3N8XA 1V3XB 1O9AA 3G8LA 4CAJA 4NG9L 2RIEA 3LN0A 1AFD1 4B2SA 2YGOA 1Z6EL 2AYLA 3ZHGA 3V64C 3GISX 2EC3A 1LPZA 1IVOC 1HT5A 3NCXA 2EI8B 1FIFA 2KB9A 1FBRA 1Z6CA 2WFXB 1APQA 3NTGA 1WMZA 1WMYA 2D1JB 4LU5A 1IGZA 2PR3B 2VWNL 2IZ4A 2A55A 3CADA 1QFKL 1EPJA 4E52A 2P26A 3OXUD 1KWYA 5JB8E 5L30L 2UWNA 1SL5A 1J34A 1ZAQA 2K2SB 4M17A 3KQGA 1V4LA 1I0UA 2XC0L 2KMB1 2P16L 4Z0LA 1KZC1 3V65B 2EI7B 1IQFL 2W80A 4APLA 4J6NA 3KRKA 4J6KA 1X2WA 3KQCL 2OS9A 5L2YL 1UV0A 4M11A 4AK8A 2ZYCA 4GJXA 3MQLA 2EHFA 1IP0A 1E8BA 2XWJI 1BYFA 1IGXA 1FE2A 3LC3B 1LY2A 3GPRC 5JVZA 1H03P 5B1WA 2YBYA 2ORKA 4N32A 1CVUA 1F7MA 5M62A 3NTBA 1HUPA 1LITA 3BDWB 1E87A 3WBQA 2H9EL 4WRFA 1MD8A 3C8KD 3HS6A 1UKMB 3FGRA 4GKOG 2XRDA 3OP8A 4WRCA 3C9AC 4NGAL 5B1RA 5I0QB 4M10A 3FGTA 4JHSA 2G00L 2YGPA 5LGKE 4CUFA 2BSFA 4WCOA 2Y38A 3F6UL 4ZH1D 2XC4L 1C1ZA 3VYKA 1RFNB 5CKNA 1ADXA 2W86A 1COUA 2G7IA 4N7EA 1BUUA 5IKTA 1NT0A 2BMGA 3WBPA 3ZD2A 1H2QP 2XR6A 3G84A 4BXSA 3IITB 4N36A 4Y79B 1DIYA 1WHEA 1L3YA 3P7HA 1ESLA 1SL4A 2BPEA 3DEMA 2N40A 2Q1JB 3VYJA 4PDCA 1MQ6L 1XPHA 1TN3A 4ZRWA 1NFUB 1FAXL 2FZZL 1QUBA 1HZ8A 3M7PA 2ADXA 1WK1A 4AYIA 1QO6A 3Q3KB 1KCGA 1Z92B 3GCXE 2CKUA 2M94A 3N8WA 2ZWKA 3WH3A 4BXWA 3LAQA 3P5BL 1KZD1 2P3TA 2KMSA 1ZJKA 3ZD1A 3GCWE 1LPGA 4IOPB 2WG4B 5KN5C 1PW9A 1G2MB 4G96A 5F1AA 5K0HB 1V1IA 1J34B 1U8CB 4F4OC 1KWWA 3ENSA 3CALA 3KQDL 5HYTB 2RKYA 1IXXB 2KL7A 3G83A 1G1RA 1FIHA 1OK3A 2MTIA 2VUVA 3BPSE 2W81A 2QY0A 4YT7L 1HQ8A 1FSBA 2OYUP 5HYPA 4FXGG 2KV4A 3TK5B 1YTTA 3KQBL 2MGPA 3ALTA 1VVDA 4YMDA 4EZMG 1KSNB 4N34A 3O8EB 1MSBA 3BX4B 4RUTA 1IOEL 4MTHA 3ELAL 1HX2A 3TH3L 5HZPB 3KQEL 3IKQA 1FAKL 4OTJA 1CX2A 1TPGA 2Y5GL 3U7UG 2GGXA 1YUKB 2P95L 1QIUA
chains in the Genus database with same CATH topology
1KWUA 1W7XL 4Y76B 2IZ3A 5IKQA 1KG0C 3PBFA 2EI6B 3P5IA 3K9XA 2PHBB 5CKQA 4D0EA 2XWBF 4KZVA 4ZRVA 4AYMA 3CDGE 3N8YA 2XRBA 5F19A 3CS7L 2Y7XB 2UWLB 4Y6DB 1YUGA 2CJIB 2J4IB 1KZA1 4O02B 3ALUA 2KNIA 3RS1A 3CENL 2H9EC 4JYUL 1KX0A 1GK5A 3SOQA 1DY2A 1EGGA 1O7CT 1N7DA 1UMRA 1F0SB 1EPGA 1Q4GA 4JZDL 4LOSA 1URKA 2ZIBA 1DX5I 3HS7A 4Y7AB 5I46L 1SZBA 4M1GA 2VH6B 3OLTA 4UXMA 1C3AA 2Y5HL 1DVAL 2UWPB 3SW0X 2VUZA 1CQEA 2W3KB 5JBAE 3INBC 2MHPA 1RDL1 3C22A 4IOPA 1P9JA 1UZKA 2GD4A 5IKRA 3HO3A 4N37A 1IQJL 1X7AL 2YHFA 3G81A 1KZB1 2WYGB 1KX1A 1LMMA 1FJSL 3IU3I 1IXXA 1SB2A 1EQHA 3KCGL 3N8WB 4N33A 1IQEL 2F9BL 4LQFA 1W8BL 3HUPA 3P5FA 3P5HA 1K36A 1GHQB 3ALSA 3TGFA 1HREA 1KZE1 3KK6A 4A5WB 1KOEA 1O7BT 1OK9A 2VVUL 1A3PA 3PGHA 1RDI1 3BX4A 4AYEA 2XBXL 4FM5A 2VRPA 1DV8A 2RA0L 1L5GB 1RDM1 1PTHA 2DDUA 1R13A 2J94B 3LN1A 4WUXA 1WT9B 2BO2A 1DY1A 3KXVA 4ZESA 5JBBE 4QKJA 2RKZA 1XFEA 1PFXL 1X2TB 3SW2A 3F1SB 4DN8A 4WUWA 2WPJE 1U0OA 1YO8A 1LMJA 1UZJA 1G4GA 4MUCA 1BJ3B 1Q3XA 1R14A 4WJG2 1TDQB 1DY0A 2WIIC 2E3XB 5EGMB 2RIDA 3BT1A 1KIGL 3CFWA 3RJ3D 5J6GG 4BTUA 2P28B 5JBCE 1H04P 2Y80B 4OTYA 1E5UI 1U0NB 1U67A 2H2RA 2WZPP 1MPUA 1HTNA 1J9CL 1F0RB 1PXXA 2GGUA 1WHFA 3ZYGA 1V7PA 3NT1A 4XLWA 3N8YB 2W2QE 1SS2A 4JYVL 4CUDA 2RNLA 1GKNA 1KWZA 4ISHL 2NPRA 4J6LA 3ZYIB 3HO5A 1UEXA 1N1IA 1OK2A 5FFSA 3OEDC 2P3UA 1PGEA 2RHPA 1LQDA 1JBUL 4PZ5A 1IJQA 2PF5A 3ASIA 3T3AA 1K37A 4JZEL 1XDTR 1KMB1 5L2ZL 3ZRZA 4Y71B 2J34B 3HS5A 1G4FA 1C3AB 2RLQA 1IQNL 1HYRA 1K9JA 5KTHA 2JKHL 4LOTA 3LC5B 3OLUA 4MMZB 1YPQA 3KL6B 4RRXA 1MOXC 3GXEA 3UBUB 1RDJ1 4X8TL 1ELVA 4X8SL 2BZMA 1MD7A 3WWKB 1SL6A 1J35A 1NFXB 1IODB 5FO8C 4IGDA 2OX8A 3FF7C 3FBYA 3H5CB 1KWVA 1F02I 1SB2B 4X8UL 1EBVA 3CCKA 1ATBA 2BPDA 4BTIA 1APOA 3WBRA 1QO3C 4AQTA 1PWBA 1IJKB 1WT9A 2H2TB 1JWIB 3FF9A 3FFGL 3FD4A 2PUQL 2UWOB 2BOUA 3EJHA 1AFA1 3MDLA 1X2TA 2RL0A 3KMB1 5CKMA 1BV4A 2BZ6L 5B1XA 1KLOA 2WG3C 3S6XA 5F2QA 2VRPB 4PP8A 1BJ3A 3GPRB 4J6PA 2WYJB 2VH0B 4ONTD 1TLEA 2RICA 2WPLE 3QH0A 1T8DA 4CUEA 4KKDA 2K2TA 1DQBA 1UOTP 2C6UA 4N38A 2W2ME 5FFRA 3NJPC 1NPEB 3T5OA 1MQ5L 4RRWA 4Z6AL 2CG6A 1FF7A 1H2PP 2WPHE 1NWVA 3IKRA 1OK1A 2MGRA 4S0UA 1CCVA 5E8DA 1U0OB 3C8JA 1LPKA 1H8UA 4QKGA 4RRYA 3U73A 1YPUA 1YUFA 1HRFA 1AFB1 4WR9A 1EPIA 3KZJA 1ATAA 1UZPA 4ZHAB 1G1QA 3N8ZA 2XR5A 4C9FA 1E88A 3SOBB 2J95B 3PARA 4BDXA 5FFTA 3IJEB 1U5MA 1YPOA 4B2RA 3ERBA 3R62A 4N35A 1EMOA 1V7PB 2VWMK 4ZH8B 1EAIC 3M37L 4JZFL 1GZ2A 2VWLL 2XQWC 3UBUA 1NQLB 1FVUA 3G8KA 1XKBA 2B7DL 3IX0A 1UEXB 2IT6A 1OJVA 3WWKA 4M18A 1EMNA 1NFWB 4E1GA 2JGWA 1F00I 3CA7A 2JGXA 1IODA 2XBVL 1CEJA 1RJHA 1OZ7A 1UMRC 4X8VL 1RDK1 1M1XB 4COXA 1JA3A 2P3FN 3FF8C 1HAEA 1ATEA 1PPQA 2GO0A 4MMYB 1JL9A 3HO4A 1UZQA 3MQEA 1HFIA 5JW1A 3VPPA 