4C1LA

Crystal structure of pyrococcus furiosus 3-deoxy-d-arabino- heptulosonate 7-phosphate synthase i181d interface mutant
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
262
structure length
262
Chain Sequence
b'MKYSKEYKEKTVVKINDVKFGEGFTIIAGPCSIESRDQIMKVAEFLAEVGIKVLRGGAFKPRTSPYSFQGYGEKALRWMREAADEYGLVTVTEVMDTRHVELVAKYSDILQIGARNSQNFELLKEVGKVENPVLLKRGMGNTIQELLYSAEYIMAQGNENVILCERGIRTFETATRFTLDDSAVPVVKELSHLPIIVDPSHPAGRRSLVIPLAKAAYAIGADGIMVEVHPEPEKALSDSQQQLTFDDFLQLLKELEALGWKG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2-dehydro-3-deoxyphosphoheptonate aldolase
publication title Destabilization of the homotetrameric assembly of 3-deoxy-D-arabino-heptulosonate-7-phosphate synthase from the hyperthermophile Pyrococcus furiosus enhances enzymatic activity.
pubmed doi rcsb
source organism Pyrococcus furiosus
molecule tags Transferase
total genus 98
structure length 262
sequence length 262
chains with identical sequence B
ec nomenclature ec 2.5.1.54: 3-deoxy-7-phosphoheptulonate synthase.
pdb deposition date 2013-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00793 DAHP_synth_1 DAHP synthetase I family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4c1lA00
1DV7A 2YFNA 4JTUA 4NT0A 4JIPA 4IWWA 3C8FA 1HFBA 5KINA 3BARA 3R12A 1OX5A 3NQGA 2A7RA 3TQ0A 4AF0B 3KVJA 2ZA1A 3OVPA 2NLIA 4HPXA 4UTKA 1K8ZA 4M5PA 3G3DA 3B04A 1XM3A 3BO9A 4NJHA 2E5DA 4JDBA 1VLIA 4NQ1A 1W5MA 5G2WA 1JCYA 2FB3A 2C14A 3W3OA 4LNYA 3W7LA 3KOFA 3TE9A 1WV2A 5LKYA 4TIMA 1SFLA 2Q8ZA 3V1PA 4B5NA 3ANYA 3SY5A 4QNWA 4UMBA 3OIXA 2V2DA 2A2IA 3W7QA 4UFMA 3OA3A 1QPRA 3ABOA 3EWXA 3NZRA 4YCOA 4O53A 1W31A 1XBXA 1TV7A 5EMUA 1EWEA 3ZFHA 2X16A 1KM4A 1KV5A 4LRTA 2QEZA 2QUTA 4AWUA 5D2XA 4A21A 3NO5A 1TPWA 3O1NA 3PY2A 3FJ6A 3L21A 3OVRA 5TIMA 3E12A 4O52A 4H4IA 2YYUA 4JTIA 4WOZA 2JKAA 2ZFAA 1ME8A 3F1QA 2J9XA 3H54A 5LHFA 4KFPA 4ZQOA 4AHOA 4M19A 5E93A 3S5OA 3SI9A 2JGYA 3W07A 3LXAA 1I8JA 4JTEA 3PBWA 2ZRYA 4N9CA 3PSWA 1JULA 3LM7A 2X1UA 1YXYA 4U4MA 4N02A 1B4KA 4TX9A 4WJEA 3M16A 4RXFA 1DQXA 3W70A 1GPWA 1K8XA 1MO0A 2R8WA 1D9EA 3AJXA 1AW5A 1B3OA 2DZUA 2R14A 1PCKA 1IF2A 3LI0A 3I7RA 3TKFA 3OHIA 4O16A 4IQLA 1E51A 3E9AA 3EX1A 1W5NA 3BW2A 5AHIA 4DO6A 3JS3A 3CEPA 3K30A 3M0ZA 4GUGA 2IQTA 2ZTJA 3BK0A 5I3KA 1DL3A 1I4NA 4JTTA 2X2GA 3PG8A 5D2WA 4Y9AA 3P8JA 1EUNA 1JR1A 1K7EA 4CQ8A 3A5FA 5D30A 2E6AA 4ZQRA 2FPYA 4K36A 3N2MA 3GNNA 4N9DA 1R2SA 1FWTA 2Q8LA 1JCMP 3TCEA 3GKFA 5AC8A 3LBMA 3LCIA 1EIXA 2YX0A 3N9RA 1DORA 2QCDA 1OK6A 5E1QA 4MFDA 1O60A 3QW3A 4FB7A 1J4EA 3P7YA 1XXXA 4PH6A 3OVQA 4LS1A 1SQ7A 1GEQA 5CG7A 1LLWA 2EAWA 1NVMA 2V81A 4NNBA 3HMJG 4OV4A 3MO7A 3DBPA 2CFFA 4XTDA 4BI7A 4MFEA 3CEUA 2JKEA 1RD5A 3LHUA 4EF8A 3QEZA 3WK1A 3GR8A 4FXSA 2C13A 4IGHA 1QPQA 1L6SA 3QFEA 4GUFA 1F6KA 4UTUA 1KBIA 3CIWA 4NXKA 2H90A 1OFEA 4C1KA 1VCGA 1WBJA 5FEZA 1ZHAA 1L6YA 1EP1A 3W87A 4AF0A 3EKZA 1YDNA 1VLWA 3M5VA 3OBKA 2R91A 2YW4A 3W73A 3MYPA 3FIGA 4JS3A 2HSAA 4X22A 4R7JA 2VFFA 3GX9A 3IIZA 3KVLA 5DLCA 3INPA 1EWDA 3UQNA 1FWSA 3QMRA 2O7SA 2YR1A 1SUXA 2DZSA 4WUIA 2B4GA 5HQEA 1KM3A 3O6YX 2OT1A 4JTGA 2BSLA 1M5WA 4UTTC 4K39A 4KFNA 1OK4A 1G4PA 1AMKA 1LCOA 5DY3A 4PODA 4BFAA 3T40A 2NXHA 1GYNA 3ATZA 3G1FA 4LVGA 2QF7A 4Z1DA 1UB3A 3CPRA 4N4QA 1WBHA 3LGEA 3KRUA 1T99A 1LOQA 4NJKA 3PBVA 5AHNA 1HUVA 2FPTA 4IMEA 3SGZA 5HNRA 2WNQA 3L0GA 2NZLA 2WV8A 4L4MA 1HO4A 3NL6A 4IXHA 1O94A 1TV5A 5HMSA 5C6MA 3GAYA 3THQA 4M7TA 3VKJA 4JTFA 3LCFA 5DCBA 2ZQ0A 3UPWA 4G1KA 3N3MA 2DZPA 1VPXA 1MEWA 3NQ7A 2J9ZA 4O15A 2Y7DA 4IXXA 2A6NA 3OG3A 3F03K 3CLMA 1GVQA 3TJLA 4O19A 1OABA 3NM3A 3GAKA 3H53A 3HIJA 3MWAA 5EY5A 4J9JA 5TQLA 4LY8A 1YYAA 2ATSA 1VH7A 4HNNA 5CZ0A 2ZRWA 3HG4A 3DHDA 4MLRA 4PFMA 5D2YA 2TMDA 4CNNA 1KFBA 4NJGA 1TYGA 3GK0A 5C54A 1XUUA 4ZQMA 3B4UA 4ADTA 3PBYA 4EVZA 3GIYA 3DGRA 4ZMGA 4LC8A 3W1XA 2UV8G 4LVAA 4TMBA 2B7NA 2BXVA 3ABRA 1OJXA 3HBLA 3QMSA 2Y7FA 1G6CA 5I3GA 5KMYA 3LCXA 4CQ9A 3LDVA 5F4WA 3TH6A 4UUIA 5HR6A 2ZZ5A 1H63A 2VXNA 5HWNA 4N6FA 4AWSA 2QR6A 4A22A 2NWRA 3LV6A 4JTSA 4PTNA 1F73A 2F7FA 1X1ZA 1YTEA 1MZHA 2E6FA 2DJXA 3VI2A 5K4ZA 4UC5A 4PC8A 3W2MA 3GKAA 4FNSA 3WJYA 2ATMA 2FDSA 3ZWSA 3SZ8A 4JY8A 3G0XA 1Q45A 1FXPA 1JUKA 1JQVA 1TPDA 1AK5A 3W75A 5L9FA 1LOSA 1XFBA 3L2IA 4U28A 1VJIA 4MY8A 5IM51 1V7YA 1YLVA 3PWAA 2TYSA 2H3BA 1FDZA 3A23A 3L5LA 1VZWA 1GTHA 3W1RA 5D2TA 1W54A 4DO4A 3FYOA 1G7VA 2RDUA 3W7HA 3WFAA 5K2ZA 1FWNA 2QDHA 5G1YA 1MXSA 2PRHA 5AN7A 4Z08A 3TQKA 1A5SA 1JCLA 4HPJA 2GJLA 3USBA 3UWWA 1CI1A 2GVGA 1Q3NA 1W37A 4MVAA 2Y6ZA 4RJEA 4NZJA 3W71A 3MHGA 3IVSA 3P8IA 3NPWA 1W0MA 4N9EA 1TQXA 1UUOA 2Y62A 1P4CA 3IRDA 4HSOA 3THAA 4OGZA 3L68A 3L0NA 2V30A 4UR7A 4MZ1A 4IPJA 2WQPA 1JUEA 3IVTA 3C2FA 3N34A 1TPEA 1LM1A 5BNKA 2VFIA 6TIMA 1PVNA 2VEIA 2WNZA 4CNPA 5HJLA 5J5RA 3T44A 1W1ZA 4JYDA 3SGUA 2P1FA 3O05A 1V5XA 2NV1A 5A8GA 1YPFA 4JDYA 1P1XA 3P82A 1QMLA 1SZEA 2FB2A 2X1RA 5FF3A 3EKLA 2VKZG 4UIOA 5CPLA 4JYEA 4MLJA 3TW6A 4KWWA 4I7UA 2YYTA 2XFWA 1F2JA 4O0KA 5KITA 5CZTA 1KFEA 1BWLA 1I45A 4WY0A 1HL2A 4LU0A 5LNWA 1Z41A 2P0OA 2C3ZA 3DFSA 1A5BA 4JXCA 3LHYA 2ZCGA 4ADSA 4ORIA 4RKAA 3TJXA 3M47A 1AW1A 4FF7A 3G18A 1VYRA 3MUXA 1EP3A 1F74A 2CLHA 3NAVA 4X2RA 