4C1UA

Structure of the xylo-oligosaccharide specific solute binding protein from bifidobacterium animalis subsp. lactis bl-04 in complex with arabinoxylobiose
Total Genus 137
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
137
sequence length
396
structure length
396
Chain Sequence
DDKTITFWHNASAGEGRQYWENLAKSFEEANPGTKVEIQAIQNEDFAGKLQTAMQDPASGPDVFMSLGGAKTKEMIDAGQVMDLTDKISDTVKTDMKTTLSAATFDGKVYGVPVSVEPGGMWYSKDLFKKAGVSDVPATYEELLADAKKLKDSGTDAIALGAKDAWPAAHWYYWLVLRECSPEVYDKSVQDHDFSNACWVNAGKKLQELKDLKVFNDGFLTTTAQQGANSSAGLLANHKAAMELMGAWEPGVLKDLTPDQKPMADLGFFAFPEVAGGEGEPGALMGGVTYFCVNPKASQTSIDFVNYMGEKKNQEDYAKAFSTIPASEPARAVVTDESLKQVIEYLDKAPSMQLWMDTALGTNIGNALNAAVVNMLSGQGSPEDIVKAMQDAAQKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SUGAR TRANSPORTER SOLUTE-BINDING PROTEIN
publication title Structural Basis for Arabinoxylo-Oligosaccharide Capture by the Probiotic Bifidobacterium Animalis Subsp. Lactis Bl-04
pubmed doi rcsb
source organism Bifidobacterium animalis subsp. lactis bl-04
molecule tags Transport protein
total genus 137
structure length 396
sequence length 396
ec nomenclature
pdb deposition date 2013-08-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4c1uA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4c1uA02
3TQWA 1B4HA 5EYFA 2XD2A 1UTHA 2DE3A 4XTCQ 3MVXA 3H6TA 1MY1A 2Y7RA 3LSWA 1LB9A 5I56A 5H8NA 2O1LA 3OO7A 3BKIB 3K6VA 1B58A 1SDXA 4EUOA 1BTJA 3TDJA 4R6HA 4IO5A 3G7WA 4OEUA 2PMSA 4QFKA 4ELOA 4F19A 5A5XA 2XXWA 2ABHA 4X1BA 5AA3A 4PFWA 4WEPA 3PUWE 1FTOA 1Y3PA 1M5BA 1FW0A 4DE8A 1MQGA 4JXIA 4PP0A 3ILTB 1HSLA 4XKQA 3UORA 3MW0A 5I57A 3TTKA 2Y84A 3S9MC 2H99A 5KCJB 4F31B 1P99A 1MH4A 4RA1A 3MQ9A 4P0GA 3GXAA 4Q0CA 1YPNA 3B6TA 3LR1A 1I6AA 4F18A 2NWJA 4U22A 1OQHA 1MXXA 5DTBA 3H6WA 4OYVA 2ZYMA 2GHBA 2XXHA 3BBRA 3MZ1A 1P1OA 1US4A 2PT1A 1B52A 5TP9B 1Z7ME 4GL0A 2OJTA 3ZS6A 4HS7A 3TTRA 2HXWA 4P11A 4QHQA 3S2VA 2HEUA 3C35A 4L17A 1VFDA 4IO3A 5JK4A 3C31A 1B3GA 1B46A 3KN8A 3U8QA 4ELPA 3GZGA 2YJPA 3LC8A 5B70A 2GH9A 2RC9A 3TCHA 1LFGA 1VE4A 5H8QB 1MQDA 3SEYA 5AA2B 1DPPA 1NNTA 2DSFA 3KOTA 4F22A 4LATA 3VFJA 3MBPA 5CI5A 1AMFA 2F6GA 3GBAA 3RNNA 3L6HA 1Y3QA 3OD7A 4WEDA 2F6PA 4MFIA 4ZEDA 3JV9A 4H5GA 5IKBA 2NOOA 3O9PA 1R6ZA 2E1SA 2I0BA 3T9HB 1S50A 5DVJA 4G68C 1XVYA 4ESWA 3ZSFA 5H8SA 2H98A 3PUYE 1MXWA 2Q2CA 3I6VA 3C9HA 4LZ7A 4IO4A 2XHDA 3SESA 2V3QA 2ONRA 4FEDA 2DYXA 4AB5A 4ZE8A 4YKJA 4ZE9A 5AA4A 4DCXA 3CFZA 4I8CA 4H8JA 2YPNA 1PBQA 3PMXA 1JW1A 1B5JA 1ZIUA 1OVBA 2RCBA 2IEEA 4F1VA 3USDA 1NNFA 2OLBA 2B65A 4LZ8A 4POXA 1SW2A 1ZBMA 3Q29A 3UP9A 4RK2A 4NF8B 3TAJA 4X1DA 3MUQA 1USYH 1LAHE 4GOTA 4POWA 3HHFA 1FQDA 4ZEFA 2ZXTA 2F7BA 3K00A 4JBZA 4ZS9A 4KCDA 5FHOA 3TTNA 4I1DA 1WVJA 4KQPA 2E0SA 3FASA 3FJMA 1Y1MA 3IJXB 2BJJX 3B6QA 4F3SA 3TTMA 3B7DA 3VDFA 2M8CA 4LQ2A 4NF6B 3PUVE 4RXLA 5KZTA 2HZLA 4XKPA 4OWDA 4ELQA 1LCFA 1B7UA 3C33A 1ZMGA 1L5TA 2UYEA 1MXVA 3CI8A 3LUYA 3R6UA 1MDP1 2DE4A 3O28A 2O84X 4GRKA 4C0RA 4R6YA 2GRVA 2F8DA 5FTIA 4FE8A 4QSCA 2DWAA 4F3GA 4MLVA 3P7IA 3KG2A 3BFUA 3FATA 2RCAA 1SD3A 4QSDA 1Z7NE 5I58A 1FTLA 3IR1A 4Q5TA 4F3PA 4R2FA 1PB9A 5ISUA 3IK6B 4RYAA 5EHMA 1TT1A 4Z7EA 2XD3A 2V93A 1R9LA 4OHNA 2DS9A 1N7XA 3DP6A 3N6TA 2XXPA 2Q8JA 3VXCA 3PPRA 5DEXB 3S9LC 2NVUB 5AA2D 4LVQA 3FXQA 3JYRA 3LBSA 4OQOA 3HCQA 3KZGA 2Y7KA 4Z0IA 4GXAA 2F7AA 2HQ0A 1SI0A 1VSOA 1A55A 3I3VA 4LQ5A 3HPIA 2QMWA 3IAZA 2I58A 3RLFE 4E0XA 4DXBA 1CE2A 3KEIA 2QS3A 1US5A 2AYSA 4YB5A 3OSQA 3SDFA 4ND9A 1AOVA 3OO6A 4LONB 1M5DA 5KCJA 3KJTA 3KN7A 3SEXA 1PBPA 3ZKKA 3IOUA 4GXSB 3W9VA 2GHAA 3MP6A 5H8HB 1Y3NA 3H3GA 4NEDA 4R72A 4RY1A 3TELA 1USYE 1FTKA 2FA7A 5TP9A 4GLIA 4WXJA 1Y1ZA 1OQGA 1ZKBA 4O3BA 2PT2A 2AL5A 3QAXA 2D5WA 2R6GE 1RYOA 3EHUA 5TPAB 2QRYA 3D4CA 1SI1A 3LSLA 3TYHA 2WKYA 3MZ9A 1B0LA 3B6WA 4GWOA 4NWDA 3ILUB 3EPEA 2H4IA 4OMBA 3PMWA 1FQFA 4XKRA 1B5IA 2B3FA 4XKNA 3TPAA 2ZNUA 3V83A 4KHZE 3KJ7A 4R74A 5CMKA 2ZYKA 1ZU0A 4IGTA 3RPWA 3HV1A 5AA2A 3M3LA 4N6PA 3PPNA 3CG3A 3WAFA 1MY2A 4IB2A 4KFQA 1CB6A 1H44A 3H06B 3IL1B 4U1OA 3C4MA 1D4NA 1EU8A 2F7CA 4R73A 2A5SA 1ZTYA 3U1OA 2ESNA 5KDTB 2ONKE 4H1XA 3N6UA 4NF5B 3FGSA 3FIRA 4G77A 3EN3A 2P2AA 4IY5A 2W7YA 3Q26A 2Z23A 1XOCA 1MPDA 3M3FA 2VP1A 3VE1B 4UA8A 3ODBA 4JWYA 3QYTA 4ESXA 2AIXA 1MDQA 5HPQA 1QUJA 4BDMA 3SETA 3CSGA 1DMBA 4ZZAA 4OVJA 3PUZE 2PX1A 5L9MA 1P1NA 2XX8A 2QJEA 4BLAA 5DT6A 4KYEA 3PU5A 4IO2A 2Z8DA 5I2NA 1TFAA 2OZZA 2F97A 4XIGQ 3IO6A 4QFNA 4HCYA 2OCUA 2VD3A 4NF8A 4FJPA 3FVKA 3O6HA 4G4PA 3THIA 1SW5A 3FVGA 3RTFB 3MPKA 2Z22A 3H7MA 3S9NC 3V5AA 4F1YA 4DIGA 4TOZA 2DWJA 5I2KB 4PFTA 4BDOA 1DOTA 4KD5A 1URGA 3FJ7A 4KYSA 1MY3A 2O69A 2Z8FA 4NF6A 5L9SA 4K3FA 4JWXA 1N7WA 4G2ZA 1R9QA 1YCJA 1QULA 1MQIA 3S9EA 3TZAA 3FJGA 1EZ9A 3ECRA 3E4RA 4LUBA 4RK9A 4F3BA 3IOVA 2D3IA 1NMUA 3OO8A 1M5CA 2VOZA 5K2YA 2G93A 2UXAA 4YKIA 3K6WA 2H9BA 3LSFB 4YB7A 3SEUA 1PDAA 3PMVA 4F39A 3V8XB 3TCFA 1ZLQA 3N94A 2REGA 1PEBA 4JDFA 1MY0A 3MWBA 4UACA 4Q30B 3VLUA 3VVEA 1JEVA 1FTMA 3RT6B 1I6QA 4HTGA 4JWOA 5JEIA 4KYDA 3O66A 3SERA 2ZNTA 4FECA 3T93B 2PYYA 5DEXA 3SEVA 1JQFA 3N5LA 3Q25A 3DM0A 1LAXA 3ZKLA 3UIFA 4U4XA 