4C1FA

Crystal structure of the metallo-beta-lactamase imp-1 with l-captopril
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
219
structure length
219
Chain Sequence
SLPDLKIEKLDEGVYVHTSFEEVNGWGVVPKHGLVVLVNAEAYLIDTPFTAKDTEKLVTWFVERGYKIKGSISSHFHSDSTGGIEWLNSRSIPTYASELTNELLKKDGKVQATNSFSGVNYWLVKNKIEVFYPGPGHTPDNVVVWLPERKILFGGCFIKPYGLGNLGDANIEAWPKSAKLLKSKYGKAKLVVPSHSEVGDASLLKLTLEQAVKGLNESK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA-LACTAMASE IMP-1
publication title Structural Basis of Metallo-beta-Lactamase Inhibition by Captopril Stereoisomers.
pubmed doi rcsb
source organism Serratia marcescens
molecule tags Hydrolase
total genus 69
structure length 219
sequence length 219
chains with identical sequence B
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2013-08-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 4c1fA00
2CBNA 1BVTA 5HIQA 4EYFA 3SFPA 4FEKA 2NXAA 4GYQA 4RM5A 4Z6XA 4ZO2A 1VGNA 5K4MA 4TYFA 5FQBA 3S0ZA 2QJSA 3IDZA 1A8TA 4RL0A 3X2ZA 4TZFA 4UA4A 2QINA 4EXYA 4RAMA 2Q0JA 2QDTA 2YNVA 4UAMA 4UWRB 1ZNBA 5HIOA 3AJ3A 2M5DA 2BFKA 5EWAA 2UYXA 5HH4A 2ZNBA 2A7MA 5HIPA 2Q42A 1XM8A 3I11A 5ACQA 4Z60A 3PY6A 4DIKA 1MQOA 4EYLA 3H3EA 2Y8AA 3T9MA 5HH6A 3AF6A 5ACXA 4EY2A 1YCGA 3IOGA 2FM6A 5IQKA 2ZWRA 4Z5ZA 3BK2A 3IE2A 4O98A 2P1EA 2Y87A 3I14A 4D1WA 3RKJA 4BP0A 4RBSA 2WHGA 1YCFA 2QEDA 2GKLA 4KEPA 1JJTA 1P9EA 5K4KA 4Z7RA 5AEBA 1L9YA 4KEQA 5A0VA 5A5ZA 4EFZA 4TZEA 3JXPA 4AX1B 3KNRA 3AF5A 2VW8A 2BG8B 1VMEA 2BR6A 4H0DA 2BFZB 1YCHA 5ACTA 5K0WA 3ADRA 5DPXA 2H6AA 4FSBA 2GCUA 1ZKPA 4ZEJA 2YNUA 4J5HA 4RL2A 5LMCA 3T3OA 4AD9A 2AZ4A 5K4NA 2OHJA 3LVZA 4UWPB 3RKKA 3QH8A 2P97A 5LM6A 4UBQA 2GFJA 4GCWA 1WRAA 3MD7A 5EW0A 5EV6A 3ESHA 5AXRA 2FU6A 5EVDA 3VQZA 5AHOA 3ZQ4A 4C1DA 4XWWA 4DILA 3ZWFA 5A87A 4YSBA 2BFZA 5B1UA 1WUPA 4C1GA 4ZNBA 4D1UA 2BFLA 1QH5A 5ACPA 2HB9A 5LSCA 3SPUA 4HL2A 2FK6A 4PVOA 5ACSA 3SD9A 5LS3A 2XR1A 4NQ4A 4LE6A 2BG6A 1X8IA 4HKYA 3ZNBA 5AHRA 4J5FA 2BG7A 4CHLA 2Q0IA 4NQ2A 2P18A 4Z5YA 5B3RA 4UWSB 5B15A 4GYUA 3ZR9A 2I7XA 2YZ3A 1M2XA 4C1FA 4D1TA 4F6ZA 1DD6A 3I13A 3I0VA 3DHBA 5A0TA 5ACWA 2NZFA 4FR7A 1ZTCA 5FQCA 4NQ6A 1KO2A 4HL1A 5KILA 3DH8A 3IE1A 1XTOA 2P4ZA 3X30A 5EV8A 3G1PA 3SW3A 2FHXB 3IEMA 1SMLA 2WYLA 4TYTA 5LCFA 3RPCA 