4C1LA

Crystal structure of pyrococcus furiosus 3-deoxy-d-arabino- heptulosonate 7-phosphate synthase i181d interface mutant
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
262
structure length
262
Chain Sequence
MKYSKEYKEKTVVKINDVKFGEGFTIIAGPCSIESRDQIMKVAEFLAEVGIKVLRGGAFKPRTSPYSFQGYGEKALRWMREAADEYGLVTVTEVMDTRHVELVAKYSDILQIGARNSQNFELLKEVGKVENPVLLKRGMGNTIQELLYSAEYIMAQGNENVILCERGIRTFETATRFTLDDSAVPVVKELSHLPIIVDPSHPAGRRSLVIPLAKAAYAIGADGIMVEVHPEPEKALSDSQQQLTFDDFLQLLKELEALGWKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2-dehydro-3-deoxyphosphoheptonate aldolase
publication title Destabilization of the homotetrameric assembly of 3-deoxy-D-arabino-heptulosonate-7-phosphate synthase from the hyperthermophile Pyrococcus furiosus enhances enzymatic activity.
pubmed doi rcsb
source organism Pyrococcus furiosus
molecule tags Transferase
total genus 98
structure length 262
sequence length 262
chains with identical sequence B
ec nomenclature ec 2.5.1.54: 3-deoxy-7-phosphoheptulonate synthase.
pdb deposition date 2013-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00793 DAHP_synth_1 DAHP synthetase I family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4c1lA00
1OF6A 1ZNNA 4HT3A 2NWSA 4M7TA 3UZJA 2W6RA 3LHWA 1MSSA 2YCEA 4E2BA 5K9CA 3STGA 4FX7A 4FF7A 2ALDA 2NUWA 2WO5A 2GJLA 4WOQA 2J9ZA 2VC6A 2QF7A 3BLFA 3S8HA 3DHDA 1VPXA 4UMCA 2Y63A 3L68A 4TIMA 1AW5A 3Q58A 4N4QA 5D2XA 3QMSA 1OYCA 2GOUA 5F4XA 4BWLC 1IXNA 3FJLA 3T55A 3M5VA 3QEZA 4UUIA 2QDHA 3W7KA 3G0XA 1O94A 2ZQ0A 4ADSA 2Y7DA 4RCXA 1F6PA 4RKAA 1KV8A 3HPXA 3MI2A 1H62A 2QCGA 3LTSA 3M6YA 4Y90A 5AHLA 4QISA 3N2MA 5TQLA 3ABOA 1JJKA 3W1AA 3PSWA 4Z0SA 5C54A 2O7SA 1ML1A 2YZRA 5D2VA 4Z08A 3KXQA 2YDAA 4GJ1A 3KRSA 1VCGA 4QNWA 1R2TA 3W1LA 4EF8A 4K38A 3W7NA 1YXYA 4YXGA 5FEXA 1Z41A 1GTHA 2RDTA 4RZ5A 4DEFA 3V1PA 3ABQA 1G4TA 5AHFA 3W2JA 3C2RA 1VS1A 4MUZA 1KW1A 4FXSA 4DO6A 4ZMGA 3EKZA 2EPHA 4GUFA 3O06A 4JTEA 3U6WA 1M7OA 1SW0A 3F1QA 3FEMA 3KHJA 5F1UA 4MJZA 3VFLA 3O63A 3C2FA 4M6VA 3SY5A 4BF9A 3SSJA 3E96A 1YXDA 1SZEA 4DQWA 1EIXA 4AHPA 1YYAA 3BVJA 4Q4KA 5F4WA 1F7BA 4JTFA 3DH7A 3S9YA 2YX0A 1LDCA 4IPIA 1U5JA 2JK2A 1RQEA 3W74A 1VRDA 1KLZA 1Q6OA 4JIPA 2DZVA 5KZDA 1OJXA 3DFQA 4CNOA 3N19B 4KFOA 4X9SA 3G18A 3E49A 3UWVA 5LHEA 2QCNA 1B3OA 4GBUA 4MY8A 1A50A 4LC8A 3GDKA 4LU0A 1EX5A 4LS2A 3S5YA 1FCQA 4XKYB 4Y96A 4FX6M 3OHIA 4Y8FA 1Z42A 1R30A 2VFGA 3LGEA 4FNSA 1WBHA 2CZ5A 3W7GA 3PM6A 1YADA 4A2RA 1RV8A 2LLEA 1TPEA 4WQ6A 3LHVA 5EYWA 4PH6A 2E5BA 4MZYA 1DV7A 2YR1A 4K8HA 3GK0A 1C9DA 2JBMA 4WD0A 3TMQA 5HNRA 3QQ0A 1AW1A 3W23A 1I2RA 3LCHA 3G22A 1SW7A 3MUXA 1O4UA 2FQIA 1X1OA 3LCXA 1SO6A 3TW7A 3L21A 4AWSA 2PC4A 3S1WA 1YPFA 4QSHA 1WA3A 3LHZA 3CU2A 3H53A 4QM1A 2GVJA 5D37A 5KMYA 2B4GA 1ME9A 1KBJA 1PL9A 2DZPA 4K7VA 4LUJA 5FF2A 3BARA 5IBXC 4FX8A 3S5OA 3W1MA 3GYEA 4LNYA 4UMAA 4LV9A 5G1YA 2CLEA 4AF0A 5HQEA 2RDUA 2J9XA 1T0OA 1L9WA 3LCWA 3QH2A 2X1SA 4HKPA 3HQ1A 5FF4A 3PBYA 1PS9A 3NQGA 4GWEA 4FNPA 3W7CA 1K8ZA 1ZFJA 4UTMA 1KFKA 5AHNA 3TDFA 5DLCA 3ANYA 1M5WA 3LBMA 3MBDA 4PA8A 1KM2A 2TYSA 1TPC1 1KFEA 2VFDA 2Z2UA 3DFPA 3UWZA 2WJZA 2V8ZA 2ISSA 1MO0A 2HMCA 2ZFAA 4GFSA 1AG1O 4HNNA 4XTDA 3RLUA 3MW7A 1OX4B 5EBUA 3IIXA 2W79A 2CW6A 3LHUA 4O4VA 1FX6A 1VCFA 1TPUA 5BMWA 3NL5A 5D32A 3WK0A 2NZLA 3TQKA 3LM7A 2ATMA 1S5WA 5CZTA 2ZRYA 1E51A 3L5LA 2CLOA 5U4NA 2D73A 2WV8A 2OZ0A 4AVFA 4N2YA 4NU7A 2XFWA 4O17A 1GVFA 3NQCA 2ZCGA 2P10A 5AYZA 3T44A 3C56A 4POCA 3ZS4A 4LS0A 3DGRA 1F5ZA 3D0CA 1GPWA 1ICPA 1XBXA 2XN1A 3ATZA 4MLRA 4I7UA 1VLWA 1TPB1 1O60A 1W54A 1J2WA 3MP5A 1JULA 1VLIA 2B7PA 4PL2A 5AHIA 3P60A 3DAQA 1DQXA 1K02A 3ABRA 3FFSA 4IMDA 4UR7A 2VFIA 3NQ7A 3NGJA 4AHOA 4ORMA 1UJPA 4YCPA 3C61A 1DQWA 3EWZA 3O15A 4E0CA 5BW6A 1FUYA 4H3DA 3NDOA 2XN2A 3HIJA 3P62A 4IXXA 2JKPA 1VGAA 3USBA 1VYSX 3PUEA 3W87A 3O05A 1JCXA 1Z48A 4DF2A 4MY9A 1XI3A 3NEVA 1JCYA 1TTJA 4CCDA 3L5MA 1A5CA 1FWTA 1RZMA 3KFTA 1FXQA 2R94A 2O7QA 1YDOA 4FIQA 1TRIA 2QCDA 3WJSA 1L6WA 1GYLA 3TE9A 1W3NA 1OFDA 4IQLA 4CLMA 5LNUA 3TIMA 3JR2A 2OX1A 1TQXA 3VCRA 2QUVA 1JQVA 1ZCOA 1CI1A 5KINA 4JX5A 2DJLA 1TPVA 4TX9A 3QFEA 4HNUA 4HNVA 3OG3A 3LV5A 4NNAA 1ZAHA 2CZDA 1EA0A 5L6UA 1XL9A 2DZTA 4DXVA 3CEUA 3A9IA 4HSOA 3S1XA 1TPDA 1RD5A 3OIXA 2NUYA 4UTKA 1X8FA 1B57A 4RK8A 1EB3A 3S1UA 2X1RA 1ZENA 1RR2A 1EEPA 5KITA 4BFAA 2J27A 3HG4A 5G5IA 3L9CA 1JUEA 3H55A 3NO5A 1DJNA 1FWNA 2A4AA 1H60A 3SECA 3M5XA 3QMTA 2WSYA 2C3ZA 4YCOA 2PE4A 2Z6IA 4YL2A 1OF8A 4JTJA 1HTIA 1R46A 1YPIA 2E77A 2I9EA 4L4LA 2ZZ2A 2BX7A 3M47A 4O28A 3RLVA 3F4WA 5D02A 5KZEA 1YTDA 4UFLA 3A23A 2PRLA 1SUXA 1YTEA 1L2UA 2NX1A 3C6CA 5LGZA 4JIQA 3KVKA 4JR5A 3FKRA 1MEIA 2J9YA 1EP3A 4UCGA 1NFBA 5E0KA 1WDWA 5AYYA 3C3NA 4LOCA 1TJRA 3FYOA 2H90A 4JTTA 5EL1A 3W83A 4IOTA 2CZFA 2ABAA 3S0CA 5HWJA 4O54A 3WJYA 3TJXA 3GXPA 1KTBA 2H3BA 5H91A 4H4IA 3V75A 1D9EA 3LBCA 3G1HA 5CSSA 3STFA 4A21A 2C1HA 2WKJA 3BG5A 3WJWA 5K7JA 1C29A 1ADOA 1BKSA 1FQ0A 4LV4A 1XM3A 3M0ZA 2VELA 1ZJIA 4HIBA 1EUNA 4LWWA 5F2IA 2E6DA 3TQVA 1W5NA 3P84A 2FPYA 4M6PA 1TIMA 3PBUA 1HG3A 4D2JA 3IVSA 1TSIA 1A5SA 1WQ5A 3A5FA 3HF3A 5DXXA 1OVDA 4MJMA 5A8GA 3LCIA 3RNDA 3HG3A 2FPTA 2YYTA 5D2WA 3G8EA 1VQTA 