4C1KA

Crystal structure of pyrococcus furiosus 3-deoxy-d-arabino- heptulosonate 7-phosphate synthase
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
262
structure length
262
Chain Sequence
b'MKYSKEYKEKTVVKINDVKFGEGFTIIAGPCSIESRDQIMKVAEFLAEVGIKVLRGGAFKPRTSPYSFQGYGEKALRWMREAADEYGLVTVTEVMDTRHVELVAKYSDILQIGARNSQNFELLKEVGKVENPVLLKRGMGNTIQELLYSAEYIMAQGNENVILCERGIRTFETATRFTLDISAVPVVKELSHLPIIVDPSHPAGRRSLVIPLAKAAYAIGADGIMVEVHPEPEKALSDSQQQLTFDDFLQLLKELEALGWKG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2-DEHYDRO-3-DEOXYPHOSPHOHEPTONATE ALDOLASE
molecule tags Transferase
publication title Destabilization of the Homotetrameric Assembly of 3-Deoxy-D-Arabino-Heptulosonate 7-Phosphate Synthase from the Hyperthermophile Pyrococcus Furiosus Enhances Enzymatic Activity
pubmed doi rcsb
total genus 96
structure length 262
sequence length 262
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.5.1.54: 3-deoxy-7-phosphoheptulonate synthase.
pdb deposition date 2013-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00793 DAHP_synth_1 DAHP synthetase I family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4c1kA00
3HF3A 4GUGA 4O18A 3BG3A 1YTKA 4FNRA 4GC4A 3LCWA 1L2UA 3FJ6A 5BW6A 3OVQA 1VYPX 2I1OA 3GR7A 5DLCA 1B4KA 5FEWA 3RK8A 4DF1A 4FNTA 1G6CA 4O16A 3LHUA 5F4WA 1N7KA 4WZHA 1TV8A 3W1XA 4OQVA 4LNYA 1K3UA 1FWWA 4IJBA 3C2FA 3KXQA 2V30A 3H55A 4JEQA 1O94A 4E2BA 1GTEA 1LORA 1SFLA 3BK0A 3ATZA 1DKWA 4AWUA 3G1SA 2CLEA 1OVDA 4O13A 1DJNA 3TAKA 1TPFA 4N9CA 2DZPA 2PRMA 1TTPA 1C29A 1YDVA 4NX5A 1WA3A 2YFOA 2DZWA 1UUMA 1OHLA 3L9CA 1THFD 1YDNA 3W87A 4DBDA 3EEGA 1HO4A 1SSDA 2C15A 2QDGA 3W22A 3G1XA 1NFBA 2YDAA 2WKJA 1Q6RA 1TPB1 1JQXA 4MFEA 4RV8A 4HT3A 4NQ1A 3FYPA 2FTPA 1YADA 4LUIA 5FEZA 1OFRA 2BX7A 4K7YA 4CNPA 4X2RA 3BPWA 2B0MA 4UMCA 4IUOA 4JYDA 3OEXA 3MWAA 3THAA 5AHMA 1RQEA 1QAPA 4A3UA 5G1TA 3SGZA 4LU0A 2Y7FA 1YXYA 5G4EA 2CW6A 4N9EA 1WBJA 3QSTA 3W88A 2ZZ4A 4GXMA 6ALDA 2CLMA 2CLOA 1MXSA 1AW1A 4R53A 3A21A 2ZZ7A 3WJZA 5FF4A 3NPXA 3S5NA 3CEPA 5KTLA 3GX9A 2QUVA 3S0CA 5EL1A 2YZRA 3C2EA 3NZRA 3GDTA 3TNOA 3DFSA 2Y70A 1HG3A 3NZ1A 2PRHA 3TFXA 3RFAA 4UTKA 2P10A 3M9YA 4UTLA 5MHBA 1LBFA 3NXFA 2JGQA 4JNMA 4JTLA 5HWJA 3MMTA 3T4CA 3T7VA 4NUWA 2HSAA 4LVAA 3NQFA 1YPFA 3DI0A 2QAFA 1SW3A 1EUNA 1E51A 1ZCOA 3DU0A 1CW2A 3F1QA 2GVLA 4CQ8A 1F76A 5CSRA 3KX6A 1W3IA 5HR7A 1OX4A 3QW3A 2EHHA 2NUXA 4S2CA 4O52A 3L21A 5F4XA 2I9EA 2C13A 1I45A 3I7QA 3KAOA 1TPVA 4K36A 1VH7A 5EBUA 4K7VA 1S5TA 5CG7A 2TYSA 4UTWA 3R5EA 1TO3A 1XM3A 3NPVA 1AL8A 4C1KA 3M7WA 2V2CA 4UTTC 4AWTA 1M6JA 5D33A 1RZMA 3BLEA 4CCDA 1GVQA 5DCBA 1AW2A 2WSYA 4PC8A 4Z0JA 4JX5A 3C61A 3TC6A 3GAKA 3LRLA 4GWEA 5AHEA 2WPBA 3DGRA 2FFCA 5U7SA 1IXPA 2JKPA 4QITA 3MYPA 5AYZA 3P5ZA 1JCNA 4JIPA 3VKJA 3LRKA 5G5IA 3UWZA 1FCBA 2Q8LA 1GWJA 3JS3A 3GKAA 2QCFA 1I2QA 4K37A 2QCCA 5C2XA 2C16A 1OABA 1SW7A 4JXCA 4LC8A 3TW7A 1Z48A 1K03A 1L6SA 5CSSA 1TRIA 3G1HA 4MUZA 3ZWSA 1MSSA 3CB8A 1FCUA 3IVUA 3G22A 5EKYA 3NQ8A 3PY2A 1ALDA 5U4NA 1NEYA 3SECA 1JJKA 3QSRA 3IEBA 4FF7A 4MZYA 2ATSA 4HNTA 4WUIA 1SQ7A 3LOTA 1P0NA 5BMXA 2GQ8A 5KMYA 3PG9A 3CM4A 1R2TA 3W84A 3C52A 2V81A 2FPYA 2CZ5A 3SSJA 1X7FA 1YTDA 5J5DA 2CLKA 4DF2A 5K3VA 5K9CA 3IIPA 3QFEA 3DFNA 1NAL1 2RKXA 2O7SA 3LV5A 2QUTA 1EWDA 1FWRA 1K7XA 2VFGA 4E2DA 4TIMA 2CZFA 3JRKA 4JTTA 2Y88A 4JTKA 2WO5A 4KWWA 2RFGA 4ZQCA 5HR6A 3PM6A 3EKLA 3G1VA 3RLUA 3TSBA 3PG8A 4A2RA 1PCKA 3LXAA 5D2VA 1ME8A 1NF0A 1T0OA 4HKPA 2B7OA 1JRCA 1QPQA 1RR2A 4IX2A 1SZEA 3NQ6A 4QSHA 1KBJA 3NNTA 3WK3A 1VC4A 4S2BA 1HUVA 3DBPA 1XBYA 2Q8ZA 1D3HA 4W9TA 1KBIA 1PV8A 4ZVJA 4AMAA 3KRZA 5K4XA 4C1LA 3A9IA 3LTYA 1W54A 1LROA 2AGKA 3C6CA 4NXSA 1TPEA 5LGZA 1QNVA 2EPHA 3W7GA 1TREA 3HBLA 5FEXA 1H7NA 2TRSA 4IGHA 2EGZA 1X1OA 3TMLA 1FDZA 3W7QA 4UTWC 1KM6A 4HNUA 5AHLA 2R94A 2Z6JA 3QQ1A 4FNUA 3M5ZA 4O1DA 4O28A 1KFCA 4XWUA 5LHFA 5FF7A 1DQXA 3M41A 4AVFA 3NQDA 3M44A 4ZQMA 2VEMA 4J9JA 1JUEA 4M7SA 4O17A 1F2JA 4CCCA 3U6WA 1OF6A 4JY9A 3W07A 1JCJA 2LLEA 3NQ2A 1X8FA 2A4AA 2ISSA 5AYYA 1V7YA 2XN2A 1EUAA 3TE9A 4FEZA 4LVBA 3W76A 1ME9A 3UZJA 1KM5A 3G8RA 3E0IA 2R8WA 1KM0A 3LERA 1M7OA 5CZTA 1YTEA 4Z1AA 3S42A 2E1DA 2J9ZA 3CHVA 1FWTA 4IWWA 3STEA 2C19A 3H53A 4K8EA 3IIZA 4ALDA 5HMSA 4NT0A 5LSMA 2OMAA 3LX9A 3PUEA 2OZ0A 3HGJA 4AAJA 5AC8A 1SZGA 3LHVA 4KKXA 1DORA 4IPIA 1K7EA 1H7WA 1WOAA 1R2SA 1RPXA 4Q32A 5BRBA 4LY8A 3W7HA 5FEPA 4IX0A 4MY1A 1GG0A 1QPRA 1XUUA 3CU2A 5F2GA 1BWLA 1FQ0A 1T96A 3EXSA 5I3FA 2Y85A 1F6PA 1CI1A 3STCA 2WNZA 1LBMA 3BV4A 3T44A 2KZHA 2NXHA 4TU1A 1ONRA 2ALDA 2H6RA 1VPXA 2QCDB 4H3DA 1TPDA 3A22A 4O14A 1GYLA 4AF0B 1NSJA 5G1YA 2VFFA 3E12A 3T55A 2ZZ6A 4FO4A 4MVAA 4NZJA 4UFKA 2C6QA 2CU0A 3NQAA 4ONVA 2NX3A 3NQ7A 2QCLA 3NO5A 1PS9A 3NG3A 5DBUA 2W6RA 1V5XA 7TIMA 2DJLA 1ZALA 3PSVA 2Z2UA 3W9ZA 5D03A 3GNNA 3VCRA 5E0KA 1ZENA 3TXZA 2QR6A 2YCEA 4ZQRA 3GYEA 1XBXA 3S1WA 1DL3A 1XL9A 1TCDA 5AOUA 3C0JA 4DELA 3HQ1A 4ORIA 1A5SA 5F2LA 4BK9A 3W7CA 1DHPA 1TIMA 1KV8A 2E5DA 3N34A 4IMDA 3UXAA 4NJKA 2VFHA 4IOTA 4PH6A 1FWSA 2PE4A 2FB3A 2VFIA 1VRDA 3GDKA 2H8XA 1GPWA 4PEKA 5F1UA 3HG4A 1G4SA 3TK7A 2JKAA 1O5XA 3R8RA 3LI0A 3P8IA 4QAIA 4OT7A 3ZFHA 2B4GA 2ZA2A 3QEZA 3W1TA 