1M7PA 1H5YA 3TIMA 5AC6A 2I9EA 3KX6A 2E09A 1L6WA 5FF4A 3SFKA 3TFCA 4HNVA 4GWEA 1VGAA 1Z42A 4RXGA 1EPXA 3MI3A 4FHAA 1I2OA 5G4WA 1I2RA 3UWYA 1GVOA 1FBAA 4DELA 3C3NA 5CSSA 1PV8A 3UD6A 4OV9A 2QCDB 1XBVA 1ZAJA 5KZEA 1X1OA 3FA5A 3N2XA 1KFLA 4O50A 2BWGA 3IGSA 3GDRA 3W1UA 4RLIA 2WJZA 3S5ZA 4ZZ9A 1KFCA 4HN4A 3HF3A 1B57A 2QJGA 4O28A 3CB8A 1C9DA 2WSYA 3QZEA 5LNVA 3W86A 2H8XA 1W3IA 2NXIA 4O17A 2HS8A 3KFTA 1FX6A 3L5AA 2A21A 4M7SA 4CCDA 5D09A 3NG3A 3GVGA 3CT7A 1ME9A 3KVMA 1FDYA 1HO1A 3QPYA 4MJZA 4UXDA 4RZ5A 1H1YA 4K6AA 3FLUA 5F4SA 3STCA 3GR7A 4N4PA 4LUIA 2ZYFA 4JX6A 3WJSA 4A2RA 1H7NA 3VE7A 2Y70A 1HTIA 4RK8A 4WQ6A 3Q94A 3WK0A 1KM0A 4XBSA 5HUOA 4M6PA 1LRQA 2ABAA 4AH7A 3WJZA 1WA3A 3UY8A 1OFPA 3UY7A 3W9ZA 3PR2A 2I1OA 5BOOA 1LBMA 3BLEA 1EEPA 2RHGA 3QPZA 5A5WA 3S5NA 3LLFA 5C5YA 3RF9A 1C8VA 4FNQA 1VHNA 2A4AA 3B0VC 3WJXA 4O4VA 2A1YA 1GYLA 1XKYA 3EX4A 5D37A 1K03A 2ISWA 1BEUA 1GG0A 3E02A 3S0CA 3UXDA 1Q6RA 1S3HA 1XL9A 2FLIA 3L0KA 4GUJA 5LGXA 4W9TA 3HGOA 4XKYA 4IPIA 1PHWA 4ICNA 2FTPA 4K38A 5D03A 5D2VA 3G22A 4GBUA 3PBUA 2WKJA 3DZ1A 4QQ3A 1Z48A 4DXVA 2V5BA 1TREA 2QCLA 3MP3A 1YDVA 1G7UA 2GPTA 5F1VA 1T8XA 2C6QA 5EYWA 1VCFA 2VELA 4DPQA 3VFLA 4A2SA 1O5KA 4XTIA 3LCWA 1TPB1 4LVDA 3HO8A 2A7PA 2P10A 2GQ8A 3C2RA 3NEVA 4JTJA 1PHQA 2VFGA 3Q37A 3LB0A 3GB6A 3O16A 1KLZA 4BF9A 4QIUA 3QW4B 1JCNA 5L6UA 2QCNA 3TX9A 4EWND 4O4WA 5D05A 3GDTA 2YDAA 4DBEA 3NNTA 4MUZA 4RX0A 3PF3A 1LP6A 3I7SA 4Y6GA 1H61A 3W7PA 2J6XA 2Z1BA 4PCFA 2GOUA 3W2KA 4MKNA 4FNRA 1AL7A 2ZRUA 3I68A 3RNDA 3UWVA 1KW1A 3V75A 1LORA 5K3VA 4N2YA 3L5MA 2V9DA 2BZNA 3FS2A 4YL2A 3HG2A 3N14A 5TBOA 3W2JA 1XI3A 3G8EA 3IIXA 4GRSA 2V5LA 3SJ3A 1OFRA 3BV4A 4CCEA 4UTTA 3MMTA 3S5YA 4FNPA 1EP2A 1GTEA 4GUHA 2QCEA 4WY0F 2VC6A 3QQ0A 2YCEA 4GNJA 2HS6A 1K7FA 4BWLC 3EWYA 2QDGA 1N7KA 3GXPA 4O0ZA 3PB0A 3W74A 4HNTA 3A21A 2BLEA 3LV5A 3DI1A 2EGZA 3NQCA 4Y90A 3DXIA 2A6LA 3G1AA 1WQ5A 4NZFA 4S2CA 3P84A 5HR7A 5EBUA 3TUUA 5CGQA 3KXQA 3G0SA 3LHZA 3G1YA 1UJPA 2B0MA 2C18A 1CX9A 3L67A 5H91A 2Y88A 1A50A 3QF0A 4ZQPA 2Y7EA 3UZ5A 5I3IA 4I7VA 3BG9A 3TMQA 4NU7A 2TSYA 3IIOA 5U7SA 3NVTA 4E38A 1QNVA 3B06A 3SIZA 3W7EA 2B7PA 1I2PA 2DORA 4FXRA 3DFNA 1H60A 3O07A 1QO5A 5EPDA 3U8GA 1RVGA 3T7VA 3CC1A 2QUUA 3DKLA 3Q58A 3TDFA 3NYZA 1F5ZA 3H55A 2DZVA 5HUPA 2Z6JA 2NV2A 2EHHA 3CM4A 1WOBA 5G4EA 1L9WA 3TXVA 3VCRA 3TW7A 4NVTA 3LI1A 3PB2A 2WOQA 2ZZ6A 2DJLA 2EPHA 1D3HA 4GJ1A 4UFLA 3MP5A 3GDLA 1FCBA 3A9IA 4LV4A 4WXYA 1IXPA 5AOUA 1MSSA 3NOEA 1QPOA 2A5HA 3QMTA 4O54A 1F76A 1ZCOA 3EWBX 3FEMA 3LHWA 1KLYA 3W2UA 2ZDRA 3NQAA 1JJKA 4NNCA 1G4SA 4TMCA 1DVJA 2NWSA 3PAJA 3NQVA 3NQDA 4WY0B 3S1XA 3W7GA 1UUMA 4MYXA 5FF0A 4ML9A 4KWVA 1DQWA 4PL2A 3RK8A 1OYCA 4GE8A 3GNDA 5D32A 1KTBA 4O1DA 4ZVJA 2H3DA 2ZTKA 4HHPA 5FF7A 2H6RA 2OCZA 4DPPA 4UNKA 3CWOX 3MYOA 1SZFA 1W5OA 4LUJA 4O1CA 4FNTA 4GUIA 1NEYA 1QDSA 5FEXA 3SECA 1A5CA 3LTPA 3W1PA 2QAPA 5CPMA 2V82A 4LW7A 3EXRA 3B0PA 3M44A 2QCMA 3BW3A 4OWGA 5E0KA 1IXOA 1GQNA 4P61A 1VHCA 4XUGA 3LXBA 4DQWA 4JNMA 4UFKA 1VRDA 2E1DA 4YXGA 4XBKA 3S1UA 3SW6A 1F05A 2RDWA 3ELFA 4Y8FA 2E6YA 4OU1A 4H3DA 1I2NA 3RU6A 1H50A 3DU0A 5DXXA 3UWUA 2TRSA 2CZEA 3IIPA 3EEGA 4POCA 3MJYA 3S1WA 3O15A 3TXZA 3KHJA 3G1SA 3L9CA 2QKFA 1Y0EA 3LX9A 1NF7A 1KA9F 3FOKA 6ALDA 3C4UA 1KM1A 1YXCA 3M5YA 1WXJA 2QAFA 2VOMA 3LCLA 3HGJA 1WOAA 3L65A 5DXYA 4O1BA 4JX5A 2H8ZA 3EX3A 3W1AA 5K7JA 3CIXA 4R34A 1TCDA 1ZNNA 4ZQCA 2RDTA 4HNUA 2ZA2A 3B05A 3TSDA 4IMGA 5FI8A 2NUWA 4UFJA 3WK2A 1THFD 1IIHA 3BLFA 5G5IA 1R46A 2ALDA 2BX7A 4XZ9A 2E5BA 3STFA 4UTJA 1DJQA 3TROA 4OT7A 3C52A 1C29A 5CPNA 4MIMA 2CU0A 1NF0A 2V8ZA 1TO3A 4Z1CA 2WO5A 1PS9A 3QRHA 5DY2A 5J5DA 3CTLA 2G97A 3CQ0A 3P74A 4O14A 4BK9A 2D73A 2AAMA 3QC3A 3RLVA 3DHFA 1R30A 2XN2A 4AWTA 4UTWC 3KVKA 1PIIA 1VYSX 1ICSA 1LOLA 4O10A 4XKYB 4NNAA 1GVSA 1ML1A 3P61A 5AYZA 4Q32A 3OEXA 4JX4A 5LSMA 2W79A 1TB3A 3A22A 4E2BA 4A3UA 2C0AA 4FIQA 4H6KA 1YADA 2GJNA 2AGKA 4D2JA 2ZRZA 4UR8A 3W6YA 5F2MA 4BR1A 2YSWA 1OFAA 1S5TA 4JEQA 3O06A 3KAOA 1KM2A 1KV8A 2NUYA 2FPVA 1ADOA 4IJBA 2QJHA 4C1LA 4R53A 4K37A 4WOQA 2G5WA 4O12A 4PA8A 1ZENA 3TNOA 3BPWA 2VEMA 1LBLA 1TQJA 4LWWA 1J5TA 4A29A 2FJKA 3TFXA 2ZZ7A 3NQ8A 3NPVA 3RLUA 4XWUA 3JRKA 4FIRA 4TU1A 3NXFA 4LOCA 3W2LA 3NA8A 1YDOA 3HB9A 3W84A 5D02A 2X30A 2QCFA 4JYFA 4NJJA 3W7MA 4PEKA 4N9BA 1QR7A 1SO5A 4QAIA 3NQ6A 1OF6A 3G1XA 3ABSA 3LTSA 4L4LA 3W83A 1LZOA 2WSRA 3LTYA 5HWMA 2B7QA 3W22A 4OHQA 2Y89A 7TIMA 1EUAA 2GUUA 3W1NA 1TMHA 4OQVA 1G4TA 1SSDA 1RZMA 1T96A 5IBXC 1ZJIA 3W7JA 8TIMA 1SO3A 3LCHA 3NPUA 4JIQA 3CU2A 3TC7A 1XUZA 1TJRA 4FX7A 1O4UA 4QITA 2CLLA 3QSTA 3M5ZA 4O13A 5CPOA 3G1HA 3LLDA 4RCXA 1OX6A 1XCFA 3U6WA 3N73A 5LNSA 4JN6A 3NR0A 3W1MA 3LXCA 5LZLA 1KTNA 2V2CA 5KZMA 3EX2A 3RFAA 1SW3A 1EB3A 3GZ3A 5CSRA 1CW2A 4QNEA 2CLFA 3IGXA 2E6DA 1ZAIA 5D33A 1QAPA 3O63A 1KM6A 1LBFA 1OX4A 5EKYA 2DU2A 2ZRXA 3BW4A 4S2BA 2OZ0A 1KM5A 3S6DA 5LNUA 5LNRA 3T78A 1AG1O 3W7NA 3B03A 1TPC1 2CLKA 4M6VA 3T55A 4WXZA 1G4EA 1QPNA 3C2VA 3T4CA 3UZJA 1RV8A 1X6UA 2E5CA 4KFOA 4EOUA 4Z1AA 3DENA 2RKXA 1TPUA 5DBTA 3M9YA 1K02A 4MY1A 4AB4A 4TR9A 2CLMA 3NM1A 3W7IA 2J88A 4CNOA 1H7OA 3GYEA 2OT0A 4HSNA 1H1ZA 2ZA3A 1TJPA 1OHLA 4LS2A 1UCWA 4DF2A 4UNLA 3HOJA 1OFBA 2R94A 5CKSA 3GXTA 2A85A 