4C1LA

Crystal structure of pyrococcus furiosus 3-deoxy-d-arabino- heptulosonate 7-phosphate synthase i181d interface mutant
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
262
structure length
262
Chain Sequence
MKYSKEYKEKTVVKINDVKFGEGFTIIAGPCSIESRDQIMKVAEFLAEVGIKVLRGGAFKPRTSPYSFQGYGEKALRWMREAADEYGLVTVTEVMDTRHVELVAKYSDILQIGARNSQNFELLKEVGKVENPVLLKRGMGNTIQELLYSAEYIMAQGNENVILCERGIRTFETATRFTLDDSAVPVVKELSHLPIIVDPSHPAGRRSLVIPLAKAAYAIGADGIMVEVHPEPEKALSDSQQQLTFDDFLQLLKELEALGWKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2-dehydro-3-deoxyphosphoheptonate aldolase
publication title Destabilization of the homotetrameric assembly of 3-deoxy-D-arabino-heptulosonate-7-phosphate synthase from the hyperthermophile Pyrococcus furiosus enhances enzymatic activity.
pubmed doi rcsb
source organism Pyrococcus furiosus
molecule tags Transferase
total genus 98
structure length 262
sequence length 262
chains with identical sequence B
ec nomenclature ec 2.5.1.54: 3-deoxy-7-phosphoheptulonate synthase.
pdb deposition date 2013-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00793 DAHP_synth_1 DAHP synthetase I family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4c1lA00
1HO4A 5CPMA 4UCGA 3W7RA 3TK7A 3CIWA 3NGJA 1KV8A 1H7PA 2OCZA 2B0MA 1XUUA 1QPRA 3O07A 1S5VA 4WX2A 1QFEA 5TIMA 2RDTA 3D0CA 4AHOA 5AFDA 1KFLA 3RFAA 1FWTA 3ATZA 3PBWA 2E6DA 2QCGA 4ML9A 4HNNA 4KWWA 4X3ZA 1KTNA 3LRKA 4N6EA 3G0XA 4IQLA 4Z1AA 1H7WA 3STEA 2ATSA 1IIHA 2NV2A 4HNVA 4XZ9A 1WOBA 3E12A 4ZZ9A 3DBPA 3MBDA 3NL3A 5F1VA 3W72A 4IOTA 3MJYA 3N14A 1QOPA 3UYCA 1Q6QA 2NUYA 1FCBA 3NR0A 1TCDA 2A6NA 3GAKA 5C2XA 1I2NA 5FEPA 3UPBA 3LHYA 1GEQA 4LS0A 1NF7A 2H90A 1FBAA 2VKZG 5EYWA 4JD4A 3EKZA 3IGXA 3QMRA 4O19A 1LBLA 1UJPA 1JQXA 2J9XA 1H63A 4O12A 1TTJA 4O15A 5FI8A 3MWAA 3VE9A 3BGGA 2VEMA 4O16A 5D2TA 2A21A 2TMDA 5K4XA 1JUEA 3F1QA 1WYIA 2NLIA 4A21A 5I3JA 3LV5A 4ORMA 3FA5A 5CPNA 2Z0IA 4M7TA 3LHVA 5BNKA 3WJYA 3O06A 1KW1A 4O1DA 3DHFA 5HWJA 4LC8A 4Z1BA 3O1NA 4Q32A 4JTJA 2H8ZA 1F74A 2VFHA 1X1ZA 3FFSA 3I68A 5AC7A 5LHEA 4UFMA 3DGRA 4PA8A 1OX6A 3TMLA 4KFOA 3KAOA 4LRTA 4JYEA 3N73A 1D3GA 4QQ3A 3SGUA 3SGZA 3MUXA 4RV8A 3IVUA 3S5OA 1YTEA 1RQEA 1WBJA 5F1UA 1FWNA 4O54A 1TV5A 1V7YA 1JRCA 3EXRA 3P5YA 1LDCA 1RVGA 4QAIA 1TPH1 1H7OA 4O0KA 3NQFA 4K36A 4JTEA 1KFBA 3O6YX 3UZ5A 1A50A 3KRSA 2V82A 4O52A 2PURA 1KA9F 4J9JA 1K7FA 2XN1A 4HPXA 3NL5A 4Y96A 4GUGA 3GK0A 3W7JA 2I9EA 5FF0A 1SW7A 3G8RA 2XFWA 4JTTA 2BLEA 3B06A 3DFNA 3GDLA 5CSRA 1TTIA 3U6WA 4A3UA 1AW5A 2J6XA 3DENA 2CLEA 4OWGA 5CZSA 3PF3A 4JEQA 1VGAA 1FWWA 2X1TA 3TUUA 2NXIA 5FEWA 3MP5A 1P1XA 4CQ9A 4FEZA 4O28A 5TBOA 2CLFA 4AF0B 2C14A 1G67A 2GVLA 5FF4A 1TYGA 1YDVA 4DF1A 4LT9A 4GE8A 1NSJA 4DO6A 2JK2A 4DF0A 1RZMA 1PV8A 4YCOA 2VXNA 1M7PA 2BWGA 4ADUA 5BOOA 2QCFA 2ZA1A 3Q37A 1HO1A 4NXKA 1FDZA 3HJZA 2OMAA 2OT0A 3TMQA 1TRIA 3CPRA 2VEPA 3F4WA 5D30A 2NX3A 3QQ0A 4RJEA 2FB3A 4BWLC 5J5DA 1TJPA 2A85A 2CLLA 4IPJA 1G69A 1XBXA 2QKFA 1B4EA 1GT8A 2QJGA 4QIUA 1GZGA 4PTNA 4RXFA 4NUWA 3HGJA 1THFD 2BTMA 3EX2A 4DEFA 4YWIA 1VZWA 1G6CA 3W7CA 2FPYA 3L21A 3TJXA 1OX5A 2VEKA 2YW3A 4JDYA 1EB3A 4NZFA 2NXHA 4O4VA 3NQGA 3SY5A 1W5NA 3DFTA 2FPTA 3GNNA 4JR5A 1J4EA 2J88A 3S5NA 3TQVA 3NQDA 1FXQA 3NQEA 5CG7A 1OX4B 1M5WA 2D73A 2CLHA 2QCDA 2V2HA 3IIOA 4TX9A 1PVNA 1ME7A 4O1BA 2CZFA 2OJPA 1ADOA 1J2WA 1YXDA 1O4UA 4JX5A 3NG3A 3PBVA 1T99A 1QWGA 4LVAA 2ZA2A 5IM51 5BMWA 1O60A 3TDFA 2GPTA 4TO8A 3M44A 5HULA 1SW0A 4JX6A 3S1UA 4YL2A 3ABRA 3I6RA 4UNKA 3FS2A 4JTSA 2BSLA 1TV7A 5D38A 2ZTJA 3C2VA 1V5XA 1TB3A 4LS2A 3GKFA 3STCA 3UXAA 1IXOA 1KM3A 3LBCA 2CZDA 3TAOA 3DHDA 3AJXA 2CWNA 2A7NA 5DXXA 2TRSA 3P80A 1AL7A 2WSRA 1ZALA 3S6DA 4PODA 3V1PA 2YXGA 3HGSA 4OQVA 5AHLA 3MYPA 2ZQ0A 3TU9A 2NZLA 1TPB1 2YYUA 4E2DA 1OFEA 3OG3A 2RHGA 2QCMA 4Q33A 1FX6A 4OBTA 4S1FA 1F6PA 1AL8A 2YR1A 3HO8A 3G1SA 2C0AA 1WOAA 1YPIA 2A0NA 5AYYA 2FTPA 3DKLA 1YDNA 3W85A 3QRHA 3L0GA 5DXYA 1VYSX 1B4KA 3DI1A 1ZAIA 4XKYB 3OEXA 5F2LA 4LVBA 4S2BA 2QCNA 2YW4A 3BLEA 4JNMA 2OX1A 2WNQA 3GVGA 4EIVA 3W7NA 4Z1CA 1B9BA 3W88A 3NPWA 2WV8A 3PUDA 1HL2A 3WJSA 3W2UA 2FB2A 1KBIA 2B7OA 2C19A 4MJZA 1B57A 5EPDA 5MHBA 4WY0F 2I1OA 5D09A 1I8JA 4FNQA 2C6QA 3GAYA 4NXSA 4X2RA 2E1DA 2E6AA 1F2JA 1S3HA 4WD0A 5D02A 5E1QA 5AOUA 3FIGA 2E6FA 3PS7A 4QNWA 1H1YA 3Q94A 1JQVA 2B7QA 3M47A 3L5MA 2PC4A 3GKAA 3G0SA 2P1FA 4U4MA 3L65A 3LB0A 4K7VA 1GVSA 1TREA 3TV8A 3NEVA 4O50A 3PSVA 4TMBA 3UWZA 5AHEA 3FKRA 4UTLA 3VI2A 5D33A 3FLUA 3B0UX 2NWRA 2HTMA 1SZEA 4NJHA 5T26A 1W3TA 1L6SA 2NXGA 3M6YA 1Z42A 4JICA 1EA0A 1W5QA 1H5YA 3EX4A 4XUGA 4UFIA 3W2LA 2RKXA 3QZEA 1QPOA 2C3ZA 3DFOA 4A2SA 1JCXA 3SIZA 1Q3NA 1H7NA 1YPFA 4HPJA 4PH6A 5KITA 3VNDA 4LUIA 3L5AA 4BWLA 4H3DA 4RK8A 1PS9A 1GTEA 3GB6A 5EL1A 2QAFA 2Z6IA 1WDWA 3B4UA 1NF0A 2HS8A 3CEPA 3P82A 4RKAA 2E5DA 1EIXA 3GR7A 3P8IA 3C61A 1MZHA 1TPFA 1TO3A 1D9EA 4IMEA 3HOJA 3IRDA 3BG5A 3G18A 3GDTA 3M5YA 4JXCA 5HNRA 1X7FA 1JULA 4HIBA 5LKYA 1TPC1 3NPVA 4UTMA 2GVJA 1E51A 3NQMA 2EPHA 2G95A 4N9CA 4AF0A 3PR2A 1GG1A 1TTPA 3O15A 5E0KA 1WBHA 1XBZA 4S2CA 3A24A 5E93A 4AHQA 1QO2A 1R47A 2B7PA 5K3VA 3LBMA 4UFHA 2C13A 3LHZA 4YLWA 3BVJA 3TJLA 2PCQA 4FX7A 4NX5A 3M5VA 