4C1FA

Crystal structure of the metallo-beta-lactamase imp-1 with l-captopril
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
219
structure length
219
Chain Sequence
b'SLPDLKIEKLDEGVYVHTSFEEVNGWGVVPKHGLVVLVNAEAYLIDTPFTAKDTEKLVTWFVERGYKIKGSISSHFHSDSTGGIEWLNSRSIPTYASELTNELLKKDGKVQATNSFSGVNYWLVKNKIEVFYPGPGHTPDNVVVWLPERKILFGGCFIKPYGLGNLGDANIEAWPKSAKLLKSKYGKAKLVVPSHSEVGDASLLKLTLEQAVKGLNESK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA-LACTAMASE IMP-1
molecule tags Hydrolase
source organism Serratia marcescens
publication title Structural Basis of Metallo-beta-Lactamase Inhibition by Captopril Stereoisomers.
pubmed doi rcsb
total genus 69
structure length 219
sequence length 219
chains with identical sequence B
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2013-08-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 4c1fA00
2I7VA 4EYLA 1M2XA 5ACVA 4EYBA 4YSBA 5AXRA 2QINA 2YNTA 4FR7A 1A8TA 5DPXA 1YCGA 4C1HA 2YNVA 3T3OA 4ZNBA 4NQ4A 5ACRA 4NQ5A 3BK2A 2OHHA 3RKJA 1QH5A 4ZO3A 1VGNA 2FU9A 1A7TA 5HIOA 2OHIA 2NZEA 1VMEA 3H3EA 2P4ZA 2Y8BA 2QDSA 5IQKA 4KEPA 4BZ3A 4AWZA 5KILA 4EFZA 2VW8A 5B15A 5A0VA 3SW3A 1DD6A 4XUKA 4HL1A 4UWSB 1P9EA 5HH4A 3X2ZA 2FHXB 2GCUA 3LVZA 3IEMA 5LLDA 2AZ4A 5ACUA 4TZBA 5LMCA 1KO2A 4H0DA 4D1UA 4RM5A 4WD6A 3RKKA 5AXOA 5EH9A 4B87A 2UYXA 2BG8B 2Y87A 2I7XA 5KIKA 3A4YA 3RPCA 5FQCA 4TYFA 2P97A 5FQAA 4BP0A 2E7YA 2CBNA 4TZFA 2ZO4A 4C1CA 4Z6XA 3KNSA 2XF4A 5B3RA 2DOOA 1X8IA 2Q0IA 4C1DA 2YNUA 5ACSA 1X8GA 1JJTA 5EVKA 3SD9A 3ZWFA 3JXPA 2YNWA 5EWAA 3ADRA 2P1EA 4GYQA 2M5CA 3DHAA 2H6AA 4DIKA 2R2DA 4GYUA 5AYAA 5EVDA 4NQ6A 3IE1A 1ZKPA 1WUOA 4RAMA 5EHTA 3I14A 4EYFA 2Q9UA 4JO0A 2GFKA 2BG6A 3AJ3A 3KL7A 5K4MA 4Z5ZA 4UWPB 3AF5A 3QH8A 5K4NA 1ZNBA 4XWTA 2BMIA 4UBQA 3SBLA 4D1WA 3TP9A 2BG7A 4TZ9A 5LCHA 2GKLA 4ZEJA 1SMLA 3R2UA 5ACQA 3DH8A 2QJSA 2BG8A 3MD7A 3S0ZA 3BV6A 5EV6A 5B1UA 3IOFA 1YCHA 4GCWA 2BIBA 2M5DA 1WUPA 1KO3A 1VJNA 2WYMA 3I15A 5EW0A 2ZNBA 4Z67A 2BTNA 3X2XA 4NQ2A 2I7TA 4HKYA 5LM6A 2BFZB 4EXSA 2FU7A 4PVTA 5EV8A 4RL0A 2OHJA 4J5HA 4Z7RA 3ESHA 3WXCA 3T9MA 2BFLA 5HISA 2HB9A 2BGAA 4UA4A 2YNTB 4UAMA 3VPEA 2GMNA 2QEDA 4YSLA 4C09A 2ZWRA 3BC2A 4FSBA 2NXAA 2YNVB 3BK1A 3VQZA 2Y8AA 1K07A 4V0HA 4C1EA 1WRAA 4P62A 5LCAA 4Z5YA 