5CMBA 3CFXA 1SBPA 1GVCA 3RQTA 1GGGA 1T0KA 1VFEA 4ELRA 4F2OA 2Y7WA 3CRBA 3KBRA 1LGBC 2O1MA 3RN8A 4LA9A 3K02A 4FIMA 5IAIA 4OERA 2IA4A 4H65A 1MM6A 3CG1A 4C1TA 1UTBB 4G8NA 4YMAA 2HZKA 1S9TA 4U1ZA 3G3FA 1AL3A 1FQAA 5H8FB 3K6UA 1D3KA 1TFDA 2H5YA 2Z8EA 3IX1A 4NTLA 4KI0E 2O51A 2QPQA 3MZBA 1B1HA 3HHGA 3HSTA 1MQHA 1I69A 1SW4A 3G3JA 2RF1A 1XVXA 1NKXA 3E3KA 1LSTA 4F29A 4WKMA 3OOAA 3FXRA 1N3XA 4P0IA 3CR9A 2ZYNA 3W9WA 5F1QA 3CFLA 4DLDA 2F5XA 5CMCA 4H67A 4MLQA 4U21A 4ONYA 5TPAA 3VLVA 3LSXA 4F1UA 1RKMA 4PFUA 1O7TA 2V25A 2XXUA 3K1PA 5LOMA 4LP2B 4R6KA 1ANFA 4R75A 3GBBA 2NXOA 3UA8A 5ELVA 5J1DA 3RGYA 2RC7A 4ZZEA 5L9OA 2O7IA 3VVDA 3M8UA 1B7HA 1II5A 5M2VA 1URDA 2AL4A 1LBBA 1MH3A 1B32A 1DPEA 2O68A 2I3VA 1B6HA 2THIA 4NWCA 3MC2A 3MPLA 4ISUA 4QF9A 3UK4A 4ZEIA 3TCGA 3MVYA 1XS5A 1B4ZA 3TODA 5JTYB 5KDTA 1SVXB 4M1VA 4YU0A 3K2DA 5ITPA 3EHTA 3MVZA 1MXUA 1WDNA 4R2BA 4U23A 2QMXA 1MM7A 3IORA 3TUSA 2P0SA 3O6GA 4EF1A 4OFOA 1B7ZA 3QXMA 3PGFA 2I4BA 2X7QA 4KPTA 2XXVA 4QFPA 3H6UA 4DZ1A 2V84A 4YICA 3A3UA 3VXBA 4THIA 2DOJA 1J1NA 3A09A 3I5OA 5F7VA 1GTKA 4ZEKA 3WAEA 3A3CA 3O29A 4QFOA 4BDLA 3KSJA 4R9FA 4NF4B 4MF3A 1LBCA 2HAVA 4H8IA 1HSJA 1NFTA 3IB0A 3KFMA 5I2KA 3OSRA 5CBRA 4YMBA 5CBSA 1KWHA 1BP5A 3ONMA 1QUIA 3MAMA 2QS1A 2F36A 1Y4TA 2REJA 4LZ5A 1IEJA 1DTGA 5ICTA 1N3WA 5AA1A 2DXYA 3QIMA 1DTZA 1B3LA 3K0VA 4NE4A 1UIVA 1IITA 2QL3A 1VR5A 5B7DA 3KGCA 1GR2A 2DWIA 4ZEBA 1P1WA 2V3UA 5CC2A 2I4CA 5CRYA 2QSXA 3KSXA 2GFEA 2ANJA 4C1UA 2DQVA 1D9VA 2FYIA 4EXKA 4XXUA 4JSDA 3PD9A 1TWYA 5H8QA 3FZVA 3K1MA 1NH8A 1MRPA 1H45A 4G68B 1BKAA 2LAOA 1B2HA 3PUXE 2I49A 1EH3A 4EQBA 1PC3A 1LB8A 1A8EA 2O6AA 1BLFA 4OESA 3TTLA 2RINA 3T9UA 2DXRA 4JB7A 4HW8A 1JW5A 2RKMA 4ZECA 1SYIA 4GD5A 1ELJA 4IO6A 1MPCA 3K1NA 4QSEA 1IUDA 1NNKA 2RC8A 2QS4A 2ZMBA 2KLFA 4I62A 1UTBA 1MS7A 1H76A 3RUMA 3T9XB 1B3FA 3HO7A 5H8FA 3L6GA 3HN0A 2Q89A 3F11A 2Y7IA 3PPQA 4RPOA 4FORA 1YAEA 3D4GA 4DXUA 3DP4A 2B3BA 2Q9TA 2HAUA 2XX9A 1LFHA 2UVHA 1EZPA 4TLLB 3PPPA 5I84A 1B1XA 5AE4A 4F2QA 4GIZA 4EQ9A 2I3WA 2DVZA 3GLBA 2YLNA 5CM6A 4HCWA 1Q1KA 4Q8RA 5I59B 3FVOA 4GL8A 1B5HA 1XHYA 2A5TB 3G3KA 1IXGA 4AQ4A 1AH5A 1UQWA 4BDRA 4U4SA 3FUZA 3CSBA 4YB6A 3K6XA 1LFIA 1SYHA 4E0WA 3Q27A 4O3AA 1N04A 4OETA 2UVIA 1B3HA 1M5EA 3PD8A 1QKBA 5L8DA 3H6VA 2I0CA 1XC1A 1IIWA 1QVSA 3BFTA 4YKKA 2ONSA 2I48A 3OEMA 4EQ7A 1P1UA 5JTYA 3O97A 2F78A 1POY1 2HCAA 1DSNA 3O2AA 2O7UA 5FHMA 4BDNA 4OXVA 2XX7A 2VHAA 2F34A 1IXHA 4OENA 4IY6A 2PBWA 4GFRA 1FTJA 1IXIA 1Y20A 1NNPA 3FV1A 3EQ1A 1QUKA 1PB7A 5CMMA 4R9GA 4I9DA 4H5FA 1H3DA 3K01A 3O6IA 2DP8A 5DVFA 2V3TA 3QUFA 3FD3A 2DVCA 3TQLA 2XXXA 4O3CA 3M3KA 4GQOA 4NF4A 2QS2A 1PB8A 3T66A 2OWSA 1JETA 3OMBA 1FQBA 1B3EA 2XXYA 3G3HA 1Y9UA 2ZNSA 2CZLA 1UTHB 4H6DA 4DXCA 1FQCA 4OZ9A 3T9VA 3CVGA 3VV5A 1MXZA 2R71A 3T96B 1FQEA 5I56B 4M4GA 2HFBA 4OEVA 5H8NB 4RJZA 4RPNA 5H8HA 1B0HA 2X26A 4X48A 5I2NB 4BDQA 1OMPA 4JSOA 3R7XA 5A5XB 1ZJLA 1HSEA 3RT8A 3MP8A 3QK6A 3DLNA 3N26A 2NUVA 3MP1A 4YZZA 3E13X 1M5FA 3R26A 1WODA 5I57B 3E9XA 1D9YA 5K2XA 1B40A 3KOSA 1AIVA 3VLWA 2FNCA 3IOWA 1MQJA 2DWHA 1IZ1A 2XXIA 4RNSA 3IO4A 3U93A 4GVOA 2OWTA 1P1QA 4PE5B 4G68A 2XXRA 1A99A 5ICQA 3TMGA 3UGWA 1SW1A 4PQJA 2F35A 3UN6A 3Q28A 3VVFA 1LAGE 2I6EA 3C32A 1N0TA 4ECFA 3OEKA 5DVIA 2UYFA 3FVNA 4EF2A 5DYHA 4NF5A 1JEUA 5HBCA 5TU0A 1SQYA 3FV2A 2PVUA 3AXFA 4G8MA 1JNFA 1A54A 1UIUA 3CIJA 3S4UA 3KN3A 4PETA 3U92A 4IGRA 1F9BA 2UVJA 4QRZA 2XXQA 1Y4CA 1N84A 2XXTA 1OLCA 4YKPA 4N13A 4DCYA 3C36A 4N07A 3H03A 4OTEA 1MG1A 3IOTA 3IB2A 1R1NA 4GF8A 1MPBA 3EF7A 1B05A 3RTWB 4MH5A 4U2RA 2H25A 3DELB 1QJMA 3C34A 4YAHX 1NL5A 4EXLA 1OLAA 4H0WA 1A7LA 5FHNA 5AA4B 5BUUA 4EDPA 1IQ7A 3QUJA 3EHSA 5I59A 1JW4A 1JVXA 5BWJA 4ZDMA 3IB1A 3PPOA 1RYXA 2A5TA 1MY4A 3TFLA 2ZYOA 3W15C 3QSLA 1FCKA 1OIBA 1A40A 2OK2A 4G8HA 4KCCA 3H4ZA 2Q2AA 1B9JA 2VGQA 3T22A 3U94A 3K4UA 3OENA 4TLMB 4FEBA 5EHSA 1O64A 1QW0A 1BIYA 1LCTA 2UVGA 1ATGA 1I6BA 3V89B 1MXYA 3IJOB 1POTA 1XT8A 3MJNA 2VD2A 1QKAA 1JVYA 3G3IA 3SKPA 3OELA 5HM4B 1S7YA 3U72A 4IO7A 1OVTA 1EZOA 3PV0E 1IXCA 3FXUA 1Q35A 2Y7PA 4X9TA 3TEPA 1YTVA 4NMYA 2G29A 3DP8A 4FAJA 2OBGA 1LLSA 1NH7A 4PFYA 4QFLA 4FATA 1N76A 1GV8A 2D21A 2X7PA 2CMOA 1URSA 2R9JA 1B51A 4OFJA 4DDDA 5I58B 3JZJA 3SEWA 1H43A 4TQUQ 3G3GA 5FTHA 2DE2A 4OFLA 2P1SA 3OXNA 3MVWA 1LAFE 3TKDA 3OO9A 2Q88A 2ALUA 1O63A 1TXFA 4MBPA 3RY3A 4AB6A 4KR5A 5ITOA 1A8FA
chains in the Genus database with same CATH superfamily