2OZ0A 4JIQA 4O18A 1GG0A 3STFA 2IQTA 1OFBA 4NQ1A 4RZ4A 2A7RA 4CNPA 1K7XA 3O05A 5EY5A 3OIXA 1FQ0A 2FJKA 4JTFA 4UR8A 1VYPX 3W86A 4ALDA 1W5PA 4UIOA 2V8ZA 3QMSA 3WK3A 1DQXA 4A29A 3C3NA 1SR9A 1RQHA 4H4IA 1SPQA 1S5TA 3HPSA 2H6RA 5I3HA 1NEYA 1QO5A 1RQBA 4MVAA 4ZQMA 3QM3A 1GPWA 2EHHA 1R46A 3A5VA 3OVRA 3EWWA 2WOQA 4DO5A 2BZNA 1LP6A 2XN2A 1OX4A 4FIRA 3W70A 2GQ9A 3L68A 3TX9A 1ALDA 3HF3A 4LNYA 1BWKA 1SSDA 1U5JA 4FNUA 1ZCOA 3C2EA 1QDSA 4Z1DA 3EWUA 3TH6A 3W73A 1K02A 1Q6RA 2GJNA 4FX8A 5DY3A 4UTJA 3W1UA 1HUVA 3W23A 1W3NA 2W79A 3IVTA 3W1QA 3M41A 3LERA 3EX6A 4K6AA 3B8DA 3ZWSA 2ZZ5A 3QSRA 4WXYA 4MOZA 4OHQA 4R53A 1OFQA 3LTPA 4DBDA 4E38A 3B05A 2Y89A 2DZSA 4HN4A 3DXIA 1XKYA 1ZHAA 5C5YA 4Z08A 1FWSA 2ALDA 1ICPA 1I2QA 2VOMA 2QUVA 3LV6A 1BEUA 1ZAHA 4ZMGA 3G24A 3KVLA 1DOSA 1KTCA 3W7MA 2JBMA 3C2FA 3N2MA 5CZTA 1SQ7A 1GJPA 4GUFA 3NM1A 3IGSA 4OT7A 3EX3A 3W1TA 3KOFA 2QCCA 3P67A 1A5SA 3QPYA 2AQWA 2NWSA 3G1AA 4LU0A 5EMUA 3CC1A 1G4TA 2HSAA 3MI3A 1KV5A 1LYXA 5C54A 1VLIA 5K9CA 5DBUA 4LVFA 4XTDA 2R91A 2QF7A 3S42A 4BR1A 1SO5A 3LGEA 3NDOA 2DZXA 4CNNA 1MXSA 3DI0A 4GJ1A 5LNUA 3OA3A 4XKYA 2OT1A 3NQ6A 1TQXA 5EA9A 2NX1A 3NXFA 2HMCA 3EB2A 4UTTA 1KFCA 4K8EA 5D32A 2P10A 4FO4A 3M1ZA 2VFDA 3LCHA 1UUOA 2X2GA 5G2HA 2C1HA 2R8WA 4QJ1A 3P61A 5U7SA 4I7WA 1O95A 1KM6A 4LS1A 4IMDA 5G1TA 3S9YA 5AN7A 4M19A 5AYZA 4MKNA 5C55A 6TIMA 1MEWA 3W1AA 4BF9A 2NV1A 4JS3A 1TV8A 3IIZA 1PHWA 3LHUA 3CLMA 3WJWA 2H8XA 2JKEA 2LLEA 3QQ1A 1PCWA 2DJXA 4XWUA 1OF6A 2NUWA 2E6YA 3VFLA 2QJHA 3ABOA 4QITA 3LCLA 1QPQA 1Q6OA 5KZMA 1UASA 3NZ1A 4HNUA 3L66A 5AHFA 3NNTA 4MFDA 3C0JA 3FEMA 4AH7A 4Y8FA 3UPWA 3LHWA 3JRKA 1QPNA 3S1VA 3SZ8A 5TQLA 1OVDA 3MP4A 1ICQA 4ZQRA 3I7SA 4IWWA 4O4WA 1P0KA 1QAPA 2FFCA 2Z6JA 3BW4A 2E68A 2XN0A 3NYZA 4K37A 4UFJA 3PVFA 4FIQA 2WNNA 1A5CA 2QUUA 3E02A 4JY9A 3SR7A 4JTKA 3I7QA 1VR6A 4N2YA 4O57A 1W54A 1FWRA 3PBUA 3W9ZA 1G7VA 1TJRA 1P5BA 5U4NA 1HTIA 4CCDA 1UCWA 3BPWA 3NPXA 1P0NA 3CHVA 4LOCA 3SECA 1VHNA 4XBSA 4JY8A 3GX9A 4CNOA 4NJKA 1A53A 1OFDA 1A5BA 4UC5A 3LX9A 1JR1A 2ZRXA 1GYLA 1ML1A 4WQ6A 5LGZA 1R2RA 1FXPA 3TCEA 2WQPA 1AG1O 1O5XA 1XBYA 3UXDA 3W7QA 2JKPA 4E0CA 4MIMA 4AXKA 4I9AA 3W7HA 3N19B 3LTSA 3SW6A 5LNSA 1LZOA 1MO0A 4DPQA 4PL1A 3W1RA 5K4ZA 1NAL1 4MYAA 1UB3A 3OVPA 5HR6A 4UFKA 3KVKA 2UV8G 5FEZA 4TR9A 1LBMA 1GVQA 3RLUA 2GVGA 1SW3A 5CZJA 5ABTA 3GXTA 3A23A 2J27A 5D2WA 3F4NA 2Y7GA 5KMYA 1TPEA 3C52A 2ISSA 4X9SA 1SZGA 3NQAA 2YPIA 1H61A 3MO7A 4GFSA 4QNEA 2B4GA 4XQ6A 1RPXA 2H3DA 2YFOA 3QW3A 3CWNA 2A6LA 1Q45A 1TMHA 1PIIA 3KVMA 1DBTA 3N2XA 2HS6A 4JX4A 3AO0A 5EKYA 4DPPA 1EPXA 4HT3A 4DQWA 1H60A 4O0ZA 3F03K 4OV4A 5CPLA 3UD6A 3DH7A 1C29A 4JYDA 2J24A 4WXZA 1OHLA 2ZBTA 3PY2A 2ZRVA 3GIYA 4Z0JA 4FF7A 3W1NA 2E5CA 3NQVA 5G5IA 5FEXA 1TIMA 4FXSA 2ZRYA 4BI6A 3U2OA 1YLVA 3NL2A 4O10A 3S1WA 4PC8A 3OVQA 1ME8A 3KRZA 1YYAA 3THQA 4ORIA 1F7BA 2C16A 1TRDA 3NQCA 3TIMA 1OYAA 2Y85A 2O7SA 1OFOA 1VLWA 1AW2A 4AEOA 1IGSA 5CZ0A 1KFEA 3MI6A 3USBA 1W5MA 2WKJA 4M7SA 4XTIA 2QDGA 3LI1A 3G22A 3O16A 4OU1A 2Y61A 1QR7A 4LV4A 4UNLA 3C8FA 3ZS4A 3MHUA 2GOUA 5A5WA 1SO3A 4R7JA 3TXVA 3M16A 3LOTA 3TFXA 3OHIA 5SWUA 1IIGA 1BWLA 3GDMA 3TSBA 4ADSA 2ZRZA 3LXAA 4FXRA 1BKSA 4LV9A 1O94A 3U8GA 4OGZA 4TMCA 2Q8ZA 4LVGA 1ME9A 2J9ZA 1G7UA 5G1YA 2DZPA 1T0OA 3EEGA 2PRMA 1XM3A 1DV7A 3T40A 4OE7A 4UTWA 5KTLA 1YXCA 1QOQA 2ZCGA 1DQWA 2VFIA 1F73A 1FUYA 1SO4A 3E0IA 1IF2A 3BG3A 2QCLA 5DN1A 1EX5A 4FNTA 5I3GA 4RCXA 3UY7A 3WJZA 4E2BA 3DU0A 3W6YA 2F84A 1YXYA 3PBYA 1VS1A 4LY8A 4IX2A 4BK9A 3P74A 1JRBA 3ANYA 4Z0SA 3RF9A 1RD5A 1XL9A 1VH7A 4GUIA 3T44A 4K7YA 1JUKA 1IXQA 5CKSA 2GUUA 3TE9A 5J5RA 3C2RA 1J5TA 2CLKA 1LOSA 4MZ8A 1DHPA 1N7KA 1L9WA 4AB4A 3RLVA 4IJBA 1K8XA 4TU1A 3HMJG 1X1OA 4A22A 1FCQA 5HINA 1YDOA 3H55A 1LTDA 3IVSA 1K03A 3HG2A 4LW7A 1FCUA 4Y90A 3G1HA 3KX6A 3R8RA 4EOUA 1XFBA 4NU7A 4NVTA 3W74A 3FJLA 1KM4A 5BRBA 1A5AA 1DORA 4JTGA 4UTTC 3O6CA 1WAUA 3W1XA 2JGYA 1LORA 1QMLA 3GR8A 1FCVA 3SSJA 5HR7A 3W3OA 3LCFA 3LCWA 3S0CA 2G96A 2H3BA 3NQ7A 3L5LA 4MLRA 1IXNA 1PE1A 1Q6LA 3NA8A 4Y6GA 1VPXA 4MFEA 1KLZA 2WSQA 1KFJA 2JKAA 4RLIA 1TSIA 4B5NA 3ELFA 3KRUA 1H1ZA 5G4WA 5F4WA 3QF0A 5HUPA 4GBUA 3HG5A 4ZL1A 4DBEA 1OK6A 1OYCA 4FNRA 4FNPA 4I7UA 4O17A 4LRSA 4GUHA 3TFCA 1GVOA 2WSYA 4K8HA 4RXGA 3WK2A 3I65A 5L6UA 4EF9A 4K39A 2WO5A 5I3IA 2CLOA 5GVJA 1KM5A 4KKXA 3T7VA 2Q3RA 4ZQPA 3L0NA 3KHJA 5D05A 1HFBA 2DZVA 3S8HA 2YZRA 4O1AA 3S5YA 2FQIA 1RR2A 1H7XA 4IX0A 4FX6M 4NNCA 1F05A 3GYEA 3QJAA 1VJIA 5G2WA 1T8XA 3M0ZA 1PCKA 5HMSA 2V81A 3PSWA 2X30A 1XDMA 3M7WA 3EXTA 4M6PA 1OJXA 4FHAA 1ZAJA 3A5FA 3TXZA 1F6KA 2FLIA 4AWSA 5LNVA 3W2NA 4C1LA 4R33A 2ISWA 2WNZA 5L9FA 1L6WA 1W56A 5HJLA 2ZRUA 4H6KA 1JVNA 2QCEA 2C18A 2QEZA 1C9DA 1MEIA 3TQKA 5DCBA 3DZ1A 3VE7A 3TSMA 4GC4A 1F5ZA 1KM1A 4AWTA 3Q2DA 4N4PA 2EAWA 2CW6A 3NAVA 2ABAA 3MHFA 1KBJA 1VHCA 1XDLA 1JCJA 3LXCA 5HWMA 4M5PA 1OFAA 4M6VA 4MYXA 1I45A 2V0TA 3NVTA 1H62A 2Y7FA 1OABA 4FNSA 3UWWA 5AC8A 5KZEA 3T4CA 5AC6A 3LTYA 3O63A 3NQ8A 1MEHA 5G4EA 3W7PA 1OFPA 5D2XA 2V2DA 2ZA3A 4CQAA 2ZFAA 2QDHA 3W22A 1PL9A 3MP3A 2Y7EA 4MPQA 1JCNA 4QM1A 1WXJA 3GNDA 3SFKA 2CLMA 4X22A 3QPZA 2A7PA 4ONVA 4ZQCA 3W76A 4BI5A 5AHIA 2V30A 2ZZ6A 5AB3A 4RZ5A 4KFPA 2PE4A 3BLFA 2WPBA 1SZNA 3RU6A 