1JWIA 3GPRD 4KI1E 4ISIL 2B5ID 2VVVL 4RRZA 4BDWA 4J38B 3HPTA 2WFTA 3WWKC 1K9IA 4LORA 3P5GA 1J35B 2P3FL 3SOVA 3GPRA 2BOKL 4Z0KB 1P0SL 3WSRA 4Y7BB 1HJ7A 4MMXB 1IQKL 1CKLA 1E8IA 2W2NE 2W2PE 1IQGL 1HCCA 1PRHA 1KLJL 2I9AA 2P93L 4G9AA 3VLGA 4YZUB 1OJWA 1VVCA 3FCSB 1B08A 1IJKC 3EGFA 3M9ZA 1YGCL 4K12A 1EZQB 1IQIL 1NZIA 4ZXYL 3M36L 2ORJA 2J2UB 4O1ZA 3N8VA 1P1ZD 2MSBA 4UWWA 2VWOL 2MCZA 1JZNA 3PAKA 3P5DA 1G2LB 2LOJA 2XBWL 1MUQA 2M74A 1G1SA 1TLGA 1DDXA 1KLIL 1GKGA 4J6QA 2BOHA 2P94L 5IKVA 1B9WA 3LTGD 5HYUB 2YRAA 1WU1B 1Y17B 1FM5A 1XKAL 3IKNA 4ZAEB 4WREA 3TBDA 1O5DL 1NFYB 4DJZA 1TPMA 5JVYA 2TGFA 3Q7DA 3P5EA 4KMB1 1SRZA 4D90A 1UOSB 2BOXA 1CVWL 1FFMA 2WPKE 1BNLA 2VJ3A 1HAFA 4WQQA 2FD6A 3L89M 2OYEP 1IOXA 2ERJA 4YLIA 1IQLL 4D0FA 2LS8A 2I9BA 3GOVA 4CSYA 3R05A 1FVUB 6COXA 5KIRA 2Y5FL 3LTFB 1XARA 2I83A 2CL8A 2RLPA 1IQML 3QMOA 2W3IB 4YNXA 2KRIA 5CISA 1B6EA 3LIWB 1BCJ1 1QGBA 1OZ7B 4GK1A 2BRSA 3K7BA 3CDGF 1OB1C 2ZQKA 2O39C 3PAQA 1BCH1 1T8CA 1RDO1 5KTIA 3NCWA 2Y7ZB 3TVJA 3L9JC 1BF9A 4QKIA 1EGIA 1TOZA 2BQ7A 4LMFA 1EPHA 1E5GA 3TK6B 1CWVA 3P7FA 2J38B 1C5MF 1KWXA 4PH9A 1GPZA 1TPNA 3WH2A 1EGFA 2KV3A 2FLBL 4KZWA 4A94C 2Y81B 2BQWA 2FLRL 1KWTA 4AYDA 4XBMA 2WPIE 1OJYA 5COXA 1YXJA 1CCFA 4XL1A 2BPHA 1V4LB 1EQGA 4QKHA 4RS0A 2XBYL 4BTTA 4J6MA 2MCYA 1RDN1 5JB9E 2V8EA 3ZYJB 3BDWA 4GI0A 1P4LD 3WHDA 2OX9A 1X2WB 4J6JA 1ATDA 2CG7A 2RIBA 4A7IA 1G1TA 3DBZA 5K8YA 1HT8A 1UKMA 1Y17A 4GJ0A 4TGFA 4ZXXL 3P7GA 1AUTL 2WPME 4G1MB 2BQ6A 2JRAA 2XC5L 2AFPA 1IQHL 5JPMG 2E3XC 1QDDA 2W26B 2RIAA 2VVCK 2Y82B 3POYA 3IKPA 1UOSA 1HCGB 1HFHA 1U0NC 3RR3A 1F7EA 1RTM1 4C16A 4ZETA 4YT6L 3QCWA 2FLGA 2W2OE 3BT2A 3NFPI 2IT5A 2YGQA 1YXKA 5FDQA 3TZIA 3ZHGD 1JV2B 2PY2A 3N8XA 1V3XB 1O9AA 3G8LA 4CAJA 4NG9L 2RIEA 3LN0A 1AFD1 4B2SA 2YGOA 1Z6EL 2AYLA 3ZHGA 3V64C 3GISX 2EC3A 1LPZA 1IVOC 1HT5A 3NCXA 2EI8B 1FIFA 2KB9A 1FBRA 1Z6CA 2WFXB 1APQA 3NTGA 1WMZA 1WMYA 2D1JB 4LU5A 1IGZA 2PR3B 2VWNL 2IZ4A 2A55A 3CADA 1QFKL 1EPJA 4E52A 2P26A 3OXUD 1KWYA 5JB8E 5L30L 2UWNA 1SL5A 1J34A 1ZAQA 2K2SB 4M17A 3KQGA 1V4LA 1I0UA 2XC0L 2KMB1 2P16L 4Z0LA 1KZC1 3V65B 2EI7B 1IQFL 2W80A 4J6NA 4J6KA 3KRKA 1X2WA 3KQCL 2OS9A 5L2YL 1UV0A 4M11A 4AK8A 4GJXA 3MQLA 2EHFA 1IP0A 1E8BA 2XWJI 1BYFA 1IGXA 1FE2A 3LC3B 1LY2A 3GPRC 5JVZA 1H03P 5B1WA 2YBYA 2ORKA 4N32A 1CVUA 1F7MA 5M62A 3NTBA 1HUPA 1LITA 3BDWB 1E87A 3WBQA 2H9EL 4WRFA 1MD8A 3C8KD 3HS6A 1UKMB 4GKOG 2XRDA 3OP8A 4WRCA 3C9AC 4NGAL 5B1RA 5I0QB 4M10A 4JHSA 2G00L 2YGPA 5LGKE 4CUFA 4WCOA 2Y38A 3F6UL 4ZH1D 2XC4L 1C1ZA 3VYKA 1RFNB 5CKNA 1ADXA 2W86A 1COUA 2G7IA 1BUUA 5IKTA 1NT0A 2BMGA 3WBPA 3ZD2A 1H2QP 2XR6A 3G84A 4BXSA 3IITB 4N36A 4Y79B 1DIYA 1WHEA 1L3YA 3P7HA 1ESLA 1SL4A 2BPEA 3DEMA 2N40A 2Q1JB 3VYJA 4PDCA 1MQ6L 1XPHA 1TN3A 4ZRWA 1NFUB 1FAXL 2FZZL 1QUBA 1HZ8A 3M7PA 2ADXA 1WK1A 4AYIA 1QO6A 3Q3KB 1KCGA 1Z92B 3GCXE 2CKUA 2M94A 3N8WA 2ZWKA 3WH3A 4BXWA 3LAQA 3P5BL 1KZD1 2P3TA 2KMSA 1ZJKA 3ZD1A 3GCWE 1LPGA 4IOPB 2WG4B 5KN5C 1PW9A 1G2MB 4G96A 5F1AA 5K0HB 1J34B 1U8CB 4F4OC 1KWWA 3ENSA 3CALA 3KQDL 5HYTB 2RKYA 1IXXB 2KL7A 3G83A 1G1RA 1FIHA 1OK3A 2MTIA 2VUVA 3BPSE 2W81A 2QY0A 4YT7L 1HQ8A 1FSBA 2OYUP 5HYPA 4FXGG 2KV4A 3TK5B 1YTTA 3KQBL 2MGPA 3ALTA 1VVDA 4YMDA 4EZMG 1KSNB 4N34A 3O8EB 1MSBA 3BX4B 4RUTA 1IOEL 4MTHA 3ELAL 1HX2A 3TH3L 5HZPB 3KQEL 3IKQA 1FAKL 4OTJA 1CX2A 1TPGA 2Y5GL 3U7UG 2GGXA 1YUKB 2P95L 4NA9L
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KWU A;  1W7X L;  4Y76 B;  2IZ3 A;  5IKQ A;  1KG0 C;  3PBF A;  2EI6 B;  3P5I A;  3K9X A;  2PHB B;  5CKQ A;  4D0E A;  2XWB F;  4KZV A;  4ZRV A;  4AYM A;  3CDG E;  3N8Y A;  2XRB A;  5F19 A;  3CS7 L;  2Y7X B;  2UWL B;  4Y6D B;  1YUG A;  2CJI B;  2J4I B;  1KZA 1;  4O02 B;  3ALU A;  3RS1 A;  3CEN L;  4JYU L;  1KX0 A;  1GK5 A;  3SOQ A;  1DY2 A;  1EGG A;  1O7C T;  1N7D A;  1UMR A;  1F0S B;  1EPG A;  1Q4G A;  4JZD L;  4LOS A;  1URK A;  2ZIB A;  1DX5 I;  3HS7 A;  4Y7A B;  5I46 L;  1SZB A;  4M1G A;  2VH6 B;  3OLT A;  4UXM A;  1C3A A;  2Y5H L;  1DVA L;  2UWP B;  3SW0 X;  2VUZ A;  1CQE A;  2W3K B;  5JBA E;  3INB C;  2MHP A;  1RDL 1;  3C22 A;  4IOP A;  1P9J A;  1UZK A;  2GD4 A;  5IKR A;  3HO3 A;  4N37 A;  1IQJ L;  1X7A L;  2YHF A;  3G81 A;  1KZB 1;  2WYG B;  1KX1 A;  1FJS L;  3IU3 I;  1IXX A;  1SB2 A;  1EQH A;  3KCG L;  3N8W B;  4N33 A;  1IQE L;  2F9B L;  4LQF A;  1W8B L;  3HUP A;  3P5F A;  3P5H A;  1K36 A;  1GHQ B;  3ALS A;  3TGF A;  1HRE A;  1KZE 1;  3KK6 A;  4A5W B;  1KOE A;  1O7B T;  