3TQWA 1B4HA 5EYFA 2XD2A 1UTHA 2MKZA 2DE3A 4XTCQ 3MVXA 3H6TA 1MY1A 2Y7RA 3LSWA 1K9YA 1LB9A 5I56A 5H8NA 2O1LA 3OO7A 3BKIB 1FJ9A 3K6VA 1B58A 1SDXA 4EUOA 1BTJA 3TDJA 2Y5LA 4N6KA 4R6HA 4GWXA 5IZ1A 4IO5A 5EQ9A 3G7WA 4OEUA 2PMSA 4QFKA 4ELOA 4F19A 5A5XA 2XXWA 2ABHA 4X1BA 5AA3A 4PFWA 4WEPA 3PUWE 4N8GA 3KBZA 1FTOA 1Y3PA 1M5BA 1FW0A 2FVZA 4DE8A 1MQGA 4JXIA 4PP0A 3ILTB 1HSLA 4XKQA 3FXBA 3MW0A 3UORA 5I57A 3TTKA 2Y84A 3S9MC 2H99A 5KCJB 4F31B 1P99A 1MH4A 3A29A 4RA1A 3MQ9A 4P0GA 3GXAA 4Q0CA 1YPNA 3B6TA 3LR1A 1I6AA 4F18A 2NWJA 4U22A 1OQHA 1MXXA 4NX1A 5DTBA 2QFLA 3H6WA 4OYVA 2ZYMA 2GHBA 2XXHA 3BBRA 3MZ1A 1P1OA 4GX4A 1US4A 2WYPA 2PT1A 1B52A 5TP9B 1Z7ME 4GL0A 2OJTA 1NV7A 5IZ3B 4HS7A 3ZS6A 3TTRA 2HXWA 4P11A 2F3DA 4QHQA 4H45A 1AWBA 3S2VA 2HEUA 3C35A 3U65A 4L17A 5J16A 1VFDA 3E78A 4IO3A 5JK4A 3C31A 1B3GA 1B46A 3KN8A 3U8QA 4ELPA 2CZHA 3GZGA 2YJPA 3LC8A 5B70A 2KR0A 2GH9A 4NG7A 2RC9A 3TCHA 1LFGA 4N15A 1VE4A 2XWOA 5H8QB 1MQDA 3SEYA 5AA2B 1DPPA 1NNTA 2DSFA 3KOTA 4F22A 4LATA 3VFJA 3MBPA 5CI5A 4NHBA 1AMFA 2F6GA 3GBAA 3RNNA 3L6HA 1Y3QA 3OD7A 4WEDA 2F6PA 4MFIA 4ZEDA 3JV9A 5FBPA 4NGUA 4H5GA 5IKBA 2NOOA 4GWSA 3O9PA 1R6ZA 1Q9DA 2E1SA 3IFAA 2I0BA 3T9HB 1S50A 5DVJA 4GBWA 4G68C 1XVYA 4ESWA 1JP4A 3ZSFA 5H8SA 2H98A 3PUYE 1MXWA 2Q2CA 3I6VA 3C9HA 4LZ7A 3NOHA 4IO4A 2XHDA 3SESA 2V3QA 2ONRA 4FEDA 2DYXA 4AB5A 4ZE8A 4YKJA 4ZE9A 1CNQA 5AA4A 2BJIA 4DCXA 3CFZA 4I8CA 4H8JA 2YPNA 1PBQA 3PMXA 1JW1A 1FPLA 1B5JA 1ZIUA 1OVBA 2RCBA 2B4LA 4G61A 2IEEA 4P56A 4F1VA 3USDA 1NNFA 4PAIA 2OLBA 2B65A 4LZ8A 4POXA 1SW2A 1ZBMA 3Q29A 3UP9A 4RK2A 4NF8B 3TAJA 4X1DA 3MUQA 1USYH 1LAHE 4GOTA 4POWA 3HHFA 1FQDA 4ZEFA 2ZXTA 4JVDA 4GX3A 4OVPA 2F7BA 3K00A 4JBZA 1LBYA 4ZS9A 2XA5A 4KCDA 5FHOA 3TTNA 4I1DA 1WVJA 4KQPA 1YZ0A 2E0SA 3FASA 3FJMA 5F24A 1Y1MA 3IJXB 2BJJX 3B6QA 4F3SA 3TTMA 3B7DA 3VDFA 2M8CA 4LQ2A 4NF6B 3PUVE 4RXLA 5KZTA 4NF0A 2HZLA 4XKPA 4OWDA 4ELQA 1LCFA 1B7UA 5LTCA 1INPA 3C33A 1ZMGA 1L5TA 2UYEA 4XFEA 1MXVA 3CI8A 3LUYA 1QGXA 3QMFA 2CZIA 1DCUA 3R6UA 1MDP1 2DE4A 2KQZA 3O28A 2ZZVA 2O84X 4GRKA 4GWZA 4C0RA 4R6YA 2GRVA 2F8DA 5FTIA 3IFCA 3KC1A 4PDDA 4P9KA 4FE8A 4QSCA 2DWAA 1RDYA 4F3GA 4MLVA 3P7IA 3KG2A 3BFUA 3FATA 2RCAA 1SD3A 1FPBA 4QSDA 2Q74A 4PBHA 1Z7NE 4PF6A 5I58A 1FTLA 3IR1A 4Q5TA 1LBXA 4F3PA 4R2FA 1PB9A 1YYZA 5ISUA 3IK6B 4RYAA 5EHMA 1TT1A 4Z7EA 2XD3A 2V93A 1R9LA 4OHNA 2DS9A 1N7XA 1EYKA 1NV3A 3DP6A 3N6TA 2XXPA 2Q8JA 3VXCA 3PPRA 5DEXB 4I3EA 3RPLB 3S9LC 2NVUB 5AA2D 4LVQA 3FXQA 3JYRA 3LBSA 4OQOA 2VPOA 3HCQA 4X8RA 3KZGA 1RDXA 2Y7KA 4Z0IA 4GXAA 2F7AA 2HQ0A 1SI0A 1VSOA 1A55A 5T3JA 4LQ5A 3I3VA 3HPIA 3LUZA 2QMWA 3IAZA 1DBZA 2I58A 3RLFE 3B8BA 4O7IA 4E0XA 4DXBA 1CE2A 3KEIA 2QS3A 4I3YA 1US5A 2AYSA 4NQ8A 4YB5A 3OSQA 3SDFA 4ND9A 1AOVA 3OO6A 4LONB 1M5DA 5KCJA 1FBFA 3KJTA 3KN7A 3SEXA 4FBPA 1PBPA 3ZKKA 5IM2A 3IOUA 3HFUA 4DI4B 4GXSB 3W9VA 2GHAA 3MP6A 5H8HB 1Y3NA 3H3GA 4NEDA 5EQAA 4R72A 4RY1A 3TELA 1USYE 1FTKA 2FA7A 4HE0A 4N6DA 5TP9A 4GLIA 4WXJA 1Y1ZA 1OQGA 1ZKBA 5IZ3A 4GWYA 4O3BA 2PT2A 2AL5A 3QAXA 2D5WA 2R6GE 2JJKA 1RYOA 3EHUA 5TPAB 2QRYA 3D4CA 1SI1A 3LSLA 3TYHA 2WKYA 3MZ9A 1B0LA 3B6WA 4GWOA 4NWDA 3ILUB 3EPEA 2H4IA 4OMBA 4UABA 3PMWA 1FQFA 4XKRA 1B5IA 2B3FA 1FPGA 4XKNA 3TPAA 4OVSA 2ZNUA 3V83A 4KHZE 3KJ7A 4R74A 5CMKA 2ZYKA 1RDZA 1ZU0A 4IGTA 3RPWA 3HV1A 1NV2A 5AA2A 3M3LA 4N6PA 3PPNA 4PGPA 3CG3A 3WAFA 1MY2A 4PC9A 4IB2A 4KFQA 1CB6A 1H44A 3H06B 3IL1B 4U1OA 3C4MA 1D4NA 1EU8A 2F7CA 4R73A 2A5SA 4GWWA 1ZTYA 3U1OA 2ESNA 5KDTB 2ONKE 4H1XA 3N6UA 4NF5B 3FGSA 3FIRA 4G77A 3EN3A 2P2AA 4IY5A 2W7YA 3Q26A 2Z23A 1XOCA 1MPDA 5ET7A 3M3FA 2VP1A 3VE1B 3E79A 4UA8A 3ODBA 4JWYA 3QYTA 4ESXA 2QVUA 2AIXA 1MDQA 5HPQA 1QUJA 4BDMA 3SETA 3CSGA 3KC0A 1DMBA 4ZZAA 4OVJA 3PUZE 2PX1A 5L9MA 1P1NA 2XX8A 2QJEA 4BLAA 2FBPA 5DT6A 4KYEA 3PU5A 2OX3A 4IO2A 2Z8DA 5I2NA 1TFAA 2OZZA 2F97A 4XIGQ 3IO6A 4QFNA 4HCYA 2OCUA 2VD3A 4NF8A 4FJPA 3FVKA 3O6HA 4G4PA 3THIA 1SW5A 3FVGA 1FSAA 3RTFB 3MPKA 2Z22A 3H7MA 3S9NC 1FBHA 3V5AA 4F1YA 4DIGA 4TOZA 2DWJA 5I2KB 1FPDA 4PFTA 4KD5A 1DOTA 1NV6A 4GBVA 4BDOA 1URGA 3FJ7A 4KYSA 1MY3A 2O69A 2Z8FA 4NF6A 5L9SA 4HE1A 4K3FA 4JWXA 4OA4A 1FPFA 1N7WA 4G2ZA 4N91A 1R9QA 1IMDA 1YCJA 1QULA 1MQIA 3S9EA 3TZAA 3FJGA 4P1EA 1EZ9A 3ECRA 1FBCA 2Y5KA 2XXKA 3E4RA 4LUBA 1G0HA 4RK9A 4F3BA 1D9QA 3FBPA 3IOVA 2D3IA 1NMUA 3OO8A 1M5CA 2VOZA 2P3VA 5K2YA 2G93A 2UXAA 4YKIA 3K6WA 2H9BA 3LSFB 4YB7A 3SEUA 3ISPA 1PDAA 3PMVA 4F39A 3V8XB 3TCFA 1ZLQA 3N94A 2REGA 1PEBA 4JDFA 1MY0A 3MWBA 4UACA 4MCOA 4Q30B 3VLUA 3VVEA 1JEVA 1FTMA 3RT6B 1I6QA 4HTGA 4JWOA 5JEIA 3PTYA 4KYDA 3O66A 3SERA 2ZNTA 4FECA 3T93B 2PYYA 5DEXA 3SEVA 1JQFA 3N5LA 3Q25A 3DM0A 4O7MA 3RPLA 1LAXA 3ZKLA 3UIFA 4U4XA 5CMBA 3CFXA 1SBPA 1GVCA 3RQTA 1GGGA 1T0KA 1VFEA 4ELRA 4F2OA 3T0JA 2Y7WA 3CRBA 3KBRA 1LGBC 1FPJA 2O1MA 3RN8A 4LA9A 3K02A 4FIMA 5IAIA 4OERA 2IA4A 4H65A 1MM6A 3CG1A 4C1TA 1UTBB 1YXIA 4G8NA 4YMAA 2HZKA 1S9TA 4U1ZA 1XI6A 1LBVA 1AL3A 3G3FA 1FQAA 5H8FB 3K6UA 2XWVA 1D3KA 1TFDA 2H5YA 2Z8EA 4JVIA 3IX1A 4NTLA 4KI0E 2O51A 2QPQA 3MZBA 3GYYA 1B1HA 2FIEA 3HHGA 3HSTA 1MQHA 1I69A 1SW4A 3G3JA 1EYJA 2RF1A 1XVXA 1NKXA 3E3KA 1LSTA 4F29A 4WKMA 3OOAA 3FXRA 1N3XA 4P0IA 3CR9A 2ZYNA 3W9WA 5F1QA 3CFLA 4DLDA 2F5XA 5CMCA 4X04A 2PFYA 4H67A 4MLQA 4U21A 4ONYA 3RYDA 5TPAA 3VLVA 2ZZWA 4O94A 3LSXA 4QBAA 4F1UA 1RKMA 4PFUA 1O7TA 2V25A 5ET5A 2XXUA 3K1PA 5LOMA 1FPKA 1IMCA 4LP2B 4R6KA 1ANFA 4R75A 3GBBA 2NXOA 1IMBA 3UA8A 5ELVA 5J1DA 3RGYA 4MNCA 2RC7A 4ZZEA 5L9OA 2O7IA 3VVDA 3M8UA 1B7HA 3MSTA 1II5A 5M2VA 4PGNA 2VPNA 1URDA 2AL4A 1LBBA 1MH3A 1B32A 1DPEA 5ESYA 2O68A 2WBDA 2I3VA 1B6HA 2THIA 4NWCA 1NUWA 3MC2A 3MPLA 4ISUA 4QF9A 3UK4A 4ZEIA 3TCGA 3MVYA 1XS5A 1B4ZA 3TODA 1KA0A 2HPGA 5JTYB 5KDTA 1SVXB 4M1VA 4YU0A 3K2DA 5ITPA 3EHTA 3MVZA 5ET8A 1MXUA 1KZ8A 1WDNA 4R2BA 4U23A 1KA1A 4PAKA 2QMXA 1MM7A 3IORA 3TUSA 