4O0ZA 1RV8A 2FQIA 3EWYA 3LHWA 1UBSA 3TROA 1TYGA 4AWSA 4X22A 1UJPA 1ZAHA 2G96A 1K8XA 1UUOA 3W1MA 2QJGA 1I8JA 3GB6A 3THQA 5EY5A 4P2VA 3MI2A 3LI1A 4ADSA 3UWVA 1KTNA 3DXIA 2GPTA 4Z1CA 3MW7A 1FCVA 3GDMA 2ZTKA 5TIMA 3WK1A 1OYAA 3T40A 5I3IA 3QJAA 2IQTA 3EB2A 3MHUA 1LCOA 3SIZA 4OHQA 4WOZA 1I2PA 4HPJA 1KV5A 3EWWA 1T8XA 1U83A 3GKFA 4YLWA 3IV3A 1C9DA 1EEPA 1TV5A 2EF9A 3QZEA 3N2MA 2NX1A 2C3ZA 2QCNA 1W0MA 1GVRA 2CLLA 4IMGA 4MOZA 3W2LA 3LLFA 1S5VA 4TX9A 1MEIA 3GXTA 1NF7A 5BNKA 4HN4A 4KFOA 3SW6A 4QM1A 1X1ZA 3TKFA 3PR2A 3PUOA 1QCWA 1W5OA 3NQCA 3L5LA 5T26A 3WK0A 3O6CA 1LRTA 2B7QA 5CPNA 4RXFA 4EOUA 2GJNA 5AC7A 4ZL1A 3TQ0A 3O07A 1B3OA 3S6DA 5DN1A 3BW4A 3M1ZA 3TSMA 1JCMP 3BW2A 2Y61A 2H90A 2ZZ5A 3EWUA 3KRSA 4RLIA 1GVOA 2Q3OA 3W2KA 5KITA 4QIUA 3UWWA 4WXYA 4JTIA 3IIOA 4PTNA 1H62A 3BW3A 3NM3A 3ABOA 5CKSA 2E6FA 3HO8A 4OWGA 3U8GA 4EWND 1VS1A 1FXPA 3BO9A 4WY0A 3RLVA 2CWNA 1BTMA 1G69A 3DAQA 4O8RA 5FF2A 4P61A 4LOCA 1TQXA 3KVMA 1O95A 3LTPA 5LNVA 3TW6A 4LTSA 3HGSA 5HNRA 1B4EA 1ZAJA 3CEUA 3G1DA 3OVRA 4DPPA 4YXGA 3I65A 4LRSA 4EF8A 1L6YA 4FIRA 3V1PA 1XBVA 5H91A 4MY9A 1YDOA 5HUPA 1ZY9A 3SR7A 1LOQA 3W72A 1Y0EA 4O54A 1W5PA 3OIXA 3FOKA 3LCFA 3QRHA 5AYXA 3RF9A 1KFLA 1EWEA 1K02A 1TV7A 2ABAA 3BARA 3EX6A 4DF0A 1TMHA 3GLCA 2VEPA 3M5VA 1JRBA 3DFPA 5EPDA 3HMJG 4O4WA 5G2WA 3C56A 3DZ1A 1L9WA 2F7FA 3KVKA 3S1UA 1I2OA 2RDWA 1H60A 4QISA 4BF9A 5H2ZA 1OX5A 1QPNA 5LNUA 3UD6A 3LTSA 4DO4A 3F4NA 3SJ3A 4FXRA 4JN6A 4K8HA 3TV8A 4TMBA 2ZDRA 3NPUA 1WQ5A 2F84A 4CNNA 3TIMA 3O15A 3P8JA 8TIMA 3I68A 5TQLA 3TXVA 4U4MA 1KFEA 2G97A 1MO0A 2A0NA 4UTUA 3NYZA 1WOBA 3SGUA 1PHWA 1G7VA 3VFLA 4YCOA 3UZ5A 3M5XA 3G3MA 5TBOA 2NX9A 3C3NA 3GIYA 1KM1A 3UWQA 3E9AA 3JR2A 3LHTA 2VFDA 3KVLA 2VXNA 4Y90A 2ZZ3A 3HPZA 4LW7A 2FLIA 3P82A 2AQWA 4NJHA 1RQBA 4GRSA 4HNNA 3Q37A 3N73A 1T99A 3EKZA 3UYCA 3GZ3A 4EIVA 5G2IA 1XDLA 2YGYA 1YXCA 4UR8A 5I3HA 1W8SA 5CPMA 4G1KA 4JGDA 5LNSA 3KOFA 4JX4A 3GXNA 4LWWA 3W2JA 3WJXA 1H50A 4KFPA 5K7JA 3L67A 4JD4A 3N3MA 5CPLA 1A50A 3TFCA 1IIGA 5KZDA 5DCEA 2HMCA 2VC6A 2RHGA 1O60A 3FYOA 1WXJA 4AEOA 5K4ZA 3CIWA 1OX4B 4O0KA 3LB0A 1M5WA 2J9XA 1I2RA 4K6AA 1OYBA 1KLYA 3UY7A 1EIXA 1XI3A 2FPVA 3P5YA 4QQ3A 5F1VA 3NGJA 2A2IA 2H3BA 3LCHA 4JTSA 4RKAA 3LHYA 3LM7A 1XXXA 1SU5A 3EX1A 4NU7A 1UASA 3P7YA 4JTJA 1EB3A 3HGOA 3ABRA 2ZRXA 2ZRZA 4N9BA 4R34A 5F2IA 1GVSA 3K30A 1XBZA 3GXPA 3S5YA 4OV4A 3C2RA 4BWLA 1U5JA 3B03A 5KSWA 3ZWTA 5D02A 2DU2A 5DY2A 2NUYA 3ELFA 3EXTA 2ZCGA 4MJZA 1P1XA 4Z0SA 3U2OA 2PC4A 4N02A 4DO5A 4GBUA 3STGA 2V5BA 1LLZA 1FBAA 1EX5A 2VKZG 3N9SA 4JX6A 1TQJA 3TUUA 4O15A 1LRNA 1F05A 3P62A 5D09A 3ABQA 2NLIA 1SR9A 1LZOA 2WNQA 3E49A 4NNAA 2TPSA 2DJXA 4OBTA 1MZHA 1HTIA 2Y7GA 4N2YA 1VHNA 1DVJA 1IXNA 3HG3A 1KFKA 1VLIA 4UTTA 2QEZA 3W1AA 4HHPA 3W1UA 3HJZA 3QMRA 3FEMA 1OF8A 2FIQA 5HJLA 3NQEA 1TPWA 4DPQA 1FY6A 1HFBA 4UFJA 2ZYFA 3N14A 4UIOA 4UTMA 2XFWA 4B5NA 4CLMA 4NNCA 1F73A 4IXXA 1QR7A 2ZQ0A 1YPIA 4I9AA 4R33A 1Q6QA 4BI5A 1VYSX 4JY8A 3G1AA 1K8YA 2FB2A 2W79A 3LCLA 5K9DA 1TJPA 5AFDA 3PS7A 3M5YA 3NL5A 1W37A 2NWRA 1VR6A 5E93A 2A1YA 4MLRA 4QNWA 5C55A 1G4TA 3O16A 3DFQA 4Z1DA 2X1RA 2NXIA 3NPWA 2FPTA 1GEQA 2W0UA 1TTJA 3Q58A 5A5WA 3ZS4A 4H6KA 1OG0A 1VLWA 1TTQA 4R7JA 3P84A 2QCDA 2WSRA 3CT7A 2C0AA 4UC5A 3OA3A 4O1BA 4LS2A 2YSWA 1FCQA 2BWGA 4WXZA 4A21A 1R47A 4KWVA 4AHPA 5K9XA 3G3DA 3DI1A 5LKYA 3OVPA 2YPIA 3L5MA 3B0PA 3P81A 3HGRA 1LOSA 3P74A 1A5CA 4UTIA 3TX9A 2BXVA 3BGGA 4O53A 1YLVA 4O57A 4WX2A 4FX7A 4ZQPA 2CZEA 5J5RA 3INPA 3IIVA 1GOXA 1BWKA 1H7XA 3IGUA 3UXDA 2ISWA 3NL3A 1YYAA 1QO5A 3W83A 4UNLA 5D2XA 3W2NA 4MYXA 3ABSA 3EX2A 1H1YA 1HL2A 3RNDA 1OFAA 3PC0A 4ZQNA 4A29A 3V75A 5L9FA 2VEKA 3DHDA 5K2ZA 4GJ1A 1KTBA 1WAUA 1PVNA 3CIXA 2BSLA 4NX0A 3AJXA 4OU1A 1WBHA 1VGAA 3L2IA 3GDLA 3LXBA 5DXXA 1HO1A 1WV2A 2YW3A 3PB0A 4BR1A 1C8VA 5AN7A 3NDOA 5D30A 3PVFA 1TSIA 2DZUA 3FKKA 2WV8A 4M6VA 2YW4A 4POCA 2X1TA 3FJLA 5IBXC 1Q6OA 3UWYA 1FXQA 3R13A 1WX0A 1ZNNA 1XUZA 2DP3A 4NJGA 4DO6A 4RJEA 2WNNA 3CC1A 3TQKA 2QAPA 4U28A 2CZDA 5I3KA 3NOEA 3M16A 3A5VA 3C8FA 1H61A 3OHIA 1TJRA 2QCMA 1ADOA 4TO8A 1SFJA 5AB3A 4GUHA 4N6EA 4KFNA 3EWXA 4BI6A 2ZTJA 2A6LA 4LV9A 1LTDA 4O12A 5I3JA 3PSWA 4QJ1A 5EA9A 4O4VA 5KZMA 4GNJA 1SPQA 3W7PA 4IXHA 4RCXA 1VJIA 1OFPA 2Y7DA 3T78A 2GUUA 3O6YX 3MJYA 4ICNA 5G2HA 3WJWA 4S1FA 2XN0A 2TSYA 1OFDA 2ZZ2A 1DQWA 1F7BA 1IXOA 3G24A 1P4CA 1OFEA 5FESA 3MUXA 1D9EA 3W6YA 4XTDA 2J27A 3EWZA 2QF7A 3IRDA 3GNDA 2E77A 4O50A 3OG3A 2Y89A 5FI8A 4GUJA 4RK8A 3P60A 4MKNA 4M6PA 3G0XA 5HWMA 3NQVA 4XKYA 1SW0A 4L4LA 4NXKA 2ZBTA 3OBKA 4X9SA 2GOUA 1VCVA 3G1FA 2Z1BA 3W86A 5C54A 2E6AA 3USBA 1AG1O 1JCLA 4BFAA 2B7NA 3WFAA 6TIMA 4O1AA 1GG1A 3NR0A 1N8FA 4PL1A 1MEWA 1W3TA 4OE7A 3TC7A 4AF0A 2NXGA 2FJKA 4BI7A 4FIQA 4Q33A 3MP5A 4UFLA 4IPJA 1JQVA 2A7RA 5AHFA 3A23A 1SZNA 2Z0IA 3KHJA 4LUJA 1PL9A 1P5BA 3QMSA 1H7RA 3FLUA 4CQ9A 3W1RA 3PBYA 5I3GA 2GJLA 2CLHA 2WJZA 3PAJA 3M6YA 4JR5A 1QFEA 3NAVA 4NJIA 4DEFA 4JDBA 4AXKA 1O5KA 5CPOA 4Y9AA 2ZFAA 3A24A 3NM1A 1GZGA 2GVGA 3GAYA 3NA8A 4MIMA 3W71A 1BKSA 4AB4A 4EF9A 3TU9A 1LYXA 3O05A 2CFFA 3HB9A 1A5BA 2TMDA 3TR2A 3L68A 5D2YA 5CGQA 4MZ8A 2OT1A 1QO2A 3LRMA 4N9DA 2YXGA 3MBFA 4UXDA 1OYCA 1VZWA 3TA6A 4N6FA 1A53A 4HSNA 3UPBA 3BG9A 