1JT1A 1E5DA 4RAWA 3IDZA 1HLKA 5AHOA 4LE6A 2WRSA 4PVOA 3I13A 5FQBA 3F9OA 3IE0A 5ACXA 1Y44A 2QDTA 4F6HA 3IELA 3SFPA 2Q42A 2BR6A 1ZTCA 3PY5A 1DXKA 5HH6A 2DKFA 5ACTA 3FCZA 3ZNBA 4Z60A 2FK6A 3P2UA 5HIPA 5ACWA 3L6NA 5AHRA 3SRXA 4AWYB 1BC2A 3DHBA 2YCBA 4O98A 5K0WA 4AX1B 2WHGA 3IOGA 4HL2A 4U4LA 4AX0B 5LSCA 4UWRB 4CHLA 2WYMC 5LCFA 4RBSA 5LE1A 3PG4A 1YCFA 3G1PA 5A0TA 2A7MA 1MQOA 5AEBA 3IE2A 4AD9A 3Q6VA 1BMCA 1JJEA 3I0VA 3FAIA 2NZFA 4RL2A 2BFZA 5HIQA 2AIOA 4EXYA 5A87A 1WW1A 1KR3A 5HH5A 3KNRA 4ZO2A 1QH3A 5A5ZA 2FM6A 5EVBA 5ACPA 4EY2A 2BC2A 2YZ3A 3PY6A 4DILA 4C1GA 1L9YA 5LS3A 1DDKA 3T3NA 3SPUA 3IEKA 5K4KA 2NYPA 3ZQ4A 2FU6A 4XWWA 3ZR9A 4FEKA 4F6ZA 4UWOB 4TZEA 2FHXA 3AF6A 1X8HA 1XTOA 1XM8A 3X30A 3I11A 2XR1A 2BG2A 4TYTA 4C1FA 2GFJA 3DHCA 4YSKA 2WYLA 2ZZIA 4D02A 4D1VA 2Q0JA 1BVTA 2P18A 4J5FA 3X2YA 4KEQA 2FU8A 2BFKA 4D1TA
chains in the Genus database with same CATH superfamily
2I7VA 4EYLA 1M2XA 5ACVA 4EYBA 4YSBA 5AXRA 2QINA 2YNTA 4FR7A 1A8TA 5DPXA 1YCGA 4AXHA 4C1HA 2YNVA 3T3OA 4ZNBA 4NQ4A 5ACRA 4NQ5A 4NURA 3BK2A 2OHHA 3RKJA 1QH5A 4ZO3A 1VGNA 2FU9A 1A7TA 5HIOA 2OHIA 2NZEA 1VMEA 3H3EA 2P4ZA 2Y8BA 2QDSA 4PDXA 5IQKA 4KEPA 4BZ3A 4AWZA 5KILA 2CG2A 4EFZA 2VW8A 5B15A 5A0VA 3SW3A 1DD6A 4XUKA 4HL1A 4UWSB 1P9EA 5HH4A 3X2ZA 2FHXB 2CFUA 2GCUA 3LVZA 3IEMA 5LLDA 2AZ4A 5ACUA 4TZBA 5LMCA 1KO2A 4H0DA 4D1UA 4RM5A 4WD6A 3RKKA 5AXOA 5EH9A 4B87A 2UYXA 2BG8B 2Y87A 2I7XA 5KIKA 3A4YA 3RPCA 5FQCA 4TYFA 2P97A 5FQAA 4BP0A 2E7YA 2CBNA 4TZFA 2ZO4A 4C1CA 4Z6XA 3KNSA 2XF4A 5B3RA 2DOOA 1X8IA 2Q0IA 4C1DA 2YNUA 5ACSA 1X8GA 1JJTA 5EVKA 3SD9A 3ZWFA 3JXPA 2YNWA 5EWAA 3ADRA 2P1EA 4GYQA 2M5CA 3DHAA 2H6AA 4DIKA 2R2DA 4GYUA 5AYAA 5EVDA 4NQ6A 3IE1A 1ZKPA 1WUOA 4RAMA 5EHTA 3I14A 4EYFA 2Q9UA 4JO0A 2GFKA 2BG6A 3AJ3A 3KL7A 5K4MA 4Z5ZA 4UWPB 3AF5A 3QH8A 5K4NA 1ZNBA 4XWTA 2BMIA 4UBQA 3SBLA 4D1WA 3TP9A 2BG7A 4TZ9A 5LCHA 2GKLA 4ZEJA 1SMLA 3R2UA 5ACQA 3DH8A 2QJSA 2BG8A 3MD7A 3S0ZA 3BV6A 5EV6A 5B1UA 3IOFA 1YCHA 4GCWA 2BIBA 2M5DA 1WUPA 1KO3A 1VJNA 2WYMA 3I15A 5EW0A 2ZNBA 4Z67A 2BTNA 4AV7A 3X2XA 4NQ2A 2I7TA 4HKYA 5LM6A 2BFZB 4EXSA 2FU7A 4PVTA 5EV8A 4RL0A 2OHJA 4J5HA 4Z7RA 3ESHA 3WXCA 3T9MA 2BFLA 5HISA 2HB9A 2BGAA 4UA4A 2YNTB 4UAMA 3VPEA 2GMNA 2QEDA 4YSLA 4C09A 2ZWRA 3BC2A 4FSBA 2NXAA 2YNVB 3BK1A 