2ISVA 3IEBA 1NVMA 3PULA 3W7IA 1X8FA 5K2ZA 4IGHA 4D2JA 1IXPA 5C6MA 4R34A 4HKPA 4QISA 1R2TA 3G1DA 4LUJA 5DCEA 1W5OA 4GRSA 5IBXA 4JTIA 3E9AA 3QW4B 1G4EA 3E49A 5LZLA 2CZ5A 4NX0A 3MHGA 5F2GA 2ZZ7A 1H50A 4CLMA 2VENA 2DZWA 1QNVA 1CX9A 3FKKA 3LCGA 1YTDA 2VFEA 2RDUA 3QSTA 3M43A 1R30A 3P60A 1KM0A 1YTKA 3UWQA 3EX1A 2BXVA 2VFGA 3BK0A 2ZZ1A 2A2IA 3NO5A 1LM1A 4K38A 3QEZA 3S1XA 1W37A 2YGYA 1ZENA 2GQAA 1EUAA 4P61A 4O14A 2RDWA 2NX9A 4JYFA 3SI9A 3W7GA 1F76A 4WJEA 1P4CA 8TIMA 1PHQA 4LVDA 4I7VA 2CLIA 4RR4A 2E5BA 3BW2A 5F2IA 1K8YA 2DORA 3TKFA 2DU2A 1VRDA 2O7QA 3L67A 2CZEA 5LSMA 1L2UA 3CIXA 3NPUA 4RX0A 1VC4A 1I2RA 3W7LA 1LRNA 2P0OA 3TR2A 1K8ZA 2ZDRA 3P81A 2BX7A 1LOQA 1KFKA 2YCEA 1N8FA 3HBLA 3G1VA 3NL6A 4O1CA 3RNDA 1W8SA 4GWEA 4UR7A 3O8AA 4UTWC 3INPA 5G2IA 2J9YA 3W2MA 3P62A 3A22A 3Q58A 5D2YA 3T55A 4EWND 3LI0A 3PC0A 3B0VC 3E96A 4HSNA 3FYOA 3GDRA 2DJLA 2WJZA 3WK1A 4CCEA 4NJGA 3LLFA 3EWBX 1KTBA 3IGUA 3WJXA 1K3UA 2YDAA 4ADTA 1LCOA 3TW7A 3T78A 1OF8A 3C56A 2VFFA 3R13A 1K7EA 1U83A 4MZYA 1EWDA 1OYBA 4ZVJA 4UTHA 3PB2A 1BTMA 4NJIA 1I4NA 1OG0A 1WV2A 2TPSA 1XC4A 3WK0A 1JCYA 1GOXA 1DJQA 3R12A 4JDBA 3CU2A 2TYSA 4PFMA 4O13A 1TPVA 3H54A 4UFLA 3L9CA 3EWXA 2ZYFA 2V5LA 3W2JA 3MBFA 1VCFA 1GQNA 2Y88A 5CSSA 4M6QA 5DBTA 2R94A 3BV4A 2ZZ4A 3HG3A 4NNAA 3ATYA 2EKCA 2QAPA 1FDYA 2Y6ZA 4PCFA 3TNOA 1ICSA 3NQ2A 3DFQA 1XI3A 1WQ5A 1EWEA 1LBFA 3A21A 3BGJA 4N9BA 4RZ6A 3TAKA 2R14A 3NM3A 3W1PA 4GNJA 1RV8A 4WY0B 1T96A 3PWAA 1ZFJA 2PRLA 3KXQA 3PB0A 3UWYA 2W6RA 3QYQA 3G3MA 2V2CA 4ZQNA 1W0MA 2VC6A 1TTQA 1GYNA 3QH2A 1EEPA 4NNBA 4Y9AA 3CTLA 5D2VA 3K30A 4MY1A 5DCDA 2FPVA 2X16A 3L0KA 3P8JA 5KINA 4L4LA 2PRHA 3BG9A 4NJJA 4W9TA 4XBKA 1VQTA 3LM7A 4IUOA 3UWVA 4HNTA 5LNRA 3HGOA 3MI2A 4TIMA 1JJKA 4UTKA 1W1ZA 4JTHA 3UY8A 5AYXA 3B04A 3W87A 3JS3A 2C15A 1I2PA 4UTIA 3PUEA 4POCA 3LXBA 4AWUA 5HQEA 4UTUA 3LRLA 2GJLA 2QCHA 2X1UA 4HHPA 3FJ6A 3THAA 1SUXA 5LNWA 1LROA 3EWZA 3G3DA 5BMXA 1H7RA 1TPWA 5F4SA 3RK8A 3UNDA 2I14A 3BW3A 3QFEA 3ZWTA 3C2OA 3W07A 1EUNA 3HPZA 4MUZA 3IIVA 1GVRA 3P84A 3LCIA 4DELA 5HWNA 5H91A 2DZUA 4O8RA 3G1XA 2A5HA 4A2RA 3HB9A 3PUOA 2FDSA 3W83A 3PG9A 3CEUA 3LCXA 4AHPA 4NT0A 7TIMA 3W7DA 3G0UA 4JGDA 2Y70A 5KZDA 1AW1A 1DVJA 5I3FA 3W7OA 5AHNA 5F2MA 2EGZA 4DF2A 3R89A 3TA6A 3DKJA 3EKLA 1ONRA 5D37A 4MY8A 6ALDA 4GXMA 3CWOX 3ZR4A 4CCCA 4AMAA 5LHFA 1N55A 1ZJIA 2G5WA 3QC3A 1D3HA 1JUBA 3CQ0A 5A8GA 3BLIA 4IPIA 2X1RA 1SFJA 3TW6A 1YADA 3GLCA 3NZRA 3STGA 1VYRA 4MLJA 3W84A 4BFAA 3N34A 3M9YA 5DLCA 4JTUA 4ICNA 3TROA 4ZQOA 3W2KA 2QR6A 2ATMA 4EVZA 2DZTA 3W75A 2YFNA 3EXSA 3HPXA 4MJMA 1XUZA 3CT7A 5FF7A 1OK4A 3B03A 1O5KA 3G8EA 5EBUA 2TSYA 2AGKA 4WOZA 4AAJA 1UUMA 2VEIA 2CU0A 4WZHA 2RH9A 3KFTA 3LLDA 4N9DA 4DO4A 4N4QA 4UMCA 2Y62A 3HG4A 3L2IA 2ZZ3A 4FB7A 1AK5A 1CI1A 1HG3A 3C4UA 3IIXA 1AMKA 4UMAA 5BW6A 3ZFHA 3C6CA 5IBXC 3MYOA 1R2SA 1WX0A 3G1YA 3TSDA 2QJIA 2G97A 5KSWA 3PG8A 4LWWA 2RFGA 1EP3A 4O53A 4EF8A 3IIPA 1H51A 1DKWA 4QSHA 5HUOA 1B3OA 4DXVA 5DY2A 1GTHA 3A9IA 3P5ZA 4JTLA 4JIPA 2Q8LA 4IMFA 3N3MA 1M6JA 1SZFA 2A4AA 2ABBA 2KZHA 4P2VA 1Y0EA 1FDJA 1Z41A 2AAMA 3QMTA 1L6YA 1W31A 3HQ1A 1X6UA 3TQ0A 1ZNNA 5CGQA 2ZTKA 4N9EA 3TC7A 1CW2A 3FOKA 1KLYA 3EWYA 1SO6A 4UUIA 5LGXA 3W7EA 3OBKA 2EF9A 2YSWA 5AHMA 4IXHA 1Z48A 1ZY9A 1LRQA 1EP2A 2Y63A 4C1KA 2ZRWA 3BARA 1SU5A 3NOEA 4MZ1A 4JN6A 4BI7A 1LOLA 4G1KA 1I2OA 5K7JA 3HIJA 3GXPA 3W71A 2VELA 2A1YA 1NFBA 2Z1BA 3DFPA 4MY9A 4N02A 4CQ8A 1DJNA 2NUXA 4WOQA 3W7KA 5D03A 2YYTA 4L4MA 3YPIA 3BO9A 3MW7A 2ZZ2A 2W0UA 3W1MA 1XXXA 3G1FA 2Y7DA 4Q4KA 1LRTA 3N9RA 2DP3A 3LRMA 3JR2A 3R5EA 2Q3OA 2V5BA 1C8VA 2E77A 4LTSA 4WY0A 4IMGA 1EP1A 3IV3A 4N6FA 3S5ZA 3LHTA 1GVFA 3FYPA 3M5XA 2YX0A 1XCFA 3CM4A 2Z2UA 3RMJA 1SFLA 1OFRA 3UQNA 1TPDA 3PM6A 3GXNA 1G4PA 3M5ZA 3B0PA 4LC6A 1TPUA 3LDVA 5K9DA 3DFSA 1UBSA 4IMCA 3MMTA 3VKJA 2B7NA 1LLZA 3HGRA 1G4SA 1TQJA 1VCGA 4YMZA 3WFAA 4WUIA 2QUTA 4UXDA 3I7RA 5D04C 1MSSA 4AVFA 1WA3A 3O6DA 5FESA 3VCRA 2JGQA 1Z44A 4KFNA 1GWJA 1XBVA 1VCVA 3CB8A 3R2GA 4KWVA 3DAQA 1SSGA 2QCDB 5FF2A 4YCPA 5FF3A 2X1SA 3W1LA 4UMBA 5K9XA 3UZJA 5CPOA 2GQ8A 2V9DA 1W3IA 5DELA 5F4XA 3UWUA 1JCLA 1QCWA 3KVJA 4YXGA 1S5WA 4OV9A 1M7OA 1DL3A 4PEKA 3SJ3A 1KM2A 3TC6A 4HSOA 3P7YA 3N9SA 3H53A 3V75A 2E09A 4NZJA 2CFFA 4PL2A 4O11A 3ABSA 2F7FA 5H2ZA 3ABQA 5I3KA 3PAJA 1JCMP 1FY6A 4IXXA 1LLWA 4U28A 2FIQA 4GUJA 3GZ3A 3GDKA
chains in the Genus database with same CATH superfamily
1HO4A 2NQHA 2CBJA 3PZQA 3RDKA 4D6CA 1XUUA 5ABGA 4WX2A 1QFEA 3HQOA 3AS0A 3WLMA 4AHOA 5AFDA 1KFLA 3RFAA 1FWTA 1TJ0A 1ITCA 4HNNA 4X3ZA 1JPIA 3B8IA 1UZ1A 4N6EA 3VTRA 2OXNA 5REQA 3TYEA 4W85A 2ATSA 4AYGA 2NV2A 4HNVA 3E12A 1V0NA 1ZBWA 4LNCA 1KCZA 5F1VA 4G5DA 2R9RA 3TR9A 4GY0A 2PDNA 3W72A 4IOTA 1UWRA 2OWWA 1E3ZA 1BGGA 2A6NA 3GAKA 4DWSD 1ZQ5A 5FIPA 4L1XA 3UW6A 4I3GA 2H90A 3VGBA 3IJDA 3PJTA 3EOSA 3N2BA 3Q65A 1XIHA 1TTJA 4HU4A 3MWAA 2GK1A 2OEKA 4Z42C 2VEMA 3KLKA 1X1NA 2VVSA 2WYSA 4KGLA 2QMJA 2DSVA 2POZA 2NLIA 3BUVA 2HK1A 1I1XA 4Z2IA 9XIAA 1V02E 1NQKA 4H7VA 5HWJA 4HJWA 5E0FA 2GWNA 2PGEA 4XO6A 1R3QA 5T8GA 5LHEA 4UFMA 1AZ1A 3TMLA 3KAOA 3N73A 1JFHA 5CEWA 4FXJA 1KD0A 2GJPA 3CV7A 1XS2A 2WQDA 4QTGA 3RX3A 3N6JA 3P5YA 4QJ3B 1XD0A 2DDXA 3BURA 3WQDA 4BF5A 4QAIA 4MNKA 