3QH2A 1F5ZA 3C2VA 1JUKA 1ZFJA 4UNKA 3GDRA 2H8ZA 4NNBA 3MHFA 4MYAA 1PCWA 1PE1A 4TMCA 3BVJA 2I14A 1LBLA 1QDSA 2EKCA 3QM3A 3W7OA 2E5CA 3WK2A 4JYEA 1KFJA 1Q6LA 4LVGA 3IVSA 5KZEA 5A8GA 1QPOA 4UTJA 4WQ6A 3SZ8A 3LGEA 1J4EA 4PFMA 1EP1A 1RQHA 3L0GA 5AHNA 1ZAIA 5EYWA 5L6UA 2ISVA 4CNOA 5IM51 4LRTA 1PHQA 3HIJA 3B0UX 4UMAA 3HG5A 4JICA 1LP6A 4N4QA 3GR8A 2X2GA 2E6DA 1KLZA 3HG2A 1GT8A 4Y96A 3W1NA 5HUOA 1AL7A 2YX0A 2C18A 4JYFA 1CX9A 4PCFA 5AC6A 2RDUA 3NL6A 2YYTA 3TJXA 5D38A 3SY5A 2VENA 1VHCA 2HS8A 3B8DA 4XBKA 2JGYA 1SO5A 1OFBA 4O1CA 1KM2A 2GVJA 1OK4A 4UFHA 2R91A 3W1QA 3S5ZA 1K7FA 3P61A 4XZ9A 4UMBA 3ATYA 3N2XA 1IGSA 3BG5A 3L66A 1H7OA 1WYIA 2QCGA 3L0NA 4Z1BA 3YPIA 4HPXA 2Q3RA 3MP3A 3EWBX 2V8ZA 3HPSA 3R2GA 3TH6A 1ICSA 4A2SA 2HS6A 1AW5A 1G7UA 1M7PA 4FNSA 2RH9A 2DZXA 4ZMGA 1H63A 1SUXA 3LCIA 1DBTA 3N19B 5DXYA 3QC3A 4LV4A 1Z42A 2ZA3A 3PWAA 2QUUA 3CQ0A 1KA9F 1XKYA 2NV2A 3MBDA 4Y6GA 4PA8A 4JDYA 3LBCA 4LVFA 1ME7A 1XDMA 1FUYA 3KRUA 3W75A 1LLWA 4JS3A 4BWLC 5DY3A 4FB7A 4NVTA 2A5HA 2A7PA 3UPWA 3W3OA 3KFTA 3G0SA 4NZFA 1LM1A 3S1XA 5D2TA 3P80A 5DCDA 2P1FA 3LXCA 4OV9A 4DXVA 1DV7A 3I7RA 4RXGA 3MO7A 3C4UA 4RX0A 4ORMA 3W2UA 3TQVA 2BLEA 3M0ZA 1EA0A 1ML1A 3QPZA 4YWIA 1XCFA 2J88A 2QCHA 4L4MA 4I7WA 4AH7A 3QPYA 3L0KA 2Y6ZA 1IIHA 3DHFA 1R46A 5BMWA 4O10A 4JTGA 1KFBA 2CLIA 2AAMA 1TPC1 1P0KA 5EMUA 1XFBA 3FIGA 3G8EA 3DKJA 4FX8A 1SSGA 3GVGA 3VE7A 2Y63A 3L5AA 3G1YA 1TRDA 1W31A 4FX6M 3DENA 2OJPA 4M6QA 2BTMA 1LDCA 5D37A 1LRQA 4IMEA 3W1LA 5D04C 2EAWA 4JTHA 2R14A 2WQPA 3MI6A 2XN1A 1EPXA 4K39A 4HIBA 5IBXA 3BLFA 2ABBA 1X6UA 1B57A 1I4NA 3W2MA 1Q3NA 4JIQA 1S5WA 1LOLA 4LVDA 3TAOA 3W7JA 4AHQA 5C5YA 2PURA 4I7VA 1R30A 4FHAA 1UB3A 4E38A 1H7PA 3CPRA 4GE8A 3S9YA 3DFTA 3W74A 1W1ZA 3B0VC 2ZZ1A 4XKYB 2YR1A 4WY0B 5HWNA 2ATMA 3TJLA 3IIXA 5F2MA 3F03K 2QJHA 5D32A 2V9DA 2OX1A 1QWGA 3IGSA 4YCPA 1OK6A 2VEIA 5BOOA 3A5FA 2VELA 3DH7A 2Z6IA 3L65A 3BLIA 2VOMA 1G4PA 3I6RA 2DZTA 3W7DA 3QF0A 1PIIA 3W7MA 1JULA 3UY8A 1SO6A 2H3DA 1KTCA 3GK0A 1Z41A 3VE9A 3W73A 4WD0A 4JTFA 3VNDA 1TTIA 1H5YA 1ZHAA 3W70A 2UV8G 3O1NA 3NL2A 4I7UA 4RR4A 2DORA 3MP4A 2QKFA 4DQWA 1ZJIA 2DZSA 3R89A 4PODA 3LDVA 3B04A 3CLMA 3MHGA 3LCXA 5D05A 3S8HA 1IF2A 5GVJA 3NEVA 4YL2A 3P67A 1TPUA 5HULA 2PRLA 4O11A 4LS1A 4EVZA 2D73A 2C14A 1OX6A 4MFDA 1RVGA 1GTHA 4LT9A 3M47A 2ZRYA 3QYQA 1GYNA 1G4EA 4RZ4A 3NVTA 1A5AA 5KINA 5AHIA 1JCXA 5HQEA 3KVJA 3S5OA 2O7QA 4XUGA 2C1HA 1Q45A 3TCEA 3Q2DA 2J6XA 3B05A 5FF3A 3R12A 3UNDA 4LS0A 1FWNA 1WDWA 2G95A 3E02A 4E0CA 3LCGA 4CQAA 2YYUA 5E1QA 3G18A 4QNEA 2G5WA 3IGXA 4Y8FA 1QOQA 2FDSA 2ZRWA 3TMQA 4ADUA 2B7PA 2Y62A 3LLDA 5CZSA 4ZQOA 2A6NA 5SWUA 2J24A 4ADTA 4XBSA 1BEUA 1GQNA 3W7LA 4ZZ9A 2V2DA 1KM4A 1JVNA 2J9YA 3PBUA 3B06A 3ZR4A 4WOQA 4HSOA 2WSQA 2WOQA 2A7NA 3E96A 4K38A 3MI3A 3W23A 2Y7EA 3O8AA 2E68A 4MPQA 1FDYA 1RD5A 1IXQA 1W5NA 3SI9A 1H51A 2GQ9A 4X3ZA 2P0OA 3FKRA 2YFNA 1JUBA 1TB3A 5LNWA 1ICQA 3IVTA 5G4WA 2JK2A 3W7NA 3PB2A 4FXSA 2ZRUA 3W7EA 4DBEA 5FF0A 1JR1A 2E6YA 1W5MA 1UCWA 5C6MA 1D3GA 4M7TA 3D0CA 3F4WA 1FX6A 3W85A 2NUWA 1SO4A 2GQAA 1GVFA 4UUIA 2V2HA 3Q94A 2OT0A 4GFSA 2A85A 4LC6A 4XQ6A 3PBWA 1AK5A 1EP3A 4RZ5A 4MY8A 1R2RA 5LNRA 1Z44A 3FFSA 2V82A 2X1UA 1MEHA 3LV6A 1L6WA 4H4IA 4AHOA 4M19A 1DJQA 3QMTA 2ZA1A 3HPXA 1F74A 1O4UA 2HTMA 2JBMA 2BZNA 3CWNA 2ZRVA 3ANYA 4D2JA 5CZJA 2DZVA 3C2OA 4YMZA 5LGXA 4FNQA 4ML9A 1OFOA 4HNVA 1K8ZA 3CWOX 3PF3A 3UQNA 3DFOA 1VQTA 3FS2A 2QJIA 2RDTA 3HOJA 2X1SA 3PBVA 2V5LA 3NQMA 1KM3A 2E5BA 1B9BA 4JTEA 4MJMA 1H1ZA 1VYRA 3TSDA 2E09A 3TDFA 4A22A 4MLJA 5DELA 2NV1A 1W5QA 2A21A 3W7IA 3RMJA 3PUDA 4IQLA 4NJJA 4CCEA 1YXDA 1GJPA 4Q4KA 1W56A 3BGJA 3EX4A 1KW1A 4IMCA 1XC4A 4Z08A 3N9RA 1AMKA 2X30A 1SO3A 1W3NA 4UCGA 4O19A 4UFMA 4M5PA 1F6KA 3MYOA 1G67A 1S3HA 2CLFA 3STFA 3AO0A 2V0TA 1TPH1 3NQGA 3H54A 5LZLA 1FDJA 4WY0F 2NWSA 1J2WA 4GUIA 3WJSA 4UFIA 3W1PA 3G0UA 4GUFA 1SZFA 4RZ6A 1VCGA 5CZ0A 1J5TA 5D2WA 3SFKA 1NVMA 4UR7A 3O6DA 1OFQA 4JTUA 1JCYA 3EX3A 3I7SA 1VCFA 3FA5A 3QW4B 4WJEA 3PULA 2QCEA 4N4PA 1EP2A 3W7KA 1QOPA 4XTIA 3O63A 2NZLA 3RU6A 2PCQA 4TR9A 1I2NA 3M43A 5DBTA 2VFEA 4IMFA 3CTLA 4PL2A 3VI2A 4FNPA 5HINA 3DKLA 2QDHA 3S1VA 5LHEA 3LHZA 3WJYA 1OJXA 4OGZA 3B4UA 1N55A 2OCZA 1QMLA 4UTHA 5ABTA 2X16A 3O06A 1ICPA 3LBMA 1DOSA 5F4SA 3EXRA 4MZ1A 3UWUA 3W7RA 2JKEA 3QQ0A
chains in the Genus database with same CATH superfamily
3APTA 3F5JA 2OO6A 2PLMA 2YL8A 5I6SA 4C6EA 4GC4A 3LCWA 1L2UA 2HROA 4W89A 5BW6A 4A8IA 1N8WA 1JNEA 4J3VA 5FEWA 4DF1A 3T0DA 1N7KA 4F0HA 2VZTA 1UPMB 4NYUA 1MZRA 1AQHA 4IPLA 2Y5JA 1XYAA 1QNPA 2HPIA 2V30A 3H26A 4JEQA 1V03A 2GWGA 1LORA 1Z7AA 1J11A 3BK0A 3U9IA 1JFHA 2OOGA 3UJ2A 3M64A 2INFA 2AOSA 4N9CA 2VZUA 1XYMA 7CGTA 1TTPA 1OCNA 2RDXA 1C29A 3OA5A 4Z1YA 4PZVA 3G1XA 2YDAA 2F6XA 4MFEA 1JQXA 3U48A 1HKVA 4RV8A 4H00A 4NQ1A 1R8LA 4H19A 4GH3A 3WUGA 1XYFA 5M17A 1M7JA 2XJ7A 4K7YA 2BY1A 3LPPA 3BPWA 1MUCA 2UY2A 2GJXB 3VDHA 1QAPA 4GIAA 4EK7A 2QV5A 1NY1A 5G4EA 2CW6A 3QSTA 3W88A 1V3KA 3TJIA 3VCNA 3OYXA 3WLSA 3FCPA 3A21A 4FR1A 1TVNA 1CXLA 3NPXA 3S5NA 3CEPA 3BLPX 1X97A 2QUVA 3S0CA 5EL1A 2YZRA 3C2EA 2QF8A 3QKEA 1AQMA 4XBJA 4S39A 1IT8A 4C6PA 2JGQA 1BPLB 4PFHA 3QOKA 4F0KA 2HXTA 1JZ7A 5HWJA 2HSAA 3T1GA 4LVAA 