1GVRA 3YPIA 4TO8A 5I3FA 5CZSA 1BKSA 5KZDA 2CLOA 5I3HA 4UFIA 1WDWA 1LYXA 4BWLA 3TSBA 1TPH1 4IMDA 4RR4A 1S5WA 3STGA 1P5BA 2F84A 2PURA 3W88A 4YMZA 3GDMA 4UMAA 4DO5A 1OFDA 4IX0A 4KKXA 3HQ1A 3P80A 4NUWA 1FY6A 2I14A 4O57A 1M6JA 2GQ9A 3Q2DA 1QFEA 2C1HA 2Y63A 3HPZA 1SSGA 3R89A 1FWWA 3QQ1A 2NXGA 3P60A 2Y61A 3P5ZA 4JGDA 3UPBA 3TAKA 3C2OA 3VE9A 1QO2A 3G24A 1JCXA 3MW7A 1LRNA 5CZJA 2HMCA 3C2EA 4E0CA 4NX5A 4CLMA 3W7DA 4AVFA 5G2HA 3W2NA 2OX1A 1DOSA 1JCJA 3A24A 5BRBA 1G67A 2YW3A 1SO6A 3E0IA 3LRMA 4EIVA 1VS1A 4FEZA 3LHVA 1ZAHA 3DFOA 3QM3A 2V0TA 4UFHA 5AHMA 5ABTA 1IIGA 1W8SA 2JGQA 3NDOA 2Q3OA 3AO0A 3MI2A 4E2DA 1K3UA 4RZ6A 1W56A 3TMLA 2VENA 2WNNA 1DBTA 3F4WA 4RZ4A 3UYCA 1PCWA 3TQVA 1VYPX 3BG5A 3NGJA 2YXGA 3LBCA 3W72A 1AL8A 1MEIA 3ATYA 1VC4A 1LRTA 4ZL1A 2EKCA 1TIMA 4LRSA 3L66A 1QOQA 3DKJA 5AYYA 3HGRA 5AYXA 4FNUA 1TRIA 2QJIA 3O8AA 2KZHA 3NL5A 1LLZA 3NL3A 4O8RA 3IGUA 1QOPA 4LT9A 2Y85A 1BTMA 3MBFA 4IUOA 3NQ2A 5K9DA 1OG0A 1A53A 3N9SA 1OF8A 2CZFA 3HPSA 1YXDA 3W7RA 2PRMA 1PE1A 3FKKA 4MJMA 5LGZA 4LS0A 3FYPA 1LTDA 3GDKA 3WK3A 1NAL1 3PUOA 4X3ZA 1TV8A 3M5XA 3QYQA 4IX2A 4JTKA 3NQEA 1TSIA 4K7YA 5F2GA 4GC4A 2E68A 5AHEA 2TPSA 2XN0A 1VCVA 1VR6A 3C0JA 3EWWA 2W6RA 3HG5A 1H51A 4MY9A 3M1ZA 1YTKA 2ISSA 3W85A 4M6QA 1K7XA 4LV9A 1JVNA 1ICQA 5C55A 1M7OA 3BGGA 3C56A 4ONVA 3LHTA 1IGSA 2NX1A 3B0UX 1UBSA 1TTJA 3G0UA 3NL2A 4MZ8A 4MZYA 4MOZA 1RPXA 1ZY9A 3BLIA 4I7WA 2JBMA 2FIQA 4UTMA 4K8EA 2C15A 1TPFA 1U83A 2Z2UA 3R8RA 4UTLA 2C16A 4YCPA 2VEKA 4JY9A 3EXSA 2J24A 3S8HA 1JRBA 3IV3A 2QCCA 3HG3A 3P67A 2DP3A 1RR2A 4ZQNA 4PL1A 2GQAA 3KRSA 2QCGA 4NX0A 1KFJA 1R2TA 4WZHA 4JD4A 5AFDA 1O95A 5GVJA 4QM1A 3EWUA 1OFOA 1SU5A 5T26A 2RH9A 2V2HA 5FEWA 3I6RA 5HULA 1T0OA 4O11A 5DCEA 5HWJA 3NZ1A 1GOXA 3W7OA 2C19A 3S42A 5K4XA 1PL9A 4QISA 3I65A 3U2OA 2FQIA 4NXSA 3TU9A 1N55A 4DEFA 3QJAA 1D3GA 1H7RA 3PUDA 4IMFA 1JUBA 4UTIA 2OMAA 1ME7A 2ZRVA 3UWZA 3UXAA 3EB2A 4OBTA 1J2WA 1BWKA 1MEHA 3W1LA 1W3TA 3TR2A 2CW6A 1GG1A 1QWGA 1S5VA 1AW2A 5D38A 3PULA 2ABBA 4GFSA 4YLWA 4HIBA 5I3JA 3GLCA 4DF0A 5F2LA 5DBUA 2Z6IA 1H7PA 4MPQA 1SPQA 3W76A 1FCUA 3HGSA 1YPIA 2JK2A 3IIVA 3FFSA 3MHUA 3TC6A 5EL1A 1OYBA 2NX9A 3ZR4A 5K9CA 2YFOA 2VFHA 4LVFA 3R2GA 1O5XA 1G69A 3CWNA 4UMCA 1GWJA 2NX3A 4Y96A 2GVJA 3FKRA 4JICA 3EXTA 1F7BA 2A0NA 4UTWA 4FX6M 5KSWA 1ZFJA 3NQFA 3D0CA 1R2RA 1EA0A 3G1DA 1JRCA 2AQWA 1FXQA 3KRZA 4LTSA 3TSMA 2ZZ1A 1GT8A 2YPIA 2EF9A 1RQHA 1LROA 4CCCA 1ONRA 4OE7A 1W5PA 4CQAA 1IXQA 4DBDA 4Q4KA 1F6PA 3LOTA 1FUYA 4YWIA 5G1TA 3PM6A 1SR9A 5F1UA 1K8YA 2CLIA 3W7CA 1SO4A 1ZALA 2G96A 2Q3RA 1OX4B 3W1QA 1SW7A 2RFGA 1XDMA 1W3NA 5DN1A 3TA6A 3M6YA 3I7QA 3M41A 4Z0SA 2PE4A 2CZ5A 3DFTA 1ALDA 4LVBA 2CWNA 3TAOA 1Z44A 4WD0A 4S1FA 2LLEA 3M7WA 4P2VA 4AMAA 4FX8A 4N6EA 4JR5A 5BMXA 5C2XA 4HT3A 3NQMA 3UWQA 2B7OA 2J27A 3LRLA 4BI5A 4HKPA 4XQ6A 3STEA 4JTHA 5BW6A 1H7XA 4O1AA 5AHLA 3LRKA 1XBZA 2CZDA 3ABQA 3TV8A 1Q6OA 3LERA 4MYAA 1TRDA 2DZTA 3QSRA 3W1TA 1RQBA 4AXKA 1N8FA 1FQ0A 3MP4A 3TK7A 3PS7A 4Z1BA 2J9YA 4BI6A 3G8RA 2X1TA 2XN1A 1GZGA 5HINA 3S1VA 3G3MA 5AC7A 2YZRA 4QSHA 3ZWTA 1OVDA 3BG3A 1YTDA 5DCDA 3PSVA 5FEPA 2G95A 4K7VA 5IBXA 5BMWA 5MHBA 1OYAA 4GXMA 5H2ZA 1IXNA 4X9SA 1KBJA 2E77A 3B8DA 3PC0A 2ISVA 1TTPA 1B4EA 3BVJA 4ALDA 1H7WA 4IMCA 5K9XA 4UTHA 4AHQA 4ORMA 2WSQA 2O7QA 1X7FA 3BGJA 5SWUA 5DELA 3MHFA 3E96A 3GXNA 2W0UA 3RMJA 1XBYA 3M43A 2QCHA 1I2QA 2ZZ2A 1DKWA 3MI6A 5G2IA 1KFKA 1P0KA 3HPXA 3W23A 3DAQA 1XC4A 1EX5A 1HG3A 2DZWA 2PCQA 3P81A 5D04C 3DH7A 1GVFA 3DFQA 3IVUA 1DJNA 1FCQA 1W5QA 2WPBA 3A5VA 1SZNA 2OJPA 3PG9A 2ZZ4A 1WAUA 3IEBA 3EX6A 2CLEA 3C61A 3E49A 2VFEA 3DFPA 5AB3A 4AEOA 5F4XA 1TTQA 4I9AA 1JQXA 5FESA 3HJZA 3C6CA 2ZZ3A 3WJWA 4LC6A 3CHVA 1R47A 3VNDA 1ICPA 2NUXA 4FO4A 1FDJA 1WX0A 1X8FA 3LCGA 5EA9A 2GVLA 4ADUA 2X1SA 1TPVA 1RQEA 3ZS4A 4IOTA 3W7KA 1DHPA 4K8HA 1U5JA 1P0NA 2PC4A 2QUVA 4Z0JA 5LHEA 3SR7A 2BTMA 1Q6LA 5U4NA 1QCWA 2Z0IA 4QJ1A 3SSJA 2VFDA 3G1VA 3O6CA 4DF1A 1H62A 2DZXA 4Q33A 3O6DA 3EWZA 1NSJA 4O18A 4AAJA 4NJIA 3NPXA 2YGYA 3R5EA 2ZBTA 1OFQA 4R33A 4AHPA 3JR2A 5AHFA 5FF2A 2JKPA 3P5YA 2A7NA 5KTLA 1SW0A 1LDCA 3UNDA 3N19B 1WYIA 3P62A 3FJLA 4WX2A 3DI0A 4EF9A 3PUEA 3QH2A 1A5AA 4RV8A 1SFJA 1Q6QA 3R13A 1NFBA 1SZGA 1L2UA 2VEPA 3PVFA 1FCVA 4UCGA 4JTLA 1FWRA 2HTMA 1UASA 2Y7GA 1B9BA 1TTIA 2PRLA 1KTCA 3MBDA 1GJPA 1XDLA 1VQTA 3S9YA 5F2IA 3F4NA 2FFCA
chains in the Genus database with same CATH superfamily
2XZ7A 4JTUA 4H9UA 4IWWA 1Q65A 3BARA 1UOKA 2ZA1A 2A3HA 1V3HA 3GTNA 4DUOA 4X60A 4GABA 2CIPA 4M5PA 3UGVA 4AD4A 3B04A 4HOXA 3BO9A 4NJHA 1HF6A 3C3UA 3CB3A 2RGLA 4GH3A 1XCWA 5G2WA 1JCYA 1UMLA 3OO2A 2ESCA 4JHZA 3RDKA 4RZBA 3TZNA 1GOQA 4AIOA 2YOCA 4YVVA 3V1PA 1IR2A 1OZQA 3S2MA 4QNWA 1ZBVA 2A2IA 2INEA 3W7QA 4EK7A 3MO4A 3ABOA 3NZRA 1W31A 2PP0A 3V16A 3HZ3A 2ZVIA 1TV7A 1AODA 6XIMA 4LUTA 5A6LA 4LRTA 4HYRA 3IWPA 2QUTA 3O1NA 3ARPA 5TIMA 4H4IA 1GPFA 4WOZA 1Z9AA 2J9XA 3H54A 3NSMA 4JIEA 4KF1A 3EDFA 1V93A 3GHUA 1RSCA 3AHXA 5CEWA 1IEIA 3BJSA 4HK6A 2DZAA 3PBWA 1A5OC 2E8ZA 1EO7A 1Q6EA 1CLKA 2Q71A 2DW7A 1HJQA 1JULA 1FRBA 1UP0A 3LM7A 1UR9A 5M17A 4AEFA 4E8DA 3VX0A 4H1ZA 1GVIA 4M6UA 1K8XA 2R8WA 4E2OA 3V18A 1IHIA 1IF2A 1R9ZA 2X05A 2GSEA 3BW2A 3AZRA 1KC7A 3CEPA 3KBJA 