3IIPA 4ADTA 5FF3A 2VEPA 1NF7A 3NL6A 3LLFA 2QR6A 5EY5A 4N9CA 1JUBA 2FJKA 3QPZA 3NPWA 3W1TA 3TJLA 1KM3A 1S3HA 4QNEA 3W7IA 4O19A 3CTLA 1LTDA 1S5TA 4XKYA 3W7QA 4OWGA 3P67A 3LDVA 5HUOA 2B0MA 4FEZA 3O8AA 4A2SA 1QNVA 4NZFA 1ME7A 1I2QA 4DBEA 3P82A 3OBKA 1H1ZA 2GQ8A 2C16A 4AEOA 4DF1A 5AB3A 1U83A 3EB2A 1PHQA 4NJIA 1G7VA 4NJHA 2A2IA 4IUOA 1PHWA 3N73A 2BWGA 1WV2A 2G5WA 4J9JA 4MLJA 4S2CA 3P5ZA 1WYIA 3PUDA 2V2CA 1QPQA 1W31A 1LOLA 4Z1AA 3L2IA 2X2GA 4N02A 1EP1A 1IF2A 2YW3A 4K6AA 2CLMA 1DJQA 3C2OA 4GUHA 5D2YA 1KTCA 1WAUA 1M6JA 2DJXA 1FDJA 2WNZA 5LZLA 1GVQA 1OFBA 1TPWA 2R91A 3EKLA 3GDLA 3G1AA 3OVPA 5D38A 3TA6A 4EF9A 2QJGA 2V9DA 1IIGA 1W56A 4XBKA 1OX6A 1QPRA 1H61A 2ZTJA 1VCVA 3TC7A 3TMLA 3W85A 4NT0A 4R53A 1ONRA 4RV8A 4U28A 2J6XA 4QAIA 2VKZG 3P61A 4XQ6A 5D30A 1H1YA 1OYAA 2H6RA 1IXOA 4EOUA 3I6RA 5TBOA 1NSJA 5D03A 1ZHAA 3W72A 4JNMA 4O4WA 2ZRWA 3IIZA 3NQ2A 1TJPA 3C2EA 3O6DA 5TIMA 3G8RA 3KVMA 1OX4A 3TCEA 5DELA 2WOQA 2BZNA 1WX0A 2NXHA 1XC4A 3Q37A 5K2ZA 1P4CA 4UTWC 1GT8A 1SR9A 4YMZA 3MI3A 4LVGA 2C18A 4ZQMA 3BG9A 3JS3A 3QMRA 3S5NA 1Q6RA 3P7YA 5FEWA 1SFLA 4YWIA 1LRTA 3SIZA 1SQ7A 1H7RA 5CZ0A 3NVTA 3C52A 5FEPA 2CWNA 3B4UA 3PS7A 3NOEA 3PY2A 3U8GA 4JY8A 3W7LA 1QO2A 3N9RA 4LY8A 2E6FA 1AL8A 3LCGA 1MEHA 1LBFA 2RKXA 2ZA1A 2HSAA 4R33A 2JGQA 5CG7A 1W1ZA 3EX2A 4LVAA 1UUOA 1GTEA 1XUZA 3W1XA 3W75A 4K8EA 3VE9A 4UR8A 1X6UA 4UTTA 1A5AA 4L4MA 4ZVJA 2C19A 3PB0A 1G7UA 2G97A 5G2WA 3TSMA 1L6SA 3NM3A 4UFHA 2OMAA 4RJEA 4K39A 4PCFA 3EWUA 2HS8A 3W76A 1Q6QA 1K03A 4GUJA 1TB3A 1FDYA 2R14A 3O1NA 3M5YA 1H7PA 3O16A 1FCUA 1G6CA 2NV1A 4M7SA 1XCFA 3W73A 1ICSA 1ME8A 1DKWA 2QCMA 4IMFA 1HFBA 5I3KA 3W2LA 4OGZA 3FA5A 1LM1A 3RMJA 1JVNA 3SW6A 3R2GA 4S2BA 5K9DA 1KLYA 1T8XA 1AW2A 3Q2DA 4BWLA 4FHAA 3GAYA 2NLIA 3T40A 2V82A 4FNTA 2RDWA 4ML9A 1H50A 3HJZA 3W71A 2ZZ4A 3UWWA 2FPVA 4NNBA 3UWQA 2C6QA 3NM1A 1PE1A 3GDMA 1QPOA 4FXRA 1B9BA 5I3FA 4IXHA 3QYQA 4XZ9A 2FDSA 3W88A 3MMTA 2A6LA 1KM5A 1H7NA 3NNTA 2CLLA 2Y7GA 4LUIA 4XWUA 1LLWA 3EXSA 3DFSA 1TPFA 4OV9A 1QFEA 3B0UX 4UXDA 1WOBA 4NVTA 1THFD 5L9FA 3W2UA 4ICNA 1KM6A 3TFXA 5LNSA 2C0AA 3BK0A 1FWWA 3THQA 1OX5A 1K7FA 1SSGA 3LI1A 5BOOA 4IX0A 3BGJA 2Q8ZA 3NPXA 2EHHA 2QCLA 1YDVA 4UTLA 3LTPA 3NQDA 3QW4B 1VH7A 4M5PA 5KSWA 4UNLA 3NQAA 1JQXA 5AC6A 1OK6A 1EP2A 1F2JA 5LNWA 2TRSA 5DXYA 4UTHA 4O52A 1VYRA 2OCZA 1OYBA 5BRBA 4LW7A 5CKSA 5EMUA 5LHFA 3S42A 2JKAA 5J5DA 4JXCA 2I14A 4JTGA 5DCEA 1VJIA 4IMGA 3W2KA 3RF9A 3C0JA 3S5ZA 2NXIA 4JTSA 1G4SA 5AC7A 2ZRXA 3W86A 3SR7A 4MIMA 4MZ8A 1I8JA 4WX2A 3PUOA 1DHPA 2Y7EA 3RFAA 4P61A 4O1CA 4GC4A 4JD4A 3I7QA 4X22A 1F73A 1OK4A 1UBSA 4DPQA 4NQ1A 3WJZA 3G3DA 4Z1BA 1YDNA 3HO8A 2YFOA 4UIOA 3MHFA 3TU9A 4JTUA 1JRBA 1JCJA 2NX3A 1XBYA 3E02A 2A85A 4TO8A 2B7QA 3WK1A 1RVGA 4AWUA 4CQ9A 1TYGA 5E1QA 4NX5A 4A3UA 4RXFA 3NYZA 3B03A 4C1KA 3LHTA 4JTKA 3QM3A 4DPPA 3LRMA 1TTIA 4ZQPA 3LXCA 4KWVA 5E93A 3TKFA 5DCDA 2WQPA 2Z6JA 4JEQA 3W6YA 1KM1A 4JY9A 2BSLA 4B5NA 3WFAA 1P0KA 1PCKA 3UWYA 2ZBTA 1LLZA 2AGKA 4NJKA 2YYUA 4N9BA 2C13A 1EWDA 4LT9A 1AL7A 5EKYA 3EWYA 3SGUA 5FESA 1TO3A 4TMBA 5K4XA 3CHVA 3IEBA 5IBXA 3EX6A 4NJJA 3EWWA 1KFLA 3P81A 5J5RA 2G95A 3T4CA 1JR1A 1SW3A 4ZQOA 1QDSA 5I3IA 2Y61A 2ZA2A 4KFNA 2WSQA 1XUUA 2VEIA 3EWBX 5CZJA 1OFQA 2ZTKA 1KM4A 3BW2A 4FB7A 4KKXA 3GNDA 4FNRA 3I65A 3K30A 1QPNA 3OEXA 3W7OA 4O1BA 5D33A 1M7PA 1QCWA 3NQ8A 1W5PA 3NXFA 4ONVA 2B7OA 2Y7FA 3BG3A 3L0GA 1K7XA 3QF0A 1PIIA 3MP3A 1YXCA 2ZRUA 5C55A 4JGDA 3ZWTA 3EWXA 3A24A 3HBLA 3CB8A 3UXAA 5K4ZA 2YPIA 1KFCA 3CWNA 1CW2A 1T96A 3UY7A 4AMAA 1DORA 4CQAA 4R34A 2CLFA 2QJIA 1QOPA 3IVUA 2HS6A 4CNPA 1MEWA 2C15A 3EEGA 3MP4A 1QR7A 4FIRA 4I9AA 5HMSA 1HO4A 1Q45A 2NXGA 5LSMA 3CM4A 1SU5A 3DI1A 1XDMA 3N34A 4N9DA 2YFNA 2J88A 3MYOA 2PURA 2A6NA 3FIGA 1OHLA 5CPLA 2FLIA 4UTUA 1RPXA 4O57A 4HNTA 3PBWA 2V5LA 1W5OA 3H54A 3N3MA 2FB2A 4R7JA 1FY6A 3QPYA 3DI0A 2H3DA 4QQ3A 2A0NA 3TAKA 1N55A 4O53A 3DZ1A 3LXBA 3IGXA 4AWTA 4IMCA 4DELA 4HHPA 2TPSA 2H8ZA 3UPWA 2Y70A 1DOSA 2WSRA 3TNOA 4EIVA 3TUUA 1C8VA 4UFKA 1WBJA 3GX9A 5C5YA 3BO9A 1NF0A 2JGYA 3PG8A 2G96A 1SZNA 3FJ6A 1TV8A 3BW3A 4CQ8A 4OQVA 3E9AA 3W1PA 3L67A 2DZSA 4WY0B 1KBIA 3UPBA 3W7JA 1KV5A 3SFKA 3W22A 1PVNA 1LYXA 3R8RA 3GB6A 3HGJA 3MO7A 5K9XA 3I68A 3I7RA 2DZXA 3PVFA 3TC6A 3G24A 4K37A 3CQ0A 3TH6A 1F05A 1GJPA 3G1VA 1I2NA 3IVTA 3W7HA 1EPXA 4I7VA 1GG0A 1GVSA 4DO5A 2H8XA 5I3GA 4TU1A 3B06A 3NL3A 4RX0A 4K36A 2OJPA 1VHNA 3RU6A 3M9YA 4LRTA 1NAL1 1W5MA 1UASA 4ZQRA 1FBAA 1SO5A 1JCNA 4O0ZA 3HOJA 2P0OA 1W37A 3NA8A 4O0KA 5FF0A 2ATSA 1LCOA 4KWWA 3PAJA 4CCCA 5CPOA 3BV4A 4NUWA 3W84A 5EA9A 1GQNA 1ZAJA 2QUTA 3T7VA 4RXGA 4KFPA 3MJYA 4M6QA 2E68A 3BW4A 1VYPX 2Y88A 1H7WA 8TIMA 1LRNA 3LV6A 1PCWA 1ZAIA 2FFCA 4Y9AA 3CPRA 1QOQA 4WXZA 5KTLA 5F1VA 3DFOA 4Z1DA 4G1KA 1KA9F 4XTIA 1GYNA 1MXSA 7TIMA 3G0UA 4JS3A 1LOSA 3W2MA 1BWLA 4UMBA 2AQWA 2DZUA 1G4PA 4P2VA 1XFBA 3GXNA 4NX0A 4CCEA 3VKJA 3FOKA 3HGOA 2Z0IA 3GXTA 3LRLA 2QCDB 2QKFA 3F4NA 5SWUA 5HINA 4UTTC 1LZOA 5HWNA 1TPH1 3BLEA 3A5VA 1CX9A 1GVOA 1TREA 1IXQA 4WOZA 3TAOA 3W2NA 2FTPA 3LCLA 3NQVA 2QJHA 2VXNA 4FNUA 3NL2A 4WXYA 2ZZ3A 1JCMP 4C1LA 2E5DA 3LX9A 3PF3A 1LP6A 1TQJA 1XXXA 4EWND 2AAMA 2TMDA 3QRHA 4N4PA 4O12A 1HL2A 1EWEA 3GKAA 2QUUA 4K7YA 5AHEA 