1OK9 A;  2VVU L;  1A3P A;  3PGH A;  1RDI 1;  3BX4 A;  4AYE A;  2XBX L;  4FM5 A;  2VRP A;  1DV8 A;  2RA0 L;  1L5G B;  1RDM 1;  1PTH A;  2DDU A;  1R13 A;  2J94 B;  3LN1 A;  4WUX A;  1WT9 B;  2BO2 A;  1DY1 A;  3KXV A;  4ZES A;  5JBB E;  4QKJ A;  2RKZ A;  1XFE A;  1PFX L;  1X2T B;  3SW2 A;  3F1S B;  4DN8 A;  4WUW A;  2WPJ E;  1U0O A;  1YO8 A;  1LMJ A;  1UZJ A;  1G4G A;  4MUC A;  1BJ3 B;  1Q3X A;  1R14 A;  4WJG 2;  1TDQ B;  1DY0 A;  2WII C;  2E3X B;  5EGM B;  2RID A;  3BT1 A;  1KIG L;  3CFW A;  3RJ3 D;  5J6G G;  4BTU A;  2P28 B;  5JBC E;  1H04 P;  2Y80 B;  4OTY A;  1E5U I;  1U0N B;  1U67 A;  2H2R A;  1MPU A;  1HTN A;  1J9C L;  1F0R B;  1PXX A;  2GGU A;  1WHF A;  3ZYG A;  1V7P A;  3NT1 A;  4XLW A;  3N8Y B;  2W2Q E;  1SS2 A;  4JYV L;  4CUD A;  2RNL A;  1GKN A;  1KWZ A;  4ISH L;  2NPR A;  4J6L A;  3ZYI B;  3HO5 A;  1UEX A;  1N1I A;  1OK2 A;  5FFS A;  3OED C;  2P3U A;  1PGE A;  2RHP A;  1LQD A;  1JBU L;  4PZ5 A;  1IJQ A;  2PF5 A;  3ASI A;  3T3A A;  1K37 A;  4JZE L;  1XDT R;  1KMB 1;  5L2Z L;  3ZRZ A;  4Y71 B;  2J34 B;  3HS5 A;  1G4F A;  1C3A B;  2RLQ A;  1IQN L;  1HYR A;  1K9J A;  5KTH A;  2JKH L;  4LOT A;  3LC5 B;  3OLU A;  4MMZ B;  1YPQ A;  3KL6 B;  4RRX A;  1MOX C;  3GXE A;  3UBU B;  1RDJ 1;  4X8T L;  1ELV A;  4X8S L;  2BZM A;  1MD7 A;  3WWK B;  1SL6 A;  1J35 A;  1NFX B;  1IOD B;  5FO8 C;  4IGD A;  2OX8 A;  3FF7 C;  3FBY A;  3H5C B;  1KWV A;  1F02 I;  1SB2 B;  4X8U L;  1EBV A;  3CCK A;  1ATB A;  2BPD A;  4BTI A;  1APO A;  3WBR A;  1QO3 C;  4AQT A;  1PWB A;  1IJK B;  1WT9 A;  2H2T B;  1JWI B;  3FF9 A;  3FFG L;  3FD4 A;  2PUQ L;  2UWO B;  2BOU A;  3EJH A;  1AFA 1;  3MDL A;  1X2T A;  2RL0 A;  3KMB 1;  5CKM A;  1BV4 A;  2BZ6 L;  5B1X A;  1KLO A;  2WG3 C;  5F2Q A;  2VRP B;  4PP8 A;  1BJ3 A;  3GPR B;  4J6P A;  2WYJ B;  2VH0 B;  4ONT D;  1TLE A;  2RIC A;  2WPL E;  3QH0 A;  1T8D A;  4CUE A;  4KKD A;  2K2T A;  1DQB A;  1UOT P;  2C6U A;  4N38 A;  2W2M E;  5FFR A;  3NJP C;  1NPE B;  3T5O A;  1MQ5 L;  4RRW A;  4Z6A L;  2CG6 A;  1FF7 A;  1H2P P;  2WPH E;  1NWV A;  3IKR A;  1OK1 A;  2MGR A;  4S0U A;  1CCV A;  5E8D A;  1U0O B;  3C8J A;  1LPK A;  1H8U A;  4QKG A;  4RRY A;  3U73 A;  1YPU A;  1YUF A;  1HRF A;  1AFB 1;  4WR9 A;  1EPI A;  3KZJ A;  1ATA A;  1UZP A;  4ZHA B;  1G1Q A;  3N8Z A;  2XR5 A;  4C9F A;  1E88 A;  3SOB B;  2J95 B;  3PAR A;  4BDX A;  5FFT A;  3IJE B;  1U5M A;  1YPO A;  4B2R A;  3ERB A;  3R62 A;  4N35 A;  1EMO A;  1V7P B;  2VWM K;  4ZH8 B;  1EAI C;  3M37 L;  4JZF L;  1GZ2 A;  2VWL L;  2XQW C;  3UBU A;  1NQL B;  1FVU A;  3G8K A;  1XKB A;  2B7D L;  3IX0 A;  1UEX B;  2IT6 A;  1OJV A;  3WWK A;  4M18 A;  1EMN A;  1NFW B;  4E1G A;  2JGW A;  1F00 I;  3CA7 A;  2JGX A;  1IOD A;  2XBV L;  1CEJ A;  1RJH A;  1OZ7 A;  1UMR C;  4X8V L;  1RDK 1;  1M1X B;  4COX A;  1JA3 A;  2P3F N;  3FF8 C;  1HAE A;  1ATE A;  1PPQ A;  2GO0 A;  4MMY B;  1JL9 A;  3HO4 A;  1UZQ A;  3MQE A;  1HFI A;  5JW1 A;  3VPP A;  1JWI A;  3GPR D;  4KI1 E;  4ISI L;  2B5I D;  2VVV L;  4RRZ A;  4BDW A;  4J38 B;  3HPT A;  2WFT A;  3WWK C;  1K9I A;  4LOR A;  3P5G A;  1J35 B;  2P3F L;  3SOV A;  3GPR A;  2BOK L;  4Z0K B;  1P0S L;  3WSR A;  4Y7B B;  1HJ7 A;  4MMX B;  1IQK L;  1CKL A;  1E8I A;  2W2N E;  2W2P E;  1IQG L;  1HCC A;  1PRH A;  1KLJ L;  2I9A A;  2P93 L;  4G9A A;  3VLG A;  4YZU B;  1OJW A;  1VVC A;  3FCS B;  1B08 A;  1IJK C;  3EGF A;  3M9Z A;  1YGC L;  4K12 A;  1EZQ B;  1IQI L;  1NZI A;  4ZXY L;  3M36 L;  2ORJ A;  2J2U B;  4O1Z A;  3N8V A;  1P1Z D;  2MSB A;  4UWW A;  2VWO L;  2MCZ A;  1JZN A;  3PAK A;  3P5D A;  1G2L B;  2LOJ A;  2XBW L;  1MUQ A;  2M74 A;  1G1S A;  1TLG A;  1DDX A;  1KLI L;  1GKG A;  4J6Q A;  2BOH A;  2P94 L;  5IKV A;  1B9W A;  3LTG D;  5HYU B;  2YRA A;  1WU1 B;  1Y17 B;  1FM5 A;  1XKA L;  3IKN A;  4ZAE B;  4WRE A;  3TBD A;  1O5D L;  1NFY B;  4DJZ A;  1TPM A;  5JVY A;  2TGF A;  3Q7D A;  3P5E A;  4KMB 1;  1SRZ A;  4D90 A;  1UOS B;  2BOX A;  1CVW L;  1FFM A;  2WPK E;  1BNL A;  2VJ3 A;  1HAF A;  4WQQ A;  2FD6 A;  3L89 M;  2OYE P;  1IOX A;  2ERJ A;  4YLI A;  1IQL L;  4D0F A;  2LS8 A;  2I9B A;  3GOV A;  4CSY A;  3R05 A;  1FVU B;  6COX A;  5KIR A;  2Y5F L;  3LTF B;  1XAR A;  2I83 A;  2CL8 A;  2RLP A;  1IQM L;  3QMO A;  2W3I B;  4YNX A;  2KRI A;  5CIS A;  1B6E A;  3LIW B;  1BCJ 1;  1QGB A;  1OZ7 B;  4GK1 A;  2BRS A;  3K7B A;  3CDG F;  1OB1 C;  2ZQK A;  2O39 C;  3PAQ A;  1BCH 1;  1T8C A;  1RDO 1;  