1A0DA 4GUGA 4J3WA 1KR1A 2ZTJA 4HHLA 3WMBA 1DL3A 4MADA 2V5DA 3S5SA 5D30A 1BTCA 2E6AA 3UZWA 1XRVA 1S5NA 3N2MA 4PMDA 3B8VA 1R2SA 1FWTA 3LY0A 4ACZB 3LQLA 1XPGA 3GKFA 4C6QA 2I5GA 3LBMA 4R9XA 4CQBA 1QNSA 1DORA 1PKYA 3T0AA 3PFMA 4MFDA 2OOFA 2JIEA 1XXXA 1BYBA 1GEQA 5CG7A 1NVMA 1GOOA 2V81A 4NNBA 3HMJG 2EG6A 4I6KA 3U4FA 1A0EA 3CTTA 3CEUA 4AZBA 1YBQA 3AMLA 3H26A 1OEPA 2ZUUA 3WYZA 1S2WA 4JNYA 2WW5A 4FXSA 2XISA 3KS5A 1QPQA 1BF6A 4GUFA 1LL4A 1XIEA 4NXKA 2H90A 3VAVA 2W67A 1WNOA 1GONA 2C79A 4IJCA 5BWFA 1KNWA 1W6TA 4JNZA 1ZHAA 3DIPA 3ARVA 4ZO6A 1YDNA 5FSDC 3WQEA 3ZM8A 1POJA 3P93A 1VLWA 4E2VA 3OBKA 5I77A 2PD9A 2FHFA 4X22A 3PZUA 4H9TA 4P8VA 1XLJA 4XAYA 1SUXA 2DZSA 4WUIA 2B4GA 4HPGA 3O6YX 4I5XA 4JTGA 2G8ZA 1GZJA 1M5WA 4QG6A 2DY3A 1OK4A 2OYKA 1JD9A 1AMKA 2WMFA 1O68A 1JZ6A 1UMYA 2QF7A 3A64A 4Z1DA 3KE0A 4N4QA 1WBHA 3ITYA 1T99A 1LOQA 3BGAA 1G94A 4NJKA 5AHNA 2FPTA 4IMEA 3L0GA 1V3IA 5C6MA 2BVDA 3ANVA 2XUCA 4K8GA 4CEXC 4QLJA 2E1WA 2X0SA 4DZHA 2PLKA 4DZ5A 5FJUA 3UPWA 4AYGA 3NYDA 2QHAA 1AZ2A 1VFOA 4QAWA 1VPXA 1RY0A 2DIEA 1MVYA 4O15A 2IPJA 3CL7A 4H7VA 2A6NA 3EOUA 2JEPA 3CLMA 3KEHA 1RK5A 2XHYA 2IUZA 3VZXA 4PTWA 2ATSA 2WLYA 4HNNA 1RJQA 3DHDA 5FA5A 2WVVA 4PFMA 2RGMA 3VD9A 5AC4A 4L1XA 5GQBA 3AWOA 4HN8A 3PBYA 5LA0A 3W1XA 3OYXA 2BHUA 1DJGA 5KMYA 4DYEA 3GD6A 3LDVA 1V6YA 3PN8A 3L2MA 3TH6A 1Z89A 2YA1A 3IJQA 4IIBA 4N6FA 2XGZA 1W32A 4GD0A 1EGMA 2QR6A 2NVAA 1ZP3A 1MZHA 3ITLA 5D8WA 2BNJA 3UYIA 4PC8A 3WL0A 4IGSA 1ZJAA 2FDSA 2IMRA 3SZ8A 2XU2A 3WMSA 3ITOA 1JUKA 1JQVA 1OD0A 3WQCA 1XIJA 1XFBA 3L2IA 4U28A 4H8HA 1VJIA 4MY8A 1HX0A 1CZ1A 1YLVA 3PWAA 1J0IA 1SYTA 2H3BA 1L6FA 3A23A 3L5LA 3I3BA 3SCPA 4PCNA 1W54A 4DO4A 4JQAA 1G7VA 1IEXA 2W5FA 2J78A 4FMVA 1X98A 1NM9A 3AMCA 3UNTA 2F2HA 2ICSA 1FWNA 4CD5A 2QDHA 2OXNA 2VRJA 4HU8A 2VCAA 4MWAE 4DXKA 1A5SA 1JCLA 2GJLA 1FWAC 3UWWA 1NWTA 4EPKA 1J01A 4NZJA 3T0CA 2X0YA 2GGEA 4LF1A 3NPWA 4PSPA 3AROA 1P4CA 2OEMA 4HSOA 1AD4A 1UP2A 2DV0A 4GVFA 3OODA 2V30A 1UUQA 1XG4A 3H2FA 3D5HA 3BWWA 4CN4A 3ES7A 3FVDA 2PDQA 4LAZA 1O66A 4HP5A 5BNKA 4L9ZA 3T44A 3SGUA 1W1PA 1V5XA 3KBWA 3N3TA 1R0MA 1SZEA 3FAXA 3BAXA 5FF3A 1M7JA 2VKZG 4L1WA 4UIOA 4MLJA 2A3BA 2OOGA 4L4PA 2YYTA 4PMQA 2ZVRA 5CZTA 3VIGA 1I45A 5AZ1A 1HXJA 4WY0A 4LU0A 1A5BA 3DESA 4XBJA 4ADSA 3S2LA 3B9OA 4RKAA 3VINA 1EHAA 4X2RA 1NOFA 4GINA 4WCJA 3TIMA 1MYRA 1V3LA 4ZA0A 4I5RA 3IJ6A 4ZO8A 2DSVA 3CUXA 4Y9NA 1EPXA 4FHAA 1XYZA 1I2OA 5G4WA 1NDWA 3UWYA 3OJGA 3WQVA 5REQA 3C3NA 3WUGA 3UD6A 2QCDB 3G1RA 1ZAJA 3FA5A 3N2XA 1KFLA 3MSRA 2GVEA 2GJPA 2WJZA 3S5ZA 3A6OA 3HF3A 3NDZA 1BRLA 1BXNA 3RJYA 3CB8A 3TOPA 2G3MA 3HJEA 3KFTA 5M2FX 3BOFA 2A21A 1QTWA 1WXZA 3GTHA 4DJEC 1KRCC 4TTUA 2BHZA 2WM0A 2WZTA 3CT7A 3VKAA 3TTOA 3QPYA 4MJZA 4KERA 1M65A 2CC0A 5F4SA 3QYSA 3GR7A 4N4PA 2H9AA 2VRKA 1GGOA 4JX6A 4IIDA 3VE7A 4HBKA 3CUFA 1VAHA 1UWSA 4S3KA 4DUXA 4YIWA 1HTIA 3WUEA 3WZ0E 3WK0A 1KM0A 2E7FA 3AYTA 3RX2A 5KZ6A 4XBSA 1LRQA 4W7UA 3KOWA 3RILA 1VFSA 3S2NA 4AH7A 1WA3A 3CH9A 1OFPA 1CIUA 4FALA 4Q8OA 1QI2A 4WDUA 1AQMA 4IGMA 3PUGA 3S5NA 3KL3A 4AX7A 1PZ1A 2BASA 4Q4QA 1PKLA 2AQOA 3RF9A 2CHRA 2A4AA 4O4VA 1FWHC 5D37A 2ISWA 4HSHA 3VDBA 1GG0A 4NASA 2ISDA 4WRHA 3CV2A 1Q6RA 1S3HA 3TYZA 3GDBA 1QXLA 3L0KA 4GUJA 4IG2A 4LYRA 3HQNA 4GYPC 1PHWA 2FTPA 3G22A 5HNNA 1HIZA 1Z48A 4DXVA 2V5BA 4FAMA 1TREA 2OQLA 2V68A 3GG0A 3L4XA 4IT1A 2D2GA 3WQWA 5EYWA 2VELA 5AECA 1EQCA 3T6CA 5E9AA 4HNOA 4EPDC 1GOIA 4XTIA 3LCWA 1TPB1 1Y8BA 4LVDA 2GQ8A 3C2RA 2GGHA 4KCUA 4B5SA 4JTJA 2GVYA 1DWJM 1EZ2A 3LB0A 1ZSXA 3O16A 1U22A 3GIQA 3DYPA 2UWFA 1UYQA 1E6PA 5L6UA 3TX9A 1XC6A 3I3EA 1M41A 5D05A 4ERGA 3GDTA 4DBEA 4CUCA 4MUZA 4RX0A 1S2AA 3PF3A 1E9ZB 1LP6A 2VEGA 4Y6GA 2Z1BA 1V6UA 1XKJA 2QGHA 1VFHA 5HJYA 2ZRUA 1BVWA 4QJ5B 3POHA 1BG4A 4GLEA 2CBUA 3VABA 2ZADA 1JPDX 3MQTA 3MUAA 3NIYA 3W2JA 5M3WA 1XI3A 2WJFA 3O7UA 3K1DA 1OBAA 1RAKA 3QFWA 5E6ZA 4AG0A 5CSYA 2WJDA 1CB7B 1RBOB 4O1FA 3SN4A 4C5YA 1XYCA 1LG1A 4GNJA 4HA1A 2HS6A 1K7FA 4BWLC 2QDGA 3ZJ6A 3KLLA 1WDSA 3W74A 2BLEA 3EA3A 3PJTA 3DI1A 2EGZA 1S5MA 3Q65A 3NURA 1C91A 3KZSA 3M0LA 5TAOA 1QUMA 1WQ5A 1OG6A 3LYEA 3M0HA 2CESA 5CGQA 1E0WA 2ZUVA 5AYBA 1WDQA 2YBUA 2PU0A 3VGFA 1TWZA 1UJPA 2B0MA 2G0WA 2QXWA 2C18A 3E3HA 3BMVA 4ZE5A 2F8QA 1E0UA 4CD7A 5TNVA 3LLXA 4C90A 3BG9A 4LPCA 1TR1A 2TSYA 3IIOA 2V69A 1XYMA 3UR7A 4W5ZA 2B7PA 3CXOA 1S1PA 3SUTA 1J0HA 4GJJA 1QO5A 5EPDA 3BAYA 1V6TA 2OX4A 2QUUA 2V3FA 1JXKA 4D1JA 1RLDA 2KX9A 3DKLA 2P5NA 3AUJA 4S3DA 5BU9A 5HUPA 1BQGA 4DN1A 5G4EA 4BEQA 4NVTA 2W4XA 4GQQA 3AQUA 2EPHA 3KCJA 3GQYA 3MPGA 3GDLA 1FCBA 3A9IA 4LV4A 5C7HA 1IXPA 2P3EA 1MSSA 3R79A 1QPOA 2A5HA 2X2YA 1BFNA 4MSSA 4I9TA 3EWBX 2PDCA 2ACRA 3FEMA 2ZXDA 1E6SM 4BZYA 3LHWA 3W2UA 1JYWA 4NNCA 2QQ6A 3KHDA 3D47A 3VNJA 1KKOA 3WY1A 5FF0A 2PSNA 2BXYA 4KWVA 5CC3A 2ZICA 3R1ZA 4HZ6A 5D32A 1KTBA 3UPMA 4L6DA 2H3DA 4JTDA 5FF7A 2OCZA 3SQSA 3P14A 1A5NC 4JTCA 3MYOA 6TAAA 1SZFA 5M5DA 4H8VA 1EXBA 4L1GA 5KEZA 1US3A 2QAPA 2ZKMX 5JIWA 2V82A 4LW7A 2NQZA 1GZ1A 5G1MA 4KIRA 4AZIA 4HHMA 3VNLA 1W2VA 3BW3A 2PP3A 1IXOA 4KGJA 1VIWA 5A6TC 2BGNE 3W00A 1QNRA 1MXGA 4S3BA 3U7VA 3LXBA 1BSIA 2E1DA 1NWUA 3L4WA 2RDWA 2HWGA 4C6JA 2HE8A 4ASTA 3RU6A 1H50A 1YW1A 3UWUA 2TRSA 1HVQA 1WE5A 4POCA 4QFUA 