2P0SA 3O6GA 4EF1A 5A5LA 4OFOA 1B7ZA 3QXMA 4GX6A 3PGFA 4HXVA 3EKIA 2I4BA 2X7QA 4KPTA 2XXVA 4QFPA 3H6UA 4QXDA 1FRPA 4DZ1A 2V84A 4YICA 2WYKA 4OVTA 3A3UA 3VXBA 4THIA 2DOJA 1J1NA 4PAFA 3A09A 3I5OA 5F7VA 1GTKA 4ZEKA 3WAEA 1NI9A 3A3CA 3O29A 5LDZA 4QFOA 4PFBA 4BDLA 3KSJA 4R9FA 5EQ8A 4NF4B 3SZPA 4MF3A 1LBCA 2HAVA 4AS5A 4P3LA 4H8IA 1HSJA 1NFTA 3IB0A 3KFMA 5I2KA 4MNPA 3OSRA 3MYUA 5CBRA 4YMBA 1VDWA 5CBSA 1KWHA 1BP5A 3ONMA 1QUIA 1NV0A 1SPIA 3MAMA 2QS1A 2F36A 1Y4TA 2B4MA 2REJA 4LZ5A 1IEJA 4PBQA 1DTGA 5ICTA 1N3WA 5AA1A 2DXYA 3QIMA 4P47A 1DTZA 1B3LA 3K0VA 4NE4A 1UIVA 1IITA 2FIXA 2QL3A 4N81A 5EQ7A 1VR5A 5B7DA 3KGCA 1GR2A 2DWIA 1LBWA 4ZEBA 1P1WA 2V3UA 5CC2A 4MEVA 2I4CA 5CRYA 2QSXA 4PFIA 1FJ6A 3KSXA 3T1BA 2GFEA 2ANJA 4C1UA 2DQVA 2QVVA 1NV4A 1D9VA 2FYIA 4EXKA 4PFRA 4XXUA 4JSDA 3PD9A 2L5VA 1TWYA 5H8QA 3FZVA 3K1MA 1NH8A 1MRPA 1H45A 4PF8A 1IMEA 4G68B 1BKAA 2LAOA 4IR8A 2F3BA 1B2HA 3PUXE 2I49A 3D1RA 1EH3A 4EQBA 1PC3A 1LB8A 1A8EA 2O6AA 1BLFA 4OESA 3TTLA 4MX6A 2RINA 3T9UA 2DXRA 4JB7A 4HW8A 1JW5A 2RKMA 4ZECA 1SYIA 4GD5A 4GWUA 1ELJA 4IO6A 1LEVA 1MPCA 3K1NA 4QSEA 1IUDA 1NNKA 5ET6A 2RC8A 2QS4A 2ZMBA 2KLFA 4I62A 1UTBA 1MS7A 1H76A 3RUMA 3T9XB 1B3FA 3HO7A 5H8FA 2XWKA 3L6GA 3HN0A 1FTAA 2Q89A 3F11A 2Y7IA 3PPQA 4RPOA 4FORA 1YAEA 4HE2A 3D4GA 4DXUA 3DP4A 2B3BA 2Q9TA 1FBGA 4O8MA 2HAUA 2XX9A 1LFHA 2UVHA 1EZPA 4TLLB 3PPPA 5I84A 5I3SA 1B1XA 5AE4A 4F2QA 4GIZA 4EQ9A 2I3WA 2DVZA 3GLBA 2YLNA 5CM6A 4HCWA 1Q1KA 4Q8RA 5I59B 5IZZA 3FVOA 4GL8A 1B5HA 1XHYA 4JVCA 2A5TB 3G3KA 1LBZA 1IXGA 4AQ4A 1AH5A 1UQWA 4BDRA 4U4SA 3FUZA 3CSBA 4YB6A 3K6XA 1LFIA 1SYHA 4E0WA 3Q27A 4N4UA 1NUZA 4O3AA 1N04A 4OETA 2UVIA 1B3HA 1M5EA 3PD8A 1QKBA 1NV1A 5L8DA 3H6VA 2I0CA 1XC1A 1IIWA 1QVSA 3BFTA 4NAPA 4YKKA 2ONSA 1NUYA 2I48A 1G0IA 3OEMA 4EQ7A 1P1UA 3LV0A 5JTYA 3O97A 2F78A 1POY1 2HCAA 1DSNA 3O2AA 4P1LA 2PCRA 2WBBA 4N8YA 1NV5A 2O7UA 5FHMA 4BDNA 4OXVA 2XX7A 2VHAA 2F34A 1IXHA 4OENA 4AS4A 4IY6A 2PBWA 1K9ZA 4GFRA 1FTJA 1IXIA 3CHGA 1Y20A 1NNPA 3FV1A 2GQ1A 3EQ1A 1QUKA 1PB7A 5CMMA 4R9GA 4I9DA 4H5FA 1H3DA 3K01A 4OVRA 3O6IA 2DP8A 1FBDA 5DVFA 2V3TA 3QUFA 3FD3A 2DVCA 3TQLA 2XXXA 4O3CA 3M3KA 4GQOA 4NF4A 2QS2A 1PB8A 3T66A 2OWSA 1JETA 2PFZA 3OMBA 1IMAA 1FQBA 1B3EA 2XXYA 3G3HA 2VT5A 1Y9UA 2ZNSA 2CZLA 2XWIA 1UTHB 4H6DA 4DXCA 1FQCA 4OZ9A 3T9VA 3CVGA 3VV5A 1MXZA 2R71A 3T96B 1FQEA 5I56B 4M4GA 2HFBA 4OEVA 5H8NB 4RJZA 4RPNA 5H8HA 1B0HA 2X26A 4X48A 5I2NB 4BDQA 1OMPA 4JSOA 3R7XA 5A5XB 1ZJLA 1HSEA 3RT8A 3MP8A 3QK6A 3DLNA 3N26A 2NUVA 1IMFA 3MP1A 4YZZA 4P8BA 4I40A 4MAGA 3E13X 2CEYA 1M5FA 3R26A 1WODA 1FPIA 2R8TA 5I57B 3E9XA 1D9YA 5IGAA 5K2XA 4XF5A 1B40A 3KOSA 1AIVA 3VLWA 2FNCA 3IOWA 1MQJA 2DWHA 1IZ1A 2XXIA 4RNSA 3IO4A 3U93A 4GVOA 2WEFA 2OWTA 2ZZXA 1P1QA 4PE5B 4DI3D 4G68A 2XXRA 2OWZA 1A99A 5ICQA 3TMGA 3UGWA 1SW1A 4PQJA 2F35A 3UN6A 3Q28A 3VVFA 1LAGE 2I6EA 3C32A 1N0TA 4ECFA 3OEKA 4MIJA 5DVIA 2UYFA 3FVNA 4EF2A 5DYHA 4NF5A 1JEUA 5HBCA 5TU0A 4MHFA 1SQYA 3FV2A 2PVUA 4MNIA 3AXFA 5EYGA 2V4CA 4G8MA 1JNFA 1A54A 4MJOA 4LN5A 1UIUA 3CIJA 3S4UA 2HXRA 3KN3A 4PETA 3U92A 4IGRA 1F9BA 2UVJA 4QRZA 2XXQA 1Y4CA 1N84A 2XXTA 1OLCA 4N13A 4N07A 3C36A 4YKPA 4DCYA 3H03A 4OTEA 1MG1A 3IOTA 3IB2A 1R1NA 4GF8A 1MPBA 3EF7A 1B05A 3RTWB 4MH5A 4U2RA 2H25A 3DELB 1QJMA 3C34A 4PDHA 3BIHA 4YAHX 1NL5A 4EXLA 2WX9A 1OLAA 4PTKA 4KXPA 4H0WA 1A7LA 5FHNA 5AA4B 5BUUA 4EDPA 1IQ7A 4H46A 3QUJA 4OVQA 3EHSA 5I59A 1JW4A 1JVXA 4MMPA 3ROJA 5BWJA 4ZDMA 3IB1A 2QVRA 3PPOA 2Q8MA 1RYXA 2A5TA 1MY4A 3TFLA 2ZYOA 3W15C 3QSLA 4PCDA 1FCKA 4NN3A 1OIBA 1A40A 2OK2A 4G8HA 4KCCA 2CZKA 3H4ZA 2Q2AA 1B9JA 2VGQA 3T22A 3U94A 3K4UA 3OENA 4TLMB 1FBEA 4FEBA 5EHSA 1O64A 1QW0A 1BIYA 1LCTA 2UVGA 1ATGA 5I7IA 1I6BA 3V89B 1MXYA 3IJOB 1POTA 1XT8A 1NUXA 3MJNA 2VD2A 2DDKA 1QKAA 2P3NA 4N17A 1FBPA 2CEXA 5I5PA 1JVYA 3G3IA 5DW8A 3SKPA 3OELA 2FHYA 5HM4B 1S7YA 3U72A 4IO7A 1OVTA 1EZOA 3PV0E 1IXCA 3FXUA 1Q35A 4OANA 2Y7PA 4X9TA 3TEPA 1YTVA 1DK4A 4NMYA 2G29A 3DP8A 5EYHA 1EYIA 4FAJA 2OBGA 1LLSA 3BIGA 1NH7A 3B50A 4PFYA 1FPEA 4QFLA 4FATA 1N76A 1GV8A 2D21A 2X7PA 2CMOA 1URSA 2R9JA 1B51A 4OFJA 4XEQA 4DDDA 5I58B 3JZJA 3SEWA 1H43A 4TQUQ 3G3GA 1BK4A 5FTHA 2DE2A 4OFLA 2HHMA 2P1SA 3OXNA 3MVWA 1LAFE 4PE3A 3TKDA 3OO9A 2Q88A 2ALUA 1O63A 1TXFA 4MBPA 3RY3A 4AB6A 4KR5A 5ITOA 1A8FA
chains in the Genus database with same CATH topology
3TQWA 1B4HA 5EYFA 2XD2A 1UTHA 2DE3A 4XTCQ 3MVXA 3H6TA 1MY1A 2Y7RA 3LSWA 1LB9A 5I56A 5H8NA 2O1LA 3OO7A 3BKIB 3K6VA 1B58A 1SDXA 4EUOA 1BTJA 3TDJA 4R6HA 4IO5A 3G7WA 4OEUA 2PMSA 4QFKA 4ELOA 4F19A 5A5XA 2XXWA 2ABHA 4X1BA 5AA3A 4PFWA 4WEPA 3PUWE 1FTOA 1Y3PA 1M5BA 1FW0A 4DE8A 1MQGA 4JXIA 4PP0A 3ILTB 1HSLA 4XKQA 3UORA 3MW0A 5I57A 3TTKA 2Y84A 3S9MC 2H99A 5KCJB 4F31B 1P99A 1MH4A 4RA1A 3MQ9A 4P0GA 3GXAA 4Q0CA 1YPNA 3B6TA 3LR1A 1I6AA 4F18A 2NWJA 4U22A 1OQHA 1MXXA 5DTBA 3H6WA 4OYVA 2ZYMA 2GHBA 2XXHA 3BBRA 3MZ1A 1P1OA 1US4A 2PT1A 1B52A 5TP9B 1Z7ME 4GL0A 2OJTA 3ZS6A 4HS7A 3TTRA 2HXWA 4P11A 4QHQA 3S2VA 2HEUA 3C35A 4L17A 1VFDA 4IO3A 5JK4A 3C31A 1B3GA 1B46A 3KN8A 3U8QA 4ELPA 3GZGA 2YJPA 3LC8A 5B70A 2GH9A 2RC9A 3TCHA 1LFGA 1VE4A 5H8QB 1MQDA 3SEYA 