5KTI A;  3NCW A;  2Y7Z B;  3TVJ A;  3L9J C;  1BF9 A;  4QKI A;  1EGI A;  1TOZ A;  2BQ7 A;  4LMF A;  1EPH A;  1E5G A;  3TK6 B;  1CWV A;  3P7F A;  2J38 B;  1C5M F;  1KWX A;  4PH9 A;  1GPZ A;  1TPN A;  3WH2 A;  1EGF A;  2KV3 A;  2FLB L;  4KZW A;  2Y81 B;  2BQW A;  2FLR L;  1KWT A;  4AYD A;  4XBM A;  2WPI E;  1OJY A;  5COX A;  1YXJ A;  1CCF A;  4XL1 A;  2BPH A;  1V4L B;  1EQG A;  4QKH A;  4RS0 A;  2XBY L;  4BTT A;  4J6M A;  2MCY A;  1RDN 1;  5JB9 E;  2V8E A;  3ZYJ B;  3BDW A;  4GI0 A;  1P4L D;  3WHD A;  2OX9 A;  1X2W B;  4J6J A;  1ATD A;  2CG7 A;  2RIB A;  4A7I A;  1G1T A;  3DBZ A;  5K8Y A;  1HT8 A;  1UKM A;  1Y17 A;  4GJ0 A;  4TGF A;  4ZXX L;  3P7G A;  1AUT L;  2WPM E;  4G1M B;  2BQ6 A;  2JRA A;  2XC5 L;  2AFP A;  1IQH L;  5JPM G;  2E3X C;  1QDD A;  2W26 B;  2RIA A;  2VVC K;  2Y82 B;  3POY A;  3IKP A;  1UOS A;  1HCG B;  1HFH A;  1U0N C;  3RR3 A;  1F7E A;  1RTM 1;  4C16 A;  4ZET A;  4YT6 L;  3QCW A;  2FLG A;  2W2O E;  3BT2 A;  3NFP I;  2IT5 A;  1YXK A;  5FDQ A;  3TZI A;  3ZHG D;  1JV2 B;  2PY2 A;  3N8X A;  1V3X B;  1O9A A;  3G8L A;  4CAJ A;  4NG9 L;  2RIE A;  3LN0 A;  1AFD 1;  4B2S A;  2YGO A;  1Z6E L;  2AYL A;  3ZHG A;  3V64 C;  3GIS X;  2EC3 A;  1LPZ A;  1IVO C;  1HT5 A;  3NCX A;  2EI8 B;  1FIF A;  2KB9 A;  1FBR A;  1Z6C A;  2WFX B;  1APQ A;  3NTG A;  1WMZ A;  1WMY A;  2D1J B;  4LU5 A;  1IGZ A;  2PR3 B;  2VWN L;  2IZ4 A;  2A55 A;  3CAD A;  1QFK L;  1EPJ A;  4E52 A;  2P26 A;  3OXU D;  1KWY A;  5JB8 E;  5L30 L;  2UWN A;  1SL5 A;  1J34 A;  1ZAQ A;  2K2S B;  4M17 A;  3KQG A;  1V4L A;  1I0U A;  2XC0 L;  2KMB 1;  2P16 L;  4Z0L A;  1KZC 1;  3V65 B;  2EI7 B;  1IQF L;  2W80 A;  4J6N A;  4J6K A;  3KRK A;  1X2W A;  3KQC L;  2OS9 A;  5L2Y L;  1UV0 A;  4M11 A;  4AK8 A;  4GJX A;  3MQL A;  2EHF A;  1IP0 A;  1E8B A;  2XWJ I;  1BYF A;  1IGX A;  1FE2 A;  3LC3 B;  1LY2 A;  3GPR C;  5JVZ A;  1H03 P;  5B1W A;  2YBY A;  2ORK A;  4N32 A;  1CVU A;  1F7M A;  5M62 A;  3NTB A;  1HUP A;  1LIT A;  3BDW B;  1E87 A;  3WBQ A;  2H9E L;  4WRF A;  1MD8 A;  3C8K D;  3HS6 A;  1UKM B;  4GKO G;  2XRD A;  3OP8 A;  4WRC A;  3C9A C;  4NGA L;  5B1R A;  5I0Q B;  4M10 A;  4JHS A;  2G00 L;  2YGP A;  5LGK E;  4CUF A;  4WCO A;  2Y38 A;  3F6U L;  4ZH1 D;  2XC4 L;  1C1Z A;  3VYK A;  1RFN B;  5CKN A;  1ADX A;  2W86 A;  1COU A;  2G7I A;  1BUU A;  5IKT A;  1NT0 A;  2BMG A;  3WBP A;  3ZD2 A;  1H2Q P;  2XR6 A;  3G84 A;  4BXS A;  3IIT B;  4N36 A;  4Y79 B;  1DIY A;  1WHE A;  1L3Y A;  3P7H A;  1ESL A;  1SL4 A;  2BPE A;  3DEM A;  2N40 A;  2Q1J B;  3VYJ A;  4PDC A;  1MQ6 L;  1XPH A;  1TN3 A;  4ZRW A;  1NFU B;  1FAX L;  2FZZ L;  1QUB A;  1HZ8 A;  3M7P A;  2ADX A;  1WK1 A;  4AYI A;  1QO6 A;  3Q3K B;  1KCG A;  1Z92 B;  3GCX E;  2CKU A;  2M94 A;  3N8W A;  2ZWK A;  3WH3 A;  4BXW A;  3LAQ A;  3P5B L;  1KZD 1;  2P3T A;  2KMS A;  1ZJK A;  3ZD1 A;  3GCW E;  1LPG A;  4IOP B;  2WG4 B;  5KN5 C;  1PW9 A;  1G2M B;  4G96 A;  5F1A A;  5K0H B;  1J34 B;  1U8C B;  4F4O C;  1KWW A;  3ENS A;  3CAL A;  3KQD L;  5HYT B;  2RKY A;  1IXX B;  2KL7 A;  3G83 A;  1G1R A;  1FIH A;  1OK3 A;  2MTI A;  2VUV A;  3BPS E;  2W81 A;  2QY0 A;  4YT7 L;  1HQ8 A;  1FSB A;  2OYU P;  5HYP A;  4FXG G;  2KV4 A;  3TK5 B;  1YTT A;  3KQB L;  2MGP A;  3ALT A;  1VVD A;  4YMD A;  4EZM G;  1KSN B;  4N34 A;  3O8E B;  1MSB A;  3BX4 B;  4RUT A;  1IOE L;  4MTH A;  3ELA L;  1HX2 A;  3TH3 L;  5HZP B;  3KQE L;  3IKQ A;  1FAK L;  4OTJ A;  1CX2 A;  1TPG A;  2Y5G L;  3U7U G;  2GGX A;  1YUK B;  2P95 L;  4NA9 L; 
#chains in the Genus database with same CATH topology
 1KWU A;  1W7X L;  4Y76 B;  2IZ3 A;  5IKQ A;  1KG0 C;  3PBF A;  2EI6 B;  3P5I A;  2BT7 A;  2PHB B;  3K9X A;  5CKQ A;  4D0E A;  2XWB F;  4KZV A;  4AYM A;  3CDG E;  3N8Y A;  2XRB A;  5F19 A;  3CS7 L;  2Y7X B;  2UWL B;  4Y6D B;  1YUG A;  2CJI B;  2J4I B;  1KZA 1;  4O02 B;  3ALU A;  2KNI A;  3RS1 A;  3CEN L;  2H9E C;  4JYU L;  1KX0 A;  1GK5 A;  3SOQ A;  1DY2 A;  1EGG A;  1O7C T;  5DN5 A;  1N7D A;  3K3T A;  1UMR A;  1F0S B;  1EPG A;  1Q4G A;  4JZD L;  2X2Z A;  1URK A;  3NJA A;  4LOS A;  1DX5 I;  3HS7 A;  4Y7A B;  1KKE A;  5I46 L;  1SZB A;  2ZIB A;  4M1G A;  2VH6 B;  3OLT A;  4UXM A;  1C3A A;  2Y5H L;  1DVA L;  2UWP B;  3SW0 X;  2VUZ A;  1CQE A;  2W3K B;  5JBA E;  3INB C;  2MHP A;  1RDL 1;  3C22 A;  4IOP A;  1P9J A;  1UZK A;  2GD4 A;  5IKR A;  3HO3 A;  4N37 A;  1IQJ L;  1X7A L;  2YHF A;  3G81 A;  1KZB 1;  2WYG B;  1KX1 