4P62A 2FU9A 2OHIA 4YSKA 2Q9UA 4V0HA 4C1EA 1E5DA 2I7TA 3IOFA 5EH9A 5EHTA 4XUKA 4ZO3A 1DDKA 2YNWA 2DOOA 5AYAA 3SBLA 1Y44A 5ACRA 1BC2A 4U4LA 2YNTB 1JJEA 2YCBA 3T3NA 3X2YA 3PG4A 4PVTA 5FQAA 3P2UA 5EVBA 3BV6A 2WRSA 3KNSA 2E7YA 2AIOA 1JT1A 2OHHA 2GMNA 4C1HA 3TP9A 2BG8A 2WYMC 5ACVA 4D1VA 3BK1A 2ZZIA 2ZO4A 2BGAA 4F6HA 4RAWA 3VPEA 1VJNA 5AXOA 3FAIA 3PY5A 4AX0B 2FU8A 2I7VA 2FHXA 4EXSA 2XF4A 1X8HA 4AWZA 2BIBA 3FCZA 3X2XA 2Y8BA 2DKFA 3IE0A 3Q6VA 4TZ9A 2R2DA 2GFKA 4Z67A 1KR3A 4B87A 3WXCA 4UWOB 3DHAA 2NYPA 3BC2A 1K07A 4XWTA 3KL7A 5LCAA 4BZ3A 2YNTA 3IEKA 4AWYB 3DHCA 2QDSA 4WD6A 5KIKA 3L6NA 5LLDA 5LCHA 1BMCA 5LE1A 5HH5A 4C1CA 2NZEA 5HISA 4YSLA 3IELA 4JO0A 4TZBA 1WW1A 1QH3A 3A4YA 3F9OA 2BC2A 2BTNA 3I15A 4NQ5A 4C09A 5ACUA 5EVKA 1DXKA 2BMIA 2FU7A 2WYMA 2YNVB 3SRXA 1HLKA 2M5CA 1A7TA 2BG2A 1X8GA 1WUOA 1KO3A 3R2UA 4D02A 4EYBA
chains in the Genus database with same CATH superfamily
2CBNA 1BVTA 5HIQA 4EYFA 3SFPA 2CG3A 4FEKA 2NXAA 4GYQA 4RM5A 4Z6XA 4ZO2A 1VGNA 5K4MA 4TYFA 5FQBA 3S0ZA 2QJSA 3IDZA 1A8TA 4RL0A 3X2ZA 4TZFA 4UA4A 2QINA 4EXYA 4RAMA 2Q0JA 2QDTA 2YNVA 4UAMA 4UWRB 1ZNBA 5HIOA 3AJ3A 2M5DA 2BFKA 5EWAA 2UYXA 5HH4A 2ZNBA 4AXHA 2A7MA 5HIPA 2Q42A 1XM8A 3I11A 5ACQA 4Z60A 3PY6A 4DIKA 1MQOA 4EYLA 3H3EA 2Y8AA 3T9MA 5HH6A 3AF6A 5ACXA 4EY2A 1YCGA 3IOGA 2FM6A 5IQKA 2ZWRA 4Z5ZA 3BK2A 3IE2A 4O98A 2P1EA 2Y87A 3I14A 4PDXA 4D1WA 3RKJA 4BP0A 5A23A 4RBSA 2WHGA 1YCFA 2QEDA 2GKLA 4KEPA 1JJTA 1P9EA 5K4KA 4Z7RA 5AEBA 1L9YA 4KEQA 5A0VA 5A5ZA 4EFZA 4TZEA 3JXPA 4AX1B 3KNRA 3AF5A 2VW8A 2BG8B 1VMEA 2BR6A 4H0DA 2BFZB 1YCHA 5ACTA 5K0WA 3ADRA 5DPXA 2H6AA 5AJLA 4FSBA 2GCUA 1ZKPA 4ZEJA 2YNUA 4J5HA 4RL2A 5LMCA 3T3OA 4AD9A 2AZ4A 5K4NA 2OHJA 3LVZA 4UWPB 3RKKA 3QH8A 2P97A 5LM6A 4UBQA 2GFJA 4GCWA 1WRAA 3MD7A 5EW0A 5EV6A 3ESHA 5AXRA 2FU6A 5EVDA 3VQZA 5AHOA 3ZQ4A 4C1DA 4XWWA 4DILA 3ZWFA 5A87A 4YSBA 2BFZA 5B1UA 1WUPA 4C1GA 4ZNBA 4D1UA 2BFLA 1QH5A 5ACPA 2HB9A 5LSCA 3SPUA 4HL2A 2FK6A 4PVOA 5ACSA 3SD9A 5LS3A 4AV7A 2XR1A 4NQ4A 4LE6A 2BG6A 1X8IA 4HKYA 3ZNBA 5AHRA 4J5FA 2BG7A 2CFUA 4CHLA 2Q0IA 4NQ2A 2P18A 4Z5YA 5AIJA 5B3RA 4UWSB 5B15A 4GYUA 3ZR9A 2I7XA 2YZ3A 1M2XA 4C1FA 4D1TA 4F6ZA 1DD6A 3I13A 3I0VA 3DHBA 5A0TA 5ACWA 2NZFA 4FR7A 1ZTCA 5FQCA 4NQ6A 1KO2A 4HL1A 5KILA 3DH8A 3IE1A 1XTOA 2P4ZA 