4C1FA

Crystal structure of the metallo-beta-lactamase imp-1 with l-captopril
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
219
structure length
219
Chain Sequence
SLPDLKIEKLDEGVYVHTSFEEVNGWGVVPKHGLVVLVNAEAYLIDTPFTAKDTEKLVTWFVERGYKIKGSISSHFHSDSTGGIEWLNSRSIPTYASELTNELLKKDGKVQATNSFSGVNYWLVKNKIEVFYPGPGHTPDNVVVWLPERKILFGGCFIKPYGLGNLGDANIEAWPKSAKLLKSKYGKAKLVVPSHSEVGDASLLKLTLEQAVKGLNESK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis of Metallo-beta-Lactamase Inhibition by Captopril Stereoisomers.
pubmed doi rcsb
source organism Serratia marcescens
molecule tags Hydrolase
molecule keywords BETA-LACTAMASE IMP-1
total genus 69
structure length 219
sequence length 219
chains with identical sequence B
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2013-08-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 4c1fA00
3VPEA 3MD7A 2AIOA 2A7MA 1JT1A 4J5HA 1VGNA 2YNTA 4Z5ZA 4EY2A 2FHXA 4XWWA 5A0TA 5EVBA 1WUPA 3RPCA 4EYLA 2WRSA 3IOGA 2XF4A 3ADRA 3WXCA 5EWAA 4RM5A 5HISA 3VQZA 2Y8BA 4HL1A 5IQKA 5EH9A 3Q6VA 5ACWA 5A5ZA 4WD6A 1VMEA 5B15A 5A0VA 1A7TA 2WYMA 4O98A 4DILA 5ACRA 2GFKA 4C1DA 1SMLA 2NYPA 3H3EA 4UAMA 2OHHA 3AJ3A 4TZ9A 2M5DA 2YNTB 3SRXA 2VW8A 3FAIA 2BFLA 2YNUA 4RL0A 1JJTA 4UBQA 1YCFA 2QJSA 5HIQA 1HLKA 2BGAA 1DD6A 4HL2A 3AF5A 4Z7RA 4NQ2A 3X2YA 2I7VA 4UWRB 2ZNBA 2ZWRA 5AHOA 2WYLA 4BP0A 5ACUA 4BZ3A 5FQAA 2QEDA 4F6HA 5HIPA 4AWYB 4YSLA 2I7XA 2FU8A 4B87A 4GYQA 1QH3A 2OHJA 2Q0IA 3X2XA 3BK1A 3KNRA 1ZTCA 2BIBA 2BC2A 2DOOA 4YSKA 2BG8A 5EW0A 4ZEJA 3TP9A 2Y8AA 2I7TA 3KL7A 5B3RA 1E5DA 3SBLA 3I0VA 2YNVA 5LS3A 4NQ6A 3DHBA 3G1PA 5K0WA 2GMNA 2BG7A 3I11A 5DPXA 2GKLA 4NQ4A 2BG6A 4C09A 2YNWA 5ACPA 3JXPA 4C1EA 5AEBA 4D02A 2P18A 4UWPB 4TZFA 1MQOA 4XWTA 5K4KA 4Z6XA 2ZO4A 1X8IA 2FU9A 4KEQA 1KR3A 5LSCA 3SFPA 2WYMC 4C1HA 5ACVA 5EV8A 3BC2A 2QINA 2Y87A 2BG2A 2GFJA 2P4ZA 5LMCA 3ZNBA 1JJEA 1BMCA 1QH5A 3DHCA 3IEMA 1WW1A 2M5CA 3F9OA 4KEPA 4D1TA 4H0DA 4EYBA 3AF6A 2ZZIA 4RAWA 5ACXA 5LCFA 2E7YA 2BFZA 2QDTA 3R2UA 3ZR9A 1ZNBA 4C1FA 3ZQ4A 2YCBA 4FR7A 2QDSA 4V0HA 2FHXB 4TZEA 3IE1A 2YZ3A 4FEKA 1X8HA 3T3OA 2P97A 4FSBA 3BV6A 1YCGA 4Z67A 3T3NA 4J5FA 1A8TA 2DKFA 5FQCA 5AYAA 5AXOA 4TYFA 4YSBA 1DDKA 3LVZA 3IDZA 3IE2A 2Q0JA 5LCAA 1M2XA 1P9EA 3BK2A 4EYFA 4RBSA 