5AA2B 1DPPA 1NNTA 2DSFA 3KOTA 4F22A 4LATA 3VFJA 3MBPA 5CI5A 1AMFA 2F6GA 3GBAA 3RNNA 3L6HA 1Y3QA 3OD7A 4WEDA 2F6PA 4MFIA 4ZEDA 3JV9A 4H5GA 5IKBA 2NOOA 3O9PA 1R6ZA 2E1SA 2I0BA 3T9HB 1S50A 5DVJA 4G68C 1XVYA 4ESWA 3ZSFA 5H8SA 2H98A 3PUYE 1MXWA 2Q2CA 3I6VA 3C9HA 4LZ7A 4IO4A 2XHDA 3SESA 2V3QA 2ONRA 4FEDA 2DYXA 4AB5A 4ZE8A 4YKJA 4ZE9A 5AA4A 4DCXA 3CFZA 4I8CA 4H8JA 2YPNA 1PBQA 3PMXA 1JW1A 1B5JA 1ZIUA 1OVBA 2RCBA 2IEEA 4F1VA 3USDA 1NNFA 2OLBA 2B65A 4LZ8A 4POXA 1SW2A 1ZBMA 3Q29A 3UP9A 4RK2A 4NF8B 3TAJA 4X1DA 3MUQA 1USYH 1LAHE 4GOTA 4POWA 3HHFA 1FQDA 4ZEFA 2ZXTA 2F7BA 3K00A 4JBZA 4ZS9A 4KCDA 5FHOA 3TTNA 4I1DA 1WVJA 4KQPA 2E0SA 3FASA 3FJMA 1Y1MA 3IJXB 2BJJX 3B6QA 4F3SA 3TTMA 3B7DA 3VDFA 2M8CA 4LQ2A 4NF6B 3PUVE 4RXLA 5KZTA 2HZLA 4XKPA 4OWDA 4ELQA 1LCFA 1B7UA 3C33A 1ZMGA 1L5TA 2UYEA 1MXVA 3CI8A 3LUYA 3R6UA 1MDP1 2DE4A 3O28A 2O84X 4GRKA 4C0RA 4R6YA 2GRVA 2F8DA 5FTIA 4FE8A 4QSCA 2DWAA 4F3GA 4MLVA 3P7IA 3KG2A 3BFUA 3FATA 2RCAA 1SD3A 4QSDA 1Z7NE 5I58A 1FTLA 3IR1A 4Q5TA 4F3PA 4R2FA 1PB9A 5ISUA 3IK6B 4RYAA 5EHMA 1TT1A 4Z7EA 2XD3A 2V93A 1R9LA 4OHNA 2DS9A 1N7XA 3DP6A 3N6TA 2XXPA 2Q8JA 3VXCA 3PPRA 5DEXB 3S9LC 2NVUB 5AA2D 4LVQA 3FXQA 3JYRA 3LBSA 4OQOA 3HCQA 3KZGA 2Y7KA 4Z0IA 4GXAA 2F7AA 2HQ0A 1SI0A 1VSOA 1A55A 3I3VA 4LQ5A 3HPIA 2QMWA 3IAZA 2I58A 3RLFE 4E0XA 4DXBA 1CE2A 3KEIA 2QS3A 1US5A 2AYSA 4YB5A 3OSQA 3SDFA 4ND9A 1AOVA 3OO6A 4LONB 1M5DA 5KCJA 3KJTA 3KN7A 3SEXA 1PBPA 3ZKKA 3IOUA 4GXSB 3W9VA 2GHAA 3MP6A 5H8HB 1Y3NA 3H3GA 4NEDA 4R72A 4RY1A 3TELA 1USYE 1FTKA 2FA7A 5TP9A 4GLIA 4WXJA 1Y1ZA 1OQGA 1ZKBA 4O3BA 2PT2A 2AL5A 3QAXA 2D5WA 2R6GE 1RYOA 3EHUA 5TPAB 2QRYA 3D4CA 1SI1A 3LSLA 3TYHA 2WKYA 3MZ9A 1B0LA 3B6WA 4GWOA 4NWDA 3ILUB 3EPEA 2H4IA 4OMBA 3PMWA 1FQFA 4XKRA 1B5IA 2B3FA 4XKNA 3TPAA 2ZNUA 3V83A 4KHZE 3KJ7A 4R74A 5CMKA 2ZYKA 1ZU0A 4IGTA 3RPWA 3HV1A 5AA2A 3M3LA 4N6PA 3PPNA 3CG3A 3WAFA 1MY2A 4IB2A 4KFQA 1CB6A 1H44A 3H06B 3IL1B 4U1OA 3C4MA 1D4NA 1EU8A 2F7CA 4R73A 2A5SA 1ZTYA 3U1OA 2ESNA 5KDTB 2ONKE 4H1XA 3N6UA 4NF5B 3FGSA 3FIRA 4G77A 3EN3A 2P2AA 4IY5A 2W7YA 3Q26A 2Z23A 1XOCA 1MPDA 3M3FA 2VP1A 3VE1B 4UA8A 3ODBA 4JWYA 3QYTA 4ESXA 2AIXA 1MDQA 5HPQA 1QUJA 4BDMA 3SETA 3CSGA 1DMBA 4ZZAA 4OVJA 3PUZE 2PX1A 5L9MA 1P1NA 2XX8A 2QJEA 4BLAA 5DT6A 4KYEA 3PU5A 4IO2A 2Z8DA 5I2NA 1TFAA 2OZZA 2F97A 4XIGQ 3IO6A 4QFNA 4HCYA 2OCUA 2VD3A 4NF8A 4FJPA 3FVKA 3O6HA 4G4PA 3THIA 1SW5A 3FVGA 3RTFB 3MPKA 2Z22A 3H7MA 3S9NC 3V5AA 4F1YA 4DIGA 4TOZA 2DWJA 5I2KB 4PFTA 4BDOA 1DOTA 4KD5A 1URGA 3FJ7A 4KYSA 1MY3A 2O69A 2Z8FA 4NF6A 5L9SA 4K3FA 4JWXA 1N7WA 4G2ZA 1R9QA 1YCJA 1QULA 1MQIA 3S9EA 3TZAA 3FJGA 1EZ9A 3ECRA 3E4RA 4LUBA 4RK9A 4F3BA 3IOVA 2D3IA 1NMUA 3OO8A 1M5CA 2VOZA 5K2YA 2G93A 2UXAA 4YKIA 3K6WA 2H9BA 3LSFB 4YB7A 3SEUA 1PDAA 3PMVA 4F39A 3V8XB 3TCFA 1ZLQA 3N94A 2REGA 1PEBA 4JDFA 1MY0A 3MWBA 4UACA 4Q30B 3VLUA 3VVEA 1JEVA 1FTMA 3RT6B 1I6QA 4HTGA 4JWOA 5JEIA 4KYDA 3O66A 3SERA 2ZNTA 4FECA 3T93B 2PYYA 5DEXA 3SEVA 1JQFA 3N5LA 3Q25A 3DM0A 1LAXA 3ZKLA 3UIFA 4U4XA 5CMBA 3CFXA 1SBPA 1GVCA 3RQTA 1GGGA 1T0KA 1VFEA 4ELRA 4F2OA 2Y7WA 3CRBA 3KBRA 1LGBC 2O1MA 3RN8A 4LA9A 3K02A 4FIMA 5IAIA 4OERA 2IA4A 4H65A 1MM6A 3CG1A 4C1TA 1UTBB 4G8NA 4YMAA 2HZKA 1S9TA 4U1ZA 3G3FA 1AL3A 1FQAA 5H8FB 3K6UA 1D3KA 1TFDA 2H5YA 2Z8EA 3IX1A 4NTLA 4KI0E 2O51A 2QPQA 3MZBA 1B1HA 3HHGA 3HSTA 1MQHA 1I69A 1SW4A 3G3JA 2RF1A 1XVXA 1NKXA 3E3KA 1LSTA 4F29A 4WKMA 3OOAA 3FXRA 1N3XA 4P0IA 3CR9A 2ZYNA 3W9WA 5F1QA 3CFLA 4DLDA 2F5XA 5CMCA 4H67A 4MLQA 4U21A 4ONYA 5TPAA 3VLVA 3LSXA 4F1UA 1RKMA 4PFUA 1O7TA 2V25A 2XXUA 3K1PA 5LOMA 4LP2B 4R6KA 1ANFA 4R75A 3GBBA 2NXOA 3UA8A 5ELVA 5J1DA 3RGYA 2RC7A 4ZZEA 5L9OA 2O7IA 3VVDA 3M8UA 1B7HA 1II5A 5M2VA 1URDA 2AL4A 1LBBA 1MH3A 1B32A 1DPEA 2O68A 2I3VA 1B6HA 2THIA 4NWCA 3MC2A 3MPLA 4ISUA 4QF9A 3UK4A 4ZEIA 3TCGA 3MVYA 1XS5A 1B4ZA 3TODA 5JTYB 5KDTA 1SVXB 4M1VA 4YU0A 3K2DA 5ITPA 3EHTA 3MVZA 1MXUA 1WDNA 4R2BA 4U23A 2QMXA 1MM7A 3IORA 3TUSA 2P0SA 3O6GA 4EF1A 4OFOA 1B7ZA 3QXMA 3PGFA 2I4BA 2X7QA 4KPTA 2XXVA 4QFPA 3H6UA 4DZ1A 2V84A 4YICA 3A3UA 3VXBA 4THIA 2DOJA 1J1NA 3A09A 3I5OA 5F7VA 1GTKA 4ZEKA 3WAEA 3A3CA 3O29A 4QFOA 4BDLA 3KSJA 4R9FA 4NF4B 4MF3A 1LBCA 2HAVA 4H8IA 1HSJA 1NFTA 3IB0A 3KFMA 5I2KA 3OSRA 5CBRA 4YMBA 5CBSA 1KWHA 1BP5A 3ONMA 1QUIA 3MAMA 2QS1A 2F36A 1Y4TA 2REJA 4LZ5A 1IEJA 1DTGA 5ICTA 1N3WA 5AA1A 2DXYA 3QIMA 1DTZA 1B3LA 3K0VA 4NE4A 1UIVA 1IITA 2QL3A 1VR5A 5B7DA 3KGCA 1GR2A 2DWIA 4ZEBA 1P1WA 2V3UA 5CC2A 2I4CA 5CRYA 2QSXA 3KSXA 2GFEA 2ANJA 4C1UA 2DQVA 1D9VA 2FYIA 4EXKA 4XXUA 4JSDA 3PD9A 1TWYA 5H8QA 3FZVA 3K1MA 1NH8A 1MRPA 1H45A 4G68B 1BKAA 2LAOA 1B2HA 3PUXE 2I49A 1EH3A 4EQBA 1PC3A 1LB8A 1A8EA 2O6AA 1BLFA 4OESA 3TTLA 2RINA 3T9UA 2DXRA 4JB7A 4HW8A 1JW5A 2RKMA 4ZECA 1SYIA 4GD5A 1ELJA 4IO6A 1MPCA 3K1NA 4QSEA 1IUDA 1NNKA 2RC8A 2QS4A 2ZMBA 2KLFA 4I62A 1UTBA 1MS7A 1H76A 3RUMA 3T9XB 1B3FA 3HO7A 5H8FA 3L6GA 3HN0A 2Q89A 3F11A 2Y7IA 3PPQA 4RPOA 4FORA 1YAEA 3D4GA 4DXUA 3DP4A 2B3BA 2Q9TA 2HAUA 2XX9A 1LFHA 2UVHA 1EZPA 4TLLB 3PPPA 5I84A 1B1XA 5AE4A 4F2QA 4GIZA 4EQ9A 2I3WA 2DVZA 3GLBA 2YLNA 5CM6A 4HCWA 1Q1KA 4Q8RA 5I59B 3FVOA 4GL8A 