3X30A 5EV8A 3G1PA 3SW3A 2FHXB 3IEMA 2YHEA 1SMLA 2WYLA 4TYTA 5LCFA 3RPCA 4P62A 2FU9A 2OHIA 4YSKA 2Q9UA 4V0HA 4C1EA 1E5DA 2I7TA 3IOFA 5EH9A 5EHTA 4XUKA 4ZO3A 1DDKA 2YNWA 2DOOA 5AYAA 3SBLA 1Y44A 5ACRA 1BC2A 4U4LA 2YNTB 1JJEA 2YCBA 3T3NA 3X2YA 3PG4A 2CG2A 4PVTA 5FQAA 3P2UA 5EVBA 3BV6A 4NURA 2WRSA 3KNSA 2E7YA 2AIOA 1JT1A 2OHHA 2GMNA 4C1HA 3TP9A 2BG8A 2WYMC 5ACVA 4D1VA 3BK1A 2ZZIA 2ZO4A 2BGAA 4F6HA 4RAWA 3VPEA 1VJNA 5AXOA 3FAIA 3PY5A 4AX0B 2FU8A 2I7VA 2FHXA 4EXSA 2XF4A 1X8HA 4AWZA 2BIBA 3FCZA 3X2XA 2Y8BA 2DKFA 3IE0A 3Q6VA 4TZ9A 2R2DA 2GFKA 4Z67A 1KR3A 4B87A 3WXCA 4UWOB 3DHAA 2NYPA 3BC2A 1K07A 4XWTA 3KL7A 5LCAA 4BZ3A 2YNTA 3IEKA 4AWYB 3DHCA 2QDSA 4WD6A 5KIKA 3L6NA 5LLDA 5LCHA 1BMCA 5LE1A 5HH5A 4C1CA 2NZEA 5HISA 4YSLA 3IELA 4JO0A 4TZBA 1WW1A 1QH3A 3A4YA 3F9OA 2BC2A 2BTNA 3I15A 2CFZA 4NQ5A 4C09A 5ACUA 5EVKA 1DXKA 2BMIA 2FU7A 2WYMA 2YNVB 3SRXA 1HLKA 2M5CA 1A7TA 2BG2A 1X8GA 1WUOA 1KO3A 3R2UA 4D02A 4EYBA
chains in the Genus database with same CATH topology
2CBNA 1BVTA 5HIQA 4EYFA 3SFPA 4FEKA 2NXAA 4GYQA 4RM5A 4Z6XA 4ZO2A 1VGNA 5K4MA 4TYFA 5FQBA 3S0ZA 2QJSA 3IDZA 1A8TA 4RL0A 3X2ZA 4TZFA 4UA4A 2QINA 4EXYA 4RAMA 2Q0JA 2QDTA 2YNVA 4UAMA 4UWRB 1ZNBA 5HIOA 3AJ3A 2M5DA 2BFKA 5EWAA 2UYXA 5HH4A 2ZNBA 2A7MA 5HIPA 2Q42A 1XM8A 3I11A 5ACQA 4Z60A 3PY6A 4DIKA 1MQOA 4EYLA 3H3EA 2Y8AA 3T9MA 5HH6A 3AF6A 5ACXA 4EY2A 1YCGA 3IOGA 2FM6A 5IQKA 2ZWRA 4Z5ZA 3BK2A 3IE2A 4O98A 2P1EA 2Y87A 3I14A 4D1WA 3RKJA 4BP0A 4RBSA 2WHGA 1YCFA 2QEDA 2GKLA 4KEPA 1JJTA 1P9EA 5K4KA 4Z7RA 5AEBA 1L9YA 4KEQA 5A0VA 5A5ZA 4EFZA 4TZEA 3JXPA 4AX1B 3KNRA 3AF5A 2VW8A 2BG8B 1VMEA 2BR6A 4H0DA 2BFZB 1YCHA 5ACTA 5K0WA 3ADRA 5DPXA 2H6AA 4FSBA 2GCUA 1ZKPA 4ZEJA 2YNUA 4J5HA 4RL2A 5LMCA 3T3OA 4AD9A 2AZ4A 5K4NA 2OHJA 3LVZA 4UWPB 3RKKA 3QH8A 2P97A 5LM6A 4UBQA 2GFJA 4GCWA 1WRAA 3MD7A 5EW0A 5EV6A 3ESHA 5AXRA 2FU6A 5EVDA 3VQZA 5AHOA 3ZQ4A 4C1DA 4XWWA 4DILA 3ZWFA 5A87A 4YSBA 2BFZA 5B1UA 1WUPA 4C1GA 4ZNBA 4D1UA 2BFLA 1QH5A 5ACPA 2HB9A 5LSCA 3SPUA 4HL2A 2FK6A 4PVOA 5ACSA 3SD9A 5LS3A 2XR1A 4NQ4A 4LE6A 2BG6A 1X8IA 4HKYA 3ZNBA 5AHRA 4J5FA 2BG7A 4CHLA 2Q0IA 4NQ2A 2P18A 4Z5YA 5B3RA 4UWSB 5B15A 4GYUA 3ZR9A 2I7XA 2YZ3A 1M2XA 4C1FA 4D1TA 4F6ZA 1DD6A 3I13A 3I0VA 3DHBA 5A0TA 5ACWA 2NZFA 4FR7A 1ZTCA 5FQCA 4NQ6A 