4WLCA 3VUSA 4PUWA 4H8VA 4AWEA 2DIJA 3CGTA 1ZCOA 4OECA 2BFGA 4CQ8A 5CSRA 5CLTA 3KX6A 1W3IA 4IG2A 4H6QA 2CBVA 3QW3A 1UD2A 3ZT7A 1KWKA 3RRXA 4S2CA 3UFYA 1FKXA 1W9UA 2FHCA 2BDQA 3CT2A 4NAFB 4A3YA 2POTA 1R7AA 4BKNA 5EBUA 3AIQA 5EMMA 4K7VA 3NWRA 1TO3A 3IWPA 2ZX6A 1AL8A 2ISDA 1M6JA 5C0QA 9XIMA 1GVQA 4GIRA 4PC8A 4FI4A 1OCQA 4Z0JA 4JX5A 1J9YA 4UQAA 3T05A 5CC7A 4GWEA 3AHTA 4Y7EA 1K77A 5U7SA 3GIPA 4QITA 3KHDA 7REQB 2CKRA 3P5ZA 1V6TA 1JCNA 1X38A 2Q8LA 2D23A 4L9XA 1I2QA 4G7FA 1JPKA 2C16A 1OABA 1SW7A 2AL1A 1Z48A 3TW7A 2J77A 3R8GA 1B30A 3G1HA 4DVOA 4RE3A 5LIWX 3CAVA 1E70M 3G22A 5EKYA 1K9FA 3E0VA 1R3VA 1NEYA 5U4NA 3QSRA 3L4TA 2Z27A 3IEBA 1E9LA 2X0YA 4N42A 4MZYA 1XIEA 1SQ7A 2WZHA 3KBSA 3LOTA 4H7ZA 5BMXA 2XVGA 5BOEA 1A5MC 2XGBA 3PG9A 3QHNA 3GFZA 3C52A 1CGUA 3R0KA 1XQKA 3SSJA 1EF3A 2C7FA 1YTDA 5J5DA 1PPIA 4GYJA 5CG0A 4CU7A 4JEJA 3DFNA 3QKZA 1NAL1 4DYEA 3DECA 4CNUA 2VJXA 3LPOA 4JTTA 1GQKA 2XGIA 2ZUMA 2WO5A 1J0ZA 1DP0A 5HR6A 3PM6A 3EKLA 3AHXA 3V0SA 2KX9A 3KZSA 1PCKA 3D5HA 1ME8A 1T0OA 1JRCA 3T2QA 5MKGB 2ZX7A 1IEXA 3NNTA 5FSDC 1KBIA 1XLIA 4AMAA 3A9IA 3LTYA 2GGIA 2R1PA 1LROA 2AGKA 3MU7A 5LGZA 3D47A 1QNVA 1FHVA 3BXWA 6TAAA 4LAOA 5FEXA 5BWFA 2CKSA 4IGSA 4NZ3A 4ENLA 2WMFA 3NVDA 2R94A 5JBFA 3UG3A 1KFCA 4XWUA 5B7ZA 1EJSC 2VEMA 4O17A 1XICA 4CCCA 1OF6A 4LBRA 3M4HA 4IHCA 3B97A 1EUAA 2PF8A 4LVBA 2V5KA 1FWIC 6REQB 4CCZA 3ANUA 1ME9A 3UZJA 1KM5A 4U5IA 1R3WA 5AC4A 3WF2A 2EG6A 1CXIA 5T9BG 2E1DA 4G2DA 3CHVA 4Q7NA 1FWTA 4ATLA 3STEA 2C19A 3H53A 2VI0A 2I5IA 1OG6A 4RNIA 5HMSA 5LSMA 4YTSA 3PUEA 2V3DA 4AAJA 5AC8A 2W92A 2WVVB 4KKXA 1HJQA 4PCTA 1WOAA 3BSHA 4Q32A 1ZZMA 2J8TA 3W7HA 4US6A 1PBGA 4MY1A 1GG0A 5GJMA 1DWJM 3XINA 3CU2A 5F2GA 4KW2A 4CKQA 1GOKA 5I3FA 1F6PA 4HCDA 3UXKA 2EPLX 1I0DA 1LBMA 4LFYA 3T44A 4TU1A 2GSJA 2VVSA 2HPMA 1VPXA 1G5AA 1FVPA 3A22A 4UQCA 4O14A 4XZIA 5G1YA 3E12A 1W9DM 2J7BA 4L4PA 2NX3A 2QCLA 2QW5A 5JH1A 1ZRQA 1K1DA 1V5XA 7TIMA 4KESA 2DZBA 5D03A 4XKMA 3S1GA 3T08A 3B9DA 4XSMA 1LT7A 2HVOA 1ZENA 4F79A 2E9LA 4E4PA 4H9MA 4ZQRA 3GYEA 2PDUA 1XBXA 4KRTA 2WC3A 1TR1A 3PAOA 1XL9A 1IT0A 2R24A 4EWJA 5I09A 4XVEA 4M1BA 2X0HA 1M01A 3HQ1A 4ORIA 3WH5A 5F2LA 1AQ0A 3W7CA 1DHPA 1EJXC 2GGEA 1EQPA 4MWAB 3POHA 3N34A 4GXWA 2VFIA 1V3MA 4X2PA 1JEZA 3CZJA 1UIOA 1G4SA 3TLLA 4N0RA 1O5XA 1R85A 2YDSA 4GQBA 3P8IA 5A8MA 4HU4A 1CEOA 3WLTA 3W1TA 1Z69A 4RE4A 4PMQA 4H6RA 3AZTA 3EWYA 3TROA 4Z17A 4AWSA 3EWCA 5DQPA 4D72A 3LBOA 3GB6A 1BQGA 3THQA 3LI1A 2R1MA 1FCVA 3ZSTA 4F40A 4BS0A 2EG8A 5I3IA 1S39A 2PWEA 5FL0A 4YYCA 3MHUA 4DM1A 1Q63A 4OHQA 1OCJA 4WOZA 1I2PA 3ZT5A 1MWOA 4RE2A 3EWWA 1U83A 1SJAA 4EP8C 1EEPA 3E0WA 2EF9A 4Z2KA 2NX1A 2J6VA 1ELSA 1EJVC 1W0MA 1GVYA 3GXDA 5HNUA 1S5VA 1NF7A 3F5KA 1G1YA 3MO4A 3PR2A 3CZKA 4I3GA 3NQCA 4LEFA 4EOUA 2GJNA 2X41A 1VD6A 3TQ0A 3S6DA 1NWSA 5DN1A 3APYA 3TP4A 2J8GA 1JCMP 4LYQA 1EYWA 3EWUA 3SADA 3KRSA 1GVOA 4QSFA 1ZQ5A 3HU7A 2QLYA 4AIBA 3UWWA 3BTNA 5CXPA 3IIOA 3J7HA 1H62A 4JFSA 3T0BA 2E6FA 3U8GA 3CUJA 3QC0A 4CD7A 3BO9A 3VZYA 1BRLA 3RO8A 2V68A 2HJPA 4D8AA 5B80A 1F4HA 3AMLA 2PTDA 4LOCA 3WH9A 3VNMA 3LTPA 3S4TA 3HPAA 2VOTA 4ZB5A 1ZSXA 3GH4A 4U10A 1EC7A 2IPJA 3ARQA 3L23A 3I65A 3FAXA 2WPGA 1L6YA 1UH4A 3TW9A 3FSTA 1YDOA 5HUPA 3SRHA 3RYSA 1J18A 4FOUA 1LOQA 4R7OA 1W5PA 2WSKA 3OIXA 5AYXA 3RF9A 3WH8A 2DUAA 3HV8A 4KIRA 1K02A 4Y9MA 3WBXA 4OZOA 2A3CA 4Q4RA 3K46A 1JRBA 3DFPA 4AVOA 3HMJG 4IGNA 1VBJA 4O4WA 5G2WA 2ZUVA 3S1UA 3WELA 4WEVX 1JG9A 3NZPA 4QISA 2G37A 1NJJA 3LTSA 3F4NA 2VP8A 1BGGA 3BQ5A 3RCNA 3TV8A 3NPUA 1WQ5A 3MCOA 4CNNA 2Q71A 4E3TA 3TXVA 1XISA 3BOLA 1MO0A 4UTUA 1ADDA 4AD5A 3DFHA 2PTZA 3VFLA 3RCMA 3VABA 4YCOA 3G3MA 2NX9A 3UR2A 3UWQA 5CC5A 3E9AA 2JEQA 3JR2A 4B5XA 5FIPA 8XIAA 4JTDA 2AQWA 3QXBA 1F8IA 2PEVA 3E5BA 4PB5A 3N73A 1T99A 2VZOA 3UYCA 2OLHA 3GBEA 1O1ZA 3OGSA 3SURA 4DJFC 2YGYA 1YXCA 5I3HA 1JDFA 3K4WA 4CGTA 2G4JA 3OO2A 3UCDA 1V7AA 1A50A 5BWAA 2XPKA 3ARSA 1IIGA 3NIYA 3HM7A 3DYPA 4L9ZA 3FYOA 2E28A 1WXJA 3PUGA 2Y8UA 3OYZA 3MC5A 3LB0A 2XM2A 1I1WA 3UZXA 3T42A 4QQ3A 3VUPA 5F1VA 3NGJA 2A2IA 4JTSA 1XXXA 4KWOA 4NU7A 3REQB 4BCEA 5DX7A 5HJYA 2EXOA 2FJUB 5F2IA 3K30A 1PKYA 2C8NA 2QZRA 2HNEA 4WDUA 3RU8X 3VILA 1CDGA 1V79A 3PJTA 4C1NA 1JPDX 4GISA 1Y8BA 4IJRA 3PZIA 5D02A 2NUYA 5G4HC 3EXTA 1ISZA 4Z0SA 1QHZA 4BQ3A 4GBUA 3WDRA 1EX5A 4JX6A 3VOCA 3P62A 5D09A 1CXHA 2OKTA 3TN4A 3GTHA 2WCGA 4LGXA 1LZOA 3BLLA 2PUZA 2YA0A 4NNAA 4QCEA 1RCXB 2DQWA 4PCSA 2IXVA 3GU9A 2UWFA 2H9AA 4XSLA 3EB3A 3PJUA 2BASA 5TF0A 1GOOA 3AU2A 2WVTA 1VLIA 4HMCA 1UOZA 1ONEA 2DGAA 2A3LA 3WLMA 3WEOA 1XWYA 1UH3A 5BROA 4C91A 2PLKA 5HJLA 4XVDA 5HBFA 1HFBA 1GORA 3PFRA 4UFJA 4OVXA 2HISA 4UIOA 4UTMA 4MKSA 2D3LA 1DYSA 3ENLA 2Y1HA 3RR4A 4NNCA 4IXXA 2I57A 4R33A 4BI5A 1DWHM 1K8YA 2W79A 1GONA 1V51A 4M29A 3EOEA 1V6UA 4MLRA 2PAJA 4QNWA 5C55A 1W1IE 2OLAA 5IHSA 4DYJA 1BYCA 2NXIA 4DNHA 1ONXA 1ZLPA 3VNZA 3N12A 4ZA0A 2E25A 3S9IA 1QWKA 3LM3A 2QCDA 4NRSA 4PMZA 2YSWA 9RUBA 2BGQA 3EA2A 1ISVA 2BWGA 4LYKA 3WMCA 1J2BA 3MUAA 3T07A 2DFAA 1S5NA 3CNYA 3EA3A 3L5MA 3P81A 1NDZA 1KBBA 1XD0A 3JU2A 5JUVA 4OTKA 1A5CA 2D69A 4RNFA 4KF1A 2J78A 1YLVA 4O57A 1HKWA 5J04A 1GZ1A 4PMUA 1YIXA 5JBDA 1Q6FA 1PKMA 3URQA 5H6HA 1H1NA 1FP9A 2FGBA 3AS3A 4UNLA 