4IGHA 3ZFHA 3N2XA 5A5WA 5BMXA 2DP3A 4GUGA 4E38A 5BNKA 3MHUA 4GRSA 1XBZA 4BK9A 3G1XA 5FI8A 1OFEA 1LBLA 1D3HA 3LB0A 3DBPA 5AOUA 3C8FA 1VHCA 2EF9A 3W1UA 5LKYA 2FIQA 3LOTA 3THAA 1OFRA 1Q3NA 1P5BA 3R89A 4LVFA 4GE8A 3MI6A 1TTPA 5G1TA 1S5VA 3PG9A 2E09A 1W5QA 4O1DA 1Q6LA 3BGGA 4MFEA 3EX3A 4ZL1A 3ATYA 4EVZA 4O11A 5IM51 3UXDA 2A21A 4PC8A 2Q3RA 3B0VC 4HPXA 1XKYA 4NXSA 1TTQA 5D05A 1X7FA 4LTSA 3PULA 3VE7A 1UUMA 1FXPA 3DENA 1SFJA 2F84A 2KZHA 3YPIA 3M1ZA 4BI7A 3A21A 3C4UA 1L6YA 4MKNA 4QITA 1XBVA 2ZRVA 2ZZ1A 4O10A 2A7RA 3W1QA 3QC3A 1LROA 1OFOA 1TV5A 1GVRA 1X1ZA 1ZALA 3DXIA 3CWOX 4O1AA 5G2HA 4JX6A 3TR2A 2ZZ6A 3UZ5A 3G1SA 3SJ3A 2DU2A 4LC6A 2A7NA 1KFBA 3PC0A 3VI2A 4O13A 1LBMA 2B7NA 1K7EA 3O6YX 1A53A 4ZQNA 3W1RA 3KRZA 2BLEA 2Q3OA 4WJEA 1OFAA 1F74A 4MVAA 3P8IA 1O5KA 4WY0F 3QJAA 1UCWA 1Y0EA 2ABBA 3T78A 2VFFA 3CEPA 1GWJA 2ISWA 1NEYA 1O95A 3NPVA 1SPQA 3MWAA 4N6FA 1AK5A 4AH7A 3WJXA 3E0IA 3HG5A 2WNQA 5FEZA 3LRKA 5HWMA 2CLKA 4PODA 4LVBA 1I2PA 2X30A 3TXVA 1H7XA 5HULA 4PFMA 3W07A 3S1VA 5D09A 3NR0A 5C6MA 2C14A 3UY8A 3MYPA 1SZFA 3GDRA 1QO5A 1V5XA 2ZZ5A 4O18A 4DBDA 2BTMA 4IMEA 2V2DA 1TRDA 3ZR4A 4UTWA 3R13A 3PB2A 4GXMA 1OG0A 5G4EA 5T26A 4HPJA 2X16A 2TSYA 2VOMA 4JN6A 4UC5A 2GQAA 5DN1A 3R5EA 4IPJA 3W7EA 3DKJA 1TMHA 2ZDRA 3LHYA 1GZGA 3TROA 1I4NA 2ZA3A 2GVGA 4TR9A 1G69A 3FYPA 3GDTA 3NZRA 5HJLA 3NQFA 5AYXA 2ZZ7A 1BTMA 2E6YA 2RH9A 5U7SA 3S6DA 4JTHA 2X1UA 4BI6A 2A7PA 3N9SA 3LTYA 4WUIA 4OV4A 2WNNA 3BLIA 5AC8A 3DFTA 4BR1A 3L0NA 3HG2A 2QCEA 5DY3A 1F6KA 6TIMA 3AO0A 2A5HA 1W3TA 3E12A 4N9EA 2W0UA 3LLDA 4JYFA 4O16A 1I45A 3KVLA 2J24A 3LXAA 1J5TA 1YLVA 3GIYA 3P80A 1KTNA 1P0NA 1G67A 3B8DA 4FO4A 3G1DA 1FWSA 3PWAA 5AFDA 5LNVA 4JYEA 2QAFA 5F2GA 3SGZA 3TSDA 4RZ6A 4IJBA 1SO3A 1WOAA 2NV2A 3W7DA 4MYXA 3R12A 4WY0A 1QAPA 3INPA 4HN4A 3B05A 3G0SA 1AMKA 2QCHA 1ALDA 1GEQA 3I7SA 1FWRA 3QQ1A 5CPNA 3SZ8A 4UNKA 3GAKA 2A1YA 3CLMA 4LRSA 3QW3A 1W3IA 4BI5A 4OT7A 1K8YA 1OFPA 3TFCA 3NZ1A 4MPQA 5F4SA 3HB9A 5AN7A 2QEZA 1R2RA 2NWRA 3KX6A 1DL3A 4MYAA 3UWUA 3HGRA 3MHGA 4UFIA 3L0KA 4O15A 1K3UA 4U4MA 3BPWA 5G2IA 3GZ3A 3F03K 4GNJA 2GJNA 1KFJA 2V2HA 3O07A 3W3OA 5KZMA 1FCBA 3EXTA 3G3MA 2GVLA 4JDYA 1SZGA 4AXKA 1RQBA 3N14A 1UB3A 3STEA 3P5YA 3UQNA 2Y89A 4UFJA 3OA3A 2FB3A 1KM0A 2E1DA 3OVQA 3TSBA 4M19A 4LVDA 3M7WA 5H2ZA 3MBFA 2EAWA 1NVMA 3W9ZA 4ADUA 2Q8LA 2CLIA 3NQMA 3QSTA 4O50A 2EKCA 4IWWA 1IIHA 2ZYFA 3HPZA 2Z1BA 3EX4A 3QZEA 5AHMA 3O6CA 4OU1A 3P74A 2V5BA 2YSWA 3LCFA 3IV3A 2EGZA 2V0TA 3DFNA 2CZEA 2VEKA 1PV8A 2GUUA 3AJXA 2Y85A 3NQEA 1EUAA 3GVGA 2RHGA 1GOXA 1H63A 4JTLA 3TXZA 3FKKA 1QWGA 5DY2A 1A5BA 2DORA 4A29A 4AAJA 1N7KA 4JYDA 3DU0A 3B04A 3IIOA 3GLCA 3TW6A 3WK2A 1V7YA 5C2XA 1LRQA 1W0MA 1JUKA 4OE7A 3GKFA 3M43A 2XN0A 3A22A 2CLHA 1BEUA 3DKLA 4A22A 2OT0A 4OHQA 4QJ1A 3IRDA 3FLUA 2V81A 2PCQA 3IIVA 2X1TA 1SO4A 4XBSA 5MHBA 2YGYA 4RR4A 2CU0A 3G1FA 1N8FA 4OBTA 1DVJA 1DBTA 3LI0A 3Q94A 1I2OA 3STCA 5D2TA 5CGQA 4QIUA 3TQ0A 4MFDA 1HUVA 3HGSA 5I3HA 2ISVA 2QCCA 3HMJG 3CIXA 3C2VA 4ZZ9A 3TX9A 4Y6GA 2BXVA 2E6AA 4UTIA 1GG1A 3TK7A 3B0PA 4RZ4A 4Z1CA 1TCDA 2Y62A 2IQTA 2VEMA 1VR6A 3PR2A 4PTNA 5FF7A 1IGSA 1LORA 5CZSA 2VFEA 4AF0B 1O5XA 3W70A 4ORIA 4TMCA 4I7WA 4UTJA 1H51A 2HTMA 3SI9A 5G4WA 4MY1A 5CPMA 3UNDA 1P1XA 4NXKA 1JRCA 2JKEA 1BWKA 3KAOA 2ZRZA 4Q33A 1XDLA 1H5YA 1VC4A 2UV8G 2F7FA 3LERA 1OABA 1D3GA 1JCLA 3ELFA 3M41A 3W7PA 4H6KA 5HR7A 4DF0A 1B4KA 1B4EA 2NX9A 4X3ZA 1R47A 4HSNA 4NJGA 2OT1A 3CT7A 4Q32A 5DBUA 4AHQA 2QDGA 3NQ6A 3ZWSA 2YW4A 2VENA 3EXRA 3L66A 3QSRA 4JX4A 2Y6ZA 3W1NA 5I3JA 3EX1A 3ABSA 3PSVA 3KRUA 4O14A 3GR8A 5CSRA 2QCFA 5K3VA 3VNDA 3DHFA 4XUGA 3UYCA 4MOZA 2CFFA 4RLIA 3W7RA 2QAPA 2YXGA 4NNCA 4NZJA 3G1YA 6ALDA 1HO1A 4PEKA 1RQHA 2I1OA 2NUXA 3PBVA 3JRKA 4O8RA 1MZHA 1TV7A 5F2MA 1VZWA 2VFHA 2P1FA 4E2DA 4YLWA 4N6EA 4JTIA 1ICQA 3WK3A 3L5AA 2GPTA 3FS2A 3W7MA 4LS1A 3OVRA 2PRMA 1FDZA 4FNQA 1T99A 4WZHA 4ALDA 5F2LA 2PRHA 3M16A 1W8SA 3HPSA 1R2SA 1H7OA 2DZWA 1WXJA 3KVJA 2WPBA 5GVJA 4UFMA 4GUIA 1Z44A 1ZY9A 4Z0JA 3NAVA 1FCVA 1J4EA 4X2RA 3M5ZA 4ZQCA 3RK8A 2RFGA 3P8JA 4S1FA 5EPDA 3M44A 4JDBA 3L65A 3GNNA 3CIWA 4AB4A 1SSDA 2V30A 2R8WA 2GQ9A 1IXPA 2E5CA 1YTKA 4W9TA 5HR6A 1K8XA 3UD6A 4IX2A 5DCBA 4CNNA 3U2OA 5DBTA 4JICA 4PL1A 4MZ1A 1LOQA 5ABTA 3KOFA 3TV8A 5D04C 5HUPA 5LNRA 3IGSA 3GR7A 1G4EA 1F76A 5LGXA 3NPUA 3NG3A 3IGUA 4DO4A 1QMLA 3CC1A
chains in the Genus database with same CATH superfamily
1ZNNA 2YCEA 5I7GA 4E2BA 1DXEA 2ASHA 4FX7A 2QPXA 3BMWA 2NUWA 3O3RA 3GIPA 3AHVA 1UKPA 1X6NA 2J9ZA 5JH2A 5EBAA 2ESCA 2Y63A 3Q58A 4N4QA 3QMSA 4FOKA 1LF1A 1OYCA 1PKNA 3T55A 4UUIA 4B5WA 3AYRA 4H8HA 3G0XA 1KCZA 3GTIA 4LAMA 1O94A 1J01A 4F8XA 3MY9A 3VCCA 3HPXA 4GGBA 4RNJA 2O92A 4EK7A 1WUFA 5AHLA 4QISA 3N2MA 4S39A 1JNEA 6XIAA 2GGJA 2X42A 3PSWA 2O7SA 4YTSA 1ISVA 1N8IA 2FJUB 1W1B1 3KCLA 4US6A 1PO9A 2YDAA 1P7TB 3KRSA 4K38A 2ZVIA 1Q63A 1PIFA 1YNYA 1GTHA 4DEFA 3AHZA 1K77A 4MUZA 1KB3A 2CKRA 5H1WA 4UQCA 2EPHA 4GBDA 2VCCA 4JTEA 5A6AA 3NZQA 3GHUA 3FCPA 3TYBA 2YZ5A 5F1UA 1WKEA 1XLLA 1RP9A 4BF9A 3E96A 1PDZA 2P76A 4HYRA 1YYAA 5AZ1A 1F7BA 4JTFA 4B5UA 3B9EA 2YL9A 1TA3A 3WQ8A 1EXPA 3U5UA 3VX1A 1V3HA 2AL2B 3C0QA 2IKGA 3W74A 1VRDA 1KLZA 4JIPA 4C7GA 4CNOA 3N19B 4KFOA 4UZUA 