3MMWA 3AMCA 3O6YX 4HBKA 3UZ5A 3KRSA 1TELA 1KA9F 2QUNA 3KOXA 1H5VA 3AOFA 3W7JA 3GK0A 4W88A 4MAVA 3NIYA 1RUSA 1PZ2A 3ABXA 5FF0A 3G8RA 3B06A 2J62A 4Y9PA 4F40A 2PWFA 5CSRA 2WBGA 3DENA 3IAQA 5CZSA 2PDUA 4JEQA 3WEMA 2HRWA 1FWHC 1EOMA 4HZ7A 5FEWA 2QNEA 4FEZA 1RY8A 2H9AA 4PB5A 1UHVA 4AF0B 4YVVA 3RJYA 1QNQA 4GE8A 1NSJA 4DF0A 1RZMA 3QZAA 4ADUA 5BOOA 5I02A 3Q37A 3S6OA 5FJJA 1FDZA 1KGXA 3KZPA 3A3HA 5CSUA 3K8LA 1P7TB 5D30A 3WD3A 3WSUA 4RJEA 5BWAA 4WSKA 2PMQA 3MUY1 2WCGA 3VGDA 1DEDA 3KBVA 2BTMA 3MANA 3MVTA 4DEFA 3QKEA 3UR5A 1XD1A 3HURA 3PNUA 2F61A 1WAWA 1EB3A 6TAAA 2VGGA 4MUPA 4UTFA 3GNNA 1ZL1A 3SCOA 2ANUA 2J7GA 1J4EA 3TN4A 3TQVA 1FXQA 3NQEA 2PCEA 1UMLA 4KEUA 1XGDA 2D73A 4M8UA 2CLHA 3U4FA 4HP5A 4KERA 3OP2A 1ME7A 3LLXA 2VO5A 4O1BA 4Q7NA 4AZBA 1J2WA 1O4UA 4JX5A 4AD3A 2ISDA 2ZA2A 4XD4A 1O5QA 2GPTA 4TO8A 1SW0A 4JX6A 1MWOA 3I6RA 4UNKA 5I6SA 4CN6A 2BSLA 4RDYA 4S3AA 2YL5A 5D38A 4QE5A 4GA8A 3SDOA 3OU8A 3LBCA 3DHDA 4MDPA 1RP9A 2CWNA 5HATA 1J0JA 2DZAA 4DM2A 3IK2A 4AX7A 2QPUA 2YXGA 4MTVA 3HGSA 4RW5A 5AHLA 2EPKX 2BGQA 2NZLA 3OG3A 1C7SA 1Q6FA 2QCMA 4W7VA 4LEFA 1FWBC 1PPIA 2ZVRA 3WNLA 4S1FA 4DLMA 3AHXA 4Y7EA 3K4AA 4E5TA 3VX0A 2C0AA 4QCFA 3MY9A 5FAGA 5CJ5A 2A0NA 2Y8VA 1UP0A 3L0GA 2HNHA 4ZR8A 3KS5A 4LVBA 4S2BA 3BLEA 3D3FA 3WEOA 3W7NA 3PUDA 5LIUX 4DJEC 3W2UA 2FB2A 4P8UA 3L4ZA 4B4FA 3N2CA 5JH2A 1B57A 4H7ZA 2DFAA 3AROA 1CDGA 3QZ6A 2I1OA 5D09A 2QMKA 3GAYA 4FOUA 4NXSA 5I07A 1FH7A 1X6NA 1V3JA 4GOAA 1S3HA 1TKKA 4NILA 3PS7A 1QNOA 3KM8A 4GPNA 3O6AA 1IT0A 4F4RA 2F8QA 1UKSA 1GVSA 1TREA 2O92A 3PSVA 3V16A 1REQB 1GQIA 4ZGYA 3KOZA 3FKRA 3VI2A 3FLUA 2OQYA 4J3VA 5C9ZA 3R6IA 4NJHA 2CNCA 2VX6A 4IPLA 3M6YA 4D8AA 3RRXA 3VXGA 1W5QA 3UEQA 3EA3A 4P7LA 1JYNA 2VZTA 1ITXA 3OZYA 4I5RA 4WCJA 2C3ZA 2V68A 3TN5A 4LSBA 1JCXA 3SIZA 2ACQA 1X38A 3UPMA 2BOFX 1YPFA 1R9ZA 1ZZMA 4LUIA 3AXIA 1GTEA 5EL1A 1KCLA 2Z6IA 5I79A 3QGVA 3B4UA 1GJWA 4XD3A 1UPMB 2QUMA 1EIXA 1E0VA 3C61A 2J47A 3UERA 3LMYA 1WO2A 5HPCA 1TPFA 3H2AA 2YA0A 2VGIA 3HOJA 3RIKA 3IRDA 4FLSA 3GDTA 2QVHA 1SMDA 5HNRA 3NUKA 4HIBA 3ITCA 4WJXA 3NQMA 2PDCA 2EPHA 3R25A 3U2CA 4AF0A 4W7WA 2FTYA 3A24A 4TX6A 4AHQA 2XYLA 2B31A 1R47A 5K3VA 2E25A 4YLWA 3VILA 4JFWA 4NX5A 3VIJA 3M5VA 4F9JA 2OZ0A 3VIOA 3KL5A 4TV6A 5D9PA 4D9PA 1P7TA 2CXEA 4PMNA 4NQ1A 4LF1A 3UT0A 3O05A 1R9XA 1GJUA 2X7VA 1FQ0A 3DYPA 5FJTA 1TE6A 3VOFA 3VKCA 2DT0A 2CWXA 2V8ZA 3IJ7A 2KAUC 3C3NA 3NSNA 4OJYA 5H6HA 4H4IA 1UP2A 1WKDA 1S5TA 3HPSA 2H6RA 4JFUA 3WLIA 1RQBA 4MVAA 3QM3A 5I0DA 2EHHA 3DEQA 5FL1A 3OVRA 2WOQA 1LP6A 2F6KA 3L68A 1U5JA 3EOOA 4NRSA 2OWCA 1ZCOA 1FH8A 4DIAA 1QDSA 5CC6A 2FJUB 3W73A 2GJNA 4FX8A 3W23A 4H8UA 3S2JA 1W3NA 3BDKA 2UY4A 1U1JA 2W79A 1EH9A 5HAOA 3B8DA 3R10A 2VGBA 4MOZA 2SFPA 2W61A 1OFQA 2TAAA 4C6FA 4E38A 3B05A 3ARYA 4M6UA 1ZHAA 1FWSA 3T42A 1BEUA 2PWEA 3KVLA 3N15A 5CZTA 4DXKA 4GUFA 3NM1A 4OT7A 1KXHA 2AQWA 3F4CA 3CC1A 4B9YA 1V6WA 2EPLX 1DWJM 1MYRA 1C92A 3RO8A 1LYXA 5C54A 1VLIA 3W29A 3ZQ9A 3FYYA 4L64A 1YDYA 2QF7A 1Q8AA 4AUBA 3AIEA 4C6QA 3WDHA 1O7AA 2PODA 2DZXA 3GYCA 1MXSA 4K3ZA 3SRHA 1PWLA 4RNHA 2DH3A 3DI0A 1TMQA 2J7HA 2NX1A 1ZB5A 3NXFA 3CHEA 4CU8A 3MT1A 1TWWA 1TIWA 4GGBA 3W81A 3WQOA 3RJXA 4G56A 1BTCA 2P10A 3C2YA 3MUIA 2E3ZA 3H12A 1UUOA 3WG6A 4HMNA 3T0BA 2GQ3A 4YVPA 4GZJA 1R86A 4E8DA 3S9YA 3OIHA 2V6AA 2G4JA 4GX8A 4BF9A 4JS3A 3CLMA 1REQA 3WJWA 3DFHA 3H26A 1OF6A 2ZICA 3NJ3A 3AZSA 1YE4A 1EC9A 4QITA 3LCLA 2Q09A 2D0GA 4F3HA 3VOGA 1YHTA 3NZ1A 3KWSA 3TN6A 5AHFA 2I57A 4A05A 3NNTA 2QULA 4AH7A 3ES7A 4Y8FA 3LHWA 3RLHA 1QPNA 3MSGA 1DJZA 2FFIA 1V77A 4MB5A 3POCA 4ZQRA 4IWWA 1P0KA 1QAPA 1MNSA 3W4RA 1N8WA 2R1NA 4MF4A 4K37A 2WNNA 2V38A 1X8CA 1X7IA 3ARUA 2E8ZA 3SR7A 2Q6ZA 1NWUA 3VZZA 4JTKA 3VIKA 5GQBA 4N2YA 1W54A 3PBUA 1P5BA 3RAOA 2HQAA 3S2NA 4ZA0A 4NHVA 3GXMA 4C91A 3NPXA 1WKYA 2HROA 1XQKA 3FDKA 4LOCA 1VHNA 4XBSA 3WDPP 1G94A 1MDRA 3GX9A 3WLKX 1A53A 1OFDA 1A5BA 1JR1A 4WR3A 1GYLA 4YHEA 4LH8A 1G5AA 4KESA 3SCNA 1AG1O 5DEZA 3E74A 4E0CA 1BLIA 4W87A 3RM9A 4ECLA 1FHDA 4YPJA 4AXKA 3SW6A 3AHYA 2D69A 5LNSA 2IKHA 4DPQA 5K4ZA 5IFTA 5HR6A 5FEZA 2J7EA 1ODUA 3KHDA 3VGFA 4GIAA 1M7XA 1ODZA 1XLKA 5ABTA 4RDZA 3A23A 4Q8NA 1BYAA 5D2WA 2XTKA 3F4NA 2Y7GA 1Z8AA 3OODA 2ZIDA 3EA2A 3O7UA 5BRPA 4WHBA 4IIDA 1H61A 2ZXAA 5HPOA 2ZX6A 3OVGA 5I78A 3CPGA 2A6LA 1TMHA 1Z32X 1PIIA 4WIWA 3KVMA 5CBJA 1R3RA 4YIWA 1DBTA 3N2XA 2O0TA 3QR0A 3T0CA 1EDGA 3N18A 3F03K 4OV4A 3RPDA 2X7WA 3CUFA 4WXZA 3I6TA 8RUCA 3HTWA 1YRRA 3PY2A 4ZENA 3GIYA 3W1NA 4AZ5A 4OECA 5FEXA 1TIMA 2XH0A 4KCUA 4AC1X 3NL2A 4O10A 1P1MA 2WXDM 3MKKA 4QHRA 1QW9A 3THQA 4ORIA 3M46A 3NQCA 1OYAA 4C60A 2O7SA 4HU0A 4PUUA 1XRTA 1HGWA 4QG9A 3WBWA 2WWCA 5CZ0A 3E3HA 4HTYA 1KFEA 3V36A 4M7SA 4XTIA 1FHUA 3G22A 3OG2A 4NASA 4GQRA 1QR7A 2ALRA 2X0YA 1DJXA 3C8FA 2EG7A 3MMUA 1QU4A 3FA4A 4J2PA 3WLPA 3GDMA 1XPYA 2ZRZA 3LXAA 4HU3A 3TTYA 4CQCA 3KTCA 4PMVA 3R7MA 4LV9A 3U8GA 3WNMA 2ZC8A 4TV5A 4AY1A 1UR1A 2OVLA 2BMBA 2J9ZA 1G7UA 3ISIX 1GPFA 3P14A 4GCXA 2DZPA 3EEGA 1KBLA 3PWGA 2ZCGA 1DQWA 3KBJA 3URAA 2VFIA 1J6OA 3RG6A 1IF2A 5FSEC 2QCLA 1RA5A 4F0SA 2PA6A 1MXGA 1EX5A 1RBLA 1G01A 3UY7A 3SM0A 3WJZA 4E2BA 2EPNA 1JDDA 5A8NA 4BZYA 2XIJA 4LY8A 2ZUTA 5D9OA 3MV11 1EZ2A 2HVNA 4E8CA 1O1HA 4JKKA 