A;  5DN4 A;  1LMM A;  1FJS L;  3IU3 I;  1IXX A;  1SB2 A;  1EQH A;  3KCG L;  4BWC A;  3N8W B;  4N33 A;  1IQE L;  2F9B L;  4LQF A;  1W8B L;  3HUP A;  3P5F A;  3P5H A;  1K36 A;  1GHQ B;  3ALS A;  3TGF A;  1HRE A;  1KZE 1;  3KK6 A;  4A5W B;  1KOE A;  1O7B T;  1OK9 A;  2VVU L;  1A3P A;  3PGH A;  1RDI 1;  3BX4 A;  4AYE A;  2XBX L;  4FM5 A;  2VRP A;  1DV8 A;  2RA0 L;  1L5G B;  1RDM 1;  1PTH A;  2DDU A;  1R13 A;  2J94 B;  3LN1 A;  2Y8S A;  4WUX A;  1WT9 B;  2BO2 A;  1DY1 A;  3KXV A;  4ZES A;  5JBB E;  4QKJ A;  2RKZ A;  1LK9 A;  1PFX L;  1XFE A;  1X2T B;  3SW2 A;  3F1S B;  4DN8 A;  4WUW A;  2WPJ E;  1U0O A;  1YO8 A;  1LMJ A;  1UZJ A;  1G4G A;  4MUC A;  1BJ3 B;  1Q3X A;  1R14 A;  4WJG 2;  1TDQ B;  1DY0 A;  2WII C;  2E3X B;  5EGM B;  2RID A;  3BT1 A;  1KIG L;  3CFW A;  3RJ3 D;  5J6G G;  4BTU A;  2P28 B;  5JBC E;  1H04 P;  2Y80 B;  4OTY A;  1E5U I;  1U0N B;  1U67 A;  2H2R A;  2WZP P;  1MPU A;  2Y8T A;  1J9C L;  1F0R B;  1PXX A;  1HTN A;  2GGU A;  1WHF A;  3ZYG A;  1V7P A;  3NT1 A;  4XLW A;  3N8Y B;  2W2Q E;  1SS2 A;  4JYV L;  2I2L A;  4CUD A;  2RNL A;  1GKN A;  1KWZ A;  4ISH L;  2NPR A;  4J6L A;  3ZYI B;  3HO5 A;  1UEX A;  1N1I A;  1OK2 A;  5FFS A;  3OED C;  2HOR A;  2P3U A;  1PGE A;  2RHP A;  4YIZ A;  1LQD A;  1JBU L;  4PZ5 A;  1IJQ A;  2PF5 A;  3ASI A;  3T3A A;  1K37 A;  4JZE L;  1XDT R;  1KMB 1;  4ZRV A;  5L2Z L;  3ZRZ A;  4Y71 B;  2J34 B;  3HS5 A;  1G4F A;  1C3A B;  2RLQ A;  1IQN L;  1HYR A;  1K9J A;  5KTH A;  2JKH L;  4LOT A;  3LC5 B;  3OLU A;  4MMZ B;  1YPQ A;  3KL6 B;  4RRX A;  1MOX C;  3GXE A;  3UBU B;  1RDJ 1;  4X8T L;  1ELV A;  4X8S L;  2BZM A;  1MD7 A;  3WWK B;  1SL6 A;  1J35 A;  1NFX B;  1IOD B;  5FO8 C;  4IGD A;  2OX8 A;  3FF7 C;  3FBY A;  3H5C B;  1KWV A;  1F02 I;  1SB2 B;  4X8U L;  1EBV A;  3CCK A;  1ATB A;  2BPD A;  4BTI A;  1APO A;  3WBR A;  1QO3 C;  4AQT A;  1PWB A;  1IJK B;  1WT9 A;  2H2T B;  1JWI B;  3FF9 A;  3FFG L;  3FD4 A;  2PUQ L;  2UWO B;  2BOU A;  3EJH A;  1AFA 1;  3MDL A;  1X2T A;  2RL0 A;  3KMB 1;  5CKM A;  1BV4 A;  2BZ6 L;  5B1X A;  1KLO A;  2WG3 C;  3S6X A;  5F2Q A;  2VRP B;  4PP8 A;  1BJ3 A;  3GPR B;  4J6P A;  2WYJ B;  2VH0 B;  4GU4 A;  1TLE A;  4ONT D;  2WPL E;  2RIC A;  3QH0 A;  1T8D A;  4CUE A;  4KKD A;  2K2T A;  1DQB A;  1UOT P;  2C6U A;  4N38 A;  2W2M E;  5FFR A;  3NJP C;  1NPE B;  3T5O A;  1MQ5 L;  4RRW A;  4Z6A L;  2CG6 A;  1FF7 A;  1H2P P;  3ZLE A;  2WPH E;  1NWV A;  3IKR A;  1OK1 A;  2MGR A;  4S0U A;  1CCV A;  5E8D A;  1U0O B;  3C8J A;  4PO7 A;  1LPK A;  1H8U A;  4QKG A;  4RRY A;  3U73 A;  1YPU A;  1YUF A;  1HRF A;  1AFB 1;  4WR9 A;  1EPI A;  3KZJ A;  1ATA A;  1UZP A;  4ZHA B;  1G1Q A;  3N8Z A;  2XR5 A;  4C9F A;  1E88 A;  3SOB B;  2J95 B;  3PAR A;  4BDX A;  5FFT A;  3IJE B;  1U5M A;  1YPO A;  4B2R A;  3ERB A;  3R62 A;  4N35 A;  1EMO A;  1V7P B;  2VWM K;  4ZH8 B;  1EAI C;  3M37 L;  4JZF L;  1GZ2 A;  2VWL L;  2XQW C;  3UBU A;  1NQL B;  1FVU A;  3G8K A;  1XKB A;  2B7D L;  3IX0 A;  1UEX B;  2IT6 A;  1OJV A;  3WWK A;  4M18 A;  1EMN A;  1NFW B;  4E1G A;  2JGW A;  1F00 I;  3CA7 A;  2JGX A;  1IOD A;  2XBV L;  1CEJ A;  1RJH A;  1OZ7 A;  1UMR C;  4X8V L;  1RDK 1;  1M1X B;  4COX A;  1JA3 A;  2P3F N;  3FF8 C;  1HAE A;  1ATE A;  1PPQ A;  2GO0 A;  4MMY B;  1JL9 A;  2HOX A;  3HO4 A;  1UZQ A;  3MQE A;  1HFI A;  5JW1 A;  3VPP A;  1JWI A;  3GPR D;  4KI1 E;  4ISI L;  2B5I D;  2VVV L;  4RRZ A;  4BDW A;  4J38 B;  3HPT A;  2WFT A;  3WWK C;  1K9I A;  4LOR A;  3P5G A;  1J35 B;  2P3F L;  3SOV A;  3GPR A;  2BOK L;  4Z0K B;  1P0S L;  3WSR A;  4Y7B B;  1HJ7 A;  4MMX B;  1IQK L;  1CKL A;  1E8I A;  2W2N E;  2W2P E;  1IQG L;  1HCC A;  3CI0 J;  1PRH A;  1KLJ L;  2I9A A;  2P93 L;  4G9A A;  3VLG A;  4YZU B;  1OJW A;  1VVC A;  3FCS B;  1B08 A;  1IJK C;  3EGF A;  3M9Z A;  1YGC L;  4K12 A;  1EZQ B;  1IQI L;  1NZI A;  4ZXY L;  3M36 L;  2ORJ A;  2J2U B;  4O1Z A;  3N8V A;  1P1Z D;  2MSB A;  4UWW A;  2VWO L;  2MCZ A;  4NA9 L;  1JZN A;  3PAK A;  3P5D A;  1G2L B;  2LOJ A;  2XBW L;  1MUQ A;  2M74 A;  1G1S A;  1TLG A;  1DDX A;  1KLI L;  1GKG A;  4J6Q A;  2BOH A;  2P94 L;  5IKV A;  1B9W A;  3LTG D;  4GU3 A;  5HYU B;  2YRA A;  1WU1 B;  1Y17 B;  1V1H A;  1FM5 A;  1XKA L;  3IKN A;  4ZAE B;  4WRE A;  2BT8 A;  3TBD A;  1O5D L;  1NFY B;  4DJZ A;  1TPM A;  5JVY A;  2TGF A;  3Q7D A;  3P5E A;  3WSX A;  4KMB 1;  1SRZ A;  4D90 A;  1UOS B;  2BOX A;  1CVW L;  1FFM A;  2WPK E;  