4EWJA 4WSKA 3E49A 3UG5A 2CNCA 3HV8A 1B3OA 4GBUA 4URIA 1PZ0A 2BOGX 4LF1A 2PWHA 4LC8A 3GDKA 3CQHA 3ZVHA 1AQ0A 1EX5A 4W86A 4XKYB 1IE7C 2GJXB 2EJAA 4RNIA 3GDBA 2DUZA 4L1XA 4PH6A 4DN1A 1O6IA 4K8HA 3VOFA 3W82A 1EH9A 5CC5A 4DRSA 4QP0A 5I03A 4R85A 1XDJA 3GNOA 5CPTA 5FD0A 1R9ZA 4RE3A 1L2QA 2NSOA 3LCXA 1SO6A 2ACSA 3L21A 2PC4A 3EDDA 3T42A 2WLYA 3BUVA 4HBKA 2PU1A 2ACRA 3LSBA 3RPDA 1JAEA 2EG7A 3H53A 4JKMA 4H6RA 4Q7IA 5KMYA 2B4GA 4NKCA 1ME9A 1KBJA 3WH7A 4EXBA 3KOXA 4Q4RA 4Y2WA 1PZ3A 4AF0A 3PZGA 1A5OC 3OYZA 2X1SA 2Y8KA 3HQ1A 5FF4A 1PS9A 2FGZA 3ITTA 4H9ZA 1K8ZA 4UTMA 4DZ5A 5HK4A 5JIPA 1V6WA 5ABGA 4ZR8A 2J4GA 1MW1A 4QDWA 1J93A 2X7WA 2WJZA 1MO0A 2Y0FA 3TOPA 3N6QA 3RLUA 1RLCL 1K4HA 3CYJA 1DXFA 2X0YA 3WF1A 1B1YA 1NWRA 3BCFA 4O4VA 3B9DA 1TPUA 3N2TA 3NL5A 1J5SA 3TQKA 3LM7A 5HPOA 4KS0A 2ZRYA 3IK2A 2CLOA 4O17A 1F07A 3UR8A 1GVFA 5AYZA 2F61A 3C56A 2J7BA 3PZMA 2CWXA 4WKHA 1RBLA 1KGWA 1GCYA 1VLWA 1TPB1 3PZUA 1V0LA 4PL2A 3MZNA 4AZIA 2C91A 1JPHA 3NQ7A 3NGJA 4AHOA 4ORMA 3FDGA 3OLEA 1UD2A 3VIJA 1DQWA 3TN3A 4M24A 2O9RA 1Z89A 3NDOA 4U3CA 3W87A 3KBNA 1Z48A 2A3CA 2PBOA 4MY9A 2VMFA 3QVQA 1FWTA 3V0TA 3FA4A 3WLQA 2R94A 4QGCA 5T9CE 1ISWA 1L6WA 3AHYA 3TE9A 4H83A 1GOIA 1W3NA 4CLMA 1BXBA 2OQYA 1FKWA 2PZ0A 3UNTA 1ZCOA 1CI1A 5KINA 3ES8A 5CAHA 2YDRA 5LIKX 1O12A 3QFEA 3UR7A 3WLJA 1EJ7L 3I3DA 3QV7A 2DVUA 2WVVA 3UXLA 3OG3A 1BAGA 4NNAA 1Q6FA 4PYSA 2QNEA 4IQJA 4XVEA 1SFSA 4Z2KA 3CEUA 4HSOA 1TPDA 2FH6A 1RD5A 5TNVA 4DO7A 1EB3A 1B31A 2R1NA 1RR2A 4M0XA 4DI9A 3U7BA 2YOCA 1DTNA 4B2DA 1DJNA 2A4AA 1G9HA 2FZMA 4IG2B 2WHKA 2ZX7A 1SYTA 5C7HA 3JZEA 4YCOA 4YL2A 1HTIA 1R46A 3W02A 4L4LA 2ZZ2A 1TWDA 1KQYA 3RLVA 5D02A 4A8NA 3VKBA 1YTDA 4PULA 2HRWA 3FXYA 2PRLA 2NQJA 3RCYA 5C9WA 1QHPA 2NX1A 3LQLA 5LGZA 3WDRA 3AXMA 1ZB5A 3KVKA 1OZQA 3V3WA 5E0CA 4UCGA 3QPEA 2WB5A 4QR6A 3C3NA 3QGVA 1JYWA 2WKGA 1AFSA 3SRFA 5I6SA 4A3QA 4RUBA 4ZSTA 3TJXA 2G3FA 3REQB 3FNDA 1CXFA 1W1VA 1D9EA 3LBCA 3G1HA 3STFA 3I10A 2C1HA 1R86A 1QVBA 4P5UA 4BQ4A 4HA1A 3BSMA 3BLOA 3WNPA 1ZJIA 2DVXA 3RO8A 2J78A 1CYGA 1V3LA 4NRSA 1ELSA 3PBUA 3UJ2A 2WNWA 3WY1A 2VGBA 3ITCA 2VZTA 1JI1A 1WQ5A 4WRHA 3ZR6A 5DXXA 1HGWA 5A8GA 3PPFA 2TAAA 3LCIA 2AKZA 2AL2A 2BY2A 5D2WA 1GPFA 3BMVA 2F8QA 1BXNA 3IIPA 4LCQA 4ADTA 5FF3A 5CGTA 1MFUA 3BOLA 4N9CA 1JUBA 3PN8A 1V0NA 5GJPA 1D7KA 2V5JA 4O19A 3KP0A 3KZPA 1XLBA 3WD2A 4XKYA 1AD4A 2EBNA 4MNKA 3P67A 2TODA 5HUOA 4C1NA 2GJXA 4C6CA 1KKOA 3ZO9A 3LSCA 3CAWA 3WDJA 1WXYA 3SUWA 1I2QA 2V5CA 1E43A 3OBKA 2D69A 1GQJA 3N6JA 1Z8AA 4DF1A 3MKKA 2OOGA 4NJIA 4Q4QA 3UR2A 1V6TA 4HVXA 2A2IA 4IUOA 1WV2A 4A3YA 4MLJA 3CJPA 1R9XA 4EKJA 2XFYA 1W31A 3GIQA 3L2IA 1IF2A 1KGXA 1DJQA 1WAUA 4PMOA 2DJXA 1WPCA 1XIEA 4IZGA 1Q4NX 2ZUWA 3GDLA 4NASA 4GISA 5D38A 3TA6A 4EF9A 2QJGA 1H61A 4YHGA 3W85A 4K2SA 4R9OA 2J6XA 3IUIA 1P0EA 4ZO7A 3P14A 4EOUA 3I6RA 4UOZA 1VRXA 1U30A 3PPHA 3E2QA 4O4WA 2F6XA 3IIZA 3C2EA 1NWSA 3G8RA 4I6KA 3KLKA 1UP3A 3H4XA 5DELA 2FMNA 2NXHA 1X1NA 1AJ2A 5BWAA 1CBGA 5K2ZA 1GT8A 3BG9A 1Q6RA 2REQB 1LRTA 1B3VA 5FEPA 2CWNA 2DSZA 3B4UA 3MCMA 1C8QA 3W7LA 4HTYA 4J3WA 2E6FA 3SCPA 4IQEA 3TN5A 4HU8A 2D0HA 3N3TA 3HZ3A 4R33A 1OGGA 2GK1A 3UXKA 5CG7A 4LVAA 1C8XA 1KO0A 1V79A 2VT0A 1XUZA 4L6DA 3DCPA 3TWAA 3W1XA 3W75A 3ABXA 3LU2A 3T08A 3OOQA 4B5TA 3PB0A 2GSEA 3AHTA 5G2WA 2FYMA 3OBAA 1UD5A 3HQPA 4GK8A 4PCFA 3MUY1 3UT0A 3FHQA 2R14A 3LPOA 4LBRA 1KRBC 3M5YA 1QUMA 1FCUA 4C7DA 1PYMA 4B2DD 3DECA 5CSUA 5E0FA 2QCMA 3RIKA 4YPJA 1AQFA 4OGZA 1HZYA 2P8CA 1PB0A 4D72A 3R2GA 4B4HA 5K9DA 1T8XA 3R4IA 4WKFA 2C79A 2E40A 3WYZA 2NLIA 2V82A 4CU7A 2DT0A 4I8YA 2VRQA 2I56A 2ZZ4A 1IYXA 3UWWA 3UWQA 4PTWA 4N7QA 2QUMA 3NM1A 2QDDA 1OWQA 1T41A 3BV7A 3GVRA 2FZDA 5D8ZA 1IEQA 5JVLA 1ZUAX 2FDSA 1ECQA 4ZBCA 1BKHA 3MMTA 4HHMA 5IRPA 8CGTA 2JALA 3SCUA 3M0JA 4QCEA 1KM6A 3TFXA 3E0FA 1PPIA 4CD8A 1K9TA 1UOZA 3LI1A 4PTXA 3BGJA 3NPXA 2QCLA 3RGTA 4UTLA 4L7ZA 3LTPA 5CBJA 3L4UA 1WXZA 5GNZA 3NQAA 3GO2A 2CXEA 1QXLA 3M0IA 1F2JA 2FTWA 4EPDC 2BFGA 3XISA 4UTHA 3VA8A 1VYRA 1N2VA 3OODA 2V6AA 3VIKA 2HISA 2PD5A 2VC9A 5J5DA 2OQHA 2OKOA 4JTGA 2ZICA 2X1IA 5DCEA 3BOFA 4IMGA 3HURA 5JXQA 1W9DM 4JTSA 3SR7A 4D1IA 4MIMA 3PUOA 2EO7A 1TE1A 4GYFA 2CPUA 5DT5A 1JD9A 4GQQA 3I7QA 2BGQA 5A8OA 3G3DA 2VP8A 1YDNA 4C6IA 4GIYA 2YFOA 2E0PA 5HQLA 3SGGA 3HJEA 3TU9A 3ZT5A 4JTDA 1XBYA 3EGJA 4TO8A 2B7QA 2DSKA 3CL7A 1N82A 2OYMA 4AWUA 4CQ9A 2WWDA 3H7UA 3R58A 4Z2IA 1HJVA 3CHDA 4RXFA 3B03A 4DLFA 3LHTA 1NDZA 5AY7A 4ZQPA 3SN4A 4QG6A 4KWVA 3TKFA 4DUVA 2V67A 2WQPA 3GC4A 4M51A 3T0TA 4R7WA 1PCKA 3UWYA 2ZBTA 3P6LA 2E8ZA 4FA3A 3QLLA 3EA2A 1ZGDA 1VJZA 3SGUA 4OTKA 4TMBA 3CHVA 5HA7A 1UJQA 2WC4A 1QDSA 3QHMA 4C6KA 1ZBVA 5I3IA 2Y61A 1V02A 2AOSA 4F2BA 3OA5A 3CAKA 4MNLA 4AYSA 3EWBX 3WX7A 1D8WA 1R8LA 3S2MA 4HCLA 1KM4A 4LBSA 2OYKA 4BKNA 3NO1A 2VQTA 3I65A 3K30A 1E5JA 2NQLA 3SSZA 3MVIA 4JQ1A 4MNMA 4DUXA 1H11A 3J7HA 2IPFA 1EF3A 3V5FA 1RXOB 1XLMA 1TZ7A 3ZWTA 2Z2AA 3EWXA 2YPIA 3CWNA 2VURA 3TONA 4Q8VA 1W3HA 2QIWA 1DORA 4L9XA 3T4WA 4HPGA 3NQBA 3GS6A 4WDUA 3ZT6A 3QYSA 1QR7A 4ZFCA 1AODA 2W62A 2NXGA 5LSMA 2NV9A 4JQ3A 2R1KA 3DI1A 1VENA 1GKRA 4N9DA 3MYOA 3FIGA 4C6QA 4K3ZA 3CO4A 2FLIA 4I8DA 2REQA 4Q8UA 4O57A 1XSIA 3PBWA 1W5OA 3N3MA 3TZFA 2OSXA 2FB2A 3UF9A 