1KO2A 4HL1A 5KILA 3DH8A 3IE1A 1XTOA 2P4ZA 3X30A 5EV8A 3G1PA 3SW3A 2FHXB 3IEMA 1SMLA 2WYLA 4TYTA 5LCFA 3RPCA 4P62A 2FU9A 2OHIA 4YSKA 2Q9UA 4V0HA 4C1EA 1E5DA 2I7TA 3IOFA 5EH9A 5EHTA 4XUKA 4ZO3A 1DDKA 2YNWA 2DOOA 5AYAA 3SBLA 1Y44A 5ACRA 1BC2A 4U4LA 2YNTB 1JJEA 2YCBA 3T3NA 3X2YA 3PG4A 4PVTA 5FQAA 3P2UA 5EVBA 3BV6A 2WRSA 3KNSA 2E7YA 2AIOA 1JT1A 2OHHA 2GMNA 4C1HA 3TP9A 2BG8A 2WYMC 5ACVA 4D1VA 3BK1A 2ZZIA 2ZO4A 2BGAA 4F6HA 4RAWA 3VPEA 1VJNA 5AXOA 3FAIA 3PY5A 4AX0B 2FU8A 2I7VA 2FHXA 4EXSA 2XF4A 1X8HA 4AWZA 2BIBA 3FCZA 3X2XA 2Y8BA 2DKFA 3IE0A 3Q6VA 4TZ9A 2R2DA 2GFKA 4Z67A 1KR3A 4B87A 3WXCA 4UWOB 3DHAA 2NYPA 3BC2A 1K07A 4XWTA 3KL7A 5LCAA 4BZ3A 2YNTA 3IEKA 4AWYB 3DHCA 2QDSA 4WD6A 5KIKA 3L6NA 5LLDA 5LCHA 1BMCA 5LE1A 5HH5A 4C1CA 2NZEA 5HISA 4YSLA 3IELA 4JO0A 4TZBA 1WW1A 1QH3A 3A4YA 3F9OA 2BC2A 2BTNA 3I15A 4NQ5A 4C09A 5ACUA 5EVKA 1DXKA 2BMIA 2FU7A 2WYMA 2YNVB 3SRXA 1HLKA 2M5CA 1A7TA 2BG2A 1X8GA 1WUOA 1KO3A 3R2UA 4D02A 4EYBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CBN A;  1BVT A;  5HIQ A;  4EYF A;  3SFP A;  4FEK A;  2NXA A;  4GYQ A;  4RM5 A;  4Z6X A;  4ZO2 A;  1VGN A;  5K4M A;  4TYF A;  5FQB A;  3S0Z A;  2QJS A;  3IDZ A;  1A8T A;  4RL0 A;  3X2Z A;  4TZF A;  4UA4 A;  2QIN A;  4EXY A;  4RAM A;  2Q0J A;  2QDT A;  2YNV A;  4UAM A;  4UWR B;  1ZNB A;  5HIO A;  3AJ3 A;  2M5D A;  2BFK A;  5EWA A;  2UYX A;  5HH4 A;  2ZNB A;  2A7M A;  5HIP A;  2Q42 A;  1XM8 A;  3I11 A;  5ACQ A;  4Z60 A;  3PY6 A;  4DIK A;  1MQO A;  4EYL A;  3H3E A;  2Y8A A;  3T9M A;  5HH6 A;  3AF6 A;  5ACX A;  4EY2 A;  1YCG A;  3IOG A;  2FM6 A;  5IQK A;  2ZWR A;  4Z5Z A;  3BK2 A;  3IE2 A;  4O98 A;  2P1E A;  2Y87 A;  3I14 A;  4D1W A;  3RKJ A;  4BP0 A;  4RBS A;  2WHG A;  1YCF A;  2QED A;  2GKL A;  4KEP A;  1JJT A;  1P9E A;  5K4K A;  4Z7R A;  5AEB A;  1L9Y A;  4KEQ A;  5A0V A;  5A5Z A;  4EFZ A;  4TZE A;  3JXP A;  4AX1 B;  3KNR A;  3AF5 A;  2VW8 A;  2BG8 B;  1VME A;  2BR6 A;  4H0D A;  2BFZ B;  1YCH A;  5ACT A;  5K0W A;  3ADR A;  5DPX A;  2H6A A;  4FSB A;  2GCU A;  1ZKP A;  4ZEJ A;  2YNU A;  4J5H A;  4RL2 A;  5LMC A;  3T3O A;  4AD9 A;  2AZ4 A;  5K4N A;  2OHJ A;  3LVZ A;  4UWP B;  3RKK A;  3QH8 A;  2P97 A;  5LM6 A;  4UBQ A;  2GFJ A;  4GCW A;  1WRA A;  3MD7 A;  5EW0 A;  5EV6 A;  