1BNL A;  2VJ3 A;  1HAF A;  4WQQ A;  2FD6 A;  3L89 M;  2OYE P;  1IOX A;  2ERJ A;  4YLI A;  1IQL L;  4D0F A;  2LS8 A;  2I9B A;  3GOV A;  4CSY A;  3ZLD A;  3R05 A;  3VWO A;  4MSL A;  1FVU B;  2Y8R A;  6COX A;  5KIR A;  2Y5F L;  3LTF B;  1XAR A;  2I83 A;  2CL8 A;  2VRS A;  2RLP A;  1IQM L;  3QMO A;  2W3I B;  4YNX A;  2KRI A;  5CIS A;  1B6E A;  3LIW B;  1BCJ 1;  1QGB A;  1OZ7 B;  4GK1 A;  2BRS A;  3K7B A;  3CDG F;  1OB1 C;  2ZQK A;  2O39 C;  3PAQ A;  1BCH 1;  1T8C A;  3WSY A;  1RDO 1;  5KTI A;  3NCW A;  2Y7Z B;  3TVJ A;  3L9J C;  1BF9 A;  4QKI A;  1EGI A;  1TOZ A;  2BQ7 A;  4LMF A;  1EPH A;  1E5G A;  3TK6 B;  1CWV A;  3P7F A;  2J38 B;  1C5M F;  1KWX A;  4PH9 A;  1GPZ A;  1TPN A;  3WH2 A;  1EGF A;  2KV3 A;  2FLB L;  4KZW A;  4A94 C;  2Y81 B;  2BQW A;  2FLR L;  1KWT A;  4AYD A;  4XBM A;  2WPI E;  1OJY A;  2JJL A;  5COX A;  1CCF A;  1YXJ A;  4XL1 A;  2BPH A;  1V4L B;  1EQG A;  4QKH A;  4RS0 A;  2XBY L;  4BTT A;  4J6M A;  2MCY A;  1RDN 1;  5JB9 E;  2V8E A;  3ZYJ B;  3BDW A;  4GI0 A;  1P4L D;  3WHD A;  2OX9 A;  1X2W B;  4J6J A;  1ATD A;  2CG7 A;  2RIB A;  4A7I A;  1G1T A;  3DBZ A;  5K8Y A;  1HT8 A;  1UKM A;  1Y17 A;  4GJ0 A;  4TGF A;  4ZXX L;  3F6K A;  3P7G A;  1AUT L;  2WPM E;  4G1M B;  2BQ6 A;  2JRA A;  2XC5 L;  2AFP A;  1IQH L;  5JPM G;  2E3X C;  1RLH A;  1QDD A;  2W26 B;  2RIA A;  2VVC K;  2Y82 B;  3POY A;  3IKP A;  1UOS A;  1HCG B;  1HFH A;  1U0N C;  3RR3 A;  1F7E A;  1RTM 1;  4C16 A;  4ZET A;  4YT6 L;  3QCW A;  2FLG A;  2W2O E;  3BT2 A;  3NFP I;  2IT5 A;  2YGQ A;  1YXK A;  5FDQ A;  3TZI A;  3ZHG D;  1JV2 B;  2PY2 A;  3N8X A;  1V3X B;  1O9A A;  3G8L A;  4CAJ A;  4NG9 L;  2RIE A;  3LN0 A;  1AFD 1;  4B2S A;  2YGO A;  1Z6E L;  2AYL A;  3ZHG A;  3V64 C;  3GIS X;  2EC3 A;  1LPZ A;  1IVO C;  1HT5 A;  3NCX A;  2EI8 B;  1FIF A;  2KB9 A;  1FBR A;  1Z6C A;  2WFX B;  1APQ A;  3NTG A;  1WMZ A;  1WMY A;  2D1J B;  4LU5 A;  1IGZ A;  2PR3 B;  2VWN L;  2IZ4 A;  2A55 A;  3CAD A;  1QFK L;  1EPJ A;  4E52 A;  2P26 A;  3OXU D;  1KWY A;  5JB8 E;  5L30 L;  2UWN A;  1SL5 A;  1J34 A;  1ZAQ A;  2K2S B;  4M17 A;  3KQG A;  1V4L A;  1I0U A;  2XC0 L;  2KMB 1;  2P16 L;  4Z0L A;  1KZC 1;  3V65 B;  2EI7 B;  1IQF L;  2W80 A;  4APL A;  4J6N A;  3KRK A;  4J6K A;  1X2W A;  3KQC L;  2OS9 A;  5L2Y L;  1UV0 A;  4M11 A;  4AK8 A;  2ZYC A;  4GJX A;  3MQL A;  2EHF A;  1IP0 A;  1E8B A;  2XWJ I;  1BYF A;  1IGX A;  1FE2 A;  3LC3 B;  1LY2 A;  3GPR C;  5JVZ A;  1H03 P;  5B1W A;  2YBY A;  2ORK A;  4N32 A;  1CVU A;  1F7M A;  5M62 A;  3NTB A;  1HUP A;  1LIT A;  3BDW B;  1E87 A;  3WBQ A;  2H9E L;  4WRF A;  1MD8 A;  3C8K D;  3HS6 A;  1UKM B;  3FGR A;  4GKO G;  2XRD A;  3OP8 A;  4WRC A;  3C9A C;  4NGA L;  5B1R A;  5I0Q B;  4M10 A;  3FGT A;  4JHS A;  2G00 L;  2YGP A;  5LGK E;  4CUF A;  2BSF A;  4WCO A;  2Y38 A;  3F6U L;  4ZH1 D;  2XC4 L;  1C1Z A;  3VYK A;  1RFN B;  5CKN A;  1ADX A;  2W86 A;  1COU A;  2G7I A;  4N7E A;  1BUU A;  5IKT A;  1NT0 A;  2BMG A;  3WBP A;  3ZD2 A;  1H2Q P;  2XR6 A;  3G84 A;  4BXS A;  3IIT B;  4N36 A;  4Y79 B;  1DIY A;  1WHE A;  1L3Y A;  3P7H A;  1ESL A;  1SL4 A;  2BPE A;  3DEM A;  2N40 A;  2Q1J B;  3VYJ A;  4PDC A;  1MQ6 L;  1XPH A;  1TN3 A;  4ZRW A;  1NFU B;  1FAX L;  2FZZ L;  1QUB A;  1HZ8 A;  3M7P A;  2ADX A;  1WK1 A;  4AYI A;  1QO6 A;  3Q3K B;  1KCG A;  1Z92 B;  3GCX E;  2CKU A;  2M94 A;  3N8W A;  2ZWK A;  3WH3 A;  4BXW A;  3LAQ A;  3P5B L;  1KZD 1;  2P3T A;  2KMS A;  1ZJK A;  3ZD1 A;  3GCW E;  1LPG A;  4IOP B;  2WG4 B;  5KN5 C;  1PW9 A;  1G2M B;  4G96 A;  5F1A A;  5K0H B;  1V1I A;  1J34 B;  1U8C B;  4F4O C;  1KWW A;  3ENS A;  3CAL A;  3KQD L;  5HYT B;  2RKY A;  1IXX B;  2KL7 A;  3G83 A;  1G1R A;  1FIH A;  1OK3 A;  2MTI A;  2VUV A;  3BPS E;  2W81 A;  2QY0 A;  4YT7 L;  1HQ8 A;  1FSB A;  2OYU P;  5HYP A;  4FXG G;  2KV4 A;  3TK5 B;  1YTT A;  3KQB L;  2MGP A;  3ALT A;  1VVD A;  4YMD A;  4EZM G;  1KSN B;  4N34 A;  3O8E B;  1MSB A;  3BX4 B;  4RUT A;  1IOE L;  4MTH A;  3ELA L;  1HX2 A;  3TH3 L;  5HZP B;  3KQE L;  3IKQ A;  1FAK L;  4OTJ A;  1CX2 A;  1TPG A;  2Y5G L;  3U7U G;  2GGX A;  1YUK B;  2P95 L;  1QIU A; 
#chains in the Genus database with same CATH homology