3ES7A 3S6TA 3QPYA 2E9MA 1S2UA 4QEEA 2EEXA 3H2NA 4IM4A 3TAKA 1N55A 4M82A 3LXBA 4AWTA 2H8ZA 2Y70A 3TNOA 3PZOA 3TUUA 4HHLA 1J9YA 1U5HA 2GGHA 2OZ3A 1V0MA 4JIEA 1SZNA 3G5EA 4ML4A 4CQ8A 3E9AA 1EO5A 3B97A 3WG6A 2WYSA 3SFKA 3M64A 1BRLA 4BF7A 3ANUA 4HK6A 5K9XA 3I7RA 4K37A 3QHOA 1F05A 1GJPA 3VMPA 3G1VA 4A05A 1I2NA 3IVTA 1KQZA 2J62A 3FXGA 1B3XA 1HKIA 4NAEA 4DO5A 3WL1A 4LALA 1XRSA 2OJPA 4PCSA 1ZLPA 2WHMA 4WDWA 4GI6A 1NAL1 1W5MA 1UASA 5D9MA 1W3JA 3HOJA 4CU8A 4FS9A 3RRAA 5FF0A 5A6SA 1A5KC 4KIRA 4IUGA 5EA9A 1I0BA 4DUWA 3Q65A 4KFPA 1SGJA 1VYPX 2Y88A 1JCTA 3F7JA 1PCWA 1W91A 1ZAIA 2RAGA 2FFCA 3WQ6A 2PDJA 4AY7A 1KNWA 1KXHA 3PAOA 4G1KA 1KA9F 1MUMA 2JF6A 3W00A 5A6BA 4JS3A 3QV6A 4UMBA 3E0WA 3A4AA 1F3TA 3GXNA 4NX0A 1VKFA 4CCEA 4YVPA 3WD1A 3LRLA 1MW0A 5HINA 3NDZA 1BSIA 4B4FA 1HKWA 5HWNA 4CD7A 3A5VA 1LUCB 1CX9A 1UG6A 4WOZA 2FTPA 2PI6A 3EZ4A 2QJHA 2VTFA 1A47A 1R3WA 4WXYA 5M17A 2VYOA 2E5DA 1R5YA 1TQJA 4UR9A 3RPTA 4N4PA 3QRHA 4GGHA 1HL2A 1XIHA 1E70M 1JF5A 3AIQA 1XLFA 2G3JA 4E38A 1UWUA 5FI8A 4WJ8A 1LBLA 2RGLA 5AOUA 3W4RA 1J0YA 5LKYA 1BYBA 3T6CA 4GJIA 1OFRA 1Q3NA 1P5BA 4Q8QA 4DWSD 3TWBA 3R89A 1EFZA 4GE8A 1XIDA 4HOWA 3TLLA 3LQGA 2ZIDA 2E09A 4C6MA 4O1DA 1F3WA 1Q6LA 3BGGA 2BHZA 4ZL1A 3ATYA 4EVZA 3QFWA 3UXDA 1DHKA 4PC8A 2Q3RA 1XKYA 2XVNA 1C93A 4L4OA 2PAJA 1TTQA 1X7FA 3VE7A 1UUMA 1FXPA 1AH4A 2OWCA 2F84A 3A21A 2Y5JA 2XU2A 2DZAA 1L6YA 6A3HA 2ZRVA 3OB8A 3QC3A 3BWWA 1LROA 4D6JA 3WLTA 2EG6A 1X1ZA 2CETA 3U4AA 1MQRA 1WZAA 4MF4A 2OEKA 3ORWA 1RA5A 3AALA 3ARUA 2XZ7A 2Y5SA 3TR2A 2O56A 2V69A 4AD3A 4L1GA 4C6BA 1EHAA 3EKGA 3UA3A 2ZX8A 2DU2A 3LGGA 2VRJA 4DAFA 3VI2A 2HK0A 5IDIA 6CGTA 3FAXA 1U1UA 3WL0A 2B7NA 2AKMA 3GM8A 4Z2GA 3A12A 5JBEA 2PDFA 1JDFA 3GH4A 2Q3OA 4WJEA 1F8IA 1F74A 3P8IA 1O5KA 4WY0F 5DEZA 3G1RA 5T91A 3WF3A 3I4EA 4NP7A 1UCWA 1XR2A 2PD9A 1Y0EA 3HFYA 3LNMA 3R1ZA 4GY7A 2VFFA 1HJWA 1JGMA 2NT1A 4H41A 1LG2A 4AH7A 1AK5A 4FXFA 2ZUTA 2UY4A 3C0LA 3KZSA 4XVDA 5FEZA 1ZCCA 4GQRA 4ATDA 4IPNB 4ACZB 4JHMA 5HULA 3S1VA 5D09A 4I90A 4M81A 4XD4A 5C6MA 1SZFA 3VM7A 5HNNA 5A2BA 4QS5A 1JDEA 4JHOA 1PTDA 1S2VA 1UPPA 4IMEA 2V2DA 1WUEA 1C91A 4LANA 3ZR4A 4GQGA 5G4EA 5I3DA 2W66A 2VOMA 3VK5A 3IJIA 1US0A 3DKJA 1TMHA 2C71A 5CH9A 4AFYA 4MMWA 2ZDRA 3FAWA 4HZ8A 3CWHA 1K8CA 4A3HA 4JTHA 1RLDA 3LTYA 4LQ1A 4OV4A 5TD4A 1LL4A 4Q8PA 1GJWA 4V28A 1KKRA 5KETA 3DFTA 4BR1A 2QCEA 3A3XA 3CHEA 1W3TA 2ZUVA 2W0UA 3LLDA 3ZSTA 4ICCX 3KVLA 3AROA 4M80A 3P80A 1KTNA 5AFDA 5LNVA 3BAJA 3UGRA 5DMMA 1SMAA 3GRIA 1J18A 1WOAA 2NV2A 1ONEA 2VWSA 3WF2A 1O68A 4NZ3A 2EG8A 1DJHA 4CN6A 3A47A 1UWAA 1AMKA 2F6KA 1VP5A 1GEQA 7A3HA 1FWRA 3QLDA 5D4YA 3GAKA 2A1YA 4GZJA 1J79A 4L56A 4OT7A 4LPCA 5E09A 3UVIA 3NZ1A 3W01A 3KCJA 3R6IA 4ZOAA 3PHAA 5AN7A 2QEZA 3ZJKA 1R2RA 5A6LA 1MDRA 2XDFA 2QT3A 1WAWA 2RUSA 5HQMA 3UWUA 3T2QA 4UFIA 5I09A 4C5ZA 1Q6GA 5C0QA 5A6BD 4NF7A 2VDGA 3F03K 4GNJA 1XLCA 4CQCA 1X38A 1US2A 3IUDA 3AUJA 1SZGA 4AXKA 3SCRA 5CJ5A 4FI4A 4LAUA 3B9OA 4UFJA 3OA3A 1S3TC 4MUPA 1KM0A 1LWJA 4Q22A 4YJ5A 5BXTA 4H1ZA 4FSAA 2PFHA 4Z2HA 3VINA 4OOZA 5AC5A 3MBFA 4UBPC 1E6SM 1NVMA 4WKAA 4MAZA 4DJED 4ADUA 1Q8JA 1ZRQA 2CLIA 4AW7A 2WMKA 3LK6A 3MB9A 4O50A 4IWWA 1IIHA 4KH2A 3ARPA 5AHMA 4OU1A 4F0HA 1YE6A 1XLEA 3SUUA 3B4YA 4AMCA 4RW3A 4NI8A 3NJ3A 2HEJA 1REQB 3S2NA 2VEKA 2V38A 2Y85A 1EUAA 3GVGA 4JTLA 2BBFA 3FKKA 4A29A 1XLHA 1N7KA 3WLSA 4JYDA 7XIMA 3IIOA 4EANA 3GLCA 4EAYA 3TW6A 4MDPA 3WK2A 1NDWA 3B9AA 4P7OA 1FH9A 2CCRA 4V27A 1LRQA 1JUKA 1OC7A 1MI3A 2XN0A 4E8GA 3F5KA 3DKLA 2ZWZA 1R3RA 3EOEA 4D6GA 3MZ2A 3UJSA 4YIWA 3H24A 4Z42C 3RPMA 4DY1A 4JL2A 2X1TA 2Z25A 4Z2JA 5MHBA 4IIHA 3VD7A 4RR4A 3GXIA 2CU0A 3BOXA 4OBTA 2Z1WA 2P3EA 1DVJA 3MPGA 1W3LA 4KPLA 3STCA 3RM4A 2POTA 1CTNA 1G94A 3GNRA 3TQ0A 1C90A 2BOFX 2ZXBA 4J4KA 3WQWA 1IT8A 1FWJC 4P8UA 1UZ4A 3USZA 3HMJG 3APTA 3GHSA 1QW8A 3VYLA 3QZ6A 2E6AA 2PUZA 1FH8A 4HA0A 1CGUA 2XYLA 4Z1CA 2Y62A 2XG9A 5CQ1A 2JIEA 4CVUA 5EFDA 5CC6A 3GBDA 1LORA 3H8AA 1UR9A 4HK5A 3WNKA 2HTMA 1MYRA 4MY1A 4NRRA 2PWDA 3UJEA 4J40A 3MCOA 1BWKA 2Z27A 4KMQA 3KAOA 3RJYA 2ZRZA 3RX4A 3ELFA 3M41A 3W7PA 4H6KA 5HR7A 3RU8X 4Y9PA 2ISFA 3BZJA 5EMJA 3CT7A 5DBUA 4Q32A 5TF0A 1RAKA 2QDGA 3NQ6A 5I77A 2YW4A 5G1MA 3D3AA 1UR3M 2Y6ZA 3UXIA 1RHCA 3EX1A 4PGLA 3WH6A 4HPNA 3KRUA 5CSRA 3GR8A 4GNKB 4JZ5A 4WSJA 2PWGA 5K3VA 2ZX9A 4MB5A 2QAPA 1KBKA 2Y24A 2YXGA 2PA6A 4NZJA 3G1YA 6ALDA 1E55A 2DSWA 3PBVA 3JRKA 4KT2A 3UCCA 2B31A 3E2SA 2C1IA 4OJYA 1EXBA 2HE8A 2PGRA 1VZWA 3L5AA 3FS2A 3OVRA 2C7FA 2WZTA 1T99A 4WZHA 4ACZA 4XZIA 3T0AA 1XLAA 1FA2A 3TR9A 1Z44A 3MKVA 3NAVA 4S3GA 4Z0JA 3S4TA 2X2YA 3PANA 1KC7A 4S1FA 4HJFA 5EPDA 4AD2A 4JDBA 3FDKA 1QPKA 1P6BA 3ICJA 2ADAA 1DJYA 4GO9A 2R8WA 3VM5A 1YTKA 4IX2A 4BY3A 2DUAA 1XF0A 4OBRA 4CNNA 2DQXA 1JAKA 1L8NA 4BS0A 4MZ1A 5ABTA 3KOFA 5D04C 4W7UA 5LGXA 5A8MA 3VIOA 3IGUA 3TYZA 2QHAA 4HJWA 4MKVA 1UC4A 4ZZ9A 1OF6A 3ARYA 2W5FA 4DI8A 4EE9A 1XSKA 2W6RA 3STGA 3WMBA 1V3KA 4FF7A 4LNCA 1NIUA 4AZGA 3RN6A 3DHDA 1XKJA 3N12A 1R6WA 2W27A 4H7VA 2GOUA 1DE5A 3QC0A 4DYJA 2BGNE 2OXNA 2PDPA 3M5VA 4IP7A 4GQBA 4XZLX 3KM8A 2FVKA 3TEVA 3U2CA 3GH5A 2FHBA 1GUVA 2ZQ0A 4ADSA 1GOOA 4RKAA 2QCGA 5CBIA 3LTSA 1DPMA 3RX3A 4Y90A 3CNYA 4BEQA 1JZ2A 2EPKX 3LG3A 3O7UA 4W4QA 3W0KA 