3SRDA 1YQ2A 1US2A 2ZWZA 2CETA 1RD5A 5ABFB 2WKLA 2FTWA 3CAQA 3WH5A 5E9XA 5A8OA 5J5RA 2W66A 2XPKA 1J5TA 2BVYA 4MZ8A 1DHPA 3AXHA 4AB4A 3RLVA 4IJBA 1M53A 5I5RA 5HINA 3KLLA 1YDOA 2PWDA 3H55A 4LYRA 1OSEA 2BS9A 3R8RA 4AZIA 2PD9A 1XFBA 4NU7A 3PZTA 3MDWA 3H24A 4EP8C 1JGMA 2JGYA 1LORA 2ZUSA 4JIIX 1FWFC 3NWRA 5AZ0A 4EAMA 4HYWA 2VHLA 2H3BA 3MS8A 4MLRA 1IXNA 2UWFA 1Q6LA 3VNLA 3VD7A 1E15A 1VPXA 1A3WA 1SJDA 4DX3A 2WZEA 1KFJA 4GH1A 4PN2A 1XDJA 4RLIA 4B5NA 3ELFA 3KRUA 1MUWA 1FTXA 3BOXA 3RO6A 3L23A 4J2MA 5M17A 5F4WA 5HUPA 2Z2AA 1OK6A 1JAKA 4AYSA 3TWBA 3GNRA 4IGNA 3TFCA 1UH2A 3ZYZA 3H2OA 3I65A 2X0SA 1BF2A 1EA9C 2EBNA 3R8HA 1QNRA 2CLOA 4QLJA 5I77A 3FJNA 1KM5A 3T7VA 4F2TA 3PZUA 1KBBA 2VNCA 1VJZA 2XIBA 4HA1A 3JU2A 4XVDA 4MSSA 3S8HA 2PWVA 4AISA 3PPGA 1UOKA 1E9YB 3XISA 1PBGA 2OYLA 4IX0A 4Q8TA 2C7FA 3SRKA 4DYKA 4GVFA 8XIMA 3U9IA 4NNCA 2ONEA 1EZWA 3WX7A 4S39A 1UZ4A 1R3TA 4RZBA 3M0ZA 4MWAB 1PCKA 2VZOA 3PSWA 2X30A 1XDMA 3W25A 1BD0A 2BXYA 2DUZA 3SIMA 3U5YA 3LUTA 1WDSA 2WC7A 4IQDA 5BOFA 7XIMA 4S3CA 2ISWA 1L6WA 1D2KA 1W56A 1H49A 4D1IA 2DZBA 1LF1A 3AFBA 3H4WA 2ZRUA 1JVNA 2QCEA 3ARPA 3VNYA 3MSRA 3VGHA 1MEIA 2IPWA 3TQKA 1XH1A 1E6RA 3TSMA 3N11A 2OZ8A 3CAVA 4AWTA 4IP7A 1H2JA 4HB7A 2WWDA 2J13A 2GOKA 2F2HA 3MHFA 2TODA 1Y5VA 1XFCA 1W9UA 3LXCA 2CLPA 4DN1A 4M5PA 5BXTA 2Z1WA 1E4MM 2JIEA 3M07A 4MYXA 1OABA 3T4CA 2OO6A 1MEHA 5D2XA 4FP1A 3VZYA 2PBGA 3MP3A 2Y7EA 1WXJA 4HYVA 4ZQCA 2QIIA 5AHIA 2V30A 3KCOA 4Q8OA 4IL2A 1MW0A 1OGBA 4NYYA 2QJMA 2W27A 4QROA 2GGHA 3R0DA 3SCUA 2ISVA 1TZ9A 2WMFA 2XIIA 1K6WA 2V5CA 3W7IA 4U5KA 4JHOA 1JL8A 1RJQA 4GABA 2XZ9A 4HKPA 2NLYA 3CS2A 1R2TA 3U4AA 3GNPA 3LPGA 4AC7C 5AVHA 4JTIA 3CZGA 5LZLA 2CZ5A 2Z1XA 1O12A 5F2GA 1XYBA 3GHUA 1QNVA 3FN9A 2FKPA 2RDXA 2YDQA 1GOQA 1R30A 1KM0A 6XIMA 3OLDA 3UWQA 1M41A 2D1ZA 3K8KA 5EMLA 2JF6A 2WMGA 4C65A 1EUAA 4P61A 3A3WA 3N6HA 2RDWA 3CL7A 1R87A 3RGTA 3W7GA 5A6JA 1HVXA 4GXPA 4LVDA 2BBFA 1K8YA 2DORA 2O7QA 1K1DA 2CZEA 1L2UA 3CIXA 4GKTA 1VC4A 1WKEA 2P0OA 1K8ZA 1RPKA 5ABFA 1PZ0A 4A8RA 2BX7A 1SGJA 4KWUA 3U2EA 2YCKX 1GOOA 3RNDA 1B3XA 1BVZA 1CECA 1W8SA 4GWEA 4UR7A 3O8AA 5G2IA 2J9YA 3W2MA 3P62A 3A22A 1OWQA 3ANVA 4F0LA 4KS0A 1TV3A 2D0HA 4CCEA 4NJGA 3LLFA 1KTBA 5A6BD 1M9HA 5FSDC 1EGVA 3T07A 2PDQA 3I3EA 1GYMA 4TTGA 2FGZA 3SUTA 1WUFA 1NWTA 1Z3NA 4ZVJA 2E28A 1JD9A 4UTHA 3HU7A 2E7FA 5CGTA 1WV2A 1AQHA 3AUJA 4BJHA 3TQPA 2CKRA 1WZMA 3L9CA 1HJVA 3W2JA 1NU5A 2VTFA 1GQNA 4DJDD 4LF2A 4ATWA 1C8YA 5CJMA 3BCDA 4J1OA 3PZNA 4IT1A 3AYSA 3WN6A 2EKCA 4H83A 1FDYA 1D7KA 3NQ2A 2OEMA 4P7RA 1LBFA 3A21A 2VT0A 3BGJA 3DIPA 4N9BA 3ME3A 4V27A 4HOZA 3DC0A 4RZ6A 2RAGA 1LL4A 4A3HA 4GNJA 3GXIA 4IGSA 4WY0B 3TNBA 4ATDA 2J25A 3S1GA 2PRLA 3PB0A 3QYQA 2V2CA 4UNIA 4MWAA 2VC6A 4DBSA 3H21A 1VJSA 2C91A 1CGYA 3AAMA 4L4LA 2PRHA 3BG9A 2P0IA 4W9TA 4XBKA 4NAEB 5FCZA 4IM4A 2VC7A 1KFWA 2GGGA 3HGOA 4TIMA 2QW5A 1UR2A 4F48A 1J0ZA 1XYCA 1PKMA 4UTIA 4POCA 3LXBA 3V4BA 2QCHA 1JF6A 3TYUA 1F3WA 1EF3A 3EWZA 5BMXA 1H7RA 5F4SA 3RK8A 3BJSA 9RUBA 4E4PA 4XZHA 3W07A 4N7QA 1GVRA 1S2UA 1TR1A 2WMIB 2UZ9A 3TYCA 2NVCA 3G1XA 2J8FA 4A2RA 3B9AA 4HPGA 4XVEA 1AMYA 1PWMA 7TIMA 3G0UA 4JGDA 2Y70A 2PTZA 5KZDA 4B16A 3HJEA 3K2GA 5D9NA 3W7OA 5DMLA 5F2MA 3EA1A 3R89A 3EKLA 1POJA 6ALDA 2OX4A 4CCCA 1P6WA 1PTAA 3TTEA 1JUBA 2GFTA 4IPIA 3S5SA 4Y9MA 4MWAE 1SFSA 1VYRA 3STGA 4C6OA 3WIJA 3N34A 3WQCA 5DLCA 4DJFC 1J96A 4BQ3A 3DUGA 1J0YA 4ICNA 3CXOA 1OADA 4EVZA 2DZTA 3QYSA 5HMEA 2C71A 3WQPA 1JGIA 3Q4DA 4F0RA 1O5KA 2AGKA 2IPJA 1UWQA 2VUYA 4Z2KA 4WZHA 4WDTA 3KFTA 3LLDA 3AI0A 4UMCA 1QI4A 1F61A 1AK5A 1HG3A 1EC7A 4JKLA 3IIXA 1AMKA 2NQ5A 4BQ5A 1R2SA 3G1YA 1VENA 3AIWA 2QJIA 5KSWA 3L4WA 1ZU8A 4O53A 4EF8A 1UYQA 3H4XA 1DKWA 2WANA 3SUUA 3PFMA 2WC4A 4TQTA 5HUOA 1UQZA 1S3TC 4QR6A 3OLIA 3ITOA 4H9MA 1XYLA 3P5ZA 4IMFA 3N3MA 2INEA 3UG4A 2BHUA 1HKKA 4P2VA 1UP3A 4ENLA 2J8TA 3QMTA 1L6YA 1W31A 1X6UA 2CHOA 1X39A 2ADAA 5AECA 5CGQA 2PEVA 1H1NA 3AC0A 4N9EA 3VKAA 1XYMA 4ZODA 5I24A 3A4WA 5LGXA 1O6IA 2PF0A 3ALGA 4ML4A 1EP2A 2ZRWA 3UZXA 4D6HA 1JZ2A 4QRNA 1EGZA 4MZ1A 5LIKX 4JN6A 4BI7A 3E1F1 1RSCA 5AYBA 3OLEA 4MY9A 2Z1BA 1BF6A 4CQ8A 4D8ZA 4WOQA 2YYTA 3W1MA 1ZJAA 1XXXA 2EG6A 1JI1A 3G1FA 1OD8A 4OOUA 3BAJA 1QASA 3HM7A 4CQDA 4EK7A 4IPNB 2E77A 1XSJA 3RPMA 3RU8X 4LTSA 4WY0A 1EP1A 5HJXA 4N6FA 3LHTA 1GVFA 3WFLA 3CM4A 3A4XA 3BMXA 3R58A 2A3AA 2MANA 4LC6A 1WZLA 3LDVA 3MMTA 3URBA 2WZMA 2B7NA 7REQB 4HK6A 2CHNA 1TQJA 2QDDA 4UXDA 3I7RA 1MSSA 2D0FA 1WA3A 4G7FA 4NAEA 3O6DA 5FESA 1YE6A 1Z44A 1GWJA 1VCVA 3BLOA 3CB8A 4L80A 3VM7A 3VIHA 2QCDB 1CGVA 5FF3A 4U3CA 4MKVA 5K9XA 3UGVA 5A6SA 2V9DA 1DJWA 1IR1A 1W3IA 5DELA 3HFTA 4S3GA 3KVJA 3SY1A 1NP0A 4GO9A 4PEKA 4KWSA 4HSOA 1JD7A 3A6OA 1KGWA 2F9RA 3V75A 3EMQA 5A8QA 1IQ8A 2CFFA 4MG4A 3UZYA 1UA7A 2YB4A 3ABQA 2PTXA 3BGAA 3R0UA 1EWEA 3BLDA 4UCGA 5RUBA 3A3XA 4PUMA 3TK7A 3CIWA 4B9ZA 2QS8A 3NGJA 3VMNA 2WBKA 1H7PA 2B0MA 3CQJA 3R8GA 1TCMA 3PBWA 4KWWA 1FWEC 4NZ1A 3G0XA 4IQLA 3V5OA 1F07A 1H7WA 1BG4A 5IHRA 3STEA 1B0IA 1MW1A 3SCVA 4PMYA 3W00A 3LZ3A 3DBPA 2CESA 3NL3A 4E8GA 5E5CA 2GYIA 3XIMA 1PZ3A 1M04A 3N14A 3UYCA 1Q6QA 2NUYA 1FCBA 3CYJA 3NR0A 3OW1A 3CO8A 3HPAA 4GIRA 1GEQA 4LS0A 4KEMA 1NF7A 3H7RA 5T91A 4JD4A 3EKZA 1NP2A 3IGXA 