3TXZA 3KHJA 4HZ8A 1VKFA 2Y5EA 4LBSA 2QKFA 1HKIA 4LBUA 1KA9F 4MNKA 1YQ2A 2OU4A 2E28A 3TONA 1DWHM 1MRAA 1ODZA 2OWWA 4UOQA 4R7OA 1RXOB 5DXYA 4JX5A 3QN3A 3EX3A 4M80A 1V0LA 3GXIA 3W1AA 1VFUA 3EAUA 4PBFA 3APGA 2WZIA 2E40A 3ZXWA 4C6EA 3CASA 4OIFA 3B05A 3LEPA 4MWAD 2OEJA 1WDPA 3WK2A 1THFD 1NDZA 3TC3A 5G5IA 3HQPA 1E3ZA 4GZJA 1CYGA 4Q4MA 4Y2WA 3UCQA 4KIEA 1JI1A 2G3FA 4GNVA 1NF0A 2OO6A 4W86A 2XIBA 4Z1CA 4GA8A 2J74A 4B3KA 3GFZA 4XD3A 2PC8A 4K68A 5D9NA 5JUVA 3PZVA 4O14A 1F3XA 2PTYA 3BTNA 2FHCA 1R30A 4AWTA 4UTWC 1PIIA 4W5UA 3KRBA 4IUGA 4XKYB 4NNAA 1GVSA 1HJUA 4Q32A 5I00A 4XVEA 5H6HA 3MCMA 1IT7A 2WNWA 1TB3A 4E2BA 4A3UA 2C0AA 3PZNA 3VKCA 1PKMA 3EGJA 2GJNA 4D2JA 1VB9A 3W6YA 1WZLA 3COTA 4BR1A 3SFWA 4DJEA 3S4TA 3VKDA 3DGBA 2D24A 2PF8A 2YCLA 2NUYA 4GY0A 4IJBA 5EMLA 3WQGA 3ARRA 2G5WA 2BY1A 5B7YA 3F5JA 5E70A 2ZZ7A 2XM2A 1VD6A 1VP5A 3MSDA 1EDQA 2Y5JA 1EO5A 3RLUA 4US5D 3RCNA 4FIRA 4TU1A 4ATDA 5D02A 2X30A 4PUEA 1ZGDA 4Q22A 2CHOA 1QR7A 1R9YA 3NQ6A 1FHLA 1Z32X 1C93A 1AJ0A 3RU8X 1EJTC 2F61A 1LZOA 1HJSA 4ATWA 4W85A 5HWMA 3W22A 3W1NA 3T07A 1G4TA 1SSDA 4D71A 1EDGA 3W7JA 3CIVA 8TIMA 1B31A 3MT1A 1EYEA 1A4LA 4H6EA 2INZA 4PBGA 1HKVA 1LG2A 2QJJA 1R3VA 3EZ4A 1S2TA 5A94A 5CPOA 3G1HA 3LLDA 4RCXA 4GYPA 2OGYA 4W93A 3DG6A 1A5MC 3LXCA 1KTNA 2V2CA 5JU6A 5HMEA 2FFIA 5HAOA 3IGXA 3MZNA 3QR1A 3S6TA 2YCIX 1QAPA 4JBRA 3UZZA 1KM6A 4W88A 5AZ0A 1F3TA 5EKYA 1UWIA 3G77A 2ONEA 7XIMA 3W4RA 1VEMA 4V1YA 4DX3A 3T78A 2EQDA 3QZAA 2I9UA 2Z1SA 1Q8JA 4M6VA 3G2GA 1V02A 3C2VA 2GSHA 1X6UA 2E5CA 2C8NA 3RRXA 1TPUA 2C7FA 3M9YA 1F3EA 3EMQA 4WKFA 2B31A 4HSNA 1Y65A 6A3HA 4DF2A 1UCWA 4H9XA 4Y7EA 1XX1A 4F8XA 1OFBA 3QLLA 2NV9A 3GNPA 3N12A 3GXTA 1EOMA 1B30A 2WBKA 5CZSA 1BKSA 5KZDA 2PP1A 1PJ9A 4IFOA 1Q66A 4BWLA 1PEZA 4XIAA 1UG6A 3WEOA 3QY7A 2C91A 4J4KA 4W87A 4RR4A 1ZQ5A 1D7FA 2PURA 7ENLA 3F5KA 1OFDA 3HQ1A 1XWYA 2VVNA 2I14A 1OZMA 4O57A 2GQ9A 2ALRA 2Y63A 4F0LA 2Y61A 3P5ZA 4JGDA 3F4CA 4ZBCA 5I0DA 3UCDA 5TF0A 1UPMB 3G24A 2DSZA 1V03A 4B15A 1LRNA 1HKKA 1KGXA 5CZJA 4E0CA 1A3WA 4D6FA 4CLMA 7ODCA 3W7DA 4LFYA 5G2HA 3W2NA 2GLKA 1DOSA 1JCJA 2YW3A 4P7RA 1VS1A 1AZ1A 3GRIA 3NDOA 1W8SA 2JGQA 2X7VA 2Q3OA 4GO9A 1TZ7A 4G5DA 4RZ6A 2VZSA 1I6NA 2NQ9A 3UYCA 4JQ1A 1ZZMA 1OC5A 3WF3A 3TQVA 2WHKA 4L61A 2WC3A 1DPMA 3W72A 1VC4A 4KEMA 4CNTA 2EKCA 3NDYA 3NZPA 1VBJA 1QOQA 4FNUA 2O9RA 3MSGA 4M29A 4O8RA 2ZE0A 2D0FA 3NQ2A 3CV6A 3GBDA 4C6CA 1XFCA 1ENUA 3N9SA 1OCNA 4FI4A 3H4WA 3T0TA 1JFXA 2DVXA 1CB2A 2PD5A 1VPQA 2DT2A 4FZIA 1TX2A 5LGZA 3TEVA 2WMGA 4LS0A 1LTDA 1QHOA 3PUOA 3WNPA 1TFVA 2G3JA 4IX2A 4JTKA 2X0HA 1TSIA 5F2GA 4IICA 2TPSA 2XN0A 1VCVA 3AICA 3RLHA 4GI9A 3M1ZA 1YTKA 4HYWA 1IGSA 1UBSA 1TTJA 3G0UA 4LUSA 3SADA 3W28A 5BRPA 3RGTA 3VC6A 4I7WA 2FIQA 5GPRA 5JMUA 1S1RA 4YCPA 2ACUA 2VEKA 3EXSA 2GDQA 3OPSA 4C6OA 1JRBA 2QCCA 3BLDA 2DP3A 2O56A 2P76A 4F2UA 2QCGA 1SFTA 4XD6A 4QM1A 3EWUA 2Z7KA 2X8RA 1U5HA 4S3CA 5C2GA 3A12A 4AU0A 5HULA 1T0OA 5DCEA 3NSXA 5LA2A 3CMFA 2R9RA 2BG5A 5CXPA 1PL9A 2AKMA 3U2OA 4MNJA 4NXSA 2GDUA 4AY8A 2EEXA 3FW6A 4DEFA 4Q7BA 1D3GA 4L6OA 4IMFA 1KWKA 4JL1A 4UTIA 2GOKA 4L5ZA 2ZRVA 3UXAA 1BWKA 1W3KA 1MEHA 3JU2A 3W1LA 4OJYA 4WF7A 3ZR6A 1XIGA 1NFGA 1X6NA 3CQJA 3ISIX 3THCA 3UGRA 2OFJA 4FOKA 5F2LA 1IEVA 5A6BA 4MPQA 3ES8A 4B9YA 1XH1A 3BLKA 3TC6A 5EL1A 2NX9A 3RJXA 4IHCA 3ZR4A 1ONXA 5CC5A 4Q8TA 5K9CA 2GZXA 3R2GA 1NQKA 3W82A 4Y96A 2GVJA 1IGWA 3K8LA 4UTWA 2PDPA 5CBIA 3CUIA 3V35A 3OQEA 4GPNA 3NQFA 5DMYA 3BQ5A 1EA0A 3G1DA 1JRCA 3W02A 3KRZA 4H7ZA 1LROA 1ONRA 3SAZA 3KP0A 4W8BA 1XLAA 1JFHA 4XSLA 4TVDA 3VZZA 2G3IA 3H7RA 1IXQA 4DBDA 3GC5A 3ZLGA 1RH9A 4YWIA 3TJIA 2BBFA 4AY7A 4GI4A 1SO4A 4XAPA 4LYQA 2XM1A 3FYYA 2G96A 3U4AA 2PWEA 2RFGA 3T2OA 1EHNA 2DEPA 2HJPA 4WD0A 4A8LA 1E70M 1TV4A 4DBSA 4P2VA 4FX8A 5BMXA 2DIKA 3N13A 3EBVA 4JTHA 4GZEA 4O1AA 4AD0A 2BVWA 2CZDA 3TV8A 2DZTA 4AXKA 4AFYA 2F38A 1FQ0A 4FLOA 2FGLA 4JFWA 3PS7A 3QPEA 3CQHA 3SCSA 3VMPA 3IANA 2WKGA 4FLRA 1GZGA 4HHHA 1O6IA 3R0UA 4PN2A 1EC7A 3N2TA 3ZWTA 1YTDA 1UH2A 5FAJA 1J0JA 4K7VA 5BMWA 1OYAA 4GXMA 3VIFA 5H2ZA 1RVKA 1RP8A 2MNRA 4DUWA 3C0LA 2E77A 3GXDA 1EEXA 2ISVA 1GCYA 2Q09A 4ALDA 3CAQA 4UTHA 2J66A 2O7QA 3AI0A 1X7FA 3BGJA 3MHFA 1HP5A 4ZODA 2Z00A 3GXNA 2W0UA 1XBYA 3BV7A 2QCHA 1JZ7A 1KFKA 1P0KA 3W23A 2IKIA 9RUBA 2PCQA 5D04C 1J0KA 1IV8A 1ECEA 3DH7A 2QF8A 3DFQA 4YYFA 3K4DA 2X40A 3PG9A 1FOBA 1WAUA 2DSWA 3JZUA 2CLEA 3C61A 3E49A 4KCWA 5I78A 3UCCA 2VFEA 5HQMA 3WH8A 1KCXA 4TOQA 6ENLA 3CT2A 1EJRC 1VFLA 3HJZA 3T09A 1MQRA 1F9CA 3BMWA 2NUXA 1Q6FA 4R85A 4KCTA 4ADUA 3D6NA 3FDGA 4QSFA 1TPVA 4HMDA 1CLXA 4X0VA 1P6CA 3AJ7A 3W7KA 4DI8A 1U5JA 7A3HA 4Q7NA 1P0NA 4IZGA 2NVDA 4MNMA 4Z0JA 3SR7A 1LT7A 4B3ZA 5U4NA 3GSMA 3EMCA 1V6XA 2VFDA 3RRAA 4LALA 3G1VA 3O6CA 3N6HA 4DF1A 1H62A 3U3HA 3LG3A 3K1GA 1J96A 4O18A 4ROQA 3FVMA 1UZDA 3QC0A 4HQVA 1OFQA 2Z1XA 1H09A 1NOWA 1OGSA 3IAQA 2QGYA 2X7WA 4C6MA 2DFAA 5KTLA 3NVDA 1B3ZA 3S46A 2WHJA 4LX4A 1W9XA 3URBA 1TWIA 1Q63A 3SQMA 3DI0A 4EF9A 3GTFA 3T8QA 4RE3A 4LB4A 2P53A 4B3LA 2X42A 4W89A 1I75A 3IJDA 1Q6QA 1MFVA 1CXFA 2HTMA 1XRTA 3VOIA 3ARTA 1WKEA 3SB0A 2YZ5A 4S3JA 2Z27A 4RW5A 2OYLA 4DLMA 2PDUA 2Y0FA 1VF8A 3F4NA 1DV7A 3QR3A 1HFBA 3WQDA 1OX5A 3N6JA 3TQ0A 4AF0B 3KVJA 3OVPA 2NLIA 