3ZM8A 4MADA 1J0KA 3U2EA 3M0LA 1TZ9A 4K8GA 2VC7A 3FSTA 3KXQA 2O4MA 2PDKA 2ODOA 4IFRA 1QI5A 3W7NA 2XUCA 1YXYA 4YXGA 5FEXA 4HCHA 4GD0A 1I6NA 1CXKA 3V1PA 3ABQA 5AHFA 4GMEA 4C6OA 1IEWA 3C2RA 1VS1A 4FXSA 4DO6A 2WZIA 3EKZA 2XGIA 4DWDA 5LIYX 4I5RA 3CZGA 3U6WA 3F1QA 1RY8A 3IAQA 4IIDA 4MJZA 1X8CA 3VKKA 1TJ1A 3ZIZA 4J7RA 2X05A 5HBFA 2Y1HA 2XVLA 1EIXA 4AHPA 3WLIA 5F4WA 3DH7A 2YX0A 4FMVA 1U5JA 4H7CA 1Q6OA 3UBPC 1OJXA 4P7RA 4X9SA 4JFUA 2FZ9A 1V51A 4ROPA 4LUSB 3UWVA 4LB4A 3ZLGA 2QCNA 2XSAA 3VDGA 1A50A 2QQ6A 2VD9A 4E4FA 4H9MA 3ANVA 4FX6M 4Y8FA 2NVDA 4PCPA 4FNSA 4D6HA 4FXJA 3SDOA 1TPEA 1RJQA 3LHVA 2YR1A 5HNRA 5DO8A 4A8LA 1QBAA 3QQ0A 3W23A 4PUEA 3UJRA 2PF8A 2G3MA 4AD1A 1I2RA 5M2FX 3MMWA 3QZAA 2FQIA 4DBSA 4A3RA 1E6ZA 8XIAA 4PTVA 4WSHA 4QSHA 4QDMA 1WA3A 1FKXA 1NJJA 3U48A 2WSPA 3QOKA 4LUTB 5FF2A 3BARA 4CD5A 4FX8A 3QTGA 3NZPA 4UMAA 2CC0A 5HQEA 2RDUA 3VXGA 3BDKA 2BMBA 3SQMA 3CQKA 3QH2A 4EPBC 2DEPA 3KBVA 4FNPA 1XLKA 1KFKA 1M5WA 4AZCA 4MAVA 2XM2A 3MBDA 4PA8A 1IGWA 3GXFA 1KFEA 2GDVA 1BF6A 1XJBA 2J74A 3DFPA 1DIDA 3NCOA 3PNZA 3GE7A 1C7TA 3NZGA 2V8ZA 2WLZA 1DJXA 2ZFAA 2VWTA 3SY8A 4XTDA 4A4AA 5FCZA 1DWJM 2CW6A 3LHUA 1VCFA 1C92A 1FWHC 3FGCB 3D5HA 4UQDA 4AWEA 1E51A 1FWGC 2HE5A 2V5KA 2OZ0A 3WF4A 3V16A 1Q6EA 4AVFA 4QTGA 3MANA 4G6CA 3NQCA 2J8TA 4WIWA 4GI9A 3T44A 4KBXA 1F5ZA 3BICA 3WCZA 3D0CA 1ICPA 5BCAA 2XIOA 4XO6A 1AJZA 1FP8A 1O60A 4C60A 2PDYA 3S9ZA 4EP8C 3P60A 2WKLA 3DAQA 1YBQA 9XIAA 1Y5VA 4UR7A 2VFIA 3EDEA 3RX2A 1Q6DA 4GI4A 4G9PA 4I6VA 3EWZA 5J04A 3WDQA 2EJ1A 2FMOA 5CC3A 3PUEA 4DF2A 3NEVA 1JCYA 1TTJA 4AIBA 3KDNA 2PP3A 3ZZ1A 1BHGA 3K8LA 1AMYA 4XIAA 1TRIA 2QCDA 4AU0A 2VR4A 5LNUA 1OFDA 5EMYA 2OX1A 4WGXA 1S2CA 2QUVA 3TN6A 1ITXA 1JQVA 2DJLA 4TX9A 4HNUA 3UZXA 4OVXA 4D6DA 3VZXA 4DX3A 3A64A 1ZAHA 3BCDA 8RUCA 3AWOA 5L6UA 5LYRA 1XL9A 3SUSA 3MUIA 3OIXA 2WXDM 4UTKA 1X8FA 3N29A 4RK8A 5EMMA 3WBEA 3TVAA 1TV2A 4BFAA 4XG1A 2PODA 3RCMA 2HVMA 3M5XA 4NIRA 4J2PA 3PNUA 2HVOA 1DIEA 1K4GA 4JTJA 2I9EA 2UZ9A 3UA4A 2GSJA 3F4WA 3S2LA 4L6HA 3H26A 4FF5A 4MWAE 1SUXA 1UWTA 3C6CA 3OIHA 3FKRA 1MEIA 1RJPA 1SM9A 5XINA 2FTYA 1WDWA 4U10A 4PMUA 2RJGA 3FYOA 3W83A 1QASA 2CZFA 2ABAA 1CGVA 4B3ZA 3ALGA 1CIUA 1JFHA 4XAZA 2IS7A 1P6WA 4G7EB 3GXPA 2H3BA 4L5ZA 2O9OA 3PPGA 3M6DA 3V75A 1RJRA 5CSSA 2HXTA 5PTDA 2WKJA 5K7JA 1C29A 3PZ9A 3CO8A 4PTMA 4PMQA 1WKYA 1ADOA 1BKSA 3GH7A 4Y7EA 3IUHA 1J12A 1MUWA 3L4YA 4S3AA 4MGGA 4IFOA 1EUNA 3TQVA 1UP0A 1J8VA 2FPYA 4M6PA 4C6DA 2YIHA 1EGVA 4D2JA 3IVSA 2OG9A 5BROA 1TSIA 3HF3A 4MJMA 1OGBA 3RNDA 3HG3A 3PWGA 3G8EA 4R9XA 3VD9A 3GUGA 4JIRA 3JW7A 2QR6A 1FP9A 4MB1A 3NPWA 1ISZA 2UBPC 4W8LA 5HMDA 7PTDA 3W7IA 3BANA 3VKCA 4OUIA 1UQZA 3W7QA 3AIUA 4OWGA 3GW0A 1QATA 1H1NA 2YKKA 4JFWA 5I79A 3LDVA 2FVMA 2O55A 1MW2A 3H2FA 3JUGA 3CASA 2VX7A 2OGJA 1H09A 3EDKA 2J7CA 4IJCA 3H6OA 4JN8A 4DBEA 3K8MA 4GVHA 2Z4GA 4PSPA 1E0VA 2QMKA 4UQBA 3PPCA 2C16A 3H4GA 3G77A 1UA3A 3WH9A 3AZTA 3ARWA 3N73A 1XIIA 3VGFA 4UCFA 1WYIA 2V2CA 3VMOA 1QPQA 2X2GA 2YW3A 4K6AA 2CLMA 3IJQA 4FR6A 1XRVA 1FDJA 2WNZA 5LZLA 1GVQA 1UUQA 1TPWA 2R91A 4DZHA 3G1AA 4XB3A 4DBWA 3ARZA 5FJPA 2OEJA 1IIGA 4XBKA 1OX6A 1QPRA 2HBVA 2WMHA 3E74A 1VCVA 4I9JA 3TC7A 1GVEA 4RV8A 4DXKA 5AVNA 1E9IA 4GKLA 3L7RA 1E6NA 5D30A 1H1YA 2YBUA 1OYAA 5TBOA 2O0TA 1ZHAA 1ZBKA 4PMYA 4AIUA 1A4LA 4OOUA 1BYDA 3GVVA 1Y5WA 3O6DA 4DVOA 1TVNA 1EL3A 4DZIA 2WOQA 3FGCA 3Q37A 3GG7A 2F2KA 4O1FA 1V93A 1XLDA 3B8IA 3BLKA 1E9YB 3QMRA 3S5NA 3UZYA 3ZYZA 3RO6A 1KBBA 4IIEA 2YCLB 1UH3A 4FLQA 1XRFA 3VGBA 3NVTA 4JKKA 4ATLA 1X6LA 4I5UA 2I17A 3BAWA 3MSDA 3UESA 5FJUA 1QO2A 1V03A 3N9RA 3U7VA 4LY8A 3U3HA 4HN8A 2ZA1A 2HSAA 4US5A 4ZE5A 3BH4A 3EEZA 1W1ZA 3RJXA 1NM9A 1QHOA 3VE9A 4UR8A 1X6UA 5B7ZA 4UTTA 1U1JA 4DNHA 2I5QA 2RDXA 2C19A 4PUUA 4N42A 4EXQA 5A2AA 1L6SA 4ZB2A 5BXRA 4AY8A 1XLIA 2OMAA 4KCVA 3EWUA 3TLQA 3W76A 1K03A 4BQ3A 1NP2A 3R7MA 4H2CA 1XCFA 1ICSA 1DKWA 4IMFA 5I3KA 3W2LA 2VX5A 5EB8A 1TZZA 1GORA 4B5XA 1IT7A 3RMJA 3C0SA 1GVIA 4ICMA 3EYPA 3VPLA 4BCEA 2DH3A 1AW2A 3F5JA 2E9LA 3FW6A 3N25A 1NFGA 4FNTA 2RDWA 4ML9A 1HVXA 3FYYA 2XIMA 3B8TA 3HJZA 3WBAA 4I9TA 1TKKA 2I16A 4IT1A 1OB0A 4ZEPA 1QPOA 3Q67A 1LWIA 2HWGA 3WF0A 1B9BA 1EEXA 5I3FA 2J79A 4R27A 3OHMB 1FTXA 3W88A 3B8VA 5IDZA 4Q8WA 2D2HA 4XWUA 3BSHA 1LLWA 2X41A 3DFSA 1A0DA 1XHGA 1QNSA 2YDSA 4OV9A 3LPPA 4NVTA 2E4TA 5L9FA 3V0UA 3N18A 1YMYA 5LNSA 3F4VA 3RM8A 1OX5A 1K7FA 1A0EA 3W24A 3W53A 3EDJA 3SCVA 2Q8ZA 2J7HA 1S2TA 2PLKA 5E5CA 3QW4B 5D9OA 3GG0A 1EBHA 1H4PA 3CS2A 3AS2A 4H04A 2XH7A 4ZB0A 2Q71A 2WC3A 1HT6A 1OM0A 1DWIM 3AFBA 3UR5A 2ZWYA 1OK6A 3GU1A 1EP2A 5EMKA 3WENA 4G7EA 1F8MA 2GUYA 4CU6A 4NZ5A 1F3EA 3VNLA 4MWAC 4O52A 2OCZA 2ANUA 5CGMA 1OYBA 5BRBA 3R11A 2CIPA 3GXDA 5EMUA 1GJUA 5HDRA 1BVZA 1XICA 1PSCA 5H6HA 3W2KA 4H2HA 2CBVA 3RF9A 3C0JA 5MKGA 2NXIA 1G4SA 3SJNA 4GACA 4MZ8A 1FWIC 1I8JA 1SZRA 5CSYA 4WX2A 2XVPA 5FL1A 1R9YA 3TNBA 1UMLA 4JD4A 5A6KA 5B7YA 1F73A 1OBAA 3B3DA 3WN6A 4INFA 4DPQA 3WJZA 4JIIX 4QFUA 4XSMA 2OLHA 4UIOA 1PAMA 3MHFA 3APYA 4JTUA 1JRBA 4JFTA 3GVQA 4OKDA 1NARA 2NLYA 2RJHA 5E1QA 1L0PA 1GHSA 2OU4A 4NX5A 4W7VA 3CGTA 4TXEA 4C1KA 3KWXA 4DPPA 4AQLA 4QLJA 5DCDA 2BGSA 2Z6JA 4JEQA 3W6YA 4JY9A 7ODCA 4ES4A 2AGKA 4NJKA 4N9BA 4HB7A 1AL7A 