3VQZA 2Y8AA 1K07A 4V0HA 5AJLA 4C1EA 1WRAA 4P62A 5LCAA 4Z5YA 1JT1A 2CG3A 1E5DA 4RAWA 3IDZA 1HLKA 5AHOA 4LE6A 5AIJA 2WRSA 4PVOA 3I13A 5FQBA 3F9OA 3IE0A 5ACXA 1Y44A 2QDTA 4F6HA 3IELA 3SFPA 2Q42A 2BR6A 1ZTCA 3PY5A 1DXKA 5HH6A 2DKFA 5ACTA 3FCZA 3ZNBA 4Z60A 2FK6A 3P2UA 5HIPA 5ACWA 3L6NA 5AHRA 3SRXA 4AWYB 1BC2A 3DHBA 2YCBA 4O98A 5K0WA 4AX1B 2WHGA 3IOGA 4HL2A 4U4LA 4AX0B 5LSCA 4UWRB 4CHLA 2WYMC 5LCFA 4RBSA 5LE1A 3PG4A 1YCFA 3G1PA 5A0TA 2A7MA 1MQOA 5AEBA 3IE2A 4AD9A 3Q6VA 1BMCA 1JJEA 3I0VA 3FAIA 2NZFA 4RL2A 2BFZA 5HIQA 2YHEA 2AIOA 4EXYA 5A87A 1WW1A 1KR3A 5HH5A 3KNRA 4ZO2A 1QH3A 5A5ZA 2FM6A 5EVBA 5ACPA 4EY2A 2BC2A 2YZ3A 3PY6A 4DILA 4C1GA 1L9YA 5LS3A 1DDKA 3T3NA 3SPUA 3IEKA 5K4KA 2NYPA 3ZQ4A 2FU6A 4XWWA 3ZR9A 4FEKA 4F6ZA 4UWOB 4TZEA 2FHXA 3AF6A 1X8HA 1XTOA 1XM8A 3X30A 5A23A 3I11A 2XR1A 2BG2A 4TYTA 4C1FA 2GFJA 3DHCA 4YSKA 2WYLA 2ZZIA 4D02A 2CFZA 4D1VA 2Q0JA 1BVTA 2P18A 4J5FA 3X2YA 4KEQA 2FU8A 2BFKA 4D1TA
chains in the Genus database with same CATH topology
2I7VA 4EYLA 1M2XA 5ACVA 4EYBA 4YSBA 5AXRA 2QINA 2YNTA 4FR7A 1A8TA 5DPXA 1YCGA 4C1HA 2YNVA 3T3OA 4ZNBA 4NQ4A 5ACRA 4NQ5A 3BK2A 2OHHA 3RKJA 1QH5A 4ZO3A 1VGNA 2FU9A 1A7TA 5HIOA 2OHIA 2NZEA 1VMEA 3H3EA 2P4ZA 2Y8BA 2QDSA 5IQKA 4KEPA 4BZ3A 4AWZA 5KILA 4EFZA 2VW8A 5B15A 5A0VA 3SW3A 1DD6A 4XUKA 4HL1A 4UWSB 1P9EA 5HH4A 3X2ZA 2FHXB 2GCUA 3LVZA 3IEMA 5LLDA 2AZ4A 5ACUA 4TZBA 5LMCA 1KO2A 4H0DA 4D1UA 4RM5A 4WD6A 3RKKA 5AXOA 5EH9A 4B87A 2UYXA 2BG8B 2Y87A 2I7XA 5KIKA 3A4YA 3RPCA 5FQCA 4TYFA 2P97A 5FQAA 4BP0A 2E7YA 2CBNA 4TZFA 2ZO4A 4C1CA 4Z6XA 3KNSA 2XF4A 5B3RA 2DOOA 1X8IA 2Q0IA 4C1DA 2YNUA 5ACSA 1X8GA 1JJTA 5EVKA 3SD9A 3ZWFA 3JXPA 2YNWA 5EWAA 3ADRA 2P1EA 4GYQA 2M5CA 3DHAA 2H6AA 4DIKA 2R2DA 4GYUA 5AYAA 5EVDA 4NQ6A 3IE1A 1ZKPA 1WUOA 4RAMA 5EHTA 3I14A 4EYFA 2Q9UA 4JO0A 2GFKA 2BG6A 3AJ3A 3KL7A 5K4MA 4Z5ZA 4UWPB 3AF5A 3QH8A 5K4NA 1ZNBA 4XWTA 2BMIA 4UBQA 3SBLA 4D1WA 3TP9A 2BG7A 4TZ9A 5LCHA 2GKLA 4ZEJA 1SMLA 3R2UA 5ACQA 3DH8A 2QJSA 2BG8A 3MD7A 3S0ZA 3BV6A 5EV6A 5B1UA 3IOFA 1YCHA 4GCWA 2BIBA 2M5DA 1WUPA 1KO3A 1VJNA 2WYMA 3I15A 5EW0A 2ZNBA 4Z67A 2BTNA 3X2XA 4NQ2A 2I7TA 4HKYA 5LM6A 2BFZB 4EXSA 2FU7A 4PVTA 5EV8A 4RL0A 2OHJA 4J5HA 4Z7RA 3ESHA 3WXCA 3T9MA 2BFLA 5HISA 2HB9A 2BGAA 4UA4A 2YNTB 4UAMA 3VPEA 2GMNA 