4H9TA 2OX4A 1Q85A 4I9JA 4MYXA 4E8DA 1H1YA 1LQAA 3PC0A 4ZQNA 2FVMA 3CPUA 1WZMA 4Q8MA 4GJ1A 1MQPA 4FLOA 3CIXA 3GTXA 4NZ4A 4OU1A 1WBHA 2YB1A 4JKMA 1V77A 2YW3A 3S47A 4BR1A 2OB3A 2WMIB 3PTQA 2VR5A 3R0DA 3NDOA 1TVPA 3PVFA 2DZUA 3AMGA 3FKKA 2DSKA 4POCA 2X1TA 4GYPC 3SUSA 3R13A 4ERAA 5A6SA 3TQKA 2CZDA 1K4HA 4ICMA 3A5VA 1TJRA 2EPKX 1QI5A 3GU1A 3SUWA 3NGFA 1XSIA 3ZLHA 1KBKA 3N6HA 4HA3A 5I3JA 2Z1KA 4O4VA 1RUSA 4QG9A 2IKIA 3GO2A 4RCXA 1VJIA 3WQ8A 2ZVRA 4PTXA 3MMUA 1W3HA 5G2HA 1UBPC 2XN0A 2TSYA 3VIOA 3CMFA 4QCFA 3BLKA 3G77A 4WJXA 3SUTA 3HA1A 4AD4A 1JI2A 1E6SM 2B81A 3ARXA 4XTDA 2XWEA 3CUXA 3EWZA 3B9AA 4WSKA 3AYTA 1ZBKA 4DLFA 2MNRA 3FXGA 3OG3A 2A3HA 4GUJA 2YL9A 5HWMA 3OBEA 3NQVA 1C7SA 4IICA 3FNDA 4L4LA 4NXKA 2GK1A 4UOZA 3GFYA 3W86A 2GSHA 3HTWA 1CNVA 1K9TA 5C54A 3RLGA 3D46A 3AALA 4BFAA 4RDVA 3WFAA 2FTWA 1EHNA 4AF0A 2ZUSA 3LGGA 1IEIA 4EE9A 4BI7A 4FIQA 2I5QA 1XLDA 5ENLA 3DCPA 1OIFA 5XINA 5CJNA 1SZNA 2VC9A 2WHJA 1A5OC 1YKWA 2NV9A 3LQLA 1P5BA 4CQ9A 2CHOA 1XH0A 3PBYA 4GI4A 1JYXA 2FYMA 2CLHA 3PAJA 4NJIA 4DEFA 2VC7A 1KR0A 1O5KA 4B2DA 3KBMA 1KKOA 1MNSA 3R11A 1PB0A 1GZGA 2GVGA 3VKKA 3WDHA 3IJQA 4L56A 1BKSA 3TU9A 2CFFA 3HB9A 3RXZA 4L9YA 3L68A 5MF5A 4MZ8A 1WZLA 4N9DA 3MBFA 3ORWA 2ZDSA 1OYCA 1VZWA 4XISA 3WQ4A 2BG5A 5HNTA 1UG6A 1XLFA 3VVGA 3C2VA 4JIEA 2Y5EA 2H8ZA 4NNBA 4MYAA 1BQCA 4C5YA 2ZVIA 2JF7A 4MWAC 4TMCA 1A0CA 5FCZA 2O92A 2QXWA 4JYEA 4P8WA 4QGCA 1T41A 1ZBCA 4WQ6A 3SZ8A 3KCOA 1E40A 2FVKA 4PFMA 2WHLA 3L0GA 4C7FA 1F3XA 4HA4A 5L6UA 2P50A 2F2KA 4I9TA 4Q8QA 3GRIA 4N4QA 2J47A 5LA2A 2E6DA 2V38A 3HG2A 1ITQA 4TOQA 1AL7A 3B0XA 2YX0A 2C18A 4PCFA 2GDUA 2J62A 4O0QA 3TJXA 4JL1A 5A6TC 4XD3A 1VHCA 2P88A 3B8DA 2JGYA 1JXKA 1EOMA 1OFBA 4O1CA 1KM2A 3WQFA 1OK4A 2R91A 3W1QA 1W8GA 1UP3A 2J66A 2QQ6A 3CQKA 4Z1BA 1JD7A 2OU4A 3MP3A 1PDZA 4PYSA 4P7QA 2HVMA 1ICSA 4A2SA 2HS6A 1M7PA 4FNSA 3VIFA 2RH9A 2WYSA 3L7RA 1H63A 1SUXA 4AIOA 2AQOA 5XIAA 3ZR6A 1XRTA 4GZEA 4AISA 4YHEA 1GJWA 3H23A 3MBDA 1N2VA 4JDYA 3IV8A 4MKVA 6REQA 4JN8A 3SQMA 1AQFA 1FUYA 3VNIA 2AKZA 2PB1A 2PZNA 1VJZA 4NVTA 3A4AA 4DX3A 5D2TA 1E6PA 3P80A 3PP7A 4M1RA 1RH9A 3I7RA 8XIMA 1KKRA 2IPFA 4Y8EA 3W2UA 4LALA 1SMDA 1ML1A 3CMGA 3A12A 3AS1A 1U5HA 1XCFA 3CUZA 4MM1A 1VRXA 4LF1A 3AQUA 2Y6ZA 1UZ1A 2ZX8A 3QLDA 9XIAA 1KFBA 4AD2A 4DJFD 1LLOA 2AAMA 2NQZA 1XFBA 3FIGA 3DKJA 3GVGA 1XCXA 3WQ5A 3G1YA 1XLEA 3H24A 2Z2AA 4J4KA 1RD6A 4B5UA 2OJPA 1NFPA 2BTMA 4JTHA 2PZ0A 1DJGA 4HHMA 4D6EA 3GXIA 4QE5A 2XN1A 1Y5VA 3WNMA 3KWSA 2QNEA 5LXXA 4GYKA 3LSCA 4GPNA 3KS5A 3TYAA 3EPNA 2PURA 5C5YA 1CWYA 4HVXA 1UB3A 3CPRA 4GE8A 3W74A 1W1ZA 1XH1A 2YR1A 4DUWA 4GVHA 5HWNA 2FZMA 3L4WA 4QJ3B 3R7MA 1MI3A 5C7VA 2EO7A 4HU8A 4L7ZA 3APGA 2CLPA 4UQBA 2JEPA 4C6FA 4GGHA 4YCPA 2OGJA 2VEIA 5BOOA 3A5FA 2VELA 3BLIA 3DERA 4REQA 1G4PA 3UA3A 1PIIA 3W7MA 5FOOA 1JULA 3SN4A 1SO6A 2H3DA 1GOIA 1Z41A 3LA4A 1S1RA 4DZ5A 4IJCA 6PTDA 1ZHAA 2WCSA 2UV8G 3OODA 3NL2A 3C0SA 1KC7A 3CBWA 4RR4A 4PMOA 4DQWA 2FGLA 4F9JA 1JZ4A 3QFWA 2DH2A 1VKFA 1X98A 1Y5XA 2QJJA 4GQ0A 5D05A 1EO5A 1DE5A 2ZUUA 4YL2A 4R27A 1J0JA 3FK4A 2OKOA 3B9OA 4EVZA 2C14A 1OX6A 4LT9A 4MADA 2ZRYA 4E3VA 3RM9A 2GDQA 3M0LA 4R85A 4LX4A 2EJ1A 4JAWA 3UR7A 1A5AA 4H9YA 2WC4A 1H4PA 2WMKA 2C1HA 3Q2DA 2I7GA 3MCMA 3VZZA 4IPNB 3EDFA 3OZMA 3PZUA 2X2YA 1MXDA 1UKPA 1WDWA 4XD4A 1ESWA 4CQAA 3L4XA 2G5WA 1RLDA 1QOQA 3LQGA 2ZRWA 5JQ9A 1AH3A 4GZ7A 3QGAC 4XBSA 3HZ3A 4CNTA 4QFUA 3MUZ1 1JVNA 2J9YA 1OGSA 3UR5A 5IDZA 1X96A 4REQB 3SCPA 3B06A 4HSOA 2W66A 1I75A 2Z2BA 3A4XA 3E96A 1HVQA 2NLYA 2X7WA 3ITLA 2ZOXA 3MA8A 1UR4A 1UWSA 1RD5A 1E5NA 4G9PA 4LBUA 1W32A 2GQ9A 3UESA 2YFNA 3Q4DA 4X60A 2WM0A 5C9UA 1B54A 3AMDA 5LNWA 1XLCA 3LMYA 5GQBA 3UZWA 3Q65A 1VIWA 1T8QA 3W7EA 3TYDA 1JAKA 3OU8A 1D3GA 3HJEA 1R3TA 3F4WA 1FX6A 3W85A 4PTWA 1SO4A 3CV6A 2O4QA 3Q94A 4QEHA 4MHBA 4GFSA 2A85A 5A3HA 1XSKA 2XZ9A 3SGGA 1EBHA 1EP3A 4FPSA 3FFSA 2BHYA 4FA3A 3LV6A 2EPMX 3N1AA 1CB2A 1I60A 1QW8A 4H7CA 3P0WA 1F74A 1O4UA 3CWNA 4BJHA 3WF4A 4AC7C 3HFTA 4H8NA 4QE1A 2DZVA 1V0MA 3W38A 4J3UA 4PUEA 2PDQA 2FH6A 5A2BA 2OTDA 3WL1A 3BCJA 4E4FA 4HCLA 1JF5A 3AYVA 2QJIA 5HOSA 2RDTA 3AXHA 2V5LA 3VKDA 1KM3A 3FW6A 3QGKC 1XIJA 3KTXA 4M24A 2E09A 1US2A 3EMCA 3OLDA 3TDFA 2D24A 1NQ6A 5DELA 2C91A 4JHOA 4M3PA 5KETA 1ZP4A 3SB0A 3W7IA 4CCEA 2V63A 3EX4A 1KW1A 3I10A 1XC4A 1AH0A 1F3WA 3TYEA 1NDYA 1SO3A 4RL3A 3WKZA 1KRMA 2YCJA 4M5PA 2BVWA 1F6KA 3MYOA 2CLFA 3AO0A 1KD0A 4ZOBA 2NWSA 1JDCA 4ZO9A 4GUIA 4UFIA 3W1PA 3FY1A 4TX6A 2E7FA 1NFGA 1NVMA 4UR7A 3RM8A 3O6DA 1NM9A 4AG0A 4KH2A 1OFQA 4BF5A 3FA5A 2V3GA 3PULA 8RUCA 1DJZA 1BXCA 2YDRA 1ZUAX 1Q8AA 1GQLA 4XTIA 3O63A 2NZLA 1I2NA 3BZGA 3WBYA 5D4YA 3W6MA 3VIKA 3LHZA 3A3XA 2PP3A 1OJXA 2DSVA 4KPLA 4OGZA 1E72M 4KGLA 2OCZA 3ARRA 5D9PA 3RO6A 2PDHA 3O06A 4MF4A 1ICPA 3LBMA 2PTWA 3EXRA 4MZ1A 3NSMA 2DT2A 2JKEA 4PSRA 2NW0A 1PTAA 4GHRA 3DG6A 3HF3A 3CASA 1JD9A 1FH9A 4GABA 1K9DA 1NP0A 1UYQA 1E6ZA 2OQYA 1DIKA 3FJ6A 3VMNA 3OVQA 3VM7A 2I1OA 1B4KA 3RK8A 3LHUA 3TN6A 3W1XA 3CH0A 5CBIA 4OQVA 1UKSA 4LNYA 3AIRA 1ZJAA 4JKLA 2XSXA 3WNPA 1IZCA 3H55A 4Q4OA 5I00A 3R4IA 2VEFA 1MXGA 7PTDA 2FFIA 2Y24A 1DKWA 3ATZA 4J5NA 3T2PA 2OO0A 2PLJA 1VEOA 1VBRA 3NQBA 1DJNA 1TPFA 2ALRA 5CSYA 4W85A 2DZPA 3G2GA 2PRMA 