1QNRA 3EWYA 3SO7A 1TO3A 2YCJA 2XH2A 3B40A 4QCFA 1E4MM 1H49A 5J5RA 1SJAA 4E8DA 3ARRA 5ECUA 1YE4A 3TYAA 2ZA2A 2WJDA 3FJ4A 4XUYA 1JZ4A 4HYVA 1UR8A 3LMYA 1SJBA 3WEZA 1CXEA 1TA3B 4W88A 3FSUA 1XRTA 2W91A 2WVTA 2ZTKA 1EJUC 3MSRA 3NVDA 2C8NA 4KCWA 3OG2A 4KKXA 4LAOA 2PLCA 5D33A 1M7PA 2BVYA 3QV8A 1W5PA 3NXFA 4OZOA 4XZNX 1V6VA 2UY2A 1K7XA 3QF0A 1V6UA 3MP3A 1YXCA 4LBUA 4HGXA 2VCBA 3A24A 3AS3A 3CB8A 4GJJA 2WMFA 2DDXA 4I3GA 4UB9A 3M4HA 1Q2SA 1JZ5A 3VZZA 3SCWA 1A80A 1T96A 3KS5A 4AMAA 3DC8A 5CXPA 2CBIA 2QJIA 4ZXLA 2HS6A 4CNPA 1HIZA 2V3EA 2DY3A 3MP4A 1TVLA 4MDOA 2GDQA 2WMGA 3AMDA 1Q45A 3CM4A 3CUZA 3UZZA 4ZO9A 4US5D 1A3XA 3N34A 1XX1A 2OVLA 4QE1A 4X0VA 4IPPA 5CC7A 2Y5EA 2PURA 5CPLA 3VIHA 2YCLA 3B9NA 4HNTA 1TV4A 3F5LA 2QMJA 1ECEA 4C6EA 4O53A 4X60A 3DZ1A 4IMCA 1GOWA 1X7IA 4HHPA 4DELA 3TOYA 3HV9A 3E1F1 2WSRA 4EIVA 3LPGA 4UFKA 4AIEA 3GX9A 2OGYA 3LPFA 3BO9A 3AAMA 4G2DA 1G5AA 1U33A 2JGYA 3PG8A 2G96A 3VIFA 4XAGA 3V35A 4OQVA 3SCOA 4QROA 2Q6ZA 2NQ5A 3WUBA 1P48A 1TJ2A 1AJ0A 3R8RA 4MJ4A 3MO7A 3B0YA 1X39A 3PVFA 3TC6A 3UPMA 3CQ0A 3TH6A 1RK5A 4ZTXA 1CENA 3W7HA 1C7SA 4I7VA 1QWKA 3LS9A 4LJ3A 2BASA 5I3GA 1JYVA 2ZKMX 1Z7AA 4HMNA 4QXIA 4K36A 1QT1A 4G56A 4QEHA 3RU6A 1DJIA 3KL5A 4ZQRA 4LB3A 1FBAA 2J8GA 3SBFA 2P0OA 1Z6KA 1WDPA 4O0KA 6XIMA 1EDGA 1LCOA 4L6OA 4KWWA 5CPOA 4NUWA 1Y5XA 3BCJA 4GYJA 3AU6A 2IQ0A 4KCUA 3UG4A 1I1WA 2OTDA 4RXGA 1V7AA 3VU2A 1BFNA 1D8CA 3MJYA 2DIKA 3WMSA 1I9CB 1VF8A 2J8FA 1LRNA 1RSCA 2Z00A 1OEPA 4WXZA 3I4KA 5KTLA 1G0CA 4HZMA 5F1VA 4Z1DA 3SRHA 1GYNA 1XIFA 4HD5A 4ZENA 3CUXA 1QNOA 4RV3A 1XFBA 3FOKA 3WDIA 2AGTA 2VGGA 3N04A 5FACA 5SWUA 3BJTA 5HXMA 4U5KA 4FOJA 2G50A 2QV4A 1ITQA 1IEVA 3TP4A 3LCLA 3GG8A 2BOEX 3NQVA 4MWAB 1JPKA 3AUOA 5JBDA 3LZ5A 1JYXA 3NL2A 3T0CA 2ZZ3A 3PJUA 1JCMP 1LP6A 3LENA 3S2JA 1M53A 1AZ2A 1R3VA 2TMDA 3URAA 2OPJA 4LYKA 4PCTA 3CBWA 1NY1A 4FLRA 2BDQA 1KRAC 4K7YA 5REQB 3WIJA 3VUSA 5A5WA 4GUGA 5BNKA 4BK9A 3KWSA 2P8BA 1DTUA 3FY1A 3ZJ7A 1ADSA 3C8FA 2EF9A 3KBSA 2GOKA 2FIQA 4C90A 1OIFA 4S3KA 4LVFA 3IWPA 2XGZA 2CHRA 1UKOA 5G1TA 1S5VA 4U2ZA 1VFLA 2DGAA 3PG9A 1HQTA 2QJNA 2YCIX 4HNLA 1OINA 3B0VC 1CECA 4F0SA 1I1XA 4LTSA 2R24A 4V1XA 8XIMA 1SFJA 3M0YA 3M1ZA 5D9NA 3PZIA 3KRBA 1VBRA 3VMNA 1XBVA 3GU2A 3TZNA 1XYMA 1KCXA 3KBWA 2ZUSA 4PB3A 1V3MA 2G4FA 5G2HA 3E3HA 3QV9A 4JX6A 3EPNA 2PTZA 4ZODA 3G1SA 3SJ3A 2WM0A 4IIFA 1RALA 1EZ2A 5HJYA 4QAWA 4O13A 2YB1A 1LQ0A 3IGHX 3K8KA 4XD5A 1EQCA 1DXIA 4TVCA 3KW3A 5CAKA 3N13A 3QY7A 4RDZA 4J3TA 4MVAA 2ON3A 3TYUA 4KRZA 1WZLA 3WQVA 1DIOA 2J7GA 3NPVA 3M0KA 1SPQA 2G0WA 3E0IA 3EB4A 1KFWA 3WMLA 1NQKA 1UIPA 5HWMA 1XIMA 2Z2BA 3TXVA 2P50A 5DF0A 3U2ZA 4PFMA 4RDVA 3WNLA 1V08A 2C14A 3UY8A 3MYPA 1AH3A 3H2CA 4AEFA 1V5XA 2CHOA 4MPKA 3VD4A 1GOQA 3RXZA 4C1NB 4YYFA 1OG0A 1XIBA 3WLMA 2VDIA 4HPJA 2X16A 4EACA 5DN1A 4IPJA 3W7EA 3URQA 5C71A 1X97A 2ZA3A 3AMKA 4DWSC 4DB7A 1EOMA 3OZYA 1H3GA 1G69A 3ITOA 5HJLA 3NQFA 5H8UA 2DV0A 2E6YA 2BODX 3IJLA 5U7SA 3M0XA 2X1UA 2A7PA 2D2GA 4PB4A 1Q5MA 1M01A 1OSEA 3GHTA 2VRKA 2WNNA 3BLIA 4JFSA 3L0NA 3HG2A 4P8WA 5DY3A 2A5HA 3ITXA 4O16A 1KGUA 4REQA 1J5TA 2UWFA 3B8UA 4C7FA 1Z3NA 3B8DA 4FO4A 3G1DA 3PWAA 2QAFA 1BG4A 3CLWA 3NTYA 1KXVA 1LG1A 1GZJA 4AZBA 1QAPA 3INPA 4J5NA 3G0SA 2R82A 2QCHA 3O9NA 2NQ9A 5JBFA 3CQIA 3URBA 4HOXA 3I7SA 5CPNA 3CLMA 1DJZA 1IHIA 1HKKA 4MM1A 2PSNA 4LRSA 1RA0A 1EC8A 4QG8A 4S3BA 5AYIA 1BYAA 2BVWA 2J25A 1VIZA 1GKPA 1XIGA 3H12A 5F4SA 1XD1A 1LJYA 1KD0A 2JQXA 1JZ8A 4MYAA 4HMCA 4NI3A 3BJFA 6TAAA 2GJNA 1XC6A 3GG1A 3QQWA 3UVAA 2A79A 1FCBA 2GVLA 4XZHA 1BVNP 3P5YA 2I5GA 1WE5A 2Y89A 4PB5A 2GK1B 2F9RA 2GWNA 4M3PA 3OVQA 2IKJA 2GL5A 3R0KA 2EAWA 1JF6A 3W9ZA 2Q8LA 3NQMA 2XM1A 2EKCA 1Y7VA 3HPZA 3O6CA 3VDHA 2PGWA 2YSWA 1UMYA 1U5VA 1YQ2A 4EPEC 3GTHA 1A5LC 1UW9A 4S3JA 3VOCA 2O9PA 1GVYA 1TX0A 3TXZA 4JCLA 1A5BA 2I9UA 2DORA 4XX6A 4GZEA 4MWAA 4W89A 2G41A 3DU0A 3OP2A 2FZBA 3S1GA 5C2XA 4D9PA 1W0MA 4RPPA 1TIWA 3GKFA 3M43A 3A22A 2HVNA 1M3UA 2CLHA 2HK1A 4D71A 5REQA 4G8TA 1UD6A 2P5NA 2I7GA 3IRDA 4TTUA 2E67A 1M41A 2V81A 3IIVA 2DT3A 4V33A 3ZMRA 3G1FA 1RY0A 1DBTA 1JD7A 3Q94A 1I2OA 4GIEA 4PMJA 5CGQA 1IQ8A 3HGSA 4HYWA 5I3HA 4E3VA 2ISVA 5I23A 3NEHA 3DDMA 3OGVA 3EOUA 1T7LA 1GG1A 4MG4A 1TCDA 1OG6A 4K1GA 1GKQA 2J13A 2V5DA 4PTNA 3GD6A 2PDCA 5CZSA 2VFEA 4HA4A 3W70A 2YBVA 4I7WA 3UZWA 5G4WA 3CIVA 3UNDA 2PC8A 1JRCA 1K9FA 3DOPA 3OLGA 4M1RA 1IZCA 3VOJA 4Q33A 1UR1A 3RR4A 3VOIA 1VC4A 2F7FA 3DERA 1R7AA 1OABA 4A8IA 1FHDA 2NX9A 1YHTA 4NJGA 1O1HA 2QYGA 3BURA 2VENA 4JX4A 3L66A 3W1NA 4JQAA 1ODZA 1GW1A 4DJEC 3V18A 2DVTA 2XJ7A 4AXNA 1XW8A 3PSVA 3EBVA 2CITA 1BD0A 3ITGA 4M56A 2QCFA 1E4IA 1WKDA 3SUVA 3UYCA 4H6EA 5FJIA 4RLIA 5GJMA 3ME3A 4NNCA 4PEKA 1VBUA 4Z17A 1UZHA 2NUXA 1J11A 3GFZA 4O8RA 1HJXA 2OO6A 4LCRA 2VFHA 5HANA 4YLWA 1ICQA 1VEPA 1AQMA 4F9JA 3RMEA 3W7MA 4LS1A 2PRMA 2GFTA 3OZOA 1EJWC 4KWUA 4WK9A 4G7FA 2PRHA 3CPGA 3M16A 4GX8A 4YN5A 1H0IA 5XIMA 4AD5A 2DZWA 1WXJA 3SAZA 1VPYA 4IPLA 2SFPA 3DN5A 4CD6A 4UFMA 4GUIA 4DWSB 4H01A 4XD3A 1J4EA 1CWYA 4ZQCA 2RFGA 1IR1A 3L65A 3GNNA 4L9ZA 3WBWA 3EMQA 2FGBA 3KTCA 2WHLA 3W38A 1XYLA 1S5NA 1I60A 2GQ9A 5HR6A 1K8XA 1OC5A 1EPVA 4C6PA 4PL1A 4TUFA 3CHFA 1LOQA 1HGYA 3MVTA 2OOFA 3NG3A 4DO4A 3AIRA 3KL0A 4HT3A 