1K8ZA 3PJUA 1P6WA 2PDMA 1FVPA 3KTXA 5JXQA 2E5DA 1W5MA 2C0HA 3SUSA 3N18A 4LNYA 2WMIA 3KOFA 4BY3A 1ZS2A 4MB5A 3ANYA 2V2DA 1QPRA 2CCRA 1WKFA 2BGSA 1CTNA 3ZT6A 2Z2AA 4HCHA 1KM4A 4IQJA 3EA1A 4AWUA 2DSUA 1TPWA 1LT8A 3HMCA 3L21A 1ZBWA 4OBSA 3E12A 4W4QA 2Z25A 2P50A 2YYUA 2PGWA 2JKAA 4KEUA 4E6MA 3F1QA 1P7TB 3K2GA 4AHOA 3HU7A 5IRPA 4D6CA 1JL8A 1L6GA 2JGYA 3W81A 1JZ2A 4DWSC 3WQFA 3LA4A 1IEWA 4UNIA 4N9CA 5H8UA 1QI5A 2XVPA 1YXYA 1B4KA 4TX9A 2ANUA 3M16A 1PO9A 3AUOA 4I8DA 1MO0A 3ERPA 3AJXA 1NTHA 1RLCL 3BL3A 1Q2RA 4JFTA 3AS1A 3I7RA 4O16A 1E51A 5CJMA 3T1GA 3PPCA 1W9VA 3SUWA 3CWHA 4DO6A 1HKJA 3K30A 4LB3A 3M0ZA 2V6AA 2EO7A 2E3ZA 1CXIA 3BK0A 4M1BA 5I3KA 1I4NA 4BA0A 4JTTA 2X2GA 3OIHA 1JR1A 1K7EA 3A5FA 3W53A 1GKQA 3SCNA 4K36A 4M24A 3U2ZA 2Q8LA 3TCEA 1BYDA 5AC8A 3GYCA 1R87A 3NUKA 2QULA 4DJDD 1E6QM 3QW3A 4FB7A 3P7YA 4IPPA 3OVQA 4RDWA 3K4WA 1P6BA 1MQPA 5HOSA 4ZTXA 2EAWA 1UHVA 2PAJA 4E8GA 1I0BA 3MO7A 5JIPA 3CZKA 4F48A 3DBPA 2G50A 2CFFA 4GCXA 1VFFA 3VNYA 1J0YA 4NIRA 3F2DA 4L56A 4P8UA 3QKEA 3PZMA 1UWTA 3MMDA 4NYUA 3LN3A 3WK1A 1XH2A 1NP0A 2MANA 1PDYA 4IGHA 3IARA 3PPFA 3QFEA 1F6KA 3GO2A 4OECA 2PDIA 3CIWA 2XTKA 1BF2A 1VCGA 4JAWA 4M51A 4PRWA 1WBJA 4IIGA 4AF0A 1F61A 1W9UA 4WR3A 5M1TA 4A3YA 1POKA 2YW4A 1BSLA 3MYPA 3MANA 3FIGA 2FZDA 4LAUA 2HSAA 2VFFA 1DWGM 3GX9A 1PXGA 3KVLA 4C6FA 1EX1A 3WDJA 3OQ8A 1PIFA 4B5UA 4IP4A 3BUVA 2OT1A 4UTTC 3MJMA 4S39A 1AH0A 4PUJA 3AZSA 5DY3A 4BFAA 3T40A 1PWLA 4NF7A 1UB3A 3CPRA 3FN9A 2JF6A 3LGEA 3RHGA 4EPEC 3IJ8A 3A3XA 1UD6A 3PBVA 5HNRA 4Q4OA 2VC7A 3GAYA 1B5TA 3THQA 2J7BA 4PBEA 2PLCA 2Y1HA 5CC6A 3TOYA 4D8ZA 3N3MA 4UQCA 4C5ZA 1QI3A 3WNLA 3NQ7A 3GVWA 1HQTA 4B4HA 2Y7DA 3EDJA 3OG3A 3ITXA 3F03K 5HMDA 4HJWA 3TJLA 4O19A 3GAKA 3NM3A 5EY5A 3E74A 5HPOA 4KETA 4EWJA 1LWIA 3O0KA 1O5RA 3WD2A 4AVOA 5D2YA 4CNNA 1KFBA 1TYGA 5MKGA 3T2PA 5C54A 4ZQMA 4CU8A 2OSYA 4ADTA 1UH3A 4EVZA 3AZTA 3O9NA 3GVVA 2UV8G 2FTYA 4TMBA 3PPGA 2B7NA 1ZJBA 1MFUA 2A3LA 3B9DA 1E73M 2Y7FA 5F4WA 3UG5A 1EBGA 4UUIA 1H63A 2VXNA 3LM3A 4XZHA 2J7DA 3KS6A 1L0PA 2J7GA 2FVMA 4PTNA 1YNPA 1F73A 3OU8A 2VC5A 2DJXA 3VI2A 3WDPP 5K4ZA 4HGXA 2V5CA 3KOZA 2PZ0A 3WJYA 3VUSA 1Z8AA 4YN5A 2PF0A 3MVIA 3UJFA 3GHTA 3ZWSA 1KWGA 3BCFA 4JY8A 1Q45A 3DFHA 3LBOA 1FXPA 3I4EA 1TPDA 1RA5A 3W75A 4KRTA 1LOSA 3QV6A 2O4QA 4PMOA 3T81A 4XAFA 4ZTYA 3VCCA 3FA4A 4HA4A 3ITTA 3B8TA 4Z2GA 2GWGA 3AU6A 3FYOA 2Z24A 2RDUA 1OC7A 3MDUA 3WFAA 3CL8A 6PTDA 4H41A 5K2ZA 2DT3A 2DSKA 1X38A 5G1YA 1JDEA 1MXSA 2PA6A 4WKAA 2XH4A 3TQKA 1JZ8A 4RNHA 3IAPA 4Y9OA 4PFHA 1CI1A 4MVAA 3W71A 2VP8A 3L7RA 4KGLA 4N9EA 1TQXA 1KBKA 1BYCA 3AIQA 3L68A 4UR7A 5I03A 3C2YA 3A4JA 1IWPA 1PX8A 4L9XA 1TA3B 1PVNA 4CNPA 4D9PA 4Z2KA 3SUVA 5FOOA 2P1FA 1MUWA 2E9BA 2W63A 5A8GA 1YPFA 3UESA 4JDYA 3OLGA 1P1XA 3P82A 1QMLA 2WPGA 1OB0A 2X1RA 1MNZA 4JYEA 4LSBA 1E56A 4GO8A 2XFWA 1F2JA 3MUY1 1V3MA 4O0KA 1ZCCA 3FSTA 4YHEA 1XIHA 4NG3A 1BWLA 1Z41A 2C3ZA 4XKMA 5CCZA 3CAWA 2EPLX 4JXCA 4XZIA 1XH0A 3ITGA 2D3LA 1I0DA 3MB9A 3M47A 4MDOA 1AW1A 1K9FA 1EJVC 1VYRA 3MUXA 1EP3A 3GNXA 2HXTA 2CLHA 1KRMA 5AC6A 2I9EA 1TV3A 2BXZA 5FF4A 3TFCA 3WFZA 2UBPC 4HNVA 4GWEA 3HFTA 1FFQA 2VDIA 2W91A 1I2RA 3TTEA 2O9TA 1WPCA 4DELA 4DYKA 4LCQA 1PV8A 1M04A 1XBVA 4S3EA 3UXLA 3CQIA 3K46A 2BWGA 4AC7C 2W61A 4GYFA 2F9RA 1CGTA 1KFCA 3SURA 4B90A 4AZCA 2REQB 1C9DA 3KCOA 3QZEA 5LNVA 3W86A 1HN1A 1FX6A 3WX7A 3L5AA 4CCDA 4DWSA 4W7WA 4QCEA 3NG3A 5H1WA 4DJFD 4PUNA 3GTIA 4G8TA 1FDYA 1EJSC 1HO1A 3QKZA 3VX1A 2OR2A 4RZ5A 3VGEA 4IP5A 4K6AA 3STCA 3WMLA 2ZYFA 3AXKA 3T4WA 3WJSA 3VD4A 1H7NA 1S2VA 3C86A 3U7BA 2WCAA 3MDWA 2W27A 3PTDA 4LGXA 3Q94A 5ABHA 3ABXA 5EMKA 3OLIA 1E3XA 3N04A 2VWSA 4JKKA 2ABAA 3G6MA 3WIJA 5HPCA 4W8AA 3PR2A 1EIBA 3WFLA 1VJZA 4M82A 4YPJA 4AQLA 1RPKA 4Z1YA 3BLEA 1EEPA 2UY3A 4O8AA 4REQB 5C5YA 1GYMA 1KCLA 4ICMA 2XJ7A 2YIHA 4U33A 3RM9A 4XZWA 5CPSA 1QNOA 4D6DA 3E02A 1XIBA 3GH4A 1WAWA 2Y2WA 3WLMA 2ZXQA 3S0CA 1O12A 2FLIA 2QDDA 4K38A 1CXLA 4GBUA 4QQ3A 3KLKA 1RUSA 4M8UA 3H2CA 3NEHA 1T8XA 2JE8A 3FNDA 1XLDA 1I1WA 3SY8A 4Q8MA 1HL8A 2P10A 4PRRA 2VFGA 5EMMA 3GB6A 3M0IA 4G6CA 4JFUA 1KLZA 1V7AA 3ARZA 1R85A 4EWND 2VZVA 3R11A 4GMEA 2XWDA 3WF2A 3R4IA 1AMYA 4ZSTA 3B9AA 4QEEA 2GOUA 5HQLA 3CPGA 3W2KA 6REQB 1AL7A 3RNDA 3I68A 1JG9A 3U0HA 1KW1A 1B54A 2G3NA 2PDXA 3V75A 4N2YA 2GGJA 4GH1A 2BZNA 3E38A 3N14A 4QLLA 1TUXA 4GRSA 2V5LA 3SJ3A 4CCEA 1EGZA 3BV4A 3SCTA 1UA7A 4UTTA 4J35A 1K6AA 3MMTA 3S5YA 4FXFA 4FNPA 3OZOA 2QMJA 4RNJA 5BROA 1EP2A 4GUHA 1CECA 2VC6A 3M0YA 3QQ0A 2YCEA 1DJWA 3EWYA 1QU4A 2OELA 3OHMB 1N7KA 3WLKX 2REQA 4AX6A 3LV5A 1ZTVA 3VMNA 1EOKA 3WLTA 4IQEA 2ON3A 4H8UA 4QROA 3AIVA 4S2CA 3VNKA 3F7JA 1RD6A 1E1CA 4GIYA 2Z28A 3OTRA 1CX9A 3L67A 4ZQPA 4EP8C 1QW8A 5BRQA 3CUJA 4NU7A 4FOJA 4E38A 3LSBA 3V5CA 4MWAB 3SIZA 2ZUMA 4FP1A 3CPUA 1MUMA 3BZJA 1H60A 3O07A 3U8GA 1UROA 5E0FA 1TMLA 3MS8A 3T7VA 7REQA 4AZ5A 1U2YA 3H55A 1YX1A 4P7OA 2DZVA 2Z6JA 2EHHA 3CM4A 1L9WA 4US6A 1P0EA 1DJIA 1DWIM 1L8PA 4RNIA 4MAZA 2XFYA 3PB2A 2DJLA 4QHRA 2WJEA 4WXYA 5C0QA 4CKQA 3FV9A 1E9IA 3ZVIA 5AOUA 3NOEA 2AL2B 3LNPA 4BHYA 5RUBA 2POTA 3T42A 3CJPA 3P0XA 1JJKA 1UR3M 1TX0A 5I02A 1Q13A 2NWSA 3E2VA 1UUMA 3BSMA 3A9BA 2NVCA 1DWAM 1TVLA 2WYSA 1DQWA 3UG4A 3U48A 1OYCA 1W1A1 