4W7UA 1W1YA 1Q7MA 3VA8A 2YFOA 3I6TA 3IANA 5EB8A 3A64A 3L9CA 2GZXA 1YDNA 1FFQA 3ARUA 4H1ZA 2OLSA 4FZIA 2WKJA 4GG9A 2WJDA 1HKMA 2J79A 4CQCA 4JFVA 1E1CA 1YADA 2QDEA 4I90A 5FEZA 1DTNA 1OFRA 2BX7A 3QLLA 4IUOA 4JYDA 4X0NA 5AHMA 2D2JA 4Q8OA 4NKCA 4ZE4A 1UR2A 4A3UA 3QY8A 3SGZA 1R9ZA 2Y7FA 1WBJA 3O3RA 6ALDA 1F4AA 2CLMA 1MXSA 3FAWA 5FSEC 3WJZA 4DUXA 2OZ8A 4FF5A 1OGBA 3WBEA 4C7DA 3NZRA 3TNOA 1R38A 3CIVA 4IP4A 3EOOA 2Y70A 1HG3A 3DEQA 1R0MA 4U2ZA 4UTKA 4IL2A 3M9YA 1XLKA 3NXFA 4HOXA 4IUGA 4CN1A 5HXMA 3URNA 3NQFA 4AZ6A 3KOYA 3C8NA 4TTGA 1AJ2A 3SM0A 2QAFA 1EUNA 2VX7A 3DYMA 1CW2A 3F1QA 2GVLA 3VX0A 3GTFA 4CD6A 3BSMA 4DZAA 3FXYA 4DRSA 2D2HA 2X8RA 3A3WA 5F4XA 3FHQA 2C13A 1NOWA 1S5TA 5CG7A 2BXZA 1D7KA 2ZIDA 1M68A 1XM3A 1XW8A 3M7WA 2ZADA 1J6OA 4AWTA 4CCDA 3JUGA 3C61A 3DGRA 2FFCA 3VKBA 1IXPA 2JKPA 5CGTA 5JBEA 1VAHA 3LRKA 4R88A 5G5IA 1XD1A 4GIYA 3CUHA 1EA9C 3MKCA 2QCFA 2OELA 4GZJA 7ENLA 3T0TA 4JXCA 4HMNA 4G7EA 1U2YA 3F5LA 3ZVHA 2DIKA 1OSEA 3U57A 5CSSA 3UNTA 1XLLA 2VCCA 3IVUA 3PY2A 1ALDA 4ACYA 3R8HA 3SECA 2O9RA 5BXRA 4DWSD 4GJIA 4C6NA 2ATSA 4WUIA 3TR9A 1BYBA 1W1PA 5KMYA 1YQ2A 2HCVA 3CM4A 3VC5A 3W84A 3RMEA 2PC8A 3EMQA 1UH2A 2V81A 1QVBA 2CZ5A 2R1KA 4R9XA 3MJMA 3KL3A 4GOAA 1ZJBA 2RKXA 3WNOA 3CL8A 4HHLA 1RY8A 1FWRA 3W29A 2VFGA 4E2DA 1XIHA 3N6JA 4TIMA 4KCVA 4MTVA 1FWAC 4JTKA 3VINA 4XG1A 2XH4A 3EOLA 3WENA 3RLUA 3PG8A 4UQDA 4A2RA 5D2VA 2HQAA 2Z7KA 3K8KA 4QSHA 1KBJA 4S2BA 1M65A 1WXYA 4PB4A 5LXEA 1PV8A 4ZVJA 3KRZA 5K4XA 4C1LA 4PE8A 2PDFA 1W54A 1Z6KA 4XAFA 2ZXAA 3WDQA 1XRFA 2QDDA 4EPBC 2WMHA 3C6CA 4NXSA 1PZ3A 4PULA 4MWAE 3W7GA 1TREA 1H0IA 4JHZA 4S3AA 1H7NA 4J27A 2TRSA 2EGZA 1FDZA 2UY3A 1KM6A 4XZLX 5M03A 1OINA 4W7VA 2V6AA 3G5EA 4XO6A 3M5ZA 5JIPA 4O28A 5A6JA 5LHFA 1E9IA 1DQXA 1QOXA 3TCSA 3GVWA 4D6FA 3NQDA 1TE6A 4W8LA 1AA1B 4M7SA 1PX3A 3SY8A 3HQPA 4JY9A 3U6WA 4M80A 1DJXA 1X8FA 2ISSA 1V7YA 1CCWB 3TE9A 1GPFA 1JDAA 3W76A 3T8LA 3E0IA 1KM0A 3LERA 1XIDA 4JTAA 4Y9NA 1M7OA 5I3DA 2WANA 5CZTA 1YTEA 1XGDA 4AIEA 1IYXA 4Z1AA 3TLQA 4D6GA 4OUIA 1E73M 4IWWA 4K8EA 3IIZA 1KR1A 2OMAA 1UR9A 1UZDA 3SRDA 1SZGA 1MFUA 1EZWA 4IPIA 3FN9A 3GBDA 3PPGA 2IUZA 1UMYA 1IR1A 5A8PA 4IX0A 1XPGA 1QPRA 1T96A 3EXSA 4TVUA 2WNZA 4GK8A 2BP1A 3GQYA 1DJYA 3TVAA 2QCDB 1BKHA 3W37A 1M53A 3BMXA 1TPDA 4H83A 1UR8A 2OG9A 5HQMA 2IS7A 2E8ZA 4NZJA 1HKKA 2P5NA 2CU0A 3NQAA 4ZO8A 4WSJA 5EBAA 4HGXA 1C92A 3KCLA 1PS9A 5DBUA 2W6RA 4B90A 1ZALA 2Z2UA 1ZS2A 3ICJA 2IQDA 1QI0A 3B4YA 2QR6A 2YCEA 3UF9A 3U7BA 4YHGA 5T8GA 3UJFA 1TCDA 5AOUA 2WBGA 1UPPA 2HK0A 3C0JA 3VGHA 2P53A 2EPOA 2G3IA 6CGTA 3T09A 1A5SA 1MW0A 1W3KA 4K1WA 5DT5A 1ISXA 2E5DA 4GVFA 5HA7A 4GLEA 3K4DA 3WLHA 3UXAA 2NQLA 1GQJA 3CZGA 2BGNE 3MWCA 3CHFA 3QGVA 2PDIA 1XIIA 4NILA 1GPWA 2HXUA 3UT0A 4KRUA 1Q6EA 3R8RA 1RJPA 1SM9A 2Z1WA 5FAJA 4OT7A 4DJDD 1A5UA 2ZA2A 1P6WA 3QEZA 1PZ1A 1S2CA 4DM2A 1E6RA 3T2OA 1UBSA 1TYGA 3GHTA 4X22A 4L80A 4HZ7A 1E4LA 5E9AA 3W27A 2G96A 4WR3A 3W1MA 2QJGA 4J3WA 3GG0A 1AJ0A 1Q13A 3RJYA 3PJWA 4P2VA 3ZXWA 1XQLA 1SR0A 3MI2A 3ZJKA 3UWVA 3JW7A 2OZ3A 3JVAA 3ZJ7A 2GPTA 4Z1CA 2PDYA 4Q6JA 3WK1A 1OYAA 3T40A 3QJAA 1MQRA 3EB2A 4IIDA 4Q4SA 3EOUA 4Z2LA 4HPJA 1KV5A 1BVNP 1T8XA 4NP7A 3IV3A 3M0IA 1TV5A 3QZEA 4KCUA 3R25A 1Y5WA 3E2VA 3W2LA 2DVUA 2ZC1A 1MEIA 1XH2A 1E56A 4HN4A 4KFOA 3KLLA 3SW6A 2VRJA 3ABZA 5C2GA 1LRTA 2B7QA 4RXFA 1CZ1A 4DBSA 2WVUA 4L1WA 4NHVA 4ZL1A 3GVVA 1P43A 4M56A 4B3LA 5TD4A 4GX8A 1Z89A 2IMRA 4RLIA 4H2CA 4L1XA 3W2KA 4WXYA 4JTIA 1D2KA 4PTNA 2C0HA 3B8UA 3NM3A 5CKSA 3HO8A 4OWGA 1VS1A 1XLAA 1HJVA 1KQZA 4WY0A 1ZP3A 1BTMA 4O8RA 1C3FA 4URIA 4JOMA 4UR9A 3GVRA 4JIHA 1TQXA 2QPUA 1AJZA 1O95A 2MUCA 5LNVA 3TW6A 1TWDA 4LTSA 3HGSA 3AYRA 4RPPA 3UG4A 1MRAA 3OVRA 3I3DA 1XBVA 4G1NA 1POJA 3H70A 3GC4A 1CENA 3SCRA 4O54A 3LCFA 3ES7A 4AZCA 1KFLA 2EEXA 3QOMA 3O9NA 1EWEA 4PUKA 4L1GA 2HWGA 5H8UA 2ABAA 3BJSA 4PBEA 2BHUA 4DF0A 3H2MA 1TMHA 3GLCA 3SDOA 3ZM8A 3M5VA 4JFTA 5EPDA 3AOFA 2E1WA 5M1TA 4B5SA 1JNDA 1YX1A 3Q67A 3C56A 3MT1A 4FR6A 1HN1A 1H60A 4BF9A 1OX5A 5LNUA 4HA0A 3A47A 4IFRA 1W9BM 4R9OA 4ZXOA 4JN6A 1SJDA 2ZDRA 3BV7A 5FKYA 3I68A 1NWUA 4U4MA 2G97A 1WOBA 4OOZA 1YE4A 1G7VA 4K8GA 2XVKA 3M5XA 4INFA 5TBOA 3GIYA 2PD5A 2VFDA 3KVLA 2ZZ3A 2Q09A 4LW7A 2FLIA 2WNWA 4GX9A 3RDKA 1JCTA 4DWSC 1RQBA 2OZTA 2IKJA 2DW7A 3EKZA 4DO7A 4EIVA 5G2IA 4H9XA 1WB0A 4UR8A 2IKHA 4G1KA 3II1A 5LNSA 3KOFA 4LWWA 3GXNA 4KMQA 3W2JA 3NJ3A 2VL4A 4KFPA 5K7JA 3A6OA 4AZCB 3N3MA 5CPLA 4AZGA 5HATA 4CVUA 5DCEA 2HMCA 1UP2A 3QR0A 2V67A 1HXJA 4LY4A 1F9CA 2DIEA 2VRKA 4K6AA 1ADSA 5FL1A 1VFMA 3VDBA 3P5YA 4F2TA 4D6DA 1YW1A 4L6HA 1UWRA 2H3BA 1FOBA 3N15A 4PMXA 1PWLA 4GO9A 2NT0A 3I4KA 3CYVA 3GXFA 4HYVA 3ARPA 3CQHA 4JTJA 1OB0A 3HGOA 5I02A 2P8BA 4R34A 5ECVA 4AEEA 1FHDA 3BLOA 3S5YA 3V7PA 4DAIA 5AYIA 4BWLA 3F2BA 3P2VA 3MSDA 3WQ6A 1P1XA 3U2OA 2BVTA 3WCZA 3CAQA 4IIFA 2PC4A 3Q45A 4DO5A 3EEZA 1FBAA 1AD4A 4I6VA 5CH9A 5DT7A 1PEZA 4O15A 1LRNA 4CQDA 5F7UA 2CERA 3WQOA 3A3HA 2NLIA 2I16A 5E5CA 2JQXA 1LT8A 1TELA 3SN1A 5A8NA 2KAUC 2TPSA 3N2CA 4OUEA 4WHBA 4LEQA 2AQVA 4OBTA 1MZHA 2GYIA 1VHNA 1DVJA 1IXNA 4UTTA 2QEZA 3SCOA 4M8UA 3W1UA 3HJZA 2VQUA 1RBOB 3AS2A 3U2CA 2EJAA 2G4FA 2FIQA 1TA3B 3NQEA 1TPWA 4XIMA 4DPQA 3FYYA 5BZAA 4PR4A 