3H4WA 2OO0A 5T8GA 3LHWA 1MSSA 1M04A 3R43A 2Z1VA 1VBGA 2ALDA 5C9ZA 3F4CA 3W29A 1AQHA 4NSBA 2WJEA 2VC6A 3SADA 2HPMA 2QF7A 3BLFA 3OQ8A 3RDKA 1VPXA 2PWFA 3L68A 4TIMA 3EOSA 3MQTA 5D2XA 1EIBA 1AD1A 1UYQA 2WBKA 1UR0A 5F4XA 2PP0A 3FJLA 3CXOA 1ZPTA 2QDHA 1MW3A 2CEQA 3QR3A 3HMCA 3W7KA 3T1GA 3TCSA 1KXTA 1KV8A 3MI2A 1H62A 3FHAA 3U0HA 2DIJA 5I0DA 3M6YA 2WHJA 4QDPA 1BG9A 2PPGA 5TQLA 3ABOA 3IJ8A 4KGJA 4QX4A 1JJKA 2WVUA 1ML1A 3CV6A 1U1HA 2YZRA 3ID7A 9XIMA 1AH0A 1XYCA 4Z08A 2PLJA 2D2OA 4C6NA 3KCOA 4GJ1A 1VCGA 4QNWA 1R2TA 3W1LA 4HNOA 3MMDA 5T9BG 1XCXA 1Z41A 4GLEA 4WR3A 3PTQA 4GIRA 3OTRA 5LIWX 5CLTA 2W67A 2VVSA 4GABA 1G4TA 3W2JA 1C8YA 2VCAA 1CNVA 2VI0A 4CVWA 1KW1A 5FKYA 1E1FA 2FFIA 1W3KA 1W9VA 3O06A 4GO8A 4MWAD 1M7OA 4KF1A 3RRXA 1A5UA 4W87A 3VFLA 1RD6A 1K70A 1BRLB 3O63A 5D8WA 2PDBA 4M6VA 3SY5A 3AXIA 1SZEA 5LIUX 3BVJA 1LDCA 4NAEB 4GZIA 1OQFA 1NU5A 1WP6A 5J8LA 4UZSA 4U2YA 2Q01A 5GQBA 2OLAA 2BY0A 2V3FA 4MY8A 5E9AA 1KCLA 4LYQA 4Z1YA 4H9YA 4ZOCA 3APGA 3QN3A 4GX9A 3EOLA 2VFGA 3LGEA 3NYDA 2BV9A 1WBHA 2CZ5A 3W7GA 1ZS2A 1HF6A 4D6IA 1YADA 1RV8A 2LLEA 5E6YA 3VNZA 1UR2A 5EYWA 1F61A 1BYCA 4MZYA 1DV7A 3GK0A 2JBMA 2GGEA 1V4YA 2G3IA 2VGFA 3LCHA 1SW7A 1W8GA 2CESA 3S47A 5IHRA 3TW7A 4AWSA 1S5MA 3S1WA 1W2PA 1YPFA 1LWHA 1B54A 3CU2A 5D37A 4F66A 2W4XA 4JQ4A 4B3LA 1PL9A 4K7VA 3S5OA 1XH1A 3CHCA 2Z1KA 3W1MA 4GHRA 4LV9A 5G1YA 2J9XA 5GJNA 1GHRA 1SMDA 1PKLA 4Q4PA 5E9XA 4P7NA 4ILSA 1W2VA 3FVMA 3NQGA 4GWEA 4K1WA 4AISA 1ZFJA 4NL1A 5AHNA 3TDFA 3EA1A 2CYGA 2WMJA 3BAIA 2TYSA 4Q8MA 4AD0A 4QJ5B 2VQUA 3DHPA 2VFDA 3OGRA 4S3CA 4KESA 1R3QA 1ZP3A 4H8UA 3UWZA 2J77A 1QBBA 4JTQA 4GFSA 1AG1O 2WZHA 1IR2A 3MW7A 1OX4B 3IIXA 1Q65A 1CXIA 4ZO8A 1FX6A 3SN0A 2ATMA 5CZTA 3L5LA 3KS6A 4DZAA 2D73A 2XFWA 3WLNA 2ZCGA 4PN2A 2X0HA 1OZMA 4POCA 2V3GA 3DGRA 1XBXA 2XN1A 3ATZA 3NSNA 4I7UA 1J2WA 2B7PA 4FALA 1DQXA 3ABRA 3JVAA 3BLLA 4IMDA 5FSEC 2IKIA 4EPKA 1W1IE 1XYBA 1J6OA 1ONWA 2E9BA 1UJPA 1VFHA 5C70A 4DWSA 1S38A 1PWMA 3O15A 1FUYA 3EAUA 4H3DA 3UCDA 4IXXA 2KAUC 1SVDA 1VGAA 3QKEA 3O05A 5JH1A 2PDWA 2H9AB 1EJTC 1A5CA 1IEXA 3KFTA 1FXQA 1EC9A 2O7QA 5G4HC 3PWIA 4CGTA 2VDHA 2G37A 3WJSA 3WSUA 1OT2A 3HPFA 4IQLA 1WDRA 3TIMA 4PE8A 1XLJA 3JR2A 4WCJA 2PMQA 1TQXA 3AI0A 2GDUA 3WUEA 4ERAA 4JX5A 4Q8OA 3F4DA 1TPVA 3BL3A 4PUJA 4B5VA 3H70A 1XQLA 7REQA 3DYOA 3LV5A 1E6XM 1R0MA 2CZDA 2KX9A 3QBUA 3QHNA 2DZTA 4DXVA 1I0DA 2PTXA 3VZYA 1B57A 3FN9A 2PDUA 3S1UA 1ZENA 3AIVA 4CEXC 1TWIA 1NOUA 2J27A 3HG4A 3L9CA 3H55A 1EGZA 1FWNA 1YW1A 4UQ9A 3TYEA 3IJ9A 1M7XA 3M7SA 3QMTA 2WSYA 2C3ZA 2PE4A 2Z6IA 4HSHA 1HKJA 4DUOA 3HQNA 3BJSA 3HTWA 1YPIA 2BX7A 3M47A 4O28A 3AXHA 4E2OA 4DJDC 2XIIA 2OODA 4DBUA 1BQGA 5KZEA 3ECQA 4JOMA 4UFLA 1ITCA 3A23A 1YTEA 2ICSA 4JIQA 4FPSA 2XZ9A 2J9YA 1EP3A 2UY3A 1JDDA 5AYYA 4LOCA 2HDJA 1QU4A 1TJRA 2H90A 5EL1A 4IOTA 3T2PA 5CG0A 1NELA 2PCEA 4UOQA 1V0KA 2QIIA 5ECVA 2QJMA 4O54A 3E0VA 3WJYA 4GG9A 4G5DA 4QG9A 1J0JA 3CUGA 3U57A 5AKQA 3C86A 4A21A 2YA0A 1IT0A 4W93A 4Y9NA 1D2KA 4GFIA 4LV4A 4DIAA 2WZMA 1XM3A 4AIOA 2X09A 1DIKA 1KXQA 4HIBA 5F2IA 4AG0A 3V36A 1W5NA 1CGWA 4C6FA 1TIMA 4B3KA 2IXVA 1HG3A 1A5SA 3A5FA 3CMJA 4D8LA 1PEZA 1LQAA 2FPTA 2YYTA 1K1DA 1GQKA 2HPIA 4DXXA 3VD5A 1NF7A 3H22A 3LLFA 2DIEA 2GUBA 2E3ZA 2FJKA 3VOGA 3ERPA 1JPIA 1KM3A 1S3HA 4GYKA 4QNEA 1X98A 3QGKC 3BXWA 3GFXA 3A4JA 1Q8AA 4YTRA 3P93A 9CGTA 1UD4A 3MT1A 3TC3A 2Q02A 2VD8A 3QTPA 4FEZA 3O8AA 4A2SA 1QNVA 3RG6A 1YX1A 1ME7A 1UWRA 4C5YA 1UP2A 3P82A 4PRWA 1H1ZA 3O2LA 4JTAA 4PCNA 2XIBA 4AEOA 1JXJA 3WBXA 1G7VA 3VFCA 4NJHA 4UWMA 3WLPA 5DANA 1PHWA 2BWGA 2G5WA 1E3ZA 4S2CA 2QUNA 3P5ZA 4GOAA 1LOLA 2MNRA 2DW6A 4N02A 1EP1A 3UG3A 4XZWA 2CERA 1KTCA 1XGZA 1CCWB 1Q85A 2WJFA 1OFBA 3EKLA 1RCOB 4WEVX 1L8PA 1TUFA 3I3BA 4RE0A 1MQQA 2ZTJA 3BC9A 4DJEA 5RUBA 4YS1A 1ONRA 4P8VA 4U28A 3K4AA 2VKZG 2GGIA 1H2JA 3P61A 2PDLA 2H6RA 1IXOA 1NSJA 5D03A 1VB9A 2Z7GA 4JNMA 3VIGA 5A94A 3NQ2A 1TJPA 3P0XA 5TIMA 1FHVA 1OX4A 3TCEA 3NUKA 3E6EA 2BZNA 1XC4A 1MQPA 4H00A 4B16A 1P4CA 2OELA 4UTWC 1SR9A 3EPMA 4LVGA 2ISDA 2C18A 2IPGA 1QI3A 1SFLA 4YWIA 1SQ7A 1H7RA 5CZ0A 3C52A 4OFCA 1POKA 2G4JA 3NOEA 2XIQA 3PY2A 3U8GA 3DG6A 4JY8A 4RE2A 1EBGA 3H23A 4GVFA 1PX8A 3OU8A 3BE7A 3EDFA 2F6UA 1AL8A 2INZA 3LCGA 1MNSA 1QK0A 1PYFA 1UH4A 2O4QA 1P43A 3RILA 5AECA 1ZBWA 3VGGA 2JGQA 1UROA 1UUOA 3DUGA 5A69A 2C0HA 1A5AA 4L4MA 2QDEA 4ZVJA 3THUA 4JFVA 3EA3A 2GYIA 2H9AA 4C65A 3NM3A 1A3WA 1CLKA 4UFHA 3S6OA 4RJEA 3UETA 4YHEA 1Q6QA 2J47A 4BEUA 1TB3A 1H7PA 1G6CA 1QW9A 1K9EA 3AHXA 4M7SA 3W73A 4KEUA 4GC3A 1TWWA 4IQDA 4DAIA 1ME8A 3WKZA 1MUCA 3IJ7A 4DJFD 1LM1A 1S2WA 3SW6A 1NWTA 1QI0A 2PWVA 4XIMA 2PDXA 3HU7A 3IPWA 1UWSA 4LYRA 1P6CA 3Q2DA 3PZQA 3RYSA 3F2BA 3GAYA 3HM7A 2QF8A 2XGBA 1YPXA 1GQLA 4CUCA 1H50A 2PDGA 1HP5A 3GY1A 4NNBA 3L4VA 2C6QA 1PE1A 3GDMA 4J3XA 4W5UA 4FXRA 4ZXOA 3PK7A 3QYQA 4XZ9A 1XLGA 2HNHA 3AYTA 1AVAA 1H7NA 3NNTA 1B3YA 2Y7GA 3CTTA 3EXSA 4WLCA 4A6GA 3PUGA 3B0UX 4UXDA 4AEEA 1THFD 4JEJA 3W2UA 3BK0A 3PJXA 1OD0A 4Q3MA 3THQA 5LA2A 3VO0A 1TE6A 1SSGA 3XINA 4W5ZA 1DQUA 4IX0A 5BOFA 5I24A 2EHHA 4PUKA 1VH7A 1QI2A 3TYCA 3K1GA 5KSWA 1JQXA 4E3TA 5AC6A 5LNWA 5C2GA 1JPMA 2TRSA 4QQUA 1EDTA 5DXYA 1VBHA 3ARQA 1O5RA 5CZKA 2BXZA 4LW7A 5HPCA 5LHFA 5M03A