1B5HA 1XHYA 2A5TB 3G3KA 1IXGA 4AQ4A 1AH5A 1UQWA 4BDRA 4U4SA 3FUZA 3CSBA 4YB6A 3K6XA 1LFIA 1SYHA 4E0WA 3Q27A 4O3AA 1N04A 4OETA 2UVIA 1B3HA 1M5EA 3PD8A 1QKBA 5L8DA 3H6VA 2I0CA 1XC1A 1IIWA 1QVSA 3BFTA 4YKKA 2ONSA 2I48A 3OEMA 4EQ7A 1P1UA 5JTYA 3O97A 2F78A 1POY1 2HCAA 1DSNA 3O2AA 2O7UA 5FHMA 4BDNA 4OXVA 2XX7A 2VHAA 2F34A 1IXHA 4OENA 4IY6A 2PBWA 4GFRA 1FTJA 1IXIA 1Y20A 1NNPA 3FV1A 3EQ1A 1QUKA 1PB7A 5CMMA 4R9GA 4I9DA 4H5FA 1H3DA 3K01A 3O6IA 2DP8A 5DVFA 2V3TA 3QUFA 3FD3A 2DVCA 3TQLA 2XXXA 4O3CA 3M3KA 4GQOA 4NF4A 2QS2A 1PB8A 3T66A 2OWSA 1JETA 3OMBA 1FQBA 1B3EA 2XXYA 3G3HA 1Y9UA 2ZNSA 2CZLA 1UTHB 4H6DA 4DXCA 1FQCA 4OZ9A 3T9VA 3CVGA 3VV5A 1MXZA 2R71A 3T96B 1FQEA 5I56B 4M4GA 2HFBA 4OEVA 5H8NB 4RJZA 4RPNA 5H8HA 1B0HA 2X26A 4X48A 5I2NB 4BDQA 1OMPA 4JSOA 3R7XA 5A5XB 1ZJLA 1HSEA 3RT8A 3MP8A 3QK6A 3DLNA 3N26A 2NUVA 3MP1A 4YZZA 3E13X 1M5FA 3R26A 1WODA 5I57B 3E9XA 1D9YA 5K2XA 1B40A 3KOSA 1AIVA 3VLWA 2FNCA 3IOWA 1MQJA 2DWHA 1IZ1A 2XXIA 4RNSA 3IO4A 3U93A 4GVOA 2OWTA 1P1QA 4PE5B 4G68A 2XXRA 1A99A 5ICQA 3TMGA 3UGWA 1SW1A 4PQJA 2F35A 3UN6A 3Q28A 3VVFA 1LAGE 2I6EA 3C32A 1N0TA 4ECFA 3OEKA 5DVIA 2UYFA 3FVNA 4EF2A 5DYHA 4NF5A 1JEUA 5HBCA 5TU0A 1SQYA 3FV2A 2PVUA 3AXFA 4G8MA 1JNFA 1A54A 1UIUA 3CIJA 3S4UA 3KN3A 4PETA 3U92A 4IGRA 1F9BA 2UVJA 4QRZA 2XXQA 1Y4CA 1N84A 2XXTA 1OLCA 4YKPA 4N13A 4DCYA 3C36A 4N07A 3H03A 4OTEA 1MG1A 3IOTA 3IB2A 1R1NA 4GF8A 1MPBA 3EF7A 1B05A 3RTWB 4MH5A 4U2RA 2H25A 3DELB 1QJMA 3C34A 4YAHX 1NL5A 4EXLA 1OLAA 4H0WA 1A7LA 5FHNA 5AA4B 5BUUA 4EDPA 1IQ7A 3QUJA 3EHSA 5I59A 1JW4A 1JVXA 5BWJA 4ZDMA 3IB1A 3PPOA 1RYXA 2A5TA 1MY4A 3TFLA 2ZYOA 3W15C 3QSLA 1FCKA 1OIBA 1A40A 2OK2A 4G8HA 4KCCA 3H4ZA 2Q2AA 1B9JA 2VGQA 3T22A 3U94A 3K4UA 3OENA 4TLMB 4FEBA 5EHSA 1O64A 1QW0A 1BIYA 1LCTA 2UVGA 1ATGA 1I6BA 3V89B 1MXYA 3IJOB 1POTA 1XT8A 3MJNA 2VD2A 1QKAA 1JVYA 3G3IA 3SKPA 3OELA 5HM4B 1S7YA 3U72A 4IO7A 1OVTA 1EZOA 3PV0E 1IXCA 3FXUA 1Q35A 2Y7PA 4X9TA 3TEPA 1YTVA 4NMYA 2G29A 3DP8A 4FAJA 2OBGA 1LLSA 1NH7A 4PFYA 4QFLA 4FATA 1N76A 1GV8A 2D21A 2X7PA 2CMOA 1URSA 2R9JA 1B51A 4OFJA 4DDDA 5I58B 3JZJA 3SEWA 1H43A 4TQUQ 3G3GA 5FTHA 2DE2A 4OFLA 2P1SA 3OXNA 3MVWA 1LAFE 3TKDA 3OO9A 2Q88A 2ALUA 1O63A 1TXFA 4MBPA 3RY3A 4AB6A 4KR5A 5ITOA 1A8FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TQW A;  1B4H A;  5EYF A;  2XD2 A;  1UTH A;  2DE3 A;  4XTC Q;  3MVX A;  3H6T A;  1MY1 A;  2Y7R A;  3LSW A;  1LB9 A;  5I56 A;  5H8N A;  2O1L A;  3OO7 A;  3BKI B;  3K6V A;  1B58 A;  1SDX A;  4EUO A;  1BTJ A;  3TDJ A;  4R6H A;  4IO5 A;  3G7W A;  4OEU A;  2PMS A;  4QFK A;  4ELO A;  4F19 A;  5A5X A;  2XXW A;  2ABH A;  4X1B A;  5AA3 A;  4PFW A;  4WEP A;  3PUW E;  1FTO A;  1Y3P A;  1M5B A;  1FW0 A;  4DE8 A;  1MQG A;  4JXI A;  4PP0 A;  3ILT B;  1HSL A;  4XKQ A;  3UOR A;  3MW0 A;  5I57 A;  3TTK A;  2Y84 A;  3S9M C;  2H99 A;  5KCJ B;  4F31 B;  1P99 A;  1MH4 A;  4RA1 A;  3MQ9 A;  4P0G A;  3GXA A;  4Q0C A;  1YPN A;  3B6T A;  3LR1 A;  1I6A A;  4F18 A;  2NWJ A;  4U22 A;  1OQH A;  1MXX A;  5DTB A;  3H6W A;  4OYV A;  2ZYM A;  2GHB A;  2XXH A;  3BBR A;  3MZ1 A;  1P1O A;  1US4 A;  2PT1 A;  1B52 A;  5TP9 B;  1Z7M E;  4GL0 A;  2OJT A;  3ZS6 A;  4HS7 A;  3TTR A;  2HXW A;  4P11 A;  4QHQ A;  3S2V A;  2HEU A;  3C35 A;  4L17 A;  1VFD A;  4IO3 A;  5JK4 A;  3C31 A;  1B3G A;  1B46 A;  3KN8 A;  3U8Q A;  4ELP A;  3GZG A;  2YJP A;  3LC8 A;  5B70 A;  2GH9 A;  2RC9 A;  3TCH A;  1LFG A;  1VE4 A;  5H8Q B;  1MQD A;  3SEY A;  5AA2 B;  1DPP A;  1NNT A;  2DSF A;  3KOT A;  4F22 A;  4LAT A;  3VFJ A;  3MBP A;  5CI5 A;  1AMF A;  2F6G A;  3GBA A;  3RNN A;  3L6H A;  1Y3Q A;  3OD7 A;  4WED A;  2F6P A;  4MFI A;  4ZED A;  3JV9 A;  4H5G A;  5IKB A;  2NOO A;  3O9P A;  1R6Z A;  2E1S A;  2I0B A;  3T9H B;  1S50 A;  5DVJ A;  4G68 C;  1XVY A;  4ESW A;  3ZSF A;  5H8S A;  2H98 A;  3PUY E;  1MXW A;  2Q2C A;  3I6V A;  3C9H A;  4LZ7 A;  4IO4 A;  2XHD A;  3SES A;  2V3Q A;  2ONR A;  4FED A;  2DYX A;  4AB5 A;  4ZE8 A;  4YKJ A;  4ZE9 A;  5AA4 A;  4DCX A;  3CFZ A;  4I8C A;  4H8J A;  2YPN A;  1PBQ A;  3PMX A;  1JW1 A;  1B5J A;  1ZIU A;  1OVB A;  2RCB A;  2IEE A;  4F1V A;  3USD A;  1NNF A;  2OLB A;  2B65 A;  4LZ8 A;  4POX A;  1SW2 A;  1ZBM A;  3Q29 A;  3UP9 A;  4RK2 A;  4NF8 B;  3TAJ A;  4X1D A;  3MUQ A;  1USY H;  1LAH E;  4GOT A;  4POW A;  3HHF A;  1FQD A;  4ZEF A;  2ZXT A;  2F7B A;  3K00 A;  4JBZ A;  4ZS9 A;  4KCD A;  5FHO A;  3TTN A;  4I1D A;  1WVJ A;  4KQP A;  2E0S A;  3FAS A;  3FJM A;  1Y1M A;  3IJX B;  2BJJ X;  3B6Q A;  4F3S A;  3TTM A;  3B7D A;  3VDF A;  2M8C A;  4LQ2 A;  4NF6 B;  3PUV E;  4RXL A;  5KZT A;  2HZL A;  4XKP A;  4OWD A;  4ELQ A;  1LCF A;  1B7U A;  3C33 A;  1ZMG A;  1L5T A;  2UYE A;  1MXV A;  3CI8 A;  3LUY A;  3R6U A;  1MDP 1;  2DE4 A;  3O28 A;  2O84 X;  4GRK A;  4C0R A;  4R6Y A;  2GRV A;  2F8D A;  5FTI A;  4FE8 A;  4QSC A;  2DWA A;  4F3G A;  4MLV A;  3P7I A;  3KG2 A;  3BFU A;  3FAT A;  2RCA A;  1SD3 A;  4QSD A;  1Z7N E;  5I58 A;  1FTL A;  3IR1 A;  4Q5T A;  4F3P A;  4R2F A;  1PB9 A;  5ISU A;  3IK6 B;  4RYA A;  5EHM A;  1TT1 A;  4Z7E A;  2XD3 A;  