3ESH A;  5AXR A;  2FU6 A;  5EVD A;  3VQZ A;  5AHO A;  3ZQ4 A;  4C1D A;  4XWW A;  4DIL A;  3ZWF A;  5A87 A;  4YSB A;  2BFZ A;  5B1U A;  1WUP A;  4C1G A;  4ZNB A;  4D1U A;  2BFL A;  1QH5 A;  5ACP A;  2HB9 A;  5LSC A;  3SPU A;  4HL2 A;  2FK6 A;  4PVO A;  5ACS A;  3SD9 A;  5LS3 A;  2XR1 A;  4NQ4 A;  4LE6 A;  2BG6 A;  1X8I A;  4HKY A;  3ZNB A;  5AHR A;  4J5F A;  2BG7 A;  4CHL A;  2Q0I A;  4NQ2 A;  2P18 A;  4Z5Y A;  5B3R A;  4UWS B;  5B15 A;  4GYU A;  3ZR9 A;  2I7X A;  2YZ3 A;  1M2X A;  4C1F A;  4D1T A;  4F6Z A;  1DD6 A;  3I13 A;  3I0V A;  3DHB A;  5A0T A;  5ACW A;  2NZF A;  4FR7 A;  1ZTC A;  5FQC A;  4NQ6 A;  1KO2 A;  4HL1 A;  5KIL A;  3DH8 A;  3IE1 A;  1XTO A;  2P4Z A;  3X30 A;  5EV8 A;  3G1P A;  3SW3 A;  2FHX B;  3IEM A;  1SML A;  2WYL A;  4TYT A;  5LCF A;  3RPC A;  4P62 A;  2FU9 A;  2OHI A;  4YSK A;  2Q9U A;  4V0H A;  4C1E A;  1E5D A;  2I7T A;  3IOF A;  5EH9 A;  5EHT A;  4XUK A;  4ZO3 A;  1DDK A;  2YNW A;  2DOO A;  5AYA A;  3SBL A;  1Y44 A;  5ACR A;  1BC2 A;  4U4L A;  2YNT B;  1JJE A;  2YCB A;  3T3N A;  3X2Y A;  3PG4 A;  4PVT A;  5FQA A;  3P2U A;  5EVB A;  3BV6 A;  2WRS A;  3KNS A;  2E7Y A;  2AIO A;  1JT1 A;  2OHH A;  2GMN A;  4C1H A;  3TP9 A;  2BG8 A;  2WYM C;  5ACV A;  4D1V A;  3BK1 A;  2ZZI A;  2ZO4 A;  2BGA A;  4F6H A;  4RAW A;  3VPE A;  1VJN A;  5AXO A;  3FAI A;  3PY5 A;  4AX0 B;  2FU8 A;  2I7V A;  2FHX A;  4EXS A;  2XF4 A;  1X8H A;  4AWZ A;  2BIB A;  3FCZ A;  3X2X A;  2Y8B A;  2DKF A;  3IE0 A;  3Q6V A;  4TZ9 A;  2R2D A;  2GFK A;  4Z67 A;  1KR3 A;  4B87 A;  3WXC A;  4UWO B;  3DHA A;  2NYP A;  3BC2 A;  1K07 A;  4XWT A;  3KL7 A;  5LCA A;  4BZ3 A;  2YNT A;  3IEK A;  4AWY B;  3DHC A;  2QDS A;  4WD6 A;  5KIK A;  3L6N A;  5LLD A;  5LCH A;  1BMC A;  5LE1 A;  5HH5 A;  4C1C A;  2NZE A;  5HIS A;  4YSL A;  3IEL A;  4JO0 A;  4TZB A;  1WW1 A;  1QH3 A;  3A4Y A;  3F9O A;  2BC2 A;  2BTN A;  3I15 A;  4NQ5 A;  4C09 A;  5ACU A;  5EVK A;  1DXK A;  2BMI A;  2FU7 A;  2WYM A;  2YNV B;  3SRX A;  1HLK A;  2M5C A;  1A7T A;  2BG2 A;  1X8G A;  1WUO A;  1KO3 A;  3R2U A;  4D02 A;  4EYB A; 
#chains in the Genus database with same CATH topology