4AWZA 4EXYA 1L9YA 4RAMA 1ZKPA 4ZO3A 4GCWA 2FK6A 1KO2A 2BFKA 1K07A 4HKYA 4AX1B 3KNSA 3IOFA 5LE1A 1XTOA 1YCHA 4GYUA 4P62A 3IE0A 2OHIA 2UYXA 3I15A 2H6AA 3L6NA 1KO3A 4AD9A 2NXAA 2WHGA 3PY5A 4Z5YA 2CBNA 5B1UA 3X30A 4UWOB 2P1EA 3QH8A 4DIKA 3RKJA 5KIKA 2XR1A 4C1GA 5LM6A 5A87A 4EXSA 3P2UA 1XM8A 3S0ZA 1Y44A 4EFZA 2FM6A 4ZNBA 3SW3A 4CHLA 3DHAA 2FU6A 2BTNA 1BVTA 3SPUA 3RKKA 4AX0B 3PY6A 3ESHA 5HH5A 5AHRA 2NZFA 5KILA 3A4YA 4PVTA 4UWSB 1X8GA 5EVDA 3IELA 2BG8B 1DXKA 5HH4A 2BFZB 3PG4A 2Q42A 4RL2A 5EHTA 5FQBA 3I13A 4U4LA 4LE6A 4C1CA 4XUKA 5ACQA 2BR6A 2HB9A 3T9MA 4D1VA 3ZWFA 2AZ4A 4UA4A 4PVOA 5LCHA 1BC2A 2GCUA 3X2ZA 2YNVB 5K4NA 5HH6A 5ACSA 4F6ZA 4Z60A 5EV6A 2Q9UA 1WUOA 3IEKA 1VJNA 3SD9A 3FCZA 5LLDA 4ZO2A 4JO0A 2FU7A 4NQ5A 1WRAA 5HIOA 4TYTA 4D1UA 4TZBA 5AXRA 2R2DA 5K4MA 5ACTA 3I14A 3DH8A 2NZEA 4D1WA 2BMIA 5EVKA
chains in the Genus database with same CATH superfamily
3VPEA 3MD7A 2AIOA 2A7MA 4PDXA 1JT1A 4J5HA 1VGNA 2YNTA 4Z5ZA 4EY2A 2FHXA 4XWWA 5A0TA 5EVBA 1WUPA 3RPCA 4EYLA 2WRSA 3IOGA 2XF4A 3ADRA 3WXCA 5EWAA 4RM5A 5HISA 3VQZA 2Y8BA 4HL1A 5IQKA 5EH9A 3Q6VA 5ACWA 5A5ZA 4WD6A 1VMEA 5AIJA 5B15A 5A0VA 1A7TA 2WYMA 4O98A 4DILA 5ACRA 2GFKA 4C1DA 1SMLA 2NYPA 3H3EA 4UAMA 2OHHA 3AJ3A 4TZ9A 2M5DA 2YNTB 3SRXA 2VW8A 3FAIA 2BFLA 2YNUA 4RL0A 1JJTA 4UBQA 1YCFA 2QJSA 5HIQA 1HLKA 2BGAA 1DD6A 4HL2A 3AF5A 4Z7RA 4NQ2A 3X2YA 2CFZA 2I7VA 4UWRB 2ZNBA 2ZWRA 5AHOA 2WYLA 4BP0A 5ACUA 4BZ3A 5FQAA 2QEDA 5A23A 4F6HA 5HIPA 4AWYB 4YSLA 2I7XA 2FU8A 4B87A 4GYQA 1QH3A 2OHJA 2Q0IA 3X2XA 3BK1A 3KNRA 1ZTCA 2BIBA 4AV7A 2BC2A 2DOOA 4YSKA 2BG8A 5EW0A 4ZEJA 3TP9A 2Y8AA 2I7TA 3KL7A 5B3RA 1E5DA 3SBLA 3I0VA 2YNVA 5LS3A 4NQ6A 3DHBA 3G1PA 5K0WA 2GMNA 2BG7A 3I11A 5DPXA 2GKLA 4NQ4A 2BG6A 4C09A 2YNWA 5ACPA 3JXPA 4C1EA 5AEBA 4D02A 2P18A 4UWPB 4TZFA 1MQOA 4XWTA 5K4KA 4Z6XA 2ZO4A 1X8IA 2FU9A 4KEQA 1KR3A 5LSCA 3SFPA 2WYMC 4C1HA 5ACVA 5EV8A 3BC2A 2QINA 2Y87A 2BG2A 2GFJA 2P4ZA 5LMCA 3ZNBA 1JJEA 1BMCA 1QH5A 3DHCA 3IEMA 1WW1A 2M5CA 3F9OA 4KEPA 4D1TA 4H0DA 4EYBA 3AF6A 2ZZIA 4RAWA 5ACXA 5LCFA 2E7YA 4NURA 2YHEA 2BFZA 2QDTA 3R2UA 3ZR9A 1ZNBA 4C1FA 2CFUA 3ZQ4A 2YCBA 4FR7A 2QDSA 4V0HA 2FHXB 4TZEA 3IE1A 2YZ3A 4FEKA 1X8HA 3T3OA 2P97A 4FSBA 3BV6A 1YCGA 4Z67A 3T3NA 4J5FA 1A8TA 2DKFA 5FQCA 5AYAA 5AXOA 4TYFA 