3CZLA 2CEQA 4CD4A 4O1DA 4ZVJA 1E5JA 2ZTKA 2RUSA 4UNKA 1NP2A 4ZXOA 1JXJA 8A3HA 2XDFA 5ABEA 4O1CA 4PB3A 1NEYA 3LTPA 3AC0A 3B0XA 1GW1A 1UWAA 3WLQA 3B0PA 3M44A 3KBSA 4AZHA 3AFBA 4XD5A 4R88A 4OWGA 5LIKX 1GQNA 3POCA 2WZEA 5CZKA 4XUGA 2NW0A 1NDVA 2OB3A 1DIDA 5ABFB 2GL5A 3EKGA 2O92A 4UQDA 4XBKA 5FCZA 3D3AA 2CBJA 2ZDSA 2INFA 1P0DA 1I2NA 4X61A 1DHKA 1X96A 3IIPA 3EEGA 1UQYA 1QOXA 3VK5A 3O15A 3L9CA 3MKVA 4QG9A 1Y0EA 2DUXA 1NF7A 4K3ZA 4PSRA 1J6OA 4HMNA 3FOKA 4B5XA 3EB4A 3LMZA 5BOFA 1YXCA 1XPYA 1JPIA 1R3TA 3LCLA 3HGJA 4QP0A 1WOAA 1ISVA 2OZ8A 3M0KA 2EPMX 2VCBA 3L65A 2WB5A 4L64A 3UJSA 4O1BA 2H8ZA 3TN5A 4S23A 2XWEA 4TV6A 1ZBKA 5CLWA 1VFMA 1VRXA 2EG8A 4JKMA 1QHZA 4IMGA 1H3GA 3WNKA 4MB1A 1AVAA 2OKOA 2NUWA 1RY8A 1MDLA 3N29A 2GJXA 3A47A 1A3HA 4GQBA 4NHVA 3C52A 3EWDA 5FACA 4MIMA 3E2QA 1ITXA 1TO3A 5A6SA 5DY2A 1Z7AA 2PODA 3P74A 3CTLA 4BK9A 2D73A 2AAMA 2XN2A 2Z26A 4KESA 1TE1A 1ICSA 2I5IA 3TWAA 3VDHA 2JEQA 1IYXA 3ECQA 2WZHA 4JEJA 1FWJC 1R5YA 1YNQA 3NWRA 4FIQA 3CMJA 2VGIA 3GM8A 1PSCA 3ZZ1A 3JZEA 1WXYA 1OC6A 2HEJA 2ZRZA 2YSWA 1OFAA 4C1NB 4GIAA 3TYUA 4AY1A 3KAOA 1KM2A 1KV8A 3CHFA 1ADOA 3HA1A 2QJHA 4C1LA 4R53A 3TNOA 4D6GA 4LWWA 1J5TA 5GNXA 4A29A 3TFXA 2FH8A 2A3CA 4X63A 3WD0A 1E6XM 3WH6A 3NPVA 4GISA 1W1IE 2RJHA 1DXIA 4XAZA 4XWUA 3S3GA 2R1LA 4XZBA 3NA8A 1YDOA 3HB9A 2QDEA 2FHBA 2C1IA 2QCFA 4JYFA 4JOMA 4NJJA 1UKSA 1KR0A 3WDRA 4P7LA 1OF6A 4US5A 4FK9A 3H2NA 3G1XA 2FMNA 3W83A 1JZ4A 1XS2A 2B7QA 3FXYA 4OHQA 2Y89A 7TIMA 1REQB 3CZJA 1RZMA 1T96A 5IBXC 5PTDA 2JIWA 2ZX7A 1SO3A 4CU6A 3W27A 1WCGA 4IFRA 3CU2A 1XUZA 4MHBA 3DEQA 3L2LA 1QATA 2NSXA 4L4OA 3M5ZA 3VM7A 5FJTA 4O13A 1HT6A 3OZMA 2HK0A 5LNSA 3NR0A 3R10A 1HW6A 3CQKA 1F4HA 5LZLA 3LQGA 2ODOA 1JNEA 4V1XA 4B4FA 4YTSA 1TWDA 3WH9A 1GQKA 1SW3A 1RJRA 1E4NA 1EB3A 5CSRA 1R7OA 5FJOA 4IL0A 1MMFA 5D33A 4C60A 2VL4A 4X0NA 3O63A 3ARUA 5ABGA 4HVXA 2WWDA 1FFRA 4GFIA 2YCJA 3BW4A 1RBLA 3UEQA 3OVGA 4CD6A 1KM5A 1MRQA 1WO2A 3QZ6A 5LNRA 5FJJA 3UWEA 5ECVA 1W3JA 3V0SA 2NQ5A 3B03A 4XIMA 4IPNB 2EPKX 3T55A 1D8CA 1JAEA 1EJXC 1G4EA 1H11A 3GG8A 3AOFA 3GZAA 3SEPA 1GW9A 3WF4A 5C8BB 4TR9A 2J88A 1H7OA 3GYEA 4Q8PA 3LPGA 4EAYA 1NU5A 4GKTA 1LWJA 5B7ZA 1E40A 4U31A 1AUSL 2DH2A 4GC3A 1WP6A 3QOMA 5GNZA 4TVCA 3WQ5A 3TJ4A 1W8GA 4IMDA 4X9YA 1S5WA 3VIMA 3GDMA 3UZYA 4DO5A 4EACA 4IX0A 4IL2A 1SJAA 2QUMA 1FY6A 1M6JA 3DOPA 3AXXA 3WH5A 4GQRA 3OBEA 2ZUSA 1FWWA 3TTYA 3WLJA 2CBVA 2XPKA 3UPBA 2YL6A 3VE9A 2PDNA 2J8TA 3MW7A 1V3JA 3E0VA 3C2EA 4NZ5A 3QHNA 3VGHA 5BRBA 2J47A 3E0IA 4EIVA 4DY1A 2VJXA 3LHVA 4I8YA 3QM3A 5AHMA 2XVLA 1K4GA 4PTXA 2F6XA 3GU1A 3B0YA 5A2AA 2VENA 1V51A 1DBTA 1KBBA 5I09A 3GIPA 3SUUA 1PCWA 2NSOA 5IDZA 3BG5A 4LYKA 1G1YA 1MEIA 1OGGA 3L66A 1JDAA 3HGRA 1VJSA 2WCSA 1Q7MA 2KZHA 4TV5A 2PGRA 3IGUA 1PZ2A 4EAMA 3QGAC 3V3WA 4PZVA 1E0VA 3DYMA 4Z2JA 2WSPA 3UFYA 3EDKA 3SCVA 3W7RA 1PE1A 3BLPX 3L4ZA 4J27A 4G56A 3GDKA 3BOXA 1NIUA 3M4HA 3UBPC 4X3ZA 2CYGA 3NQEA 4K7YA 3BAKA 4GC4A 5FD0A 2XIMA 2VOTA 2E68A 5AHEA 3CS2A 1TZZA 4ZB5A 3N6QA 3ZLHA 4MY9A 3KP1A 2ISSA 1RJPA 3HFYA 4LV9A 1JVNA 3I4KA 1FH9A 1ICQA 5C55A 1M7OA 3BGGA 3C56A 1IWBA 2NX1A 3B0UX 1Q6DA 4MZYA 2PDHA 1FKXA 3R7MA 3H7VA 3MMWA 1TPFA 1TJ1A 4UTLA 2PTXA 2J24A 4QGCA 3IV3A 1UOZA 5A3HA 2IW0A 2BFGA 4PL1A 2GQAA 3TW9A 4EPBC 1KFJA 1ITQA 3E5PA 3VIOA 2O0TA 1O95A 4LQ1A 1UJQA 1OFOA 4HA3A 1SU5A 3GTXA 2RH9A 5T26A 4FR6A 5FEWA 3K5XA 3I3DA 4O11A 1UWRA 2G4JA 3NZ1A 1GUVA 3TTSA 1V4YA 1XHGA 3H2MA 4PTMA 5K4XA 1EPVA 3PBGA 2FQIA 4ATLA 1XCXA 3PK7A 4DJDC 3W38A 3QJAA 3LSCA 3ZJ8A 4B16A 1ME7A 1UD8A 2D2JA 1CPUA 4OBTA 3WELA 1J2WA 4CGTA 2FDMA 1KBLA 3TR2A 1GG1A 1AW2A 3RMEA 2YXXA 5I3JA 3DFYA 1EDTA 4DF0A 3UA4A 4L80A 3RX3A 4CVUA 3OZPA 3VILA 4GX9A 3ZQ9A 3HGSA 2JK2A 3UZXA 3MHUA 1ZBCA 1OYBA 3CUGA 5E0CA 4XUYA 1UQZA 2BHYA 2IKHA 1G69A 2PWVA 1DJXA 2WKLA 2BP1A 3LUTA 3WEZA 1F7BA 4OOUA 1ZFJA 4QDMA 1BVZA 2HCVA 1R2RA 4D8AA 4RPQA 2AQWA 3WSUA 4M1RA 2YJQA 3PTKA 2YPIA 4QX4A 1B2YA 1C8QA 3S6OA 4OE7A 1W5PA 2QNEA 3VNIA 3A3HA 2ZX6A 9XIAA 4Q4KA 3LOTA 4S3GA 2PWHA 3PM6A 1SR9A 2HPMA 4ACZA 3NQBA 2HQAA 2CLIA 3II1A 4NSBA 3C8NA 1OX4B 4BQ2A 1XDMA 1W3NA 1NOUA 5DMNA 1C7SA 3RITA 4Z0SA 3U2CA 2CZ5A 1ALDA 3K8MA 2YLLA 3AHZA 4PUDA 4S1FA 4QDWA 4AMAA 3HV8A 2XVGA 5C2XA 3NQMA 2XFFA 3LRLA 4J2PA 1V0NA 4BI5A 1VBGA 2VD8A 2ZX5A 4XQ6A 1E6RA 1H7XA 5AHLA 3LRKA 3QR0A 1XBZA 4Y9PA 3ABQA 3LERA 1CXHA 3W1TA 1RCOB 1RQBA 4OUEA 1YIXA 3CK5A 2XH2A 3MP4A 3TK7A 1H0GA 5LIYX 1WKDA 4Z1BA 2XN1A 4WSJA 5IHSA 2YZRA 4XD4A 3W6MA 4HTYA 4GHRA 2G95A 5D9OA 5IBXA 3F4DA 2OWXA 1A80A 4X9SA 4YTQA 4DJED 3BVJA 1R6WA 4AHQA 5I3DA 1E6NA 1K1DA 2EBNA 2W3ZA 3EPNA 3GH7A 1S3TC 3HPXA 2CETA 3UJRA 1PKNA 3R6IA 3CHDA 2PTDA 4F3HA 3MZ2A 1GVFA 3PP7A 1DJNA 1FCQA 1W5QA 3BAIA 4KBXA 1DE6A 2ZZ4A 4NZ1A 3F2BA 3IEBA 3LZ3A 3RAOA 1LLOA 2P8CA 5AB3A 3H4GA 5AY7A 3EPMA 1KQZA 1TTQA 1C90A 1U33A 3ARYA 1JQXA 4U2YA 3R0DA 3B8WA 3C6CA 2ZZ3A 3WJWA 3WQ4A 4WDXA 3CHVA 4EXAA 4AUBA 1R47A 4DZAA 4OTKA 1EXPA 4UTFA 1ICPA 2DPEA 1FDJA 1X8FA 3GS6A 3LCGA 5EA9A 2GVLA 3VD7A 3AHTA 3GVRA 2QUVA 2BTMA 4TX6A 1PX4A 3OBAA 1QCWA 3AIUA 3ZMRA 3SSJA 2FZBA 3FGCB 5FAGA 3B8SA 3MC5A 2QIWA 2PTWA 1AA1B 1Q6GA 3B8IA 3EWZA 4YJ5A 4NJIA 2YGYA 2RJGA 1SZRA 4YWSA 1FKWA 2ZBTA 4R33A 3C5QA 3H70A 4MPKA 