 2CBN A;  1BVT A;  5HIQ A;  4EYF A;  3SFP A;  2CG3 A;  4FEK A;  2NXA A;  4GYQ A;  4RM5 A;  4Z6X A;  4ZO2 A;  1VGN A;  5K4M A;  4TYF A;  5FQB A;  3S0Z A;  2QJS A;  3IDZ A;  1A8T A;  4RL0 A;  3X2Z A;  4TZF A;  4UA4 A;  2QIN A;  4EXY A;  4RAM A;  2Q0J A;  2QDT A;  2YNV A;  4UAM A;  4UWR B;  1ZNB A;  5HIO A;  3AJ3 A;  2M5D A;  2BFK A;  5EWA A;  2UYX A;  5HH4 A;  2ZNB A;  4AXH A;  2A7M A;  5HIP A;  2Q42 A;  1XM8 A;  3I11 A;  5ACQ A;  4Z60 A;  3PY6 A;  4DIK A;  1MQO A;  4EYL A;  3H3E A;  2Y8A A;  3T9M A;  5HH6 A;  3AF6 A;  5ACX A;  4EY2 A;  1YCG A;  3IOG A;  2FM6 A;  5IQK A;  2ZWR A;  4Z5Z A;  3BK2 A;  3IE2 A;  4O98 A;  2P1E A;  2Y87 A;  3I14 A;  4PDX A;  4D1W A;  3RKJ A;  4BP0 A;  5A23 A;  4RBS A;  2WHG A;  1YCF A;  2QED A;  2GKL A;  4KEP A;  1JJT A;  1P9E A;  5K4K A;  4Z7R A;  5AEB A;  1L9Y A;  4KEQ A;  5A0V A;  5A5Z A;  4EFZ A;  4TZE A;  3JXP A;  4AX1 B;  3KNR A;  3AF5 A;  2VW8 A;  2BG8 B;  1VME A;  2BR6 A;  4H0D A;  2BFZ B;  1YCH A;  5ACT A;  5K0W A;  3ADR A;  5DPX A;  2H6A A;  5AJL A;  4FSB A;  2GCU A;  1ZKP A;  4ZEJ A;  2YNU A;  4J5H A;  4RL2 A;  5LMC A;  3T3O A;  4AD9 A;  2AZ4 A;  5K4N A;  2OHJ A;  3LVZ A;  4UWP B;  3RKK A;  3QH8 A;  2P97 A;  5LM6 A;  4UBQ A;  2GFJ A;  4GCW A;  1WRA A;  3MD7 A;  5EW0 A;  5EV6 A;  3ESH A;  5AXR A;  2FU6 A;  5EVD A;  3VQZ A;  5AHO A;  3ZQ4 A;  4C1D A;  4XWW A;  4DIL A;  3ZWF A;  5A87 A;  4YSB A;  2BFZ A;  5B1U A;  1WUP A;  4C1G A;  4ZNB A;  4D1U A;  2BFL A;  1QH5 A;  5ACP A;  2HB9 A;  5LSC A;  3SPU A;  4HL2 A;  2FK6 A;  4PVO A;  5ACS A;  3SD9 A;  5LS3 A;  4AV7 A;  2XR1 A;  4NQ4 A;  4LE6 A;  2BG6 A;  1X8I A;  4HKY A;  3ZNB A;  5AHR A;  4J5F A;  2BG7 A;  2CFU A;  4CHL A;  2Q0I A;  4NQ2 A;  2P18 A;  4Z5Y A;  5AIJ A;  5B3R A;  4UWS B;  5B15 A;  4GYU A;  3ZR9 A;  2I7X A;  2YZ3 A;  1M2X A;  4C1F A;  4D1T A;  4F6Z A;  1DD6 A;  3I13 A;  3I0V A;  3DHB A;  5A0T A;  5ACW A;  2NZF A;  4FR7 A;  1ZTC A;  5FQC A;  4NQ6 A;  1KO2 A;  4HL1 A;  5KIL A;  3DH8 A;  3IE1 A;  1XTO A;  2P4Z A;  3X30 A;  5EV8 A;  3G1P A;  3SW3 A;  2FHX B;  3IEM A;  2YHE A;  1SML A;  2WYL A;  4TYT A;  5LCF A;  3RPC A;  4P62 A;  2FU9 A;  2OHI A;  4YSK A;  2Q9U A;  4V0H A;  4C1E A;  1E5D A;  2I7T A;  3IOF A;  5EH9 A;  5EHT A;  4XUK A;  4ZO3 A;  1DDK A;  2YNW A;  2DOO A;  5AYA A;  3SBL A;  1Y44 A;  5ACR A;  1BC2 A;  4U4L A;  2YNT B;  1JJE