2QEDA 4YSLA 4C09A 2ZWRA 3BC2A 4FSBA 2NXAA 2YNVB 3BK1A 3VQZA 2Y8AA 1K07A 4V0HA 4C1EA 1WRAA 4P62A 5LCAA 4Z5YA 1JT1A 1E5DA 4RAWA 3IDZA 1HLKA 5AHOA 4LE6A 2WRSA 4PVOA 3I13A 5FQBA 3F9OA 3IE0A 5ACXA 1Y44A 2QDTA 4F6HA 3IELA 3SFPA 2Q42A 2BR6A 1ZTCA 3PY5A 1DXKA 5HH6A 2DKFA 5ACTA 3FCZA 3ZNBA 4Z60A 2FK6A 3P2UA 5HIPA 5ACWA 3L6NA 5AHRA 3SRXA 4AWYB 1BC2A 3DHBA 2YCBA 4O98A 5K0WA 4AX1B 2WHGA 3IOGA 4HL2A 4U4LA 4AX0B 5LSCA 4UWRB 4CHLA 2WYMC 5LCFA 4RBSA 5LE1A 3PG4A 1YCFA 3G1PA 5A0TA 2A7MA 1MQOA 5AEBA 3IE2A 4AD9A 3Q6VA 1BMCA 1JJEA 3I0VA 3FAIA 2NZFA 4RL2A 2BFZA 5HIQA 2AIOA 4EXYA 5A87A 1WW1A 1KR3A 5HH5A 3KNRA 4ZO2A 1QH3A 5A5ZA 2FM6A 5EVBA 5ACPA 4EY2A 2BC2A 2YZ3A 3PY6A 4DILA 4C1GA 1L9YA 5LS3A 1DDKA 3T3NA 3SPUA 3IEKA 5K4KA 2NYPA 3ZQ4A 2FU6A 4XWWA 3ZR9A 4FEKA 4F6ZA 4UWOB 4TZEA 2FHXA 3AF6A 1X8HA 1XTOA 1XM8A 3X30A 3I11A 2XR1A 2BG2A 4TYTA 4C1FA 2GFJA 3DHCA 4YSKA 2WYLA 2ZZIA 4D02A 4D1VA 2Q0JA 1BVTA 2P18A 4J5FA 3X2YA 4KEQA 2FU8A 2BFKA 4D1TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2I7V A;  4EYL A;  1M2X A;  5ACV A;  4EYB A;  4YSB A;  5AXR A;  2QIN A;  2YNT A;  4FR7 A;  1A8T A;  5DPX A;  1YCG A;  4C1H A;  2YNV A;  3T3O A;  4ZNB A;  4NQ4 A;  5ACR A;  4NQ5 A;  3BK2 A;  2OHH A;  3RKJ A;  1QH5 A;  4ZO3 A;  1VGN A;  2FU9 A;  1A7T A;  5HIO A;  2OHI A;  2NZE A;  1VME A;  3H3E A;  2P4Z A;  2Y8B A;  2QDS A;  5IQK A;  4KEP A;  4BZ3 A;  4AWZ A;  5KIL A;  4EFZ A;  2VW8 A;  5B15 A;  5A0V A;  3SW3 A;  1DD6 A;  4XUK A;  4HL1 A;  4UWS B;  1P9E A;  5HH4 A;  3X2Z A;  2FHX B;  2GCU A;  3LVZ A;  3IEM A;  5LLD A;  2AZ4 A;  5ACU A;  4TZB A;  5LMC A;  1KO2 A;  4H0D A;  4D1U A;  4RM5 A;  4WD6 A;  3RKK A;  5AXO A;  5EH9 A;  4B87 A;  2UYX A;  2BG8 B;  2Y87 A;  2I7X A;  5KIK A;  3A4Y A;  3RPC A;  5FQC A;  4TYF A;  2P97 A;  5FQA A;  4BP0 A;  2E7Y A;  2CBN A;  4TZF A;  2ZO4 A;  4C1C A;  4Z6X A;  3KNS A;  2XF4 A;  5B3R A;  2DOO A;  1X8I A;  2Q0I A;  4C1D A;  2YNU A;  5ACS A;  1X8G A;  1JJT A;  5EVK A;  3SD9 A;  3ZWF A;  3JXP A;  2YNW A;  5EWA A;  3ADR A;  2P1E A;  4GYQ A;  2M5C A;  3DHA A;  2H6A A;  4DIK A;  2R2D A;  4GYU A;  5AYA A;  5EVD A;  4NQ6 A;  3IE1 A;  1ZKP A;  1WUO A;  4RAM A;  5EHT A;  3I14 A;  4EYF A;  2Q9U A;  4JO0 A;  2GFK A;  2BG6 A;  3AJ3 A;  3KL7 A;  5K4M