 1KWU A;  1W7X L;  4Y76 B;  2IZ3 A;  5IKQ A;  1KG0 C;  3PBF A;  2EI6 B;  3P5I A;  3K9X A;  2PHB B;  5CKQ A;  4D0E A;  2XWB F;  4KZV A;  4ZRV A;  4AYM A;  3CDG E;  3N8Y A;  2XRB A;  5F19 A;  3CS7 L;  2Y7X B;  2UWL B;  4Y6D B;  1YUG A;  2CJI B;  2J4I B;  1KZA 1;  4O02 B;  3ALU A;  2KNI A;  3RS1 A;  3CEN L;  2H9E C;  4JYU L;  1KX0 A;  1GK5 A;  3SOQ A;  1DY2 A;  1EGG A;  1O7C T;  1N7D A;  1UMR A;  1F0S B;  1EPG A;  1Q4G A;  4JZD L;  4LOS A;  1URK A;  2ZIB A;  1DX5 I;  3HS7 A;  4Y7A B;  5I46 L;  1SZB A;  4M1G A;  2VH6 B;  3OLT A;  4UXM A;  1C3A A;  2Y5H L;  1DVA L;  2UWP B;  3SW0 X;  2VUZ A;  1CQE A;  2W3K B;  5JBA E;  3INB C;  2MHP A;  1RDL 1;  3C22 A;  4IOP A;  1P9J A;  1UZK A;  2GD4 A;  5IKR A;  3HO3 A;  4N37 A;  1IQJ L;  1X7A L;  2YHF A;  3G81 A;  1KZB 1;  2WYG B;  1KX1 A;  1LMM A;  1FJS L;  3IU3 I;  1IXX A;  1SB2 A;  1EQH A;  3KCG L;  3N8W B;  4N33 A;  1IQE L;  2F9B L;  4LQF A;  1W8B L;  3HUP A;  3P5F A;  3P5H A;  1K36 A;  1GHQ B;  3ALS A;  3TGF A;  1HRE A;  1KZE 1;  3KK6 A;  4A5W B;  1KOE A;  1O7B T;  1OK9 A;  2VVU L;  1A3P A;  3PGH A;  1RDI 1;  3BX4 A;  4AYE A;  2XBX L;  4FM5 A;  2VRP A;  1DV8 A;  2RA0 L;  1L5G B;  1RDM 1;  1PTH A;  2DDU A;  1R13 A;  2J94 B;  3LN1 A;  4WUX A;  1WT9 B;  2BO2 A;  1DY1 A;  3KXV A;  4ZES A;  5JBB E;  4QKJ A;  2RKZ A;  1XFE A;  1PFX L;  1X2T B;  3SW2 A;  3F1S B;  4DN8 A;  4WUW A;  2WPJ E;  1U0O A;  1YO8 A;  1LMJ A;  1UZJ A;  1G4G A;  4MUC A;  1BJ3 B;  1Q3X A;  1R14 A;  4WJG 2;  1TDQ B;  1DY0 A;  2WII C;  2E3X B;  5EGM B;  2RID A;  3BT1 A;  1KIG L;  3CFW A;  3RJ3 D;  5J6G G;  4BTU A;  2P28 B;  5JBC E;  1H04 P;  2Y80 B;  4OTY A;  1E5U I;  1U0N B;  1U67 A;  2H2R A;  2WZP P;  1MPU A;  1HTN A;  1J9C L;  1F0R B;  1PXX A;  2GGU A;  1WHF A;  3ZYG A;  1V7P A;  3NT1 A;  4XLW A;  3N8Y B;  2W2Q E;  1SS2 A;  4JYV L;  4CUD A;  2RNL A;  1GKN A;  1KWZ A;  4ISH L;  2NPR A;  4J6L A;  3ZYI B;  3HO5 A;  1UEX A;  1N1I A;  1OK2 A;  5FFS A;  3OED C;  2P3U A;  1PGE A;  2RHP A;  1LQD A;  1JBU L;  4PZ5 A;  1IJQ A;  2PF5 A;  3ASI A;  3T3A A;  1K37 A;  4JZE L;  1XDT R;  1KMB 1;  5L2Z L;  3ZRZ A;  4Y71 B;  2J34 B;  3HS5 A;  1G4F A;  1C3A B;  2RLQ A;  1IQN L;  1HYR A;  1K9J A;  5KTH A;  2JKH L;  4LOT A;  3LC5 B;  3OLU A;  4MMZ B;  1YPQ A;  3KL6 B;  4RRX A;  1MOX C;  3GXE A;  3UBU B;  1RDJ 1;  4X8T L;  1ELV A;  4X8S L;  2BZM A;  1MD7 A;  3WWK B;  1SL6 A;  1J35 A;  1NFX B;  1IOD B;  5FO8 C;  4IGD A;  2OX8 A;  3FF7 C;  3FBY A;  3H5C B;  1KWV A;  1F02 I;  1SB2 B;  4X8U L;  1EBV A;  3CCK A;  1ATB A;  2BPD A;  4BTI A;  1APO A;  3WBR A;  1QO3 C;  4AQT A;  1PWB A;  1IJK B;  1WT9 A;  2H2T B;  1JWI B;  3FF9 A;  3FFG L;  3FD4 A;  2PUQ L;  2UWO B;  2BOU A;  3EJH A;  1AFA 1;  3MDL A;  1X2T A;  2RL0 A;  3KMB 1;  5CKM A;  1BV4 A;  2BZ6 L;  5B1X A;  1KLO A;  2WG3 C;  3S6X A;  5F2Q A;  2VRP B;  4PP8 A;  1BJ3 A;  3GPR B;  4J6P A;  2WYJ B;  2VH0 B;  4ONT D;  1TLE A;  2RIC A;  2WPL E;  3QH0 A;  1T8D A;  4CUE A;  4KKD A;  2K2T A;  1DQB A;  1UOT P;  2C6U A;  4N38 A;  2W2M E;  5FFR A;  3NJP C;  1NPE B;  3T5O A;  1MQ5 L;  4RRW A;  4Z6A L;  2CG6 A;  1FF7 A;  1H2P P;  2WPH E;  1NWV A;  3IKR A;  1OK1 A;  2MGR A;  4S0U A;  1CCV A;  5E8D A;  1U0O B;  3C8J A;  1LPK A;  1H8U A;  4QKG A;  4RRY A;  3U73 A;  1YPU A;  1YUF A;  1HRF A;  1AFB 1;  4WR9 A;  1EPI A;  3KZJ A;  1ATA A;  1UZP A;  4ZHA B;  1G1Q A;  3N8Z A;  2XR5 A;  4C9F A;  1E88 A;  3SOB B;  2J95 B;  3PAR A;  4BDX A;  5FFT A;  3IJE B;  1U5M A;  1YPO A;  4B2R A;  3ERB A;  3R62 A;  4N35 A;  1EMO A;  1V7P B;  2VWM K;  4ZH8 B;  1EAI C;  3M37 L;  4JZF L;  1GZ2 A;  2VWL L;  2XQW C;  3UBU A;  1NQL B;  1FVU A;  3G8K A;  1XKB A;  2B7D L;  3IX0 A;  1UEX B;  2IT6 A;  1OJV A;  3WWK A;  4M18 A;  1EMN A;  1NFW B;  4E1G A;  2JGW A;  1F00 I;  3CA7 A;  2JGX A;  1IOD A;  2XBV L;  1CEJ A;  1RJH A;  1OZ7 A;  1UMR C;  4X8V L;  1RDK 1;  1M1X B;  4COX A;  1JA3 A;  2P3F N;  3FF8 C;  1HAE A;  1ATE A;  1PPQ A;  2GO0 A;  4MMY B;  1JL9 A;  3HO4 A;  1UZQ A;  3MQE A;  1HFI A;  5JW1 A;  3VPP A;  1JWI A;  3GPR D;  4KI1 E;  4ISI L;  2B5I D;  2VVV L;  4RRZ A;  4BDW A;  4J38 B;  3HPT A;  2WFT A;  3WWK C;  1K9I A;  4LOR A;  3P5G A;  1J35 B;  2P3F L;  3SOV A;  3GPR A;  2BOK L;  4Z0K B;  1P0S L;  3WSR A;  4Y7B B;  1HJ7 A;  4MMX B;  1IQK L;  1CKL A;  1E8I A;  2W2N E;  2W2P E;  1IQG L;  1HCC A;  1PRH A;  1KLJ L;  2I9A A;  2P93 L;  4G9A A;  3VLG A;  4YZU B;  1OJW A;  1VVC A;  3FCS B;  1B08 A;  1IJK C;  3EGF A;  3M9Z A;  1YGC L;  4K12 A;  1EZQ B;  1IQI L;  1NZI A;  4ZXY L;  3M36 L;  2ORJ A;  2J2U B;  4O1Z A;  3N8V A;  1P1Z D;  2MSB A;  4UWW A;  2VWO L;  2MCZ A;  1JZN A;  3PAK A;  3P5D A;  