4YSBA 1DDKA 3LVZA 3IDZA 3IE2A 2Q0JA 5LCAA 1M2XA 1P9EA 3BK2A 4EYFA 4RBSA 4AWZA 4EXYA 1L9YA 4RAMA 1ZKPA 4ZO3A 4GCWA 2FK6A 1KO2A 2BFKA 1K07A 4HKYA 4AX1B 3KNSA 3IOFA 5LE1A 2CG2A 1XTOA 1YCHA 4GYUA 4P62A 4AXHA 3IE0A 2OHIA 2UYXA 3I15A 2H6AA 3L6NA 1KO3A 4AD9A 2NXAA 2WHGA 3PY5A 4Z5YA 2CBNA 5B1UA 3X30A 4UWOB 2P1EA 3QH8A 4DIKA 3RKJA 5AJLA 5KIKA 2XR1A 4C1GA 5LM6A 5A87A 4EXSA 3P2UA 1XM8A 2CG3A 3S0ZA 1Y44A 4EFZA 2FM6A 4ZNBA 3SW3A 4CHLA 3DHAA 2FU6A 2BTNA 1BVTA 3SPUA 3RKKA 4AX0B 3PY6A 3ESHA 5HH5A 5AHRA 2NZFA 5KILA 3A4YA 4PVTA 4UWSB 1X8GA 5EVDA 3IELA 2BG8B 1DXKA 5HH4A 2BFZB 3PG4A 2Q42A 4RL2A 5EHTA 5FQBA 3I13A 4U4LA 4LE6A 4C1CA 4XUKA 5ACQA 2BR6A 2HB9A 3T9MA 4D1VA 3ZWFA 2AZ4A 4UA4A 4PVOA 5LCHA 1BC2A 2GCUA 3X2ZA 2YNVB 5K4NA 5HH6A 5ACSA 4F6ZA 4Z60A 5EV6A 2Q9UA 1WUOA 3IEKA 1VJNA 3SD9A 3FCZA 5LLDA 4ZO2A 4JO0A 2FU7A 4NQ5A 1WRAA 5HIOA 4TYTA 4D1UA 4TZBA 5AXRA 2R2DA 5K4MA 5ACTA 3I14A 3DH8A 2NZEA 4D1WA 2BMIA 5EVKA
chains in the Genus database with same CATH topology
3VPEA 3MD7A 2AIOA 2A7MA 1JT1A 4J5HA 1VGNA 2YNTA 4Z5ZA 4EY2A 2FHXA 4XWWA 5A0TA 5EVBA 1WUPA 3RPCA 4EYLA 2WRSA 3IOGA 2XF4A 3ADRA 3WXCA 5EWAA 4RM5A 5HISA 3VQZA 2Y8BA 4HL1A 5IQKA 5EH9A 3Q6VA 5ACWA 5A5ZA 4WD6A 1VMEA 5B15A 5A0VA 1A7TA 2WYMA 4O98A 4DILA 5ACRA 2GFKA 4C1DA 1SMLA 2NYPA 3H3EA 4UAMA 2OHHA 3AJ3A 4TZ9A 2M5DA 2YNTB 3SRXA 2VW8A 3FAIA 2BFLA 2YNUA 4RL0A 1JJTA 4UBQA 1YCFA 2QJSA 5HIQA 1HLKA 2BGAA 1DD6A 4HL2A 3AF5A 4Z7RA 4NQ2A 3X2YA 2I7VA 4UWRB 2ZNBA 2ZWRA 5AHOA 2WYLA 4BP0A 5ACUA 4BZ3A 5FQAA 2QEDA 4F6HA 5HIPA 4AWYB 4YSLA 2I7XA 2FU8A 4B87A 4GYQA 1QH3A 2OHJA 2Q0IA 3X2XA 3BK1A 3KNRA 1ZTCA 2BIBA 2BC2A 2DOOA 4YSKA 2BG8A 5EW0A 4ZEJA 3TP9A 2Y8AA 2I7TA 3KL7A 5B3RA 1E5DA 3SBLA 3I0VA 2YNVA 5LS3A 4NQ6A 3DHBA 3G1PA 5K0WA 2GMNA 2BG7A 3I11A 5DPXA 2GKLA 4NQ4A 2BG6A 4C09A 2YNWA 5ACPA 3JXPA 4C1EA 5AEBA 4D02A 2P18A 4UWPB 4TZFA 1MQOA 4XWTA 5K4KA 4Z6XA 2ZO4A 1X8IA 2FU9A 4KEQA 1KR3A 5LSCA 3SFPA 2WYMC 4C1HA 5ACVA 5EV8A 3BC2A 2QINA 2Y87A 2BG2A 2GFJA 2P4ZA 5LMCA 3ZNBA 1JJEA 1BMCA 1QH5A 3DHCA 3IEMA 1WW1A 2M5CA 3F9OA 4KEPA 4D1TA 4H0DA 4EYBA 3AF6A 2ZZIA 4RAWA 5ACXA 5LCFA 2E7YA 2BFZA 2QDTA 3R2UA 3ZR9A 1ZNBA 4C1FA 3ZQ4A 2YCBA 4FR7A 2QDSA 4V0HA 2FHXB 4TZEA 3IE1A 2YZ3A 4FEKA 1X8HA 3T3OA 2P97A 4FSBA 3BV6A 1YCGA 4Z67A 3T3NA 