4H01A 3P5YA 1T40A 2QV4A 3UNDA 5BU6A 3P62A 4WGHA 4HU0A 3FJLA 1E1EA 1X39A 2OZ3A 3R13A 1E71M 1XD1A 1L2UA 1QW7A 1BWVA 1FCVA 3B9NA 1TELA 1MW0A 2FH6A 1UASA 2HVMA 2IKGA 4WDWA 1UW9A 5CBJA 4LANA 1TTIA 2DH3A 1XDLA 1LWHA 4H8NA 3S9YA 2FFCA 1XQLA 2OZTA 2YFNA 3L4UA 1XGDA 3C8FA 5KINA 3R12A 3VUPA 1GVEA 4HPXA 2WC4A 3B8UA 4UTKA 4JCMA 1XM3A 4JDBA 1VLIA 4NQ1A 2OLSA 1XINA 2FB3A 2C14A 4QDPA 3W7LA 3TE9A 1WV2A 4TIMA 1SFLA 3KL5A 2Q8ZA 4B5NA 3SY5A 4LAMA 1MW3A 4W84A 3HTWA 4XX6A 5IHRA 3OA3A 1CGYA 4YCOA 1GHRA 4O53A 2ZWZA 3ZFHA 3D46A 2X16A 1KV5A 3M07A 2QEZA 5I79A 4D72A 3AMDA 5D2XA 4A21A 3NO5A 3PY2A 5HMFA 2WK2A 1OADA 4AIBA 5FJRA 3U9IA 4O52A 4C7DA 2GGGA 1FP8A 4JTIA 4XISA 3VIKA 2VX4A 2ZFAA 3RO6A 2ASHA 2OODA 5LHFA 2V3EA 4KFPA 5XIAA 2QW5A 3S5OA 5GJNA 3W07A 1ZRQA 3H2AA 2J6VA 2YL9A 3LXAA 1I8JA 2HNHA 3KBNA 1TG7A 2W92A 1UR0A 1UZ4A 2FYMA 3PSWA 3FX4A 1VPYA 1E5NA 1YKWA 3DHPA 4FXJA 1DQXA 2VCCA 4JFSA 1JZ5A 1F8MA 4ICCX 4OZOA 1AW5A 1B3OA 2R14A 4B2DA 4D6EA 3TKFA 2NQJA 2O9PA 4DHGA 5H8MA 4IQLA 3UR2A 3CV7A 3EX1A 3GUGA 1UR8A 4HCLA 3JS3A 1W1VA 3GE7A 1FH7A 5TD4A 2E0PA 2CKRA 1FWDC 4A8RA 5LIUX 4IMAA 3PG8A 5D2WA 3P8JA 4K2SA 1EUNA 3H4XA 3PANA 1OD8A 2Q6ZA 4AC1X 2FPYA 4I6VA 2BV9A 2YXOA 3GNNA 4N9DA 4XO7A 2CHNA 1JCMP 1XJBA 4WKHA 2QUNA 3W01A 3ALGA 3CYJA 4NAEB 1EIXA 2YX0A 2GUBA 2QCDA 5E1QA 1NQ6A 4C6PA 1O60A 4N0RA 1D2KA 3WQ6A 1J4EA 4LS1A 1SQ7A 4LEFA 1LLWA 2IPWA 4DJDA 4XTDA 3NZQA 4OFCA 2R1NA 2JKEA 1RD5A 1ZUAX 3BC9A 3LHUA 3AHVA 3THDA 4EF8A 3QEZA 1MDRA 5BXSA 2VRQA 1SR0A 3GR8A 2C13A 1XISA 3RG6A 2PUZA 3C0QA 1L6SA 4L65A 2WZMA 3VIHA 1U1HA 1KBIA 1F3WA 2CITA 4NILA 4C1KA 1T5AA 3W87A 3UG3A 3VZYA 3FDKA 2YA2A 2PDKA 4PMUA 3M5VA 2IKJA 4D8LA 2GDVA 1IT0A 4JS3A 1FP9A 4R7JA 5DLCA 1EWDA 3UQNA 1FWSA 2YR1A 3EB3A 5IOBA 1XLHA 4AWEA 3ZIZA 2BSLA 2ZXBA 1JD7A 4H04A 4K39A 4C6BA 3EMZA 3FJNA 1TJ2A 2NXHA 4AW7A 1GYNA 4HZMA 3ATZA 8RUCA 2BOFX 3SRFA 2DT0A 1MWOA 2X1IA 2PBGA 4H9YA 1E43A 2V3DA 3KRUA 4RE4A 3VCNA 3JUGA 4IIHA 4V33A 1HUVA 3SGZA 2BB0A 4IFKB 3MKKA 4MKVA 3TA9A 3CYVA 2WNQA 1CENA 2ZX9A 3K13A 4L4MA 5A6BD 1HO4A 1DXEA 3NL6A 4IXHA 1AFSA 4QG8A 1JZ3A 2QVHA 4M7TA 3VKJA 3A3WA 1QK2A 4JTFA 3B40A 2FZ8A 3LCFA 2OEKA 2ZQ0A 3ZJKA 1WZMA 1P43A 2VGGA 3N4AA 4NZCA 4JPGA 3LGGA 1XF0A 4QR6A 3PWGA 1J10A 2PBOA 3NSNA 4MDPA 2C71A 3H53A 1E0TA 2VURA 3HIJA 5TQLA 4J9JA 4LY8A 4MG4A 3HQOA 3WO8A 1YYAA 3SM0A 4NKCA 2Y8UA 3HG4A 2IQ0A 3G6LA 3GK0A 4PCSA 3DYOA 3H7UA 2WANA 1GHSA 4GGBA 4CQCA 3DGRA 4ZMGA 2CLPA 1HGYA 5HA7A 3IS4A 2BXVA 1OJXA 3HBLA 3QMSA 4H7CA 5CSUA 4WEVX 5T91A 4WVXA 2Q02A 3WQPA 4IISA 5HR6A 2ZZ5A 1OIFA 2A79A 3AIWA 4AVNA 2GUYA 5HWNA 3A4AA 3CV1A 1ZJHA 3GW0A 4AWSA 4F0KA 2SFPA 4BF7A 2NWRA 3LV6A 2BVTA 4JTSA 2OO0A 2F7FA 1YTEA 3STPA 3PFRA 4EX4A 3VOHA 1XYLA 3UR8A 3W2MA 4FNSA 1K6WA 2IQDA 1ZP4A 1AK5A 3WL1A 5L9FA 1UIOA 5IM51 4UOZA 2ZC8A 1V7YA 3S47A 1FDZA 3FK4A 1PX3A 3W1RA 5D2TA 4ZB0A 5CPTA 3W7HA 3AXIA 3CL6A 1QWKA 1EJWC 5EB8A 5C9RA 5AN7A 4Z08A 4EXQA 3PZOA 4HPJA 3USBA 4LUTB 2GVGA 3MHGA 3IVSA 4GJIA 4E3TA 1O5QA 1R86A 4IM4A 1OQFA 2Q8XA 2Y62A 3RX4A 1Q8AA 5HXMA 4GOAA 4IPJA 2WQPA 1EZWA 3C2FA 3ICJA 1B1YA 1LM1A 2VFIA 3IV8A 3ZR5A 2WNZA 5HJLA 1KO0A 5KETA 5F7UA 3EOSA 1M7XA 3VC5A 3EKLA 2PU1A 5CPLA 3TW6A 1FWCC 2AMGA 4I7UA 3QOKA 2F6UA 5KITA 4KPLA 2VX5A 1KFEA 3N2BA 4MTVA 3GR4A 3DFSA 8XIMA 2ZCGA 3BQ6A 3PTMA 3TJXA 1UKPA 3I10A 1F74A 3NAVA 1M7PA 4WLCA 1H5YA 4RE2A 4HK7A 5EBAA 3V7PA 1Q4WA 3KX6A 1UKQA 1L6WA 1JCTA 3IK2A 4GXWA 4GQ0A 4RXGA 1RA0A 3MI3A 3UU0A 2OLHA 1GVOA 1FBAA 3VOCA 2GJRA 4LJ3A 9CGTA 4Z17A 4ZFCA 2FVKA 1G9HA 1AQFA 2PDJA 1S46A 3TYEA 3IGSA 3GDRA 3W1UA 3PJWA 3S83A 2QJGA 4O28A 3OB8A 4XG1A 4F0MA 1XLGA 2H8XA 2NXIA 5E5CA 4O17A 3KWXA 4M56A 3ZVHB 3E2RA 1YBQB 4M7SA 5D09A 3H23A 1ME9A 1ELSA 3WDHA 5DO8A 4B9ZA 1E72M 4LUIA 1O1HA 4XB3A 1OCBA 1A5KC 4A2RA 4S3AA 3GXFA 2DQXA 2Z2BA 3SN0A 4WQ6A 2YCKX 2TAAA 3MVTA 3ALFA 7CGTA 5HUOA 4NI3A 4GIEA 3UY7A 3A4WA 3TYCA 3GU9A 3WG6A 3W9ZA 1ZU8A 2PDFA 2WVTA 4CNSA 4ZCWA 2YDSA 5BOOA 3QPZA 1MI3A 4Q3MA 3FCPA 2PDLA 1K9TA 3LLFA 2HISA 4BF5A 1VHNA 3B0VC 3WJXA 1XKYA 3EX4A 4ZXLA 2WXDM 2IPFA 1EQPA 1X7IA 4PUKA 1LL7A 3UXDA 1PTGA 5LGXA 4OUIA 4W9TA 3HGOA 4XKYA 1UC5A 1XLMA 2KAUC 4ICNA 4IPIA 5D03A 2J7EA 2NQHA 3PBUA 3Q45A 4KS0A 3WDIA 1JDFA 4F0SA 1YDVA 1JGMA 2GPTA 3WD1A 3BURA 4G7FA 5F1VA 1W1YA 1VCFA 4E4FA 2VZOA 3Q4DA 3VFLA 4A2SA 4V27A 2O55A 3HO8A 2A7PA 5FSEC 2XIQA 1PHQA 4PMXA 5GJMA 4QIUA 4WIWA 3UVIA 1CCWB 3R8GA 5A8MA 2XFRA 1Q4NX 4O4WA 2YDAA 3NNTA 5T8GA 4CVWA 3EEZA 3I7SA 3W7PA 1J0ZA 2J6XA 2WVVB 3KZPA 4GG9A 4JQ3A 3UWVA 3TYBA 3AMKA 3V36A 3DUGA 2GFTA 5K3VA 3WUFA 2V9DA 3FS2A 1S2UA 3HG2A 3KTSA 5TBOA 5A95A 1V0MA 3OW1A 2G4FA 2QS8A 3G8EA 2PWDA 3IIXA 3M0XA 1B9ZA 3AWNA 2OLAA 3SN1A 3OOQA 1R8LA 2QCEA 2QVNA 4WY0F 1RCXB 1YEYA 3AALA 1ZLPA 2AGTA 1RP9A 4MJ2A 4NY2A 3GXPA 2ZUNA 3BCDA 4O0ZA 4HNTA 3A21A 1WZKA 3SCRA 3NQCA 1TWSA 1XLFA 2F2KA 3ZVHA 1ADSA 1NWRA 1J79A 3MV01 3DXIA 1GQLA 2A6LA 2ACQA 3QY6A 1M9HA 1R3QA 4PTDA 3KXQA 1YRRA 3G0SA 3LHZA 1HP4A 1HJWA 2ZC1A 2Y88A 3TP4A 1JIBA 3UZ5A 3MSYA 1M68A 4I7VA 3TMQA 4L9YA 5U7SA 1BQCA 3CLWA 4H00A 5T9BG 4JTAA 3W7EA 5A8OA 5CJNA 4FXRA 5C9XA 1UZ1A 4N42A 1OIMA 2XH0A 2NT1A 3CC1A 1S2CA 3PTQA 1FWIC 2D1ZA 5CPQA 3TDFA 3NYZA 1XIMA 3W0KA 5AC5A 1F5ZA