A;  2YCB A;  3T3N A;  3X2Y A;  3PG4 A;  2CG2 A;  4PVT A;  5FQA A;  3P2U A;  5EVB A;  3BV6 A;  4NUR A;  2WRS A;  3KNS A;  2E7Y A;  2AIO A;  1JT1 A;  2OHH A;  2GMN A;  4C1H A;  3TP9 A;  2BG8 A;  2WYM C;  5ACV A;  4D1V A;  3BK1 A;  2ZZI A;  2ZO4 A;  2BGA A;  4F6H A;  4RAW A;  3VPE A;  1VJN A;  5AXO A;  3FAI A;  3PY5 A;  4AX0 B;  2FU8 A;  2I7V A;  2FHX A;  4EXS A;  2XF4 A;  1X8H A;  4AWZ A;  2BIB A;  3FCZ A;  3X2X A;  2Y8B A;  2DKF A;  3IE0 A;  3Q6V A;  4TZ9 A;  2R2D A;  2GFK A;  4Z67 A;  1KR3 A;  4B87 A;  3WXC A;  4UWO B;  3DHA A;  2NYP A;  3BC2 A;  1K07 A;  4XWT A;  3KL7 A;  5LCA A;  4BZ3 A;  2YNT A;  3IEK A;  4AWY B;  3DHC A;  2QDS A;  4WD6 A;  5KIK A;  3L6N A;  5LLD A;  5LCH A;  1BMC A;  5LE1 A;  5HH5 A;  4C1C A;  2NZE A;  5HIS A;  4YSL A;  3IEL A;  4JO0 A;  4TZB A;  1WW1 A;  1QH3 A;  3A4Y A;  3F9O A;  2BC2 A;  2BTN A;  3I15 A;  2CFZ A;  4NQ5 A;  4C09 A;  5ACU A;  5EVK A;  1DXK A;  2BMI A;  2FU7 A;  2WYM A;  2YNV B;  3SRX A;  1HLK A;  2M5C A;  1A7T A;  2BG2 A;  1X8G A;  1WUO A;  1KO3 A;  3R2U A;  4D02 A;  4EYB A; 
#chains in the Genus database with same CATH homology
 2CBN A;  1BVT A;  5HIQ A;  4EYF A;  3SFP A;  4FEK A;  2NXA A;  4GYQ A;  4RM5 A;  4Z6X A;  4ZO2 A;  1VGN A;  5K4M A;  4TYF A;  5FQB A;  3S0Z A;  2QJS A;  3IDZ A;  1A8T A;  4RL0 A;  3X2Z A;  4TZF A;  4UA4 A;  2QIN A;  4EXY A;  4RAM A;  2Q0J A;  2QDT A;  2YNV A;  4UAM A;  4UWR B;  1ZNB A;  5HIO A;  3AJ3 A;  2M5D A;  2BFK A;  5EWA A;  2UYX A;  5HH4 A;  2ZNB A;  2A7M A;  5HIP A;  2Q42 A;  1XM8 A;  3I11 A;  5ACQ A;  4Z60 A;  3PY6 A;  4DIK A;  1MQO A;  4EYL A;  3H3E A;  2Y8A A;  3T9M A;  5HH6 A;  3AF6 A;  5ACX A;  4EY2 A;  1YCG A;  3IOG A;  2FM6 A;  5IQK A;  2ZWR A;  4Z5Z A;  3BK2 A;  3IE2 A;  4O98 A;  2P1E A;  2Y87 A;  3I14 A;  4D1W A;  3RKJ A;  4BP0 A;  4RBS A;  2WHG A;  1YCF A;  2QED A;  2GKL A;  4KEP A;  1JJT A;  1P9E A;  5K4K A;  4Z7R A;  5AEB A;  1L9Y A;  4KEQ A;  5A0V A;  5A5Z A;  4EFZ A;  4TZE A;  3JXP A;  4AX1 B;  3KNR A;  3AF5 A;  2VW8 A;  2BG8 B;  1VME A;  2BR6 A;  4H0D A;  2BFZ B;  1YCH A;  5ACT A;  5K0W A;  3ADR A;  5DPX A;  2H6A A;  4FSB A;  2GCU A;  1ZKP A;  4ZEJ A;  2YNU A;  4J5H A;  4RL2 A;  5LMC A;  3T3O A;  4AD9 A;  2AZ4 A;  5K4N A;  2OHJ A;  3LVZ A;  4UWP B;  3RKK A;  3QH8 A;  2P97 A;  5LM6 A;  4UBQ A;  2GFJ A;  4GCW A;  1WRA A;  3MD7 A;  5EW0 A;  5EV6 A;  3ESH A;  5AXR A;  2FU6 A;  5EVD A;  3VQZ A;  5AHO A;  3ZQ4 A;  4C1D A;  4XWW A;  4DIL A;  3ZWF A;  5A87 A;  4YSB A;  2BFZ A;  5B1U A;  1WUP A;  4C1G A;  4ZNB A;  4D1U A;  2BFL A;  1QH5 A;  5ACP A;  2HB9 A;  5LSC A;  3SPU A;  4HL2 A;  2FK6 A;  4PVO A;  5ACS A;  3SD9 A;  5LS3 A;  2XR1 A;  4NQ4 A;  4LE6 A;  2BG6 A;  1X8I A;  4HKY A;  3ZNB A;  5AHR A;  4J5F A;  2BG7 A;  4CHL A;  2Q0I A;  4NQ2 A;  2P18 A;  4Z5Y A;  5B3R A;  4UWS B;  5B15 A;  4GYU A;  3ZR9 A;  2I7X A;  2YZ3 A;  1M2X A;  4C1F A;  4D1T A;  4F6Z A;  1DD6 A;  3I13 A;  3I0V A;  3DHB A;  5A0T A;  5ACW A;  2NZF A;  4FR7 A;  1ZTC A;  5FQC A;  4NQ6 A;  1KO2 A;  4HL1 A;  5KIL A;  3DH8 A;  3IE1 A;  1XTO A;  2P4Z A;  3X30 A;  5EV8 A;  3G1P A;  3SW3 A;  2FHX B;  3IEM A;  1SML A;  2WYL A;  4TYT A;  5LCF A;  3RPC A;  4P62 A;  2FU9 A;  2OHI A;  4YSK A;  2Q9U A;  4V0H A;  4C1E A;  1E5D A;  2I7T A;  3IOF A;  5EH9 A;  5EHT A;  4XUK A;  4ZO3 A;  1DDK A;  2YNW A;  2DOO A;  5AYA A;  3SBL A;  1Y44 A;  5ACR A;  1BC2 A;  4U4L A;  2YNT B;  1JJE A;  2YCB A;  3T3N A;  3X2Y A;  3PG4 A;  4PVT A;  5FQA A;  3P2U A;  5EVB A;  3BV6 A;  2WRS A;  3KNS A;  2E7Y A;  2AIO A;  1JT1 A;  2OHH A;  2GMN A;  4C1H A;  3TP9 A;  2BG8 A;  2WYM C;  5ACV A;  4D1V A;  3BK1 A;  2ZZI A;  2ZO4 A;  2BGA A;  4F6H A;  4RAW A;  3VPE A;  1VJN A;  5AXO A;  3FAI A;  3PY5 A;  4AX0 B;  2FU8 A;  2I7V A;  2FHX A;  4EXS A;  2XF4 A;  1X8H A;  4AWZ A;  2BIB A;  3FCZ A;  3X2X A;  2Y8B A;  2DKF A;  3IE0 A;  3Q6V A;  4TZ9 A;  2R2D A;  2GFK A;  4Z67 A;  1KR3 A;  4B87 A;  3WXC A;  4UWO B;  3DHA A;  2NYP A;  3BC2 A;  1K07 A;  4XWT A;  3KL7 A;  5LCA A;  4BZ3 A;  2YNT A;  3IEK A;  4AWY B;  3DHC A;  2QDS A;  4WD6 A;  5KIK A;  3L6N A;  5LLD A;  5LCH A;  1BMC A;  5LE1 A;  5HH5 A;  4C1C A;  2NZE A;  5HIS A;  4YSL A;  3IEL A;  4JO0 A;  4TZB A;  1WW1 A;  1QH3 A;  3A4Y A;  3F9O A;  2BC2 A;  2BTN A;  3I15 A;  4NQ5 A;  4C09 A;  5ACU A;  5EVK A;  1DXK A;  2BMI A;  2FU7 A;  2WYM A;  2YNV B;  3SRX A;  1HLK A;  2M5C A;  1A7T A;  2BG2 A;  1X8G A;  1WUO A;  1KO3 A;  3R2U A;  4D02 A;  4EYB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...