4J5FA 1A8TA 2DKFA 5FQCA 5AYAA 5AXOA 4TYFA 4YSBA 1DDKA 3LVZA 3IDZA 3IE2A 2Q0JA 5LCAA 1M2XA 1P9EA 3BK2A 4EYFA 4RBSA 4AWZA 4EXYA 1L9YA 4RAMA 1ZKPA 4ZO3A 4GCWA 2FK6A 1KO2A 2BFKA 1K07A 4HKYA 4AX1B 3KNSA 3IOFA 5LE1A 1XTOA 1YCHA 4GYUA 4P62A 3IE0A 2OHIA 2UYXA 3I15A 2H6AA 3L6NA 1KO3A 4AD9A 2NXAA 2WHGA 3PY5A 4Z5YA 2CBNA 5B1UA 3X30A 4UWOB 2P1EA 3QH8A 4DIKA 3RKJA 5KIKA 2XR1A 4C1GA 5LM6A 5A87A 4EXSA 3P2UA 1XM8A 3S0ZA 1Y44A 4EFZA 2FM6A 4ZNBA 3SW3A 4CHLA 3DHAA 2FU6A 2BTNA 1BVTA 3SPUA 3RKKA 4AX0B 3PY6A 3ESHA 5HH5A 5AHRA 2NZFA 5KILA 3A4YA 4PVTA 4UWSB 1X8GA 5EVDA 3IELA 2BG8B 1DXKA 5HH4A 2BFZB 3PG4A 2Q42A 4RL2A 5EHTA 5FQBA 3I13A 4U4LA 4LE6A 4C1CA 4XUKA 5ACQA 2BR6A 2HB9A 3T9MA 4D1VA 3ZWFA 2AZ4A 4UA4A 4PVOA 5LCHA 1BC2A 2GCUA 3X2ZA 2YNVB 5K4NA 5HH6A 5ACSA 4F6ZA 4Z60A 5EV6A 2Q9UA 1WUOA 3IEKA 1VJNA 3SD9A 3FCZA 5LLDA 4ZO2A 4JO0A 2FU7A 4NQ5A 1WRAA 5HIOA 4TYTA 4D1UA 4TZBA 5AXRA 2R2DA 5K4MA 5ACTA 3I14A 3DH8A 2NZEA 4D1WA 2BMIA 5EVKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VPE A;  3MD7 A;  2AIO A;  2A7M A;  1JT1 A;  4J5H A;  1VGN A;  2YNT A;  4Z5Z A;  4EY2 A;  2FHX A;  4XWW A;  5A0T A;  5EVB A;  1WUP A;  3RPC A;  4EYL A;  2WRS A;  3IOG A;  2XF4 A;  3ADR A;  3WXC A;  5EWA A;  4RM5 A;  5HIS A;  3VQZ A;  2Y8B A;  4HL1 A;  5IQK A;  5EH9 A;  3Q6V A;  5ACW A;  5A5Z A;  4WD6 A;  1VME A;  5B15 A;  5A0V A;  1A7T A;  2WYM A;  4O98 A;  4DIL A;  5ACR A;  2GFK A;  4C1D A;  1SML A;  2NYP A;  3H3E A;  4UAM A;  2OHH A;  3AJ3 A;  4TZ9 A;  2M5D A;  2YNT B;  3SRX A;  2VW8 A;  3FAI A;  2BFL A;  2YNU A;  4RL0 A;  1JJT A;  4UBQ A;  1YCF A;  2QJS A;  5HIQ A;  1HLK A;  2BGA A;  1DD6 A;  4HL2 A;  3AF5 A;  4Z7R A;  4NQ2 A;  3X2Y A;  2I7V A;  4UWR B;  2ZNB A;  2ZWR A;  5AHO A;  2WYL A;  4BP0 A;  5ACU A;  4BZ3 A;  5FQA A;  2QED A;  4F6H A;  5HIP A;  4AWY B;  4YSL A;  2I7X A;  2FU8 A;  4B87 A;  4GYQ A;  1QH3 A;  2OHJ A;  2Q0I A;  3X2X A;  3BK1 A;  3KNR A;  1ZTC A;  2BIB A;  2BC2 A;  2DOO A;  4YSK A;  2BG8 A;  5EW0 A;  4ZEJ A;  3TP9 A;  2Y8A A;  2I7T A;  3KL7 A;  5B3R A;  1E5D A;  3SBL A;  3I0V A;  2YNV A;  5LS3 A;  4NQ6 A;  3DHB A;  3G1P A;  5K0W A;  2GMN A;  2BG7 A;  3I11 A;  5DPX A;  2GKL A;  4NQ4 A;  2BG6 A;  4C09 A;  2YNW A;  5ACP A;  3JXP A;  4C1E A;  5AEB A;  4D02 A;  2P18 A;  4UWP B;  4TZF A;  1MQO A;  4XWT A;  5K4K A;  4Z6X A;  2ZO4 A;  1X8I A;  2FU9 A;  4KEQ A;  1KR3 A;  5LSC A;  3SFP A;  2WYM C;  4C1H A;  5ACV A;  5EV8 A;  3BC2 A;  2QIN A;  2Y87 A;  2BG2 A;  2GFJ A;  2P4Z A;  5LMC A;  3ZNB A;  1JJE A;  1BMC A;  1QH5 A;  3DHC A;  3IEM A;  1WW1 A;  2M5C A;  3F9O A;  4KEP A;  4D1T A;  4H0D A;  4EYB A;  3AF6 A;  2ZZI A;  4RAW A;  5ACX A;  5LCF A;  2E7Y A;  2BFZ A;  2QDT A;  3R2U A;  3ZR9 A;  1ZNB A;  4C1F A;  3ZQ4 A;  2YCB A;  4FR7 A;  2QDS A;  4V0H A;  2FHX B;  4TZE A;  3IE1 A;  2YZ3 A;  4FEK A;  1X8H A;  3T3O A;  2P97 A;  4FSB A;  3BV6 A;  1YCG A;  4Z67 A;  3T3N A;  4J5F A;  1A8T A;  2DKF A;  5FQC A;  5AYA A;  5AXO A;  4TYF A;  4YSB A;  1DDK A;  3LVZ A;  3IDZ A;  3IE2 A;  2Q0J A;  5LCA A;  1M2X A;  1P9E A;  3BK2 A;  4EYF A;  4RBS A;  4AWZ A;  4EXY A;  1L9Y A;  4RAM A;  1ZKP A;  4ZO3 A;  4GCW A;  2FK6 A;  1KO2 A;  2BFK A;  1K07 A;  4HKY A;  4AX1 B;  3KNS A;  3IOF A;  5LE1 A;  1XTO A;  1YCH A;  4GYU A;  4P62 A;  3IE0 A;  2OHI A;  2UYX A;  3I15 A;  2H6A A;  3L6N A;  1KO3 A;  4AD9 A;  2NXA A;  2WHG A;  3PY5 A;  4Z5Y A;  2CBN A;  5B1U A;  3X30 A;  4UWO B;  2P1E A;  3QH8 A;  4DIK A;  3RKJ A;  5KIK A;  2XR1 A;  4C1G A;  5LM6 A;  5A87 A;  4EXS A;  3P2U A;  1XM8 A;  3S0Z A;  1Y44 A;  4EFZ A;  2FM6 A;  4ZNB A;  3SW3 A;  4CHL A;  3DHA A;  2FU6 A;  2BTN A;  1BVT A;  3SPU A;  3RKK A;  4AX0 B;  3PY6 A;  3ESH A;  5HH5 A;  5AHR A;  2NZF A;  5KIL A;  3A4Y A;  4PVT A;  4UWS B;  1X8G A;  5EVD A;  3IEL A;  2BG8 B;  1DXK A;  5HH4 A;  2BFZ B;  3PG4 A;  2Q42 A;  4RL2 A;  5EHT A;  5FQB A;  3I13 A;  4U4L A;  4LE6 A;  4C1C A;  4XUK A;  5ACQ A;  2BR6 A;  2HB9 A;  3T9M A;  4D1V A;  3ZWF A;  2AZ4 A;  4UA4 A;  4PVO A;  5LCH A;  1BC2 A;  2GCU A;  3X2Z A;  2YNV B;  5K4N A;  5HH6 A;  5ACS A;  4F6Z A;  4Z60 A;  5EV6 A;  2Q9U A;  1WUO A;  3IEK A;  1VJN A;  3SD9 A;  3FCZ A;  5LLD A;  4ZO2 A;  4JO0 A;  2FU7 A;  4NQ5 A;  1WRA A;  5HIO A;  4TYT A;  4D1U A;  4TZB A;  5AXR A;  2R2D A;  5K4M A;  5ACT A;  3I14 A;  3DH8 A;  2NZE A;  4D1W A;  2BMI A;  5EVK A; 
#chains in the Genus database with same CATH topology