1HJUA 4HSHA 3GG7A 2ZYFA 3UJSA 5JVLA 1PJ9A 1U30A 4LCQA 4CLMA 2WLYA 4U3AA 2ZQ0A 5KZ6A 3DG3A 4A4AA 3L12A 1Q6QA 4RZBA 1WO2A 1IGWA 1SJBA 5K9DA 1TJPA 5H8MA 5DF0A 5E93A 1S2WA 2WXDM 4ZFMA 4CEXC 1QI4A 3MCNA 3UG5A 3E1F1 3DFQA 3GW0A 1NTHA 4Z1DA 2X1RA 2FPTA 3ZS4A 4DJED 2HZGA 1OG0A 4H6KA 4EPDC 1OZQA 1TTQA 4U33A 2D2GA 3OA3A 4F0SA 4LS2A 1B5TA 2GVEA 5K9XA 1W2PA 1TX0A 1A4MA 1OY0A 3PBGA 1XX1A 4R5EA 3P74A 1ZB5A 2DT0A 4J2MA 3TX9A 2BXVA 3H2NA 4WX2A 3AI0A 4ZQPA 2O4MA 1L2QA 5J5RA 3S2CA 2OSYA 1GOXA 1H7XA 4O1EA 2VUNA 4RDYA 3NL3A 3WDIA 3KWXA 3AHYA 4NAFA 2Z1SA 3QBUA 2JE8A 2G0WA 4P8VA 3UPMA 1WDSA 4F9DA 1FTXA 3CZLA 1TMLA 1YMYA 4NX0A 5FJRA 4PMNA 4JCMA 2RGLA 1D8CA 2XWDA 1E1EA 1C8VA 5AN7A 4H9VA 5D30A 4R7WA 1A49A 1TSIA 1ZBVA 3FJLA 1WUEA 4P7RA 3LS9A 1Q6OA 1UWUA 3KBVA 3MB9A 3NXLA 3AFBA 4AY1A 3H2AA 4RJEA 4B91A 3EAUA 3CC1A 3GSMA 2VRQA 3AWNA 3C8FA 3WQGA 3PZ9A 1XLGA 1TFVA 3OHIA 2OQHA 2QCMA 1C8QA 4TO8A 4D6HA 2G41A 4MDOA 6ENLA 3JZUA 1CGTA 4O12A 2OYMA 2OR2A 1PZ2A 3WBAA 4RNHA 5KZMA 3B0YA 4J3TA 4GNJA 3L4UA 3W7PA 4IXHA 3TONA 3N2BA 5IXEA 4CUCA 3T78A 3N25A 2C71A 3O6YX 1KGWA 4LF2A 3MJYA 4ICNA 3WJWA 2BGSA 2XINA 3G24A 3N2OA 4WCJA 1OFEA 4DAFA 4OBRA 4QE4A 4FLSA 2J27A 1F3TA 2CBJA 2QF7A 1VFHA 1Q4WA 3MMWA 2E77A 1R3YA 2IPGA 4WKFA 1PSCA 3CS2A 4MKNA 1BVZA 2ANUA 1SGJA 1PYMA 2F9RA 3BMWA 1WAWA 4MDPA 1RBAA 4D8LA 1VCVA 3G1FA 1FRBA 4K68A 3TWBA 2ZXDA 2B7NA 1B90A 1GG1A 3DOPA 1MEWA 1XKJA 2OGYA 3F2CA 2X40A 3DIPA 1OC6A 3IUIA 4WJ8A 4Q33A 3MP5A 2VDGA 4HNCA 4AD3A 5AHFA 3A23A 3KHJA 1VEPA 2UY4A 4AY8A 1PL9A 2DSUA 1S5MA 1XC6A 3QMSA 1TWIA 2Y2WA 1S1PA 1YNQA 3FVMA 4AXNA 3N4AA 1HL9A 4HNOA 1KRBC 1MDLA 3H2OA 4AXKA 1A3HA 2YB4A 1R3RA 5EMYA 2ZFAA 2X0SA 4KQNA 3OP2A 3PPFA 3GAYA 4ZO7A 2ADAA 3NA8A 1YE6A 4MIMA 4EF9A 2DT3A 1LYXA 1DQUA 4FS9A 1FWGC 2TMDA 3DN5A 5D2YA 1BXNA 1FWHC 1HJSA 1QO2A 3LRMA 4LCRA 2YXGA 2XH0A 1E9ZB 3RPDA 2BMBA 1AFSA 1YHTA 4E8GA 1ZFJA 3MHFA 1PCWA 4TV5A 3EPOA 2FTYA 3GNRA 5A6BD 3WNLA 1LBLA 4L4OA 3MZNA 2IXUA 3QM3A 3W7OA 4BEUA 4IG2B 3M0MA 1WP6A 5LIYX 2W5FA 5KZEA 2O9PA 3VD7A 4UTJA 2QULA 1H11A 1EP1A 1RQHA 1Q2RA 1ZAIA 2ISVA 3K1GA 3MSGA 4I5UA 3N2TA 5H8PA 3GR8A 4HA1A 2X2GA 3GE7A 3ZVIA 3LZ5A 1POKA 3EDDA 3CZEA 1OC7A 1VFUA 1IZKA 1GT8A 4Y96A 5HUOA 2VX5A 2GDVA 1CX9A 3IACA 4JFUA 2VENA 1QUMA 2CHRA 3D3AA 2HS8A 4MWAD 3RM4A 3MKVA 3S5ZA 1K7FA 1QT1A 4UMBA 3ATYA 3RPTA 3YPIA 1W3JA 3N04A 4B5TA 4YU1A 2Q3RA 1IEVA 1LL7A 2V8ZA 3HPSA 1UR1A 3R6IA 4HCHA 1AW5A 2ACUA 3BE7A 3MV11 3SUUA 3PJXA 1RCOB 1H49A 1Z42A 2ZA3A 3KM8A 1XKYA 4AD0A 2NV2A 5FJUA 5BRPA 1NU5A 4Z42C 4PA8A 3SAZA 3CL6A 1ME7A 1PYFA 4Q8WA 4QG6A 4BWLC 3R10A 3UPWA 3KFTA 4BHYA 1V8EA 3G0SA 2XIIA 3KDNA 5CAHA 3OW1A 4F3HA 1XYZA 2P1FA 3LXCA 4TX8A 4OV9A 2WWDA 4DXVA 3KE0A 4C6KA 3C4UA 3EKGA 4ORMA 1L6GA 2P3ZA 2BLEA 3ZJ6A 3GU2A 1J10A 3VNJA 4L4MA 3QPYA 1IIHA 4TXEA 2WWCA 4AEFA 2Y5SA 1J96A 3RG6A 3QY7A 3BMVA 3VE7A 4C6JA 4Y9OA 3L5AA 4HJWA 3VYLA 3H21A 3N18A 4Y2WA 4M6QA 1W9XA 1LRQA 1WKFA 4IMEA 2EAWA 1AMYA 3H6OA 1EPXA 4QR6A 4HIBA 3W53A 1BD0A 2FDMA 3WUEA 4B5WA 1I4NA 1DXFA 1Q3NA 3RITA 1NOFA 2VDIA 4AHQA 5GJPA 5I79A 3S9YA 4LUTA 3VIGA 4XKYB 3BQ6A 1O1HA 2ATMA 4QLLA 3F03K 3ITTA 2QJHA 1XFCA 2V9DA 3P3BA 5D32A 3QHMA 2G50A 3IGSA 3WSUA 1FWDC 2I17A 1GKQA 4UTFA 1LL6A 2DZTA 2PU0A 4YTQA 3QF0A 4W86A 3UY8A 5LYRA 4B9ZA 1KTCA 3QTPA 4WD0A 4LSBA 4DYKA 1TTIA 1H5YA 3AZSA 1E1CB 2DVTA 3O1NA 4I7UA 2OEMA 2SFPA 2DORA 2QKFA 3IGHX 3CMJA 4FMVA 2VO5A 2DZSA 3LDVA 3B04A 1WXZA 1XG4A 4DJDA 1ECQA 1RPKA 4LYRA 5FA5A 3NEVA 1MRQA 4YIWA 1TZ9A 1Z8AA 3MQTA 4W88A 1ZPTA 4A8LA 1RVGA 1GTHA 4CD5A 4HNLA 1UUQA 1GYNA 3PZGA 4GKTA 5CBBA 1WPCA 1TA3A 1RXOB 5KINA 1V02A 3RILA 5HQEA 3KVJA 2XIQA 2O7QA 2PWVA 4J7RA 1SMAA 5FF3A 3R12A 4LS0A 1CLXA 1DTUA 2GVYA 3QYSA 1V3JA 3AIBA 1EYEA 2YYUA 5E1QA 2PDWA 3VGDA 2WKLA 2PDMA 5CPTA 1YBQB 1LG2A 2C1IA 5CZSA 5SWUA 2A6NA 3W4RA 4RDWA 2VEGA 4CVWA 4ADTA 1QBBA 1GQNA 3W7LA 2VMFA 1S46A 3UZZA 3ZR4A 4WOQA 3MY9A 4Q7BA 1WE5A 2A7NA 1X7IA 3D3FA 3ISIX 2Y7EA 3O8AA 1W5NA 1IXQA 4I6KA 4X3ZA 2P0OA 4E2OA 3FKRA 1AZ2A 3GHRA 2VCAA 3OLGA 2YCIX 2FZ8A 3KW3A 5EGRA 1ICQA 3KS6A 4D8ZA 1E43A 2JK2A 5CZKA 1WDDA 1NDVA 1YEYA 5HPCA 1V0KA 5EFDA 4V33A 2P3EA 1KFWA 3VIMA 1MUWA 3D0CA 3PTKA 2A3AA 1I0BA 1EF2A 4B9YA 4HQVA 2J7EA 4XK2A 5AVHA 3SQLA 4XQ6A 2D0GA 1DXIA 4MY8A 3CUFA 1Z44A 1C9WA 3GFXA 1OEPA 1X8CA 1MEHA 2AKMA 4M19A 1B3ZA 3QMTA 3HPXA 3BAJA 2HTMA 2JBMA 3OTRA 3AICA 4GCXA 4D2JA 1VF8A 2REQB 3ZOAA 2YXOA 4DI9A 4HNVA 1K8ZA 3CWOX 2F61A 1UHVA 3DFOA 3WZ0E 2X1SA 3PBVA 3WQWA 1OT1A 1RVKA 4MJMA 1H1ZA 1VYRA 3N4EA 1Z9AA 3TSDA 1R9YA 5TNVA 4A22A 4HPHA 4MLJA 2NV1A 1W5QA 3M0YA 4IQLA 1VJSA 4NJJA 3VO0A 3ZR5A 3C3UA 3MUIA 2R1LA 3BGJA 4IMCA 5ABFA 4I5RA 3O2LA 4O19A 4V2XA 3SCVA 4XAYA 3WF1A 3QQWA 4TVDA 1Q8JA 1PIGA 1Q6CA 4K2SA 3STFA 2V0TA 1TPH1 3NQGA 4HB7A 3QZ6A 4WY0F 3W02A 1LQ2A 5CZ0A 3VCCA 5D2WA 1XJBA 3SFKA 4DN1A 3EDKA 4ZTXA 5LIXX 5M3WA 1G9HA 2CITA 1PX8A 1R3SA 1O68A 4DLMA 4AQLA 3I7SA 2XU2A 3N3TA 3CK5A 1O12A 3PPCA 5G1MA 3RU6A 5JIWA 2F6KA 3M43A 5REQA 5DBTA 4IMFA 1E9YB 3VAVA 4I5XA 3GHUA 4PL2A 2JALA 4FNPA 2Z00A 3DKLA 4AMCA 2X09A 3VD4A 3B4UA 1N55A 1VENA 4Z2JA 4LAMA 2Y0FA 3BGAA 2X16A 4A8NA 3BH4A 4DWSB 4N6FA 3HQOA 1TIWA 3UXIA 2F38A 2BOFX 3BG3A 4FNRA 1KCZA 3S6TA 