A;  4Z5Z A;  4UWP B;  3AF5 A;  3QH8 A;  5K4N A;  1ZNB A;  4XWT A;  2BMI A;  4UBQ A;  3SBL A;  4D1W A;  3TP9 A;  2BG7 A;  4TZ9 A;  5LCH A;  2GKL A;  4ZEJ A;  1SML A;  3R2U A;  5ACQ A;  3DH8 A;  2QJS A;  2BG8 A;  3MD7 A;  3S0Z A;  3BV6 A;  5EV6 A;  5B1U A;  3IOF A;  1YCH A;  4GCW A;  2BIB A;  2M5D A;  1WUP A;  1KO3 A;  1VJN A;  2WYM A;  3I15 A;  5EW0 A;  2ZNB A;  4Z67 A;  2BTN A;  3X2X A;  4NQ2 A;  2I7T A;  4HKY A;  5LM6 A;  2BFZ B;  4EXS A;  2FU7 A;  4PVT A;  5EV8 A;  4RL0 A;  2OHJ A;  4J5H A;  4Z7R A;  3ESH A;  3WXC A;  3T9M A;  2BFL A;  5HIS A;  2HB9 A;  2BGA A;  4UA4 A;  2YNT B;  4UAM A;  3VPE A;  2GMN A;  2QED A;  4YSL A;  4C09 A;  2ZWR A;  3BC2 A;  4FSB A;  2NXA A;  2YNV B;  3BK1 A;  3VQZ A;  2Y8A A;  1K07 A;  4V0H A;  4C1E A;  1WRA A;  4P62 A;  5LCA A;  4Z5Y A;  1JT1 A;  1E5D A;  4RAW A;  3IDZ A;  1HLK A;  5AHO A;  4LE6 A;  2WRS A;  4PVO A;  3I13 A;  5FQB A;  3F9O A;  3IE0 A;  5ACX A;  1Y44 A;  2QDT A;  4F6H A;  3IEL A;  3SFP A;  2Q42 A;  2BR6 A;  1ZTC A;  3PY5 A;  1DXK A;  5HH6 A;  2DKF A;  5ACT A;  3FCZ A;  3ZNB A;  4Z60 A;  2FK6 A;  3P2U A;  5HIP A;  5ACW A;  3L6N A;  5AHR A;  3SRX A;  4AWY B;  1BC2 A;  3DHB A;  2YCB A;  4O98 A;  5K0W A;  4AX1 B;  2WHG A;  3IOG A;  4HL2 A;  4U4L A;  4AX0 B;  5LSC A;  4UWR B;  4CHL A;  2WYM C;  5LCF A;  4RBS A;  5LE1 A;  3PG4 A;  1YCF A;  3G1P A;  5A0T A;  2A7M A;  1MQO A;  5AEB A;  3IE2 A;  4AD9 A;  3Q6V A;  1BMC A;  1JJE A;  3I0V A;  3FAI A;  2NZF A;  4RL2 A;  2BFZ A;  5HIQ A;  2AIO A;  4EXY A;  5A87 A;  1WW1 A;  1KR3 A;  5HH5 A;  3KNR A;  4ZO2 A;  1QH3 A;  5A5Z A;  2FM6 A;  5EVB A;  5ACP A;  4EY2 A;  2BC2 A;  2YZ3 A;  3PY6 A;  4DIL A;  4C1G A;  1L9Y A;  5LS3 A;  1DDK A;  3T3N A;  3SPU A;  3IEK A;  5K4K A;  2NYP A;  3ZQ4 A;  2FU6 A;  4XWW A;  3ZR9 A;  4FEK A;  4F6Z A;  4UWO B;  4TZE A;  2FHX A;  3AF6 A;  1X8H A;  1XTO A;  1XM8 A;  3X30 A;  3I11 A;  2XR1 A;  2BG2 A;  4TYT A;  4C1F A;  2GFJ A;  3DHC A;  4YSK A;  2WYL A;  2ZZI A;  4D02 A;  4D1V A;  2Q0J A;  1BVT A;  2P18 A;  4J5F A;  3X2Y A;  4KEQ A;  2FU8 A;  2BFK A;  4D1T A; 
#chains in the Genus database with same CATH topology