2V93 A;  1R9L A;  4OHN A;  2DS9 A;  1N7X A;  3DP6 A;  3N6T A;  2XXP A;  2Q8J A;  3VXC A;  3PPR A;  5DEX B;  3S9L C;  2NVU B;  5AA2 D;  4LVQ A;  3FXQ A;  3JYR A;  3LBS A;  4OQO A;  3HCQ A;  3KZG A;  2Y7K A;  4Z0I A;  4GXA A;  2F7A A;  2HQ0 A;  1SI0 A;  1VSO A;  1A55 A;  3I3V A;  4LQ5 A;  3HPI A;  2QMW A;  3IAZ A;  2I58 A;  3RLF E;  4E0X A;  4DXB A;  1CE2 A;  3KEI A;  2QS3 A;  1US5 A;  2AYS A;  4YB5 A;  3OSQ A;  3SDF A;  4ND9 A;  1AOV A;  3OO6 A;  4LON B;  1M5D A;  5KCJ A;  3KJT A;  3KN7 A;  3SEX A;  1PBP A;  3ZKK A;  3IOU A;  4GXS B;  3W9V A;  2GHA A;  3MP6 A;  5H8H B;  1Y3N A;  3H3G A;  4NED A;  4R72 A;  4RY1 A;  3TEL A;  1USY E;  1FTK A;  2FA7 A;  5TP9 A;  4GLI A;  4WXJ A;  1Y1Z A;  1OQG A;  1ZKB A;  4O3B A;  2PT2 A;  2AL5 A;  3QAX A;  2D5W A;  2R6G E;  1RYO A;  3EHU A;  5TPA B;  2QRY A;  3D4C A;  1SI1 A;  3LSL A;  3TYH A;  2WKY A;  3MZ9 A;  1B0L A;  3B6W A;  4GWO A;  4NWD A;  3ILU B;  3EPE A;  2H4I A;  4OMB A;  3PMW A;  1FQF A;  4XKR A;  1B5I A;  2B3F A;  4XKN A;  3TPA A;  2ZNU A;  3V83 A;  4KHZ E;  3KJ7 A;  4R74 A;  5CMK A;  2ZYK A;  1ZU0 A;  4IGT A;  3RPW A;  3HV1 A;  5AA2 A;  3M3L A;  4N6P A;  3PPN A;  3CG3 A;  3WAF A;  1MY2 A;  4IB2 A;  4KFQ A;  1CB6 A;  1H44 A;  3H06 B;  3IL1 B;  4U1O A;  3C4M A;  1D4N A;  1EU8 A;  2F7C A;  4R73 A;  2A5S A;  1ZTY A;  3U1O A;  2ESN A;  5KDT B;  2ONK E;  4H1X A;  3N6U A;  4NF5 B;  3FGS A;  3FIR A;  4G77 A;  3EN3 A;  2P2A A;  4IY5 A;  2W7Y A;  3Q26 A;  2Z23 A;  1XOC A;  1MPD A;  3M3F A;  2VP1 A;  3VE1 B;  4UA8 A;  3ODB A;  4JWY A;  3QYT A;  4ESX A;  2AIX A;  1MDQ A;  5HPQ A;  1QUJ A;  4BDM A;  3SET A;  3CSG A;  1DMB A;  4ZZA A;  4OVJ A;  3PUZ E;  2PX1 A;  5L9M A;  1P1N A;  2XX8 A;  2QJE A;  4BLA A;  5DT6 A;  4KYE A;  3PU5 A;  4IO2 A;  2Z8D A;  5I2N A;  1TFA A;  2OZZ A;  2F97 A;  4XIG Q;  3IO6 A;  4QFN A;  4HCY A;  2OCU A;  2VD3 A;  4NF8 A;  4FJP A;  3FVK A;  3O6H A;  4G4P A;  3THI A;  1SW5 A;  3FVG A;  3RTF B;  3MPK A;  2Z22 A;  3H7M A;  3S9N C;  3V5A A;  4F1Y A;  4DIG A;  4TOZ A;  2DWJ A;  5I2K B;  4PFT A;  4BDO A;  1DOT A;  4KD5 A;  1URG A;  3FJ7 A;  4KYS A;  1MY3 A;  2O69 A;  2Z8F A;  4NF6 A;  5L9S A;  4K3F A;  4JWX A;  1N7W A;  4G2Z A;  1R9Q A;  1YCJ A;  1QUL A;  1MQI A;  3S9E A;  3TZA A;  3FJG A;  1EZ9 A;  3ECR A;  3E4R A;  4LUB A;  4RK9 A;  4F3B A;  3IOV A;  2D3I A;  1NMU A;  3OO8 A;  1M5C A;  2VOZ A;  5K2Y A;  2G93 A;  2UXA A;  4YKI A;  3K6W A;  2H9B A;  3LSF B;  4YB7 A;  3SEU A;  1PDA A;  3PMV A;  4F39 A;  3V8X B;  3TCF A;  1ZLQ A;  3N94 A;  2REG A;  1PEB A;  4JDF A;  1MY0 A;  3MWB A;  4UAC A;  4Q30 B;  3VLU A;  3VVE A;  1JEV A;  1FTM A;  3RT6 B;  1I6Q A;  4HTG A;  4JWO A;  5JEI A;  4KYD A;  3O66 A;  3SER A;  2ZNT A;  4FEC A;  3T93 B;  2PYY A;  5DEX A;  3SEV A;  1JQF A;  3N5L A;  3Q25 A;  3DM0 A;  1LAX A;  3ZKL A;  3UIF A;  4U4X A;  5CMB A;  3CFX A;  1SBP A;  1GVC A;  3RQT A;  1GGG A;  1T0K A;  1VFE A;  4ELR A;  4F2O A;  2Y7W A;  3CRB A;  3KBR A;  1LGB C;  2O1M A;  3RN8 A;  4LA9 A;  3K02 A;  4FIM A;  5IAI A;  4OER A;  2IA4 A;  4H65 A;  1MM6 A;  3CG1 A;  4C1T A;  1UTB B;  4G8N A;  4YMA A;  2HZK A;  1S9T A;  4U1Z A;  3G3F A;  1AL3 A;  1FQA A;  5H8F B;  3K6U A;  1D3K A;  1TFD A;  2H5Y A;  2Z8E A;  3IX1 A;  4NTL A;  4KI0 E;  2O51 A;  2QPQ A;  3MZB A;  1B1H A;  3HHG A;  3HST A;  1MQH A;  1I69 A;  1SW4 A;  3G3J A;  2RF1 A;  1XVX A;  1NKX A;  3E3K A;  1LST A;  4F29 A;  4WKM A;  3OOA A;  3FXR A;  1N3X A;  4P0I A;  3CR9 A;  2ZYN A;  3W9W A;  5F1Q A;  3CFL A;  4DLD A;  2F5X A;  5CMC A;  4H67 A;  4MLQ A;  4U21 A;  4ONY A;  5TPA A;  3VLV A;  3LSX A;  4F1U A;  1RKM A;  4PFU A;  1O7T A;  2V25 A;  2XXU A;  3K1P A;  5LOM A;  4LP2 B;  4R6K A;  1ANF A;  4R75 A;  3GBB A;  2NXO A;  3UA8 A;  5ELV A;  5J1D A;  3RGY A;  2RC7 A;  4ZZE A;  5L9O A;  2O7I A;  3VVD A;  3M8U A;  1B7H A;  1II5 A;  5M2V A;  1URD A;  2AL4 A;  1LBB A;  1MH3 A;  1B32 A;  1DPE A;  2O68 A;  2I3V A;  1B6H A;  2THI A;  4NWC A;  3MC2 A;  3MPL A;  4ISU A;  4QF9 A;  3UK4 A;  4ZEI A;  3TCG A;  3MVY A;  1XS5 A;  1B4Z A;  3TOD A;  5JTY B;  5KDT A;  1SVX B;  4M1V A;  4YU0 A;  3K2D A;  5ITP A;  3EHT A;  3MVZ A;  1MXU A;  1WDN A;  4R2B A;  4U23 A;  2QMX A;  1MM7 A;  3IOR A;  3TUS A;  2P0S A;  3O6G A;  4EF1 A;  4OFO A;  1B7Z A;  3QXM A;  3PGF A;  2I4B A;  2X7Q A;  4KPT A;  2XXV A;  4QFP A;  3H6U A;  4DZ1 A;  2V84 A;  4YIC A;  3A3U A;  3VXB A;  4THI A;  2DOJ A;  1J1N A;  3A09 A;  3I5O A;  5F7V A;  1GTK A;  4ZEK A;  3WAE A;  3A3C A;  3O29 A;  4QFO A;  4BDL A;  3KSJ A;  4R9F A;  4NF4 B;  4MF3 A;  1LBC A;  2HAV A;  4H8I A;  1HSJ A;  1NFT A;  3IB0 A;  3KFM A;  5I2K A;  3OSR A;  5CBR A;  4YMB A;  5CBS A;  1KWH A;  1BP5 A;  3ONM A;  1QUI A;  3MAM A;  2QS1 A;  2F36 A;  1Y4T A;  2REJ A;  4LZ5 A;  1IEJ A;  1DTG A;  5ICT A;  1N3W A;  5AA1 A;  2DXY A;  3QIM A;  1DTZ A;  1B3L A;  3K0V A;  4NE4 A;  1UIV A;  1IIT A;  2QL3 A;  1VR5 A;  5B7D A;  3KGC A;  1GR2 A;  2DWI A;  4ZEB A;  1P1W A;  2V3U A;  5CC2 A;  2I4C A;  5CRY A;  2QSX A;  3KSX A;  2GFE A;  2ANJ A;  4C1U A;  