1XX1A 2XISA 4MB4A 3CQHA 5FI8A 1RAKA 1SM9A 3BGGA 3UXKA 2QVNA 5CBBA 4MJ2A 5K4XA 3PZVA 3WMLA 5CLTA 4QLLA 1XKJA 3VOCA 4WF7A 3WL1A 3IUDA 1EPVA 4U2YA 5I3JA 1Q13A 3VDHA 3VNIA 1UWSA 2VMFA 4ILSA 2Z0IA 2FZDA 3WJYA 4FI4A 2C1GA 3DHUA 1JIBA 1GHRA 1E4LA 1KW1A 4O1DA 1V6TA 3DHFA 3O1NA 2ZADA 3LS9A 4XZWA 5CCZA 2P88A 3GG7A 1RJPA 1F74A 1CXIA 1WB0A 1MRAA 4LRTA 4PCPA 1D3GA 5CG0A 1CENA 3I4KA 3SGUA 3MUXA 1CTNA 4RV8A 1W9BM 1CIUA 2BXZA 3S5OA 1YTEA 1RQEA 1FWNA 1J9YA 4O54A 1UR0A 1TV5A 3USZA 1U1UA 3SURA 3HMCA 1RVGA 1TPH1 3KBSA 1NWSA 3OZOA 4HOXA 3NQFA 1EQCA 3ECQA 1KFBA 3ARSA 2V82A 1E9IA 3T2OA 4DAIA 4Y96A 2I9EA 5FL0A 2CYGA 1XCWA 3GDLA 2FH8A 1IE7C 2DW7A 3WENA 1TTIA 4A3UA 1ZS2A 1POKA 1AW5A 2J6XA 4OWGA 3PF3A 3ZSSA 1EYEA 4PTWA 2NXIA 2GGJA 1S2VA 3MP5A 1MQPA 1P1XA 4CQ9A 3G5EA 4O28A 5TBOA 1FWAC 2GUYA 1RD6A 1TYGA 2OSYA 4HU8A 4RE0A 5AKQA 1PV8A 2VXNA 1M7PA 1NDYA 4Z2HA 2D3LA 4BEUA 4YU1A 2OMAA 3TA9A 1HIZA 2EJAA 3V7PA 3CPRA 1ECQA 1A4MA 2VEPA 1X97A 3CAKA 3E5BA 1S5MA 4XZIA 2FB3A 3H2FA 2A85A 2CLLA 3VCCA 1GZGA 4PTNA 1Q6GA 4RXFA 1G6CA 3BAYA 4FOJA 4P7QA 1L8PA 3CMJA 1R38A 3V5CA 1W5NA 2D2OA 7REQA 2QJJA 4AEFA 4PUWA 5HOSA 2G4FA 2J88A 4AY7A 1XHGA 2YZ5A 2UY2A 1E6SM 5A94A 5JIWA 3DBNA 1ZBKA 2QCDA 3IIOA 1PVNA 1RK5A 3IJIA 1NFGA 1HJUA 4MJ4A 5FJOA 1ADOA 3IPWA 3NG3A 3PBVA 1T99A 3VGGA 4Q8MA 5CGMA 4UQBA 3TDFA 5HULA 2C79A 1BKHA 3ABRA 3A9BA 3E0WA 4MADA 1TV7A 2BGNE 2QDEA 4GZIA 3WFZA 3N04A 2ZTJA 3VYLA 3C2VA 3U7BA 3GKFA 3STCA 1S46A 5IDIA 1IXOA 4MB3A 3TAOA 3PZMA 3CHCA 4L6DA 1NJJA 3SN0A 1X96A 2J74A 4U5IA 1AL7A 1EXBA 2WSRA 4DVOA 3V1PA 4C6DA 4ZO7A 1OD0A 3WBYA 4PBEA 2YYUA 1KQYA 4E2DA 3BSMA 4IQEA 2RHGA 2Z7KA 4Q8WA 1VB9A 2RGLA 1VKFA 4R7OA 2VZSA 4OBTA 5AY7A 4NAFB 1NDWA 6CGTA 3HO8A 2WB5A 2PGFA 5AYYA 2FTPA 2P5NA 3DKLA 4CU6A 1YDNA 4O1EA 5DXYA 1B4KA 3DI1A 2VCAA 4XKYB 3OEXA 5F2LA 1U1HA 1A5OC 2YW4A 1CLVA 4L56A 3ERPA 2EXOA 3NPWA 1OM0A 3RN6A 3WJSA 4H00A 2IPFA 4DUXA 3DESA 3FGCB 2C19A 3GC2A 2C6QA 1C93A 4GBDA 4X2RA 4EPEC 4WD0A 5D02A 4NL1A 3OYXA 1BYDA 3KOWA 3LSCA 1JXJA 3EDJA 1UZHA 2A79A 3Q94A 2PC4A 2ZXDA 3GKAA 3G0SA 1YBQB 3LB0A 2Y2WA 4KRZA 3LMZA 3NEVA 4TMBA 2VRQA 3W28A 4LB4A 5T26A 1W3TA 1L6SA 3RLGA 2NXGA 1Z42A 3ZJ6A 4JICA 1EA0A 1DTNA 5EMJA 2BY3A 3W2LA 3BQ5A 2NQZA 2DSUA 3QZEA 1J11A 4IJCA 4A2SA 3S9ZA 7A3HA 3AJ7A 1Q3NA 4HPJA 5KITA 3FHQA 3TLQA 3GHRA 4J35A 1HKIA 2QGYA 1D7FA 2AGTA 1EJXC 4QEHA 1NF0A 2WMHA 3CEPA 4ICCX 2E5DA 1LL7A 2J7BA 1DE5A 3PUGA 1D9EA 3BE7A 1W91A 3ITVA 4I5UA 3G18A 4JXCA 1X7FA 1S2TA 1E43A 3VD4A 3QHOA 3VDGA 3GVQA 1TTPA 3O15A 5E0KA 1WBHA 2QZRA 1GGOA 3M0XA 1H0GA 4ZO8A 3LBMA 4B5UA 3NZQA 3TTSA 3BVJA 2PGWA 2PCQA 4L6OA 5H8UA 1A5LC 2Q01A 1GW9A 5HNUA 1VFSA 1GG0A 2ZUVA 4Q6XA 3FSUA 3H2MA 3VD5A 2GSJA 4WKAA 4CNPA 5I03A 1S2WA 4GJIA 1KWGA 4QEEA 3VDCA 5EY5A 3QGKC 4KEZA 1E6ZA 3CT2A 1CXLA 2FJKA 1VYPX 3CZKA 4GNVA 4IL0A 4ALDA 4UIOA 4A29A 4P8VA 3B8VA 1SR9A 1VPYA 3IJ8A 3QQWA 1GONA 5EMKA 3PJWA 3AU2A 3VABA 4ZQMA 1IGWA 1Z9AA 3CH0A 1R46A 3VK5A 3A5VA 4GVIA 4DO5A 2BZNA 2XVLA 5GNYA 3QPEA 3W70A 1W1TA 1UJQA 2GQ9A 3HF3A 2YIHA 4LNYA 4EXAA 4FNUA 3V0TA 4Z1DA 3TH6A 1L8NA 5DY3A 3EPNA 1AQ0A 1HUVA 2W92A 1E70M 3KL0A 2O9OA 1U2YA 2V3DA 4K6AA 4YWSA 3VUPA 3ZWSA 3UJSA 1UW9A 1ZTVA 3PTQA 4PUDA 1OT2A 1CXHA 4OHQA 4R53A 4HN8A 2QHAA 2DZSA 1NIUA 1RH9A 2ALDA 4M29A 4CNSA 2VOMA 4B15A 1ZAHA 4ZMGA 3G24A 3AZRA 1DOSA 1KTCA 4ZO6A 3C2FA 3N2MA 3LQLA 4KH2A 1XLMA 5CC7A 3W1TA 3KOFA 3WD0A 2QCCA 1OT1A 1ESWA 4LU0A 3D47A 3MI3A 3F4DA 3C86A 4J3ZA 4LVFA 4NAFA 2R91A 3S42A 4BR1A 2YB1A 3OGVA 3VINA 1XIFA 4X63A 3CH9A 4CNNA 4MNLA 5LXEA 3QHNA 5HANA 4TVCA 3T1GA 5LNUA 3OA3A 4XKYA 3NQ6A 2WC3A 1ADSA 1ZUAX 5H8MA 2YA1A 2HMCA 3HV9A 1EHAA 1BYCA 1QRQA 3C0QA 4ACYA 2VURA 3FGCA 3G6MA 1KFCA 4QJ5B 4L4OA 1KR1A 3DOPA 1QNSA 1ONWA 3VM5A 3UCQA 2VFDA 2X2GA 3ENLA 5G2HA 1HNYA 1V6UA 3VO0A 2C1HA 4QJ1A 2DPEA 5U7SA 1O95A 3HA1A 4PYSA 2OB3A 4IMDA 2NW0A 4RUBA 3CAWA 3AXXA 4V15A 1GHSA 4J3WA 1MEWA 1YBQA 4QX4A 3W1AA 3GE7A 1TV8A 3T08A 2LLEA 1PCWA 2XFYA 4XWUA 2NUWA 3UF9A 1PTDA 1E6XM 3HN3A 2D2HA 1UASA 3WQVA 2PP0A 4GACA 4XD5A 5GNXA 3FEMA 3TZNA 2MUCA 3TONA 4M1BA 2NQLA 4FPSA 1OVDA 4LYQA 5T9BG 1JG9A 3I7SA 4O4WA 4X60A 3ARVA 2FFCA 3UA3A 3BW4A 3VD9A 3KOYA 2E68A 2PD5A 3KTSA 4BS0A 1V6XA 3II1A 3KBMA 3PVFA 4FIQA 1TV4A 5DRIA 4D6FA 4NSBA 4B2DA 1GVYA 3I7QA 1VR6A 3W9ZA 1G7VA 1PUDA 3EB4A 3NEHA 5U4NA 4CCDA 3R43A 1S38A 3W53A 2ZX9A 3E38A 1XSIA 3WNNA 2QYGA 5J04A 1F8MA 2BDQA 1IEVA 4CNOA 4NJKA 3LX9A 3AU6A 4WQ6A 1R2RA 1FXPA 3RHGA 3TCEA 2WQPA 1XBYA 1ZPTA 2PBOA 3M0IA 2JKPA 4US5D 1CEOA 1KC7A 5AZ1A 3N19B 4QSFA 3ZT5A 3QV9A 2Q8XA 2HCVA 1LZOA 1E0XA 5HNNA 4PL1A 2G37A 1Z89A 3B8WA 4Q3MA 3EGJA 3OBEA 3W82A 2GVGA 2Y1HA 1EF2A 1TVPA 1AUSL 4PBGA 2YCIX 1E0WA 1TZZA 4S3EA 1TPEA 4X9SA 3MCOA 1AD1A 3MO7A 4GFSA 3AIQA 4JEJA 1KXQA 4HNCA 3GIPA 3H22A 3QW3A 1T5AA 2QT3A 1D8CA 4YYFA 1KGUA 3UYIA 4XZNX 2HS6A 3GU2A 1HJXA 1LT7A 4GQQA 4DHGA 5MF5A 2CC0A 3U5UA 3UD6A 3B9OA 3DH7A 1C29A 4HA0A 2J24A 3E0LA 4J5NA 1OHLA 1EJUC 4FA3A 2PDIA 1TWIA 4FF7A 2E5CA 4FXSA 4QS6A 3TVAA 4BI6A 1HF6A 1YLVA 4EXBA 3S1WA 2XU2A 3GC5A 2V69A 4FMVA 1B5TA 3GS6A 3TIMA 1ITQA 4PMQA 1VLWA 4L9XA 4S38A 1IGSA 1JZ8A 4JFVA 2OODA 3APYA 3O16A 4OU1A 2Y61A 3HQPA 1UD3A 4LV4A 3FA3A 3ZS4A 1G0CA 4HPHA 