 2I7V A;  4EYL A;  1M2X A;  5ACV A;  4EYB A;  4YSB A;  5AXR A;  2QIN A;  2YNT A;  4FR7 A;  1A8T A;  5DPX A;  1YCG A;  4AXH A;  4C1H A;  2YNV A;  3T3O A;  4ZNB A;  4NQ4 A;  5ACR A;  4NQ5 A;  4NUR A;  3BK2 A;  2OHH A;  3RKJ A;  1QH5 A;  4ZO3 A;  1VGN A;  2FU9 A;  1A7T A;  5HIO A;  2OHI A;  2NZE A;  1VME A;  3H3E A;  2P4Z A;  2Y8B A;  2QDS A;  4PDX A;  5IQK A;  4KEP A;  4BZ3 A;  4AWZ A;  5KIL A;  2CG2 A;  4EFZ A;  2VW8 A;  5B15 A;  5A0V A;  3SW3 A;  1DD6 A;  4XUK A;  4HL1 A;  4UWS B;  1P9E A;  5HH4 A;  3X2Z A;  2FHX B;  2CFU A;  2GCU A;  3LVZ A;  3IEM A;  5LLD A;  2AZ4 A;  5ACU A;  4TZB A;  5LMC A;  1KO2 A;  4H0D A;  4D1U A;  4RM5 A;  4WD6 A;  3RKK A;  5AXO A;  5EH9 A;  4B87 A;  2UYX A;  2BG8 B;  2Y87 A;  2I7X A;  5KIK A;  3A4Y A;  3RPC A;  5FQC A;  4TYF A;  2P97 A;  5FQA A;  4BP0 A;  2E7Y A;  2CBN A;  4TZF A;  2ZO4 A;  4C1C A;  4Z6X A;  3KNS A;  2XF4 A;  5B3R A;  2DOO A;  1X8I A;  2Q0I A;  4C1D A;  2YNU A;  5ACS A;  1X8G A;  1JJT A;  5EVK A;  3SD9 A;  3ZWF A;  3JXP A;  2YNW A;  5EWA A;  3ADR A;  2P1E A;  4GYQ A;  2M5C A;  3DHA A;  2H6A A;  4DIK A;  2R2D A;  4GYU A;  5AYA A;  5EVD A;  4NQ6 A;  3IE1 A;  1ZKP A;  1WUO A;  4RAM A;  5EHT A;  3I14 A;  4EYF A;  2Q9U A;  4JO0 A;  2GFK A;  2BG6 A;  3AJ3 A;  3KL7 A;  5K4M A;  4Z5Z A;  4UWP B;  3AF5 A;  3QH8 A;  5K4N A;  1ZNB A;  4XWT A;  2BMI A;  4UBQ A;  3SBL A;  4D1W A;  3TP9 A;  2BG7 A;  4TZ9 A;  5LCH A;  2GKL A;  4ZEJ A;  1SML A;  3R2U A;  5ACQ A;  3DH8 A;  2QJS A;  2BG8 A;  3MD7 A;  3S0Z A;  3BV6 A;  5EV6 A;  5B1U A;  3IOF A;  1YCH A;  4GCW A;  2BIB A;  2M5D A;  1WUP A;  1KO3 A;  1VJN A;  2WYM A;  3I15 A;  5EW0 A;  2ZNB A;  4Z67 A;  2BTN A;  4AV7 A;  3X2X A;  4NQ2 A;  2I7T A;  4HKY A;  5LM6 A;  2BFZ B;  4EXS A;  2FU7 A;  4PVT A;  5EV8 A;  4RL0 A;  2OHJ A;  4J5H A;  4Z7R A;  3ESH A;  3WXC A;  3T9M A;  2BFL A;  5HIS A;  2HB9 A;  2BGA A;  4UA4 A;  2YNT B;  4UAM A;  3VPE A;  2GMN A;  2QED A;  4YSL A;  4C09 A;  2ZWR A;  3BC2 A;  4FSB A;  2NXA A;  2YNV B;  3BK1 A;  3VQZ A;  2Y8A A;  1K07 A;  4V0H A;  5AJL A;  4C1E A;  1WRA A;  4P62 A;  5LCA A;  4Z5Y A;  1JT1 A;  2CG3 A;  1E5D A;  4RAW A;  3IDZ A;  1HLK A;  5AHO A;  4LE6 A;  5AIJ A;  2WRS A;  4PVO A;  3I13 A;  5FQB A;  3F9O A;  3IE0 A;  5ACX A;  1Y44 A;  2QDT A;  4F6H A;  3IEL A;  3SFP A;  2Q42 A;  2BR6 A;  1ZTC A;  3PY5 A;  1DXK A;  5HH6 