 3VPE A;  3MD7 A;  2AIO A;  2A7M A;  4PDX A;  1JT1 A;  4J5H A;  1VGN A;  2YNT A;  4Z5Z A;  4EY2 A;  2FHX A;  4XWW A;  5A0T A;  5EVB A;  1WUP A;  3RPC A;  4EYL A;  2WRS A;  3IOG A;  2XF4 A;  3ADR A;  3WXC A;  5EWA A;  4RM5 A;  5HIS A;  3VQZ A;  2Y8B A;  4HL1 A;  5IQK A;  5EH9 A;  3Q6V A;  5ACW A;  5A5Z A;  4WD6 A;  1VME A;  5AIJ A;  5B15 A;  5A0V A;  1A7T A;  2WYM A;  4O98 A;  4DIL A;  5ACR A;  2GFK A;  4C1D A;  1SML A;  2NYP A;  3H3E A;  4UAM A;  2OHH A;  3AJ3 A;  4TZ9 A;  2M5D A;  2YNT B;  3SRX A;  2VW8 A;  3FAI A;  2BFL A;  2YNU A;  4RL0 A;  1JJT A;  4UBQ A;  1YCF A;  2QJS A;  5HIQ A;  1HLK A;  2BGA A;  1DD6 A;  4HL2 A;  3AF5 A;  4Z7R A;  4NQ2 A;  3X2Y A;  2CFZ A;  2I7V A;  4UWR B;  2ZNB A;  2ZWR A;  5AHO A;  2WYL A;  4BP0 A;  5ACU A;  4BZ3 A;  5FQA A;  2QED A;  5A23 A;  4F6H A;  5HIP A;  4AWY B;  4YSL A;  2I7X A;  2FU8 A;  4B87 A;  4GYQ A;  1QH3 A;  2OHJ A;  2Q0I A;  3X2X A;  3BK1 A;  3KNR A;  1ZTC A;  2BIB A;  4AV7 A;  2BC2 A;  2DOO A;  4YSK A;  2BG8 A;  5EW0 A;  4ZEJ A;  3TP9 A;  2Y8A A;  2I7T A;  3KL7 A;  5B3R A;  1E5D A;  3SBL A;  3I0V A;  2YNV A;  5LS3 A;  4NQ6 A;  3DHB A;  3G1P A;  5K0W A;  2GMN A;  2BG7 A;  3I11 A;  5DPX A;  2GKL A;  4NQ4 A;  2BG6 A;  4C09 A;  2YNW A;  5ACP A;  3JXP A;  4C1E A;  5AEB A;  4D02 A;  2P18 A;  4UWP B;  4TZF A;  1MQO A;  4XWT A;  5K4K A;  4Z6X A;  2ZO4 A;  1X8I A;  2FU9 A;  4KEQ A;  1KR3 A;  5LSC A;  3SFP A;  2WYM C;  4C1H A;  5ACV A;  5EV8 A;  3BC2 A;  2QIN A;  2Y87 A;  2BG2 A;  2GFJ A;  2P4Z A;  5LMC A;  3ZNB A;  1JJE A;  1BMC A;  1QH5 A;  3DHC A;  3IEM A;  1WW1 A;  2M5C A;  3F9O A;  4KEP A;  4D1T A;  4H0D A;  4EYB A;  3AF6 A;  2ZZI A;  4RAW A;  5ACX A;  5LCF A;  2E7Y A;  4NUR A;  2YHE A;  2BFZ A;  2QDT A;  3R2U A;  3ZR9 A;  1ZNB A;  4C1F A;  2CFU A;  3ZQ4 A;  2YCB A;  4FR7 A;  2QDS A;  4V0H A;  2FHX B;  4TZE A;  3IE1 A;  2YZ3 A;  4FEK A;  1X8H A;  3T3O A;  2P97 A;  4FSB A;  3BV6 A;  1YCG A;  4Z67 A;  3T3N A;  4J5F A;  1A8T A;  2DKF A;  5FQC A;  5AYA A;  5AXO A;  4TYF A;  4YSB A;  1DDK A;  3LVZ A;  3IDZ A;  3IE2 A;  2Q0J A;  5LCA A;  1M2X A;  1P9E A;  3BK2 A;  4EYF A;  4RBS A;  4AWZ A;  4EXY A;  1L9Y A;  4RAM A;  1ZKP A;  4ZO3 A;  4GCW A;  2FK6 A;  1KO2 A;  2BFK A;  1K07 A;  4HKY A;  4AX1 B;  3KNS A;  3IOF A;  5LE1 A;  2CG2 A;  1XTO A;  1YCH A;  4GYU A;  4P62 A;  4AXH A;  3IE0 A;  2OHI A;  