2EQDA 1W9PA 1BRLB 2AL2A 5I78A 4XAZA 5LA0A 5BU6A 4FNTA 1G6CA 4O16A 5ABFB 1V3HA 3PNUA 2ESCA 3KXQA 3W00A 4MSSA 1O94A 4E2BA 1PTGA 1GTEA 1SFLA 3TA9A 3VK5A 4AWUA 1RBLA 2CLEA 3P14A 4O13A 3N17A 3TAKA 2E9BA 3ITXA 4JN7A 3PZQA 4G6CA 5HMFA 1VEMA 1HT6A 2WSPA 4NX5A 2DZWA 1QBAA 5IDIA 2RJGA 1UUMA 1THFD 2POZA 1T7LA 1HO4A 2V69A 2QDGA 4ICCX 3SEPA 4JQ2A 1Q6RA 2CYGA 3LU2A 1BSLA 1OC5A 3LY0A 3FYPA 3R58A 5A95A 3IJ6A 3FGCA 4CNPA 3AUJA 2B0MA 4UMCA 4EX4A 4AZ7A 3OEXA 3SRKA 3THAA 3NSNA 3KL5A 5G1TA 4LU0A 5HAOA 4N9EA 3R43A 4WKAA 4IH3A 3TOYA 1MUMA 4S3GA 3C2YA 1F07A 1AW1A 3CHEA 2ZZ7A 5FF4A 5AC5A 1PXGA 4H9UA 2WMJA 2E40A 2VQTA 2VZSA 3DFSA 1IHIA 1J6PA 2XZ7A 2ZWZA 1RP9A 3FSUA 4E5TA 3SJNA 3NZ1A 1J12A 3O0KA 4L5ZA 3TFXA 3RFAA 2P10A 5MHBA 3UERA 1E0WA 4JTLA 4C7GA 5DMMA 3I3BA 2FGZA 3T4CA 3T7VA 4NUWA 4LH8A 5GNYA 1XR2A 3ARZA 3NUKA 3FX4A 4ROPA 1P7TA 1PX4A 3KBWA 2WK2A 1L8PA 2DSWA 1A3WA 5C70A 2EHHA 2NUXA 4D9PA 4IZGA 3RJXA 4O52A 5I77A 3L21A 5CPSA 3WYZA 3H22A 3KAOA 3CUIA 4P8UA 4A3QA 1KCXA 1TPVA 4K36A 5BYWA 4HYRA 2ZUTA 2PS2A 4UTWA 5EFFA 3R5EA 4B4HA 1WKYA 3TTQA 4C1KA 2V2CA 4UTTC 2HBVA 2V3FA 3PZTA 4LAUA 1M7XA 1RZMA 1W1TA 3BLEA 4QRNA 2VDHA 1GVEA 2WSYA 3ONCA 4B16A 1LWJA 2VWSA 1UR0A 3W0KA 1E6XM 2PGEA 5AYZA 4JIPA 3VKJA 2Z24A 3BAXA 1GWJA 1O5QA 1F61A 3GKAA 2FMOA 1F3EA 1JZ5A 2E8YA 5C2XA 4FP1A 2QGYA 2ICSA 1K03A 1ZJHA 1XLMA 4YN5A 1L6SA 1SJCA 3AC0A 4GVIA 2PF0A 4MUZA 4ZSTA 3ZWSA 3WF0A 1MSSA 3PNZA 1JJKA 4IGMA 2WMGA 3GIQA 4FF7A 4HNTA 4US5A 1P0NA 2GQ8A 3CHCA 3RAOA 1H09A 2OVLA 4NG3A 4NZ5A 1Q66A 2F8QA 3DBNA 1NOUA 1X7FA 2WQDA 4GNKB 3VOIA 2BY0A 5K3VA 2O7SA 2QUTA 2NQHA 1VPYA 2R82A 1JI1A 2PWDA 3JRKA 3AJ7A 4KWWA 5I23A 4ZQCA 3G1VA 5ECUA 1NF0A 4HKPA 4A8RA 4TVCA 1ZTVA 1RR2A 4YVXA 4IX2A 4S3EA 1SZEA 3NQ6A 4Q22A 3ITCA 2PP1A 1VC4A 1HUVA 3FEQA 4GY1A 1XBYA 2Q8ZA 2ZUWA 3EB4A 5CGMA 3G6MA 2YKKA 4W9TA 1GW1A 3IJ7A 2P76A 1KRCC 3I3EA 2QMJA 5C2CA 1IEWA 1FH7A 3QZAA 4MB3A 4KETA 4K1GA 3GTNA 3HBLA 2YLAA 4A3HA 5DANA 3WIJA 1VFOA 1V93A 1G94A 5E9XA 4FNUA 2YL5A 4GZIA 5ABEA 4HBKA 4GI6A 3UJEA 1KXQA 3M41A 2OSWA 2G3FA 3M44A 3U4FA 4J9JA 1JUEA 2W67A 1JZ6A 5I5RA 2CXEA 3W07A 2LLEA 2PFHA 2A4AA 5AYYA 1O5RA 4FEZA 1J93A 4XZBA 2YA1A 3G8RA 1K8CA 2R8WA 6A3HA 4PMVA 5CJMA 1BFNA 5AZ0A 2HEJA 4QDMA 1NELA 4HZMA 4B2DD 3S42A 3FJ4A 3CLWA 3W82A 4ALDA 1YPXA 4NT0A 4PTDA 3HMCA 4PRTA 3U4AA 3F2DA 3RIKA 2DW6A 2OZ0A 1DORA 1H7WA 2PCEA 1RPXA 5BRBA 4LCSA 1VBUA 5FEPA 6XIMA 1XUUA 3MSYA 1BWLA 3KP0A 1FQ0A 3DG7A 4QLKA 3WD4A 1IT7A 1K6WA 4E4UA 1CI1A 3STCA 3BV4A 2KZHA 1IV8A 4KEZA 2H6RA 2ZXBA 4H3DA 1UOKA 1GYLA 2GWNA 4W84A 1NSJA 4AF0B 3WLLA 5T91A 2VFFA 2CNCA 3T55A 2ZZ6A 4H7VA 1CTNA 4ONVA 4IP7A 3NQ7A 4M81A 4AIUA 2PI6A 2Z4GA 3NG3A 4UNIA 3GG1A 2DJLA 3W9ZA 3EA1A 5E0KA 5TAOA 4XZMX 1E5JA 4G56A 1C90A 2VGFA 5HMDA 3SBFA 1RALA 4C90A 3CZ8A 1B31A 4KGJA 4YTRA 3O0FA 4BK9A 1TIMA 5A1AA 1REQA 4IMDA 4NJKA 4XD6A 2VFHA 1H0GA 4IOTA 4PH6A 3UYIA 1VRDA 3W6LA 3HURA 3ZLGA 4KT2A 4PUDA 4ZSUA 1EJRC 5A6AA 1CLKA 3LI0A 4UB9A 1R86A 1Q4NX 1CLVA 4QAIA 3EWDA 2TAAA 2DUXA 3ZFHA 4ZOAA 5C7HA 3AZRA 3LHWA 5CQ1A 2PWHA 3GS6A 1MW3A 1ZAHA 1K8XA 1X6LA 1UUOA 2J7HA 1I8JA 3EOSA 5EY5A 2WJFA 4ADSA 3QV8A 3MDUA 2QJNA 5E0FA 1KTNA 2PA6A 3DXIA 4G8TA 3ES8A 2C1GA 3HQNA 4NYYA 4DJEC 3GDMA 4OOUA 5TIMA 4P8XA 1DXEA 3AROA 3FA4A 2XFFA 4YLWA 3C0QA 3GNXA 1V02E 1DPMA 3N2MA 2B31A 1QNSA 2CETA 3CO4A 3EDJA 1GVRA 4IMGA 4AZBA 3TNBA 2QYGA 4MJ2A 4Q4PA 1X1ZA 4ZFCA 3PUOA 1W5OA 1PO9A 1EO7A 2DY3A 3E0FA 3L5LA 5T26A 3WK0A 3O6CA 5BXTA 5AC7A 4IPPA 2WW5A 4FSAA 3BW2A 2Y61A 3WQPA 1MW1A 3OIHA 1XDJA 2ZZ5A 1C7TA 4LUYA 4AU0A 1E0TA 3HV9A 1QXLA 2Q3OA 1L6FA 1X39A 4C6BA 3SN0A 2AAAA 2E9MA 2UBPC 1IWAA 3BW3A 1BYAA 2I9UA 3W25A 4AYGA 4EWND 2XSBA 1XCWA 3RLVA 2CWNA 2X05A 1G69A 3DAQA 4P61A 1HL8A 3KVMA 4HD5A 3MANA 3HN3A 3WMBA 5HNRA 1B4EA 3CEUA 1J0KA 4YXGA 3UBPC 4QXIA 1UC4A 2RJHA 5H91A 1T40A 4MY9A 1XV8A 1OZMA 1QJWA 1SZRA 1Y0EA 4EAYA 1K70A 3QRHA 2J13A 3H7RA 3BURA 1M41A 4BQ5A 1TV7A 3EX6A 1OGGA 2D0HA 3PZMA 1US0A 2XVLA 3A13A 3FDGA 3LUTA 3GDBA 4QX4A 1K4GA 3BOXA 1JXJA 3DZ1A 1LWIA 2F7FA 3BLDA 1XRSA 2OQLA 4O1FA 1KGUA 4GKLA 3SJ3A 1BWVA 3ABXA 4GVGA 4QJ4B 4RDZA 2F84A 3TIMA 3P8JA 5TQLA 4OBSA 1KFEA 3UG8A 2A0NA 4YTUA 3SGUA 1PHWA 4GMEA 3C3NA 1KM1A 2NSXA 4GD0A 4D71A 1P7TB 2GLKA 4Y90A 3HPZA 5DO8A 4QTGA 3GR4A 4W4QA 3ZLFA 4GRSA 3H4WA 1EJTC 4TQTA 1B3WA 1J0HA 3H7VA 1XDLA 2W61A 2GL5A 1RK6A 2RUSA 1Q65A 4C6DA 4JTRA 1EX1A 1W8SA 3UVIA 4JGDA 4WK9A 1H50A 1M1BA 5EU9A 1UJQA 3L67A 4JD4A 4HU3A 3TFCA 1E4IA 4G7EB 3QVQA 3CXOA 1EKOA 4EXQA 3VGFA 4L61A 2RHGA 4JCLA 3BUVA 5K4ZA 3FVDA 3CIWA 4O0KA 5JMUA 3F4VA 1MW2A 1M5WA 2J9XA 1I2RA 1UMLA 1XI3A 4S3KA 3LCHA 2YIHA 1XS2A 2ISFA 4GJJA 4WRHA 4NASA 3EX1A 4MMWA 1KXHA 4IQEA 1EGMA 2PTYA 5C8BB 2Z26A 2ZRZA 3L2MA 1XBZA 3H2FA 3GXPA 2Y8KA 4U2YA 2DUZA 3BAYA 3B03A 3ZWTA 4ZEPA 5M2FX 2O56A 5DY2A 7A3HA 1QRQA 2ZCGA 4MJZA 4PBFA 4L65A 2V5BA 3R94A 4QAWA 2VKZG 2XIBA 4JZ5A 4QDPA 1PTDA 1F05A 1GW9A 2IKGA 2ZC8A 1SR9A 3QN3A 5DMYA 1BF2A 2DEPA 2PDXA 2J25A 1OBAA 1WZKA 1Z32X 3OZYA 1HTIA 2Y7GA 1LQ0A 3HG3A 3DGBA 4IFKA 4HHPA 1J79A 3M7SA 1Q6GA 3VOGA 1L0PA 1OF8A 4N7QA 3TJ4A 4BF7A 2AL2B 1LJYA 3AXXA 1B3XA 3OPSA 1FY6A 2R1NA 4RV3A 2EPNA 3AIUA 4M6UA 3N14A 2XFWA 4MB1A 4S3BA 1F73A