A;  2DKF A;  5ACT A;  3FCZ A;  3ZNB A;  4Z60 A;  2FK6 A;  3P2U A;  5HIP A;  5ACW A;  3L6N A;  5AHR A;  3SRX A;  4AWY B;  1BC2 A;  3DHB A;  2YCB A;  4O98 A;  5K0W A;  4AX1 B;  2WHG A;  3IOG A;  4HL2 A;  4U4L A;  4AX0 B;  5LSC A;  4UWR B;  4CHL A;  2WYM C;  5LCF A;  4RBS A;  5LE1 A;  3PG4 A;  1YCF A;  3G1P A;  5A0T A;  2A7M A;  1MQO A;  5AEB A;  3IE2 A;  4AD9 A;  3Q6V A;  1BMC A;  1JJE A;  3I0V A;  3FAI A;  2NZF A;  4RL2 A;  2BFZ A;  5HIQ A;  2YHE A;  2AIO A;  4EXY A;  5A87 A;  1WW1 A;  1KR3 A;  5HH5 A;  3KNR A;  4ZO2 A;  1QH3 A;  5A5Z A;  2FM6 A;  5EVB A;  5ACP A;  4EY2 A;  2BC2 A;  2YZ3 A;  3PY6 A;  4DIL A;  4C1G A;  1L9Y A;  5LS3 A;  1DDK A;  3T3N A;  3SPU A;  3IEK A;  5K4K A;  2NYP A;  3ZQ4 A;  2FU6 A;  4XWW A;  3ZR9 A;  4FEK A;  4F6Z A;  4UWO B;  4TZE A;  2FHX A;  3AF6 A;  1X8H A;  1XTO A;  1XM8 A;  3X30 A;  5A23 A;  3I11 A;  2XR1 A;  2BG2 A;  4TYT A;  4C1F A;  2GFJ A;  3DHC A;  4YSK A;  2WYL A;  2ZZI A;  4D02 A;  2CFZ A;  4D1V A;  2Q0J A;  1BVT A;  2P18 A;  4J5F A;  3X2Y A;  4KEQ A;  2FU8 A;  2BFK A;  4D1T A; 
#chains in the Genus database with same CATH homology
 2I7V A;  4EYL A;  1M2X A;  5ACV A;  4EYB A;  4YSB A;  5AXR A;  2QIN A;  2YNT A;  4FR7 A;  1A8T A;  5DPX A;  1YCG A;  4C1H A;  2YNV A;  3T3O A;  4ZNB A;  4NQ4 A;  5ACR A;  4NQ5 A;  3BK2 A;  2OHH A;  3RKJ A;  1QH5 A;  4ZO3 A;  1VGN A;  2FU9 A;  1A7T A;  5HIO A;  2OHI A;  2NZE A;  1VME A;  3H3E A;  2P4Z A;  2Y8B A;  2QDS A;  5IQK A;  4KEP A;  4BZ3 A;  4AWZ A;  5KIL A;  4EFZ A;  2VW8 A;  5B15 A;  5A0V A;  3SW3 A;  1DD6 A;  4XUK A;  4HL1 A;  4UWS B;  1P9E A;  5HH4 A;  3X2Z A;  2FHX B;  2GCU A;  3LVZ A;  3IEM A;  5LLD A;  2AZ4 A;  5ACU A;  4TZB A;  5LMC A;  1KO2 A;  4H0D A;  4D1U A;  4RM5 A;  4WD6 A;  3RKK A;  5AXO A;  5EH9 A;  4B87 A;  2UYX A;  2BG8 B;  2Y87 A;  2I7X A;  5KIK A;  3A4Y A;  3RPC A;  5FQC A;  4TYF A;  2P97 A;  5FQA A;  4BP0 A;  2E7Y A;  2CBN A;  4TZF A;  2ZO4 A;  4C1C A;  4Z6X A;  3KNS A;  2XF4 A;  5B3R A;  2DOO A;  1X8I A;  2Q0I A;  4C1D A;  2YNU A;  5ACS A;  1X8G A;  1JJT A;  5EVK A;  3SD9 A;  3ZWF A;  3JXP A;  2YNW A;  5EWA A;  3ADR A;  2P1E A;  4GYQ A;  2M5C A;  3DHA A;  2H6A A;  4DIK A;  2R2D A;  4GYU A;  5AYA A;  5EVD A;  4NQ6 A;  3IE1 A;  1ZKP