2UYX A;  3I15 A;  2H6A A;  3L6N A;  1KO3 A;  4AD9 A;  2NXA A;  2WHG A;  3PY5 A;  4Z5Y A;  2CBN A;  5B1U A;  3X30 A;  4UWO B;  2P1E A;  3QH8 A;  4DIK A;  3RKJ A;  5AJL A;  5KIK A;  2XR1 A;  4C1G A;  5LM6 A;  5A87 A;  4EXS A;  3P2U A;  1XM8 A;  2CG3 A;  3S0Z A;  1Y44 A;  4EFZ A;  2FM6 A;  4ZNB A;  3SW3 A;  4CHL A;  3DHA A;  2FU6 A;  2BTN A;  1BVT A;  3SPU A;  3RKK A;  4AX0 B;  3PY6 A;  3ESH A;  5HH5 A;  5AHR A;  2NZF A;  5KIL A;  3A4Y A;  4PVT A;  4UWS B;  1X8G A;  5EVD A;  3IEL A;  2BG8 B;  1DXK A;  5HH4 A;  2BFZ B;  3PG4 A;  2Q42 A;  4RL2 A;  5EHT A;  5FQB A;  3I13 A;  4U4L A;  4LE6 A;  4C1C A;  4XUK A;  5ACQ A;  2BR6 A;  2HB9 A;  3T9M A;  4D1V A;  3ZWF A;  2AZ4 A;  4UA4 A;  4PVO A;  5LCH A;  1BC2 A;  2GCU A;  3X2Z A;  2YNV B;  5K4N A;  5HH6 A;  5ACS A;  4F6Z A;  4Z60 A;  5EV6 A;  2Q9U A;  1WUO A;  3IEK A;  1VJN A;  3SD9 A;  3FCZ A;  5LLD A;  4ZO2 A;  4JO0 A;  2FU7 A;  4NQ5 A;  1WRA A;  5HIO A;  4TYT A;  4D1U A;  4TZB A;  5AXR A;  2R2D A;  5K4M A;  5ACT A;  3I14 A;  3DH8 A;  2NZE A;  4D1W A;  2BMI A;  5EVK A; 
#chains in the Genus database with same CATH homology
 3VPE A;  3MD7 A;  2AIO A;  2A7M A;  1JT1 A;  4J5H A;  1VGN A;  2YNT A;  4Z5Z A;  4EY2 A;  2FHX A;  4XWW A;  5A0T A;  5EVB A;  1WUP A;  3RPC A;  4EYL A;  2WRS A;  3IOG A;  2XF4 A;  3ADR A;  3WXC A;  5EWA A;  4RM5 A;  5HIS A;  3VQZ A;  2Y8B A;  4HL1 A;  5IQK A;  5EH9 A;  3Q6V A;  5ACW A;  5A5Z A;  4WD6 A;  1VME A;  5B15 A;  5A0V A;  1A7T A;  2WYM A;  4O98 A;  4DIL A;  5ACR A;  2GFK A;  4C1D A;  1SML A;  2NYP A;  3H3E A;  4UAM A;  2OHH A;  3AJ3 A;  4TZ9 A;  2M5D A;  2YNT B;  3SRX A;  2VW8 A;  3FAI A;  2BFL A;  2YNU A;  4RL0 A;  1JJT A;  4UBQ A;  1YCF A;  2QJS A;  5HIQ A;  1HLK A;  2BGA A;  1DD6 A;  4HL2 A;  3AF5 A;  4Z7R A;  4NQ2 A;  3X2Y A;  2I7V A;  4UWR B;  2ZNB A;  2ZWR A;  5AHO A;  2WYL A;  4BP0 A;  5ACU A;  4BZ3 A;  5FQA A;  2QED A;  4F6H A;  5HIP A;  4AWY B;  4YSL A;  2I7X A;  2FU8 A;  4B87 A;  4GYQ A;  1QH3 A;  2OHJ A;  2Q0I A;  3X2X A;  3BK1 A;  3KNR A;  1ZTC A;  2BIB A;  2BC2 A;  2DOO A;  4YSK A;  2BG8 A;  5EW0 A;  4ZEJ A;  3TP9 A;  2Y8A A;  2I7T A;  3KL7 A;  5B3R A;  1E5D A;  3SBL A;  3I0V A;  2YNV A;  5LS3 A;  4NQ6 A;  3DHB A;  3G1P A;  5K0W A;  2GMN A;  