1G2L B;  2LOJ A;  2XBW L;  1MUQ A;  2M74 A;  1G1S A;  1TLG A;  1DDX A;  1KLI L;  1GKG A;  4J6Q A;  2BOH A;  2P94 L;  5IKV A;  1B9W A;  3LTG D;  5HYU B;  2YRA A;  1WU1 B;  1Y17 B;  1FM5 A;  1XKA L;  3IKN A;  4ZAE B;  4WRE A;  3TBD A;  1O5D L;  1NFY B;  4DJZ A;  1TPM A;  5JVY A;  2TGF A;  3Q7D A;  3P5E A;  4KMB 1;  1SRZ A;  4D90 A;  1UOS B;  2BOX A;  1CVW L;  1FFM A;  2WPK E;  1BNL A;  2VJ3 A;  1HAF A;  4WQQ A;  2FD6 A;  3L89 M;  2OYE P;  1IOX A;  2ERJ A;  4YLI A;  1IQL L;  4D0F A;  2LS8 A;  2I9B A;  3GOV A;  4CSY A;  3R05 A;  1FVU B;  6COX A;  5KIR A;  2Y5F L;  3LTF B;  1XAR A;  2I83 A;  2CL8 A;  2RLP A;  1IQM L;  3QMO A;  2W3I B;  4YNX A;  2KRI A;  5CIS A;  1B6E A;  3LIW B;  1BCJ 1;  1QGB A;  1OZ7 B;  4GK1 A;  2BRS A;  3K7B A;  3CDG F;  1OB1 C;  2ZQK A;  2O39 C;  3PAQ A;  1BCH 1;  1T8C A;  1RDO 1;  5KTI A;  3NCW A;  2Y7Z B;  3TVJ A;  3L9J C;  1BF9 A;  4QKI A;  1EGI A;  1TOZ A;  2BQ7 A;  4LMF A;  1EPH A;  1E5G A;  3TK6 B;  1CWV A;  3P7F A;  2J38 B;  1C5M F;  1KWX A;  4PH9 A;  1GPZ A;  1TPN A;  3WH2 A;  1EGF A;  2KV3 A;  2FLB L;  4KZW A;  4A94 C;  2Y81 B;  2BQW A;  2FLR L;  1KWT A;  4AYD A;  4XBM A;  2WPI E;  1OJY A;  5COX A;  1YXJ A;  1CCF A;  4XL1 A;  2BPH A;  1V4L B;  1EQG A;  4QKH A;  4RS0 A;  2XBY L;  4BTT A;  4J6M A;  2MCY A;  1RDN 1;  5JB9 E;  2V8E A;  3ZYJ B;  3BDW A;  4GI0 A;  1P4L D;  3WHD A;  2OX9 A;  1X2W B;  4J6J A;  1ATD A;  2CG7 A;  2RIB A;  4A7I A;  1G1T A;  3DBZ A;  5K8Y A;  1HT8 A;  1UKM A;  1Y17 A;  4GJ0 A;  4TGF A;  4ZXX L;  3P7G A;  1AUT L;  2WPM E;  4G1M B;  2BQ6 A;  2JRA A;  2XC5 L;  2AFP A;  1IQH L;  5JPM G;  2E3X C;  1QDD A;  2W26 B;  2RIA A;  2VVC K;  2Y82 B;  3POY A;  3IKP A;  1UOS A;  1HCG B;  1HFH A;  1U0N C;  3RR3 A;  1F7E A;  1RTM 1;  4C16 A;  4ZET A;  4YT6 L;  3QCW A;  2FLG A;  2W2O E;  3BT2 A;  3NFP I;  2IT5 A;  2YGQ A;  1YXK A;  5FDQ A;  3TZI A;  3ZHG D;  1JV2 B;  2PY2 A;  3N8X A;  1V3X B;  1O9A A;  3G8L A;  4CAJ A;  4NG9 L;  2RIE A;  3LN0 A;  1AFD 1;  4B2S A;  2YGO A;  1Z6E L;  2AYL A;  3ZHG A;  3V64 C;  3GIS X;  2EC3 A;  1LPZ A;  1IVO C;  1HT5 A;  3NCX A;  2EI8 B;  1FIF A;  2KB9 A;  1FBR A;  1Z6C A;  2WFX B;  1APQ A;  3NTG A;  1WMZ A;  1WMY A;  2D1J B;  4LU5 A;  1IGZ A;  2PR3 B;  2VWN L;  2IZ4 A;  2A55 A;  3CAD A;  1QFK L;  1EPJ A;  4E52 A;  2P26 A;  3OXU D;  1KWY A;  5JB8 E;  5L30 L;  2UWN A;  1SL5 A;  1J34 A;  1ZAQ A;  2K2S B;  4M17 A;  3KQG A;  1V4L A;  1I0U A;  2XC0 L;  2KMB 1;  2P16 L;  4Z0L A;  1KZC 1;  3V65 B;  2EI7 B;  1IQF L;  2W80 A;  4J6N A;  4J6K A;  3KRK A;  1X2W A;  3KQC L;  2OS9 A;  5L2Y L;  1UV0 A;  4M11 A;  4AK8 A;  4GJX A;  3MQL A;  2EHF A;  1IP0 A;  1E8B A;  2XWJ I;  1BYF A;  1IGX A;  1FE2 A;  3LC3 B;  1LY2 A;  3GPR C;  5JVZ A;  1H03 P;  5B1W A;  2YBY A;  2ORK A;  4N32 A;  1CVU A;  1F7M A;  5M62 A;  3NTB A;  1HUP A;  1LIT A;  3BDW B;  1E87 A;  3WBQ A;  2H9E L;  4WRF A;  1MD8 A;  3C8K D;  3HS6 A;  1UKM B;  4GKO G;  2XRD A;  3OP8 A;  4WRC A;  3C9A C;  4NGA L;  5B1R A;  5I0Q B;  4M10 A;  4JHS A;  2G00 L;  2YGP A;  5LGK E;  4CUF A;  4WCO A;  2Y38 A;  3F6U L;  4ZH1 D;  2XC4 L;  1C1Z A;  3VYK A;  1RFN B;  5CKN A;  1ADX A;  2W86 A;  1COU A;  2G7I A;  1BUU A;  5IKT A;  1NT0 A;  2BMG A;  3WBP A;  3ZD2 A;  1H2Q P;  2XR6 A;  3G84 A;  4BXS A;  3IIT B;  4N36 A;  4Y79 B;  1DIY A;  1WHE A;  1L3Y A;  3P7H A;  1ESL A;  1SL4 A;  2BPE A;  3DEM A;  2N40 A;  2Q1J B;  3VYJ A;  4PDC A;  1MQ6 L;  1XPH A;  1TN3 A;  4ZRW A;  1NFU B;  1FAX L;  2FZZ L;  1QUB A;  1HZ8 A;  3M7P A;  2ADX A;  1WK1 A;  4AYI A;  1QO6 A;  3Q3K B;  1KCG A;  1Z92 B;  3GCX E;  2CKU A;  2M94 A;  3N8W A;  2ZWK A;  3WH3 A;  4BXW A;  3LAQ A;  3P5B L;  1KZD 1;  2P3T A;  2KMS A;  1ZJK A;  3ZD1 A;  3GCW E;  1LPG A;  4IOP B;  2WG4 B;  5KN5 C;  1PW9 A;  1G2M B;  4G96 A;  5F1A A;  5K0H B;  1J34 B;  1U8C B;  4F4O C;  1KWW A;  3ENS A;  3CAL A;  3KQD L;  5HYT B;  2RKY A;  1IXX B;  2KL7 A;  3G83 A;  1G1R A;  1FIH A;  1OK3 A;  2MTI A;  2VUV A;  3BPS E;  2W81 A;  2QY0 A;  4YT7 L;  1HQ8 A;  1FSB A;  2OYU P;  5HYP A;  4FXG G;  2KV4 A;  3TK5 B;  1YTT A;  3KQB L;  2MGP A;  3ALT A;  1VVD A;  4YMD A;  4EZM G;  1KSN B;  4N34 A;  3O8E B;  1MSB A;  3BX4 B;  4RUT A;  1IOE L;  4MTH A;  3ELA L;  1HX2 A;  3TH3 L;  5HZP B;  3KQE L;  3IKQ A;  1FAK L;  4OTJ A;  1CX2 A;  1TPG A;  2Y5G L;  3U7U G;  2GGX A;  1YUK B;  2P95 L;  4NA9 L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...