A;  1WUO A;  4RAM A;  5EHT A;  3I14 A;  4EYF A;  2Q9U A;  4JO0 A;  2GFK A;  2BG6 A;  3AJ3 A;  3KL7 A;  5K4M A;  4Z5Z A;  4UWP B;  3AF5 A;  3QH8 A;  5K4N A;  1ZNB A;  4XWT A;  2BMI A;  4UBQ A;  3SBL A;  4D1W A;  3TP9 A;  2BG7 A;  4TZ9 A;  5LCH A;  2GKL A;  4ZEJ A;  1SML A;  3R2U A;  5ACQ A;  3DH8 A;  2QJS A;  2BG8 A;  3MD7 A;  3S0Z A;  3BV6 A;  5EV6 A;  5B1U A;  3IOF A;  1YCH A;  4GCW A;  2BIB A;  2M5D A;  1WUP A;  1KO3 A;  1VJN A;  2WYM A;  3I15 A;  5EW0 A;  2ZNB A;  4Z67 A;  2BTN A;  3X2X A;  4NQ2 A;  2I7T A;  4HKY A;  5LM6 A;  2BFZ B;  4EXS A;  2FU7 A;  4PVT A;  5EV8 A;  4RL0 A;  2OHJ A;  4J5H A;  4Z7R A;  3ESH A;  3WXC A;  3T9M A;  2BFL A;  5HIS A;  2HB9 A;  2BGA A;  4UA4 A;  2YNT B;  4UAM A;  3VPE A;  2GMN A;  2QED A;  4YSL A;  4C09 A;  2ZWR A;  3BC2 A;  4FSB A;  2NXA A;  2YNV B;  3BK1 A;  3VQZ A;  2Y8A A;  1K07 A;  4V0H A;  4C1E A;  1WRA A;  4P62 A;  5LCA A;  4Z5Y A;  1JT1 A;  1E5D A;  4RAW A;  3IDZ A;  1HLK A;  5AHO A;  4LE6 A;  2WRS A;  4PVO A;  3I13 A;  5FQB A;  3F9O A;  3IE0 A;  5ACX A;  1Y44 A;  2QDT A;  4F6H A;  3IEL A;  3SFP A;  2Q42 A;  2BR6 A;  1ZTC A;  3PY5 A;  1DXK A;  5HH6 A;  2DKF A;  5ACT A;  3FCZ A;  3ZNB A;  4Z60 A;  2FK6 A;  3P2U A;  5HIP A;  5ACW A;  3L6N A;  5AHR A;  3SRX A;  4AWY B;  1BC2 A;  3DHB A;  2YCB A;  4O98 A;  5K0W A;  4AX1 B;  2WHG A;  3IOG A;  4HL2 A;  4U4L A;  4AX0 B;  5LSC A;  4UWR B;  4CHL A;  2WYM C;  5LCF A;  4RBS A;  5LE1 A;  3PG4 A;  1YCF A;  3G1P A;  5A0T A;  2A7M A;  1MQO A;  5AEB A;  3IE2 A;  4AD9 A;  3Q6V A;  1BMC A;  1JJE A;  3I0V A;  3FAI A;  2NZF A;  4RL2 A;  2BFZ A;  5HIQ A;  2AIO A;  4EXY A;  5A87 A;  1WW1 A;  1KR3 A;  5HH5 A;  3KNR A;  4ZO2 A;  1QH3 A;  5A5Z A;  2FM6 A;  5EVB A;  5ACP A;  4EY2 A;  2BC2 A;  2YZ3 A;  3PY6 A;  4DIL A;  4C1G A;  1L9Y A;  5LS3 A;  1DDK A;  3T3N A;  3SPU A;  3IEK A;  5K4K A;  2NYP A;  3ZQ4 A;  2FU6 A;  4XWW A;  3ZR9 A;  4FEK A;  4F6Z A;  4UWO B;  4TZE A;  2FHX A;  3AF6 A;  1X8H A;  1XTO A;  1XM8 A;  3X30 A;  3I11 A;  2XR1 A;  2BG2 A;  4TYT A;  4C1F A;  2GFJ A;  3DHC A;  4YSK A;  2WYL A;  2ZZI A;  4D02 A;  4D1V A;  2Q0J A;  1BVT A;  2P18 A;  4J5F A;  3X2Y A;  4KEQ A;  2FU8 A;  2BFK A;  4D1T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...