2BG7 A;  3I11 A;  5DPX A;  2GKL A;  4NQ4 A;  2BG6 A;  4C09 A;  2YNW A;  5ACP A;  3JXP A;  4C1E A;  5AEB A;  4D02 A;  2P18 A;  4UWP B;  4TZF A;  1MQO A;  4XWT A;  5K4K A;  4Z6X A;  2ZO4 A;  1X8I A;  2FU9 A;  4KEQ A;  1KR3 A;  5LSC A;  3SFP A;  2WYM C;  4C1H A;  5ACV A;  5EV8 A;  3BC2 A;  2QIN A;  2Y87 A;  2BG2 A;  2GFJ A;  2P4Z A;  5LMC A;  3ZNB A;  1JJE A;  1BMC A;  1QH5 A;  3DHC A;  3IEM A;  1WW1 A;  2M5C A;  3F9O A;  4KEP A;  4D1T A;  4H0D A;  4EYB A;  3AF6 A;  2ZZI A;  4RAW A;  5ACX A;  5LCF A;  2E7Y A;  2BFZ A;  2QDT A;  3R2U A;  3ZR9 A;  1ZNB A;  4C1F A;  3ZQ4 A;  2YCB A;  4FR7 A;  2QDS A;  4V0H A;  2FHX B;  4TZE A;  3IE1 A;  2YZ3 A;  4FEK A;  1X8H A;  3T3O A;  2P97 A;  4FSB A;  3BV6 A;  1YCG A;  4Z67 A;  3T3N A;  4J5F A;  1A8T A;  2DKF A;  5FQC A;  5AYA A;  5AXO A;  4TYF A;  4YSB A;  1DDK A;  3LVZ A;  3IDZ A;  3IE2 A;  2Q0J A;  5LCA A;  1M2X A;  1P9E A;  3BK2 A;  4EYF A;  4RBS A;  4AWZ A;  4EXY A;  1L9Y A;  4RAM A;  1ZKP A;  4ZO3 A;  4GCW A;  2FK6 A;  1KO2 A;  2BFK A;  1K07 A;  4HKY A;  4AX1 B;  3KNS A;  3IOF A;  5LE1 A;  1XTO A;  1YCH A;  4GYU A;  4P62 A;  3IE0 A;  2OHI A;  2UYX A;  3I15 A;  2H6A A;  3L6N A;  1KO3 A;  4AD9 A;  2NXA A;  2WHG A;  3PY5 A;  4Z5Y A;  2CBN A;  5B1U A;  3X30 A;  4UWO B;  2P1E A;  3QH8 A;  4DIK A;  3RKJ A;  5KIK A;  2XR1 A;  4C1G A;  5LM6 A;  5A87 A;  4EXS A;  3P2U A;  1XM8 A;  3S0Z A;  1Y44 A;  4EFZ A;  2FM6 A;  4ZNB A;  3SW3 A;  4CHL A;  3DHA A;  2FU6 A;  2BTN A;  1BVT A;  3SPU A;  3RKK A;  4AX0 B;  3PY6 A;  3ESH A;  5HH5 A;  5AHR A;  2NZF A;  5KIL A;  3A4Y A;  4PVT A;  4UWS B;  1X8G A;  5EVD A;  3IEL A;  2BG8 B;  1DXK A;  5HH4 A;  2BFZ B;  3PG4 A;  2Q42 A;  4RL2 A;  5EHT A;  5FQB A;  3I13 A;  4U4L A;  4LE6 A;  4C1C A;  4XUK A;  5ACQ A;  2BR6 A;  2HB9 A;  3T9M A;  4D1V A;  3ZWF A;  2AZ4 A;  4UA4 A;  4PVO A;  5LCH A;  1BC2 A;  2GCU A;  3X2Z A;  2YNV B;  5K4N A;  5HH6 A;  5ACS A;  4F6Z A;  4Z60 A;  5EV6 A;  2Q9U A;  1WUO A;  3IEK A;  1VJN A;  3SD9 A;  3FCZ A;  5LLD A;  4ZO2 A;  4JO0 A;  2FU7 A;  4NQ5 A;  1WRA A;  5HIO A;  4TYT A;  4D1U A;  4TZB A;  5AXR A;  2R2D A;  5K4M A;  5ACT A;  3I14 A;  3DH8 A;  2NZE A;  4D1W A;  2BMI A;  5EVK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...