3L2MA 1TJ1A 1UIOA 3TFXA 5FA5A 1BWLA 4H6EA 4FLQA 3BXWA 4OGZA 4TMCA 5BROA 2WAGA 5E0CA 4XAGA 3OBAA 3DG7A 5G1YA 1T0OA 3TOPA 2PRMA 4XISA 1XM3A 3GD6A 4WRHA 5KTLA 1YXCA 2P53A 1Y5XA 5EU9A 2XVGA 1VBJA 1F73A 2WSKA 3GRIA 3BAXA 4XAZA 1SO4A 1UD4A 1NDZA 4RPPA 3WUGA 4FNTA 5I3GA 4RCXA 2ZX7A 3DU0A 3WMSA 1VS1A 2VD8A 2X40A 3P74A 4GIEA 4Z0SA 2BY1A 4LUTB 1XQLA 2AL1A 3NDZA 1VBRA 2IPGA 3TN3A 2CLKA 1N7KA 2GUBA 3PTKA 1L9WA 3HMJG 4A8LA 1X1OA 3VKKA 4A22A 1ONEA 3WLTA 1LTDA 3IVSA 1FKWA 2E9BA 3GTIA 4Y90A 5KEZA 1B54A 4EOUA 3CASA 1PKNA 1PKYA 4HZ6A 4JTGA 3BAKA 1WAUA 4XB3A 3PHAA 2ZXBA 4ACZB 2VX7A 4Q4RA 4JQAA 1Q5MA 2YOCA 1XG4A 2YDRA 4LUYA 1TWDA 1QHZA 1KCXA 5CPTA 3L5LA 1V3LA 1W9DM 2INFA 3GHSA 4MFEA 3U48A 3GVRA 2I56A 2NSOA 1TSIA 4L9ZA 2R1KA 3LSBA 3T9PA 3GU9A 5G4WA 3VFCA 3QF0A 4GBUA 3HG5A 4DBEA 4RNIA 3AS1A 5CJNA 4FNPA 4I7UA 4O17A 4MGGA 4LRSA 4C6EA 4K8HA 2WO5A 3WLJA 1L6GA 4IIGA 4KKXA 2Q3RA 3POHA 3L0NA 3KHJA 5D05A 2YZRA 1ADDA 1BQCA 2FQIA 1RR2A 1H7XA 4TVDA 5DT7A 1X98A 2VEFA 3M0YA 4G2DA 3S47A 3EZ4A 3CUGA 4FX6M 1F05A 3MDUA 5BXPA 3ITGA 2WHMA 4A3RA 3C0SA 4HCDA 2D2GA 3EXTA 3ITTA 5XIAA 3XINA 4DI9A 4W4QA 1FWIC 3CHFA 3TXZA 1F6KA 2FLIA 4JFTA 1RALA 3N1AA 1XRSA 4AFYA 5E70A 3WH7A 1OC7A 4QP0A 3CIVA 2JIWA 1W9PA 3GO2A 3TJIA 5HJLA 3NXLA 4FSAA 1HKMA 2QEZA 4Z2GA 2DUAA 1GVEA 1IEQA 2C0HA 4OUIA 3GTFA 3VE7A 1CBGA 1FRBA 4GC4A 3GWQA 4QE4A 3VDBA 4N4PA 1KKRA 3PANA 3WNOA 4EXQA 3NAVA 1KBJA 4L5ZA 4PGLA 3BTNA 1M68A 3N4EA 2BOEX 4EE9A 3P93A 4FLRA 3N12A 3W02A 2Y7FA 3UWWA 5KZEA 2J75A 5A95A 5AC6A 3SQSA 3W7PA 1OFPA 3OHMB 3SY8A 5CQ1A 3AIUA 2ZFAA 1ISXA 4MPQA 2A3LA 4DJFA 1JCNA 1M3UA 3V0UA 3MTWA 3SFKA 4CEUC 4X22A 3LBOA 4L9YA 2ZZ6A 2WVTA 1QBBA 3L4XA 2PE4A 4KFPA 2Y5SA 4MDOA 3N6QA 1SZNA 1C3FA 5HXMA 3U3HA 3HZ3A 4PMOA 1BQGA 4F0KA 1FWCC 1U22A 3CB3A 1LWJA 1UQYA 4D2JA 3SJNA 5C6MA 4QISA 2AQVA 5PTDA 3E0FA 4Z2JA 1R0MA 4LUJA 2QV5A 5DCEA 2PSNA 3WF2A 1NARA 2FVKA 4J27A 3QW4B 3AYVA 2ZZ7A 4G7EB 1H50A 3LCGA 1YTDA 4XIMA 1JYVA 3QSTA 3P60A 1S5NA 2VR2A 3EX1A 3BK0A 1HXJA 2X0HA 4D1JA 4C7FA 2YGYA 4GI4A 2J79A 2PWGA 2A3CA 4DUVA 2Z27A 2GDUA 1F76A 3QY8A 4YTRA 1P4CA 4UZSA 1PHQA 4RR4A 3BW2A 5F2IA 1VRDA 2VDGA 1HKVA 4L61A 2AMGA 4AMCA 4LUTA 3WNPA 3TR2A 4J28A 1DJYA 1LOQA 4W84A 1KFKA 1K9FA 1M03A 2G3IA 1V4YA 1N8FA 3HBLA 2RGMA 3PZGA 2Z1SA 4IIHA 4UTWC 9XIMA 3ZR6A 4XZLX 3VD3A 3Q58A 5D2YA 4EWND 1FKXA 3B0VC 3FYOA 1ZJHA 2HK0A 2VDIA 3WJXA 4AVNA 1MUMA 3N13A 2BV9A 2YLLA 3TW7A 4ACZA 1F8IA 3W26A 1VEMA 2VFFA 3R13A 1J12A 4H8VA 3AS3A 1M7JA 3MUZ1 5C2GA 1VP5A 1OG0A 1XC4A 1JCYA 3ZVIA 3CU2A 4O13A 2XIMA 2ZYFA 2V5LA 4KF1A 1S39A 3JZUA 3OO2A 5DO8A 3MBFA 1VCFA 4HA4A 1TX0A 1A3HA 5J8LA 3VU2A 3HG3A 4OBSA 2QAPA 1UKPA 1K9EA 3TNOA 3NOYA 1WQ5A 2C8NA 5G4HC 2VP8A 3O3RA 3C0LA 1WDDA 3TAKA 4DNHA 5ECVA 3VNJA 1T96A 4MNMA 4LAMA 1BXBA 3PWAA 3GUGA 1ZFJA 4JPGA 4ES4A 2W6RA 4DM1A 3G3MA 2QPXA 1GYNA 2YLAA 4L7ZA 4YNGA 1EEPA 3BICA 4NNBA 4Y9AA 3CTLA 5D2VA 3K30A 2X1IA 2X16A 3WLSA 2D23A 3L0KA 4D72A 4NJJA 3UA4A 1VQTA 3LM7A 4R88A 3UJRA 4HNTA 5LNRA 3B8SA 3MI2A 3N3TA 1PYFA 3THDA 1DIDA 4GZ7A 2Z26A 4FK9A 3GFYA 3FY1A 3W87A 2QQ6A 1RJRA 4XO7A 3PUEA 4GI8A 1T8QA 5HQEA 2ON3A 3KEHA 4AWUA 4UTUA 2EPMX 3CPUA 2X1UA 4HHPA 4PMZA 4I8YA 3L4TA 4GO8A 1SUXA 1WCGA 4YJ5A 4JZ5A 4QE1A 5LNWA 1R3WA 3G3DA 1TPWA 3BW3A 4S3FA 3ZWTA 2IKIA 4XX6A 3SN1A 5H91A 4CEXC 2HV5A 2I9UA 1HJQA 2DZUA 1WDQA 2PWUA 8A3HA 5EGRA 4R9OA 2VRKA 4AU0A 2V3EA 4B4HA 3HB9A 3PUOA 2FDSA 4UBPC 1XIEA 4YTTA 3PG9A 2ZVIA 3LCXA 2X05A 1FWDC 4NT0A 3WQ8A 3W7DA 3N9KA 1ECEA 1AW1A 1J8VA 4D71A 2EGZA 2WM1A 4I90A 1DIOA 3WQ6A 1OCNA 3KE0A 3TA6A 5JXQA 2E0PA 3E2QA 2PI6A 1UD2A 2GZXA 1XICA 1US3A 2IKGA 3CWOX 1VEPA 3T2QA 4ATLA 4AMAA 4W8AA 1ZJIA 2G5WA 3QC3A 1HVQA 3IK4A 2HWGA 5A8GA 5LIWX 1V3KA 3LN3A 4KEVA 4QDPA 3RUBL 4MLJA 4KBXA 5IHSA 4BY3A 4WSHA 1J79A 3M9YA 4HGXA 4G7EA 3CL8A 4H04A 2Q71A 3TROA 4ZQOA 4PBFA 2ATMA 1XW8A 3HQNA 4CQBA 3P2VA 4J3SA 3W75A 3EXSA 3ZVHB 4MJMA 4AZCB 1XUZA 5FF7A 3B03A 1IHIA 3G1RA 1U30A 2D24A 5EBUA 4YHGA 2ASHA 4DO4A 4LBRA 5EFFA 4F0HA 3CUZA 3HG4A 4GXWA 1U5HA 5BW6A 3MYOA 3TSDA 1SYTA 2G97A 4JNZA 1OQFA 1UUQA 4LWWA 4S23A 3U57A 2YCJA 5GJMA 4JAWA 3IIPA 4HCHA 4M24A 1NOFA 3WQFA 1MNZA 3RYSA 4G6CA 5DY2A 1LUCB 4GKLA 3VOJA 1V03A 2ZC1A 2PF8A 3OGRA 2OO0A 3G6LA 1Y0EA 2AAMA 1UD6A 3HQ1A 2O9PA 3KCLA 2ZTKA 5LIXX 4LANA 1CW2A 1F3EA 4R9XA 5C7VA 3EWYA 1Z69A 3F2CA 4UUIA 3CK5A 1UKOA 4J3TA 3OBKA 5GJPA 3UR7A 2ZXQA 3W7EA 2PS2A 2BVTA 2YSWA 1CB2A 5AHMA 1E71M 4IXHA 1Z48A 1ZY9A 1LRQA 2JQXA 4C1KA 2MNRA 1QWKA 4LBSA 4GVHA 3VNZA 4U2ZA 2DY3A 4ZB2A 4LJ3A 3WKZA 4JTQA 1IYXA 1I60A 1ZLPA 3TCSA 4G1KA 3SADA 1AH0A 5JIPA 4GZEA 4Y2WA 1ISVA 3W71A 2A1YA 4BQ2A 3R1ZA 1DJNA 4HNLA 1GCYA 4ZBCA 1HJWA 3MW7A 2ZZ2A 2W0UA 2BGSA 2Y7DA 4PSRA 4Q4KA 2G3FA 3RM4A 3N9RA 3U0HA 4GCAA 5HDRA 1A49A 1QXLA 1BPLB 1ITUA 4AZGA 2VL4A 3MVIA 3W01A 4IMGA 1U5VA 3IV3A 2W9MA 3FYPA 3BCFA 1SFLA 3PM6A 2DIKA 2IQ0A 5C0QA 3DFSA 3SEPA 1QOXA 2CBUA 1W3HA 2W3ZA 1HKWA 3WH6A 1VCGA 4CNUA 4WUIA 2QUTA 5D04C 4KPLA 4AVFA 2DUXA 3VC5A 3ZLFA 2JGQA 1QHOA 5XIMA 3VGEA 4IICA 1LWHA 4KWVA 1UC4A 5FF2A 4YCPA 4BA0A 2X1SA 3W1LA 4GYJA 5F4XA 1JCLA 1E4IA 1S5WA 4DUWA 3FXGA 5LYRA 2NVAA 4MAZA 1DL3A 1C8QA 2R82A 3H53A 4B5TA 2G3JA 2WHJA 4U3AA 4V1YA 4YVXA 4PL2A 5HK4A 4X0VA 3V1HA 2F7FA 5H2ZA 1CXKA 3SCWA 2WMKA 4L6HA 1FY6A 4E3TA 4U28A 3M4HA 4A8NA 3GZ3A 4JTHA 1BXCA 5CPMA 1KV8A 3N4FA 1EJVC 2Z25A 1IT7A 5TIMA 4BKNA 3ATZA 3QN3A 1NOUA 4CUCA 1W32A 1KTNA 3KBWA 1IIHA 1XIDA 4XZ9A 4NI8A 4ZZ9A 5CC5A 4HA3A 1XYFA 2REQB 5DX7A 3LZ5A 3NYDA 2PPGA 3MJYA 1QOPA 1EL3A 4MM1A 4C90A 3BOLA 5A2BA 5C2XA 2HBVA 3LENA 3LHYA 4DBUA 3BOFA 1LG2A 2VKZG 5EYWA 3UBPC 1XH2A 4GJJA 2EQDA 1LBLA 3BWWA 2J9XA 3QXBA 1H63A 4O12A 4O15A 4CD7A 3ARRA 3VE9A 1IV8A 1Y7VA 4O16A 2QPSA 1UC5A 3CNYA 3ZVHA 1V8EA 4AZCA 4A4AA 1WYIA 1YNPA 4LX4A 1B3WA 3LV5A 4S3BA 3FA5A 4RE3A 1MFVA 4M7TA 1VFHA 4PUJA 3KDOA 5D8WA 3O06A 2BODX 3GHTA 3GH7A 1FOBA 4LC8A 2GJRA 3LD5A 1VFTA 4PMDA 4JTJA 2H8ZA 3V5FA 4O0QA 3WDIA 1EDQA 3I68A 5AC7A 4H8NA 3DGRA 1JPMA 1AQFA 2XJ7A 1XRVA 4QQ3A 1BG9A 3MB9A 1Q6DA 3IVUA 2E67A 4ZOAA 1WBJA 1KCKA 1MW2A 3PNZA 2YXOA 1LUCA 4MNJA 3EXRA 1LDCA 1BVWA 1H7OA 1DJGA 4F79A 4O0KA 4HYRA 1R3SA 4K36A 2ZKMX 2Y5EA 4H2HA 2PURA 1K7FA 1Z7AA 3KL3A 3NL5A 5M1TA 4XAFA 1SW7A 2XFWA 4JTTA 2BLEA 1UG6A 3CV6A 2DT1A 1RVKA 5BYWA 1TVLA 4IFRA 3WQGA 4YYCA 1DHKA 3U6WA 2CLEA 4AXNA 1I9CB 1VGAA 1Q8JA 1FP9A 3TUUA 3B40A 2YL9A 1TUXA 4QDWA 3UGRA 2CLFA 2C14A 3CHDA 1G67A 2GVLA 5FF4A 3ALFA 1V93A 4OOZA 1SJAA 4L1WA 3RCYA 4DF1A 3F4VA 4DO6A 2JK2A 1EFZA 4ZFCA 3HJZA 4C5ZA 2OT0A 2VCBA 4XG1A 3TMQA 4B5WA 1OCQA 3TP4A 1JZ3A 3F4WA 1BSLA 2NX3A 3QQ0A 4IPJA 1G69A 3MWCA 2QKFA 1B4EA 3H4GA 2QJGA 2Y4SA 1GVIA 3H23A 4NUWA 2V3FA 3HGJA 1QK0A 5B80A 3EX2A 4PTVA 2OSXA 4YWIA 1VZWA 1GK8A 4M82A 3RX2A 2FPYA 2VEKA 3H2EA 3NQGA 4I9JA 1M65A 3DFTA 2FPTA 3FDGA 1HL9A 2VR4A 2OLHA 3KBNA 2VX4A 2FH6A 3S5NA 3ZMRA 3NQDA 2PDXA 3ZJ7A 1OX4B 1M5WA 2Z24A 3WL0A 2V2HA 4HNOA 4TX8A 4TX9A 4GINA 1E40A 2CZFA 2PFHA 2Q02A 1W1YA 2OJPA 1QWGA 4LVAA 1CB7B 5B7ZA 1J01A 1O60A 5BMWA 5A6MA 1QI2A 1DWHM 3VOIA 1W2PA 2WKGA 4JIRA 3M44A 3S1UA 4YL2A 1IZCA 3FAXA 4ROPA 1F4HA 4JTSA 1P48A 2I5IA 4V1XA 4ERIA 1V5XA 1TB3A 2P3EA 1GQKA 1KM3A 1DWGM 4F0MA 4XD6A 2A7NA 5DXXA 2TRSA 3P80A 5FJIA 2OQHA 4GQGA 1T40A 1W9VA 3NDYA 3MYPA 3FJ4A 3K1GA 1JDAA 4F66A 4R7WA 1IWPA 4IIFA 1QVBA 4O1FA 2ZDSA 3T4WA 3QV8A 3ARZA 4IJRA 4KMQA 5A6KA 3BAWA 3WLHA 4BCEA 2REQA 3RM8A 1E6PA 1JPDX 3QRHA 1LQAA 1VYSX 3MV01 3A4AA 2QCNA 2V3GA 2OX1A 3UJFA 2WNQA 3GVGA 1XISA 3W88A 3CWHA 4LEQA 1BGAA 4PCNA 1KBIA 3MKVA 2HNEA 1UBPC 2CBIA 4Q22A 3S9IA 4MJZA 5EPDA 4C6BA 1ISZA 4WY0F 1I8JA 1UOZA 3GDBA 3MC5A 4FNQA 4XK2A 1V6VA 2E1DA 3UESA 2E6AA 1F2JA 2CIPA 1Z6KA 3NTYA 5E1QA 3VMOA 5AOUA 4LYPA 1H1YA 1CXEA 4UQCA 1JQVA 3FXYA 3L5MA 3Q45A 3AWNA 3L65A 3IJQA 4K7VA 1A5KC 3TV8A 4Q4PA 3UWZA 4L4PA 5AHEA 1A5NC 1MQQA 2OKOA 3B0UX 2NWRA 2HTMA 4J4KA 3MKCA 1UKQA 3DHPA 3VKBA 3GU1A 3TEVA 3LGDA 4JHZA 1XLCA 2D20A 3GXFA 2WCAA 3DFOA 1TR9A 1Q2RA 1WDPA 1WXYA 4L1GA 1OC6A 4PH6A 1UR3M 1QI3A 3M7SA 4IF2A 3MO4A 4C6JA 4BWLA 4DB7A 1RA0A 2FGLA 3K46A 1XPGA 3A47A 3OB8A 1WDWA 3MU7A 3WUEA 1A0DA 2EO7A 3A64A 3N29A 1JZ6A 2ZX8A 3O0FA 2XGZA 3QKZA 2XG9A 4IGMA 7ODCA 3WF0A 2OZ3A 1VFUA 3M5YA 2IKJA 1TE1A 4JNYA 4IFOA 5AVNA 4ICMA 3NPVA 2GVJA 1E51A 2VYOA 4N9CA 3P0XA 4PTXA 2ICSA 2PLMA 1DP0A 4LYKA 7ENLA 5BZAA 1W1PA 3PR2A 1GG1A 3DDMA 4F8XA 1W8GA 1XIGA 4FOKA 4UFHA 4US5A 2C13A 2R1LA 3TJLA 1PDYA 4FX7A 2IXVA 3PTMA 1WE5A 4JIQA 4CVUA 1J6PA 3N2TA 4MWAD 4PEEA 3KUMA 2PDGA 1OFBA 2A7RA 1K7XA 3TLLA 4GGHA 3CV1A 1B2YA 1GKRA 1R3VA 3OIXA 4JTFA 4UR8A 3GBEA 2J7FA 3W86A 1W5PA 2WVUA 3QMSA 3WK3A 4OIFA 5A6TC 2XWDA 3IV8A 2GVYA 1NEYA 2BOGX 1E3XA 2VWTA 3K4DA 1V02A 1OX4A 3AUOA 1W1A1 4HZMA 5A3HA 1P0BA 2ZUMA 4PUNA 1NOWA 1BXNA 4Q4MA 1NFPA 1SSDA 2XIQA 4A3QA 5DMNA 1FWJC 4AEEA 4IIEA 1K02A 1Q6RA 3W1UA 3GR4A 3S2MA 3I6EA 2YDSA 3OQEA 2FHFA 2NSXA 3EX6A 4AD1A 3WBEA 3S46A 3QSRA 3VC6A 1SMAA 5JBDA 4TVUA 3R4IA 2XHYA 5LXXA 2Y89A 4JIHA 4HN4A 3DXIA 1WPCA 1H41A 3RR4A 4C6LA 3OOQA 4KWOA 4Z08A 1ICPA 3PJXA 1OINA 1BRLB 2V5KA 4KT2A 2JBMA 2VQTA 1K6AA 1SQ7A 1TA3B 1GJPA 3EX3A 3QY6A 3R0KA 5CSYA 1A5SA 3QPYA 1D8WA 1J0HA 3G1AA 2PTWA 3I4EA 3OJGA 1G4TA 3CO4A 3BLKA 5BU6A 1KV5A 2VRJA 5DBUA 4XTDA 4DWSB 1SO5A 3S3GA 3TTQA 3LGEA 3FAWA 3NDOA 3WCZA 3RMEA 1O68A 1FWGC 3N17A 4GLEA 1TZ7A 2EEXA 4GJ1A 1RP8A 4GQBA 2PDHA 3KDNA 1H3GA 2XIOA 3ITLA 4QBXA 5HMFA 5JH1A 3BV7A 3EOUA 4K8EA 2J6VA 1PKLA 4FO4A 3LCHA 1AA1B 3T0AA 3BMVA 2HISA 1HJSA 3NO1A 4JCMA 1E9LA 4I9TA 2JEPA 1EQPA 2XH4A 1OGGA 2BB0A 1KM6A 1QW7A 3QY7A 1NH6A 5G1TA 5AN7A 3H7UA 5AYZA 4MKNA 3H6OA 4Q8UA 2A3BA 1E4NA 3IIZA 1PHWA 3WO8A 1H4PA 3ES8A 1LJYA 1XLEA 2E6YA 3SCSA 5TAOA 3ZXWA 4UCFA 3ICJA 1QPQA 2DT3A 1RLDA 4IISA 5CPQA 5KZMA 4D6DA 4H1ZA 4MFDA 3C0JA 1UA3A 1GKQA 5I06A 2GDVA 5CPSA 4G9PA 3SZ8A 1EO7A 2VEGA 5I00A 3VNKA 4L65A 1ICQA 1EJSC 3GXDA 2GL5A 2HJPA 2Z6JA 4UOJA 2G8ZA 5D9MA 2XN0A 2I7GA 4IH3A 3WQWA 3IJ9A 4RE2A 2ESCA 3E02A 4Q8VA 4RV3A 4LQ1A 4EPKA 4O57A 4NG3A 1FWRA 5E09A 1HTIA 4CD8A 2VCCA 1P0NA 4KGJA 4AG0A 2IUZA 3FVMA 3SECA 1MUCA 3W0KA 4JY8A 1JPHA 3MSDA 1ML1A 4WVXA 1DXIA 3W7QA 3QV7A 4MIMA 4D8LA 3T0DA 3LTSA 4MYAA 1UB3A 3OVPA 4UFKA 3KVKA 4TR9A 1LBMA 3EDDA 3BMWA 3RLUA 4CCZA 4HMDA 2OTDA 5CZJA 1GUVA 3GXTA 1P6CA 2ISSA 5DMYA 4FLOA 1SZGA 4WGXA 1EJRC 4QNEA 1AJZA 1V0MA 3AIVA 4DJDC 4XQ6A 3CWNA 4NKCA 2I5GA 2DW6A 4ZXLA 1PX8A 2XVPA 3AO0A 1GNXA 3CMGA 4DPPA 1EPXA 4HT3A 5FJUA 3BAIA 4DYJA 4O0ZA 4P7NA 1XLIA