2DQV A;  1D9V A;  2FYI A;  4EXK A;  4XXU A;  4JSD A;  3PD9 A;  1TWY A;  5H8Q A;  3FZV A;  3K1M A;  1NH8 A;  1MRP A;  1H45 A;  4G68 B;  1BKA A;  2LAO A;  1B2H A;  3PUX E;  2I49 A;  1EH3 A;  4EQB A;  1PC3 A;  1LB8 A;  1A8E A;  2O6A A;  1BLF A;  4OES A;  3TTL A;  2RIN A;  3T9U A;  2DXR A;  4JB7 A;  4HW8 A;  1JW5 A;  2RKM A;  4ZEC A;  1SYI A;  4GD5 A;  1ELJ A;  4IO6 A;  1MPC A;  3K1N A;  4QSE A;  1IUD A;  1NNK A;  2RC8 A;  2QS4 A;  2ZMB A;  2KLF A;  4I62 A;  1UTB A;  1MS7 A;  1H76 A;  3RUM A;  3T9X B;  1B3F A;  3HO7 A;  5H8F A;  3L6G A;  3HN0 A;  2Q89 A;  3F11 A;  2Y7I A;  3PPQ A;  4RPO A;  4FOR A;  1YAE A;  3D4G A;  4DXU A;  3DP4 A;  2B3B A;  2Q9T A;  2HAU A;  2XX9 A;  1LFH A;  2UVH A;  1EZP A;  4TLL B;  3PPP A;  5I84 A;  1B1X A;  5AE4 A;  4F2Q A;  4GIZ A;  4EQ9 A;  2I3W A;  2DVZ A;  3GLB A;  2YLN A;  5CM6 A;  4HCW A;  1Q1K A;  4Q8R A;  5I59 B;  3FVO A;  4GL8 A;  1B5H A;  1XHY A;  2A5T B;  3G3K A;  1IXG A;  4AQ4 A;  1AH5 A;  1UQW A;  4BDR A;  4U4S A;  3FUZ A;  3CSB A;  4YB6 A;  3K6X A;  1LFI A;  1SYH A;  4E0W A;  3Q27 A;  4O3A A;  1N04 A;  4OET A;  2UVI A;  1B3H A;  1M5E A;  3PD8 A;  1QKB A;  5L8D A;  3H6V A;  2I0C A;  1XC1 A;  1IIW A;  1QVS A;  3BFT A;  4YKK A;  2ONS A;  2I48 A;  3OEM A;  4EQ7 A;  1P1U A;  5JTY A;  3O97 A;  2F78 A;  1POY 1;  2HCA A;  1DSN A;  3O2A A;  2O7U A;  5FHM A;  4BDN A;  4OXV A;  2XX7 A;  2VHA A;  2F34 A;  1IXH A;  4OEN A;  4IY6 A;  2PBW A;  4GFR A;  1FTJ A;  1IXI A;  1Y20 A;  1NNP A;  3FV1 A;  3EQ1 A;  1QUK A;  1PB7 A;  5CMM A;  4R9G A;  4I9D A;  4H5F A;  1H3D A;  3K01 A;  3O6I A;  2DP8 A;  5DVF A;  2V3T A;  3QUF A;  3FD3 A;  2DVC A;  3TQL A;  2XXX A;  4O3C A;  3M3K A;  4GQO A;  4NF4 A;  2QS2 A;  1PB8 A;  3T66 A;  2OWS A;  1JET A;  3OMB A;  1FQB A;  1B3E A;  2XXY A;  3G3H A;  1Y9U A;  2ZNS A;  2CZL A;  1UTH B;  4H6D A;  4DXC A;  1FQC A;  4OZ9 A;  3T9V A;  3CVG A;  3VV5 A;  1MXZ A;  2R71 A;  3T96 B;  1FQE A;  5I56 B;  4M4G A;  2HFB A;  4OEV A;  5H8N B;  4RJZ A;  4RPN A;  5H8H A;  1B0H A;  2X26 A;  4X48 A;  5I2N B;  4BDQ A;  1OMP A;  4JSO A;  3R7X A;  5A5X B;  1ZJL A;  1HSE A;  3RT8 A;  3MP8 A;  3QK6 A;  3DLN A;  3N26 A;  2NUV A;  3MP1 A;  4YZZ A;  3E13 X;  1M5F A;  3R26 A;  1WOD A;  5I57 B;  3E9X A;  1D9Y A;  5K2X A;  1B40 A;  3KOS A;  1AIV A;  3VLW A;  2FNC A;  3IOW A;  1MQJ A;  2DWH A;  1IZ1 A;  2XXI A;  4RNS A;  3IO4 A;  3U93 A;  4GVO A;  2OWT A;  1P1Q A;  4PE5 B;  4G68 A;  2XXR A;  1A99 A;  5ICQ A;  3TMG A;  3UGW A;  1SW1 A;  4PQJ A;  2F35 A;  3UN6 A;  3Q28 A;  3VVF A;  1LAG E;  2I6E A;  3C32 A;  1N0T A;  4ECF A;  3OEK A;  5DVI A;  2UYF A;  3FVN A;  4EF2 A;  5DYH A;  4NF5 A;  1JEU A;  5HBC A;  5TU0 A;  1SQY A;  3FV2 A;  2PVU A;  3AXF A;  4G8M A;  1JNF A;  1A54 A;  1UIU A;  3CIJ A;  3S4U A;  3KN3 A;  4PET A;  3U92 A;  4IGR A;  1F9B A;  2UVJ A;  4QRZ A;  2XXQ A;  1Y4C A;  1N84 A;  2XXT A;  1OLC A;  4YKP A;  4N13 A;  4DCY A;  3C36 A;  4N07 A;  3H03 A;  4OTE A;  1MG1 A;  3IOT A;  3IB2 A;  1R1N A;  4GF8 A;  1MPB A;  3EF7 A;  1B05 A;  3RTW B;  4MH5 A;  4U2R A;  2H25 A;  3DEL B;  1QJM A;  3C34 A;  4YAH X;  1NL5 A;  4EXL A;  1OLA A;  4H0W A;  1A7L A;  5FHN A;  5AA4 B;  5BUU A;  4EDP A;  1IQ7 A;  3QUJ A;  3EHS A;  5I59 A;  1JW4 A;  1JVX A;  5BWJ A;  4ZDM A;  3IB1 A;  3PPO A;  1RYX A;  2A5T A;  1MY4 A;  3TFL A;  2ZYO A;  3W15 C;  3QSL A;  1FCK A;  1OIB A;  1A40 A;  2OK2 A;  4G8H A;  4KCC A;  3H4Z A;  2Q2A A;  1B9J A;  2VGQ A;  3T22 A;  3U94 A;  3K4U A;  3OEN A;  4TLM B;  4FEB A;  5EHS A;  1O64 A;  1QW0 A;  1BIY A;  1LCT A;  2UVG A;  1ATG A;  1I6B A;  3V89 B;  1MXY A;  3IJO B;  1POT A;  1XT8 A;  3MJN A;  2VD2 A;  1QKA A;  1JVY A;  3G3I A;  3SKP A;  3OEL A;  5HM4 B;  1S7Y A;  3U72 A;  4IO7 A;  1OVT A;  1EZO A;  3PV0 E;  1IXC A;  3FXU A;  1Q35 A;  2Y7P A;  4X9T A;  3TEP A;  1YTV A;  4NMY A;  2G29 A;  3DP8 A;  4FAJ A;  2OBG A;  1LLS A;  1NH7 A;  4PFY A;  4QFL A;  4FAT A;  1N76 A;  1GV8 A;  2D21 A;  2X7P A;  2CMO A;  1URS A;  2R9J A;  1B51 A;  4OFJ A;  4DDD A;  5I58 B;  3JZJ A;  3SEW A;  1H43 A;  4TQU Q;  3G3G A;  5FTH A;  2DE2 A;  4OFL A;  2P1S A;  3OXN A;  3MVW A;  1LAF E;  3TKD A;  3OO9 A;  2Q88 A;  2ALU A;  1O63 A;  1TXF A;  4MBP A;  3RY3 A;  4AB6 A;  4KR5 A;  5ITO A;  1A8F A; 
#chains in the Genus database with same CATH topology
 3TQW A;  1B4H A;  5EYF A;  2XD2 A;  1UTH A;  2MKZ A;  2DE3 A;  4XTC Q;  3MVX A;  3H6T A;  1MY1 A;  2Y7R A;  3LSW A;  1K9Y A;  1LB9 A;  5I56 A;  5H8N A;  2O1L A;  3OO7 A;  3BKI B;  1FJ9 A;  3K6V A;  1B58 A;  1SDX A;  4EUO A;  1BTJ A;  3TDJ A;  2Y5L A;  4N6K A;  4R6H A;  4GWX A;  5IZ1 A;  4IO5 A;  5EQ9 A;  3G7W A;  4OEU A;  2PMS A;  4QFK A;  4ELO A;  4F19 A;  5A5X A;  2XXW A;  2ABH A;  4X1B A;  5AA3 A;  4PFW A;  4WEP A;  3PUW E;  4N8G A;  3KBZ A;  1FTO A;  1Y3P A;  1M5B A;  1FW0 A;  2FVZ A;  4DE8 A;  1MQG A;  4JXI A;  4PP0 A;  3ILT B;  1HSL A;  4XKQ A;  3FXB A;  3MW0 A;  3UOR A;  5I57 A;  3TTK A;  2Y84 A;  3S9M C;  2H99 A;  5KCJ B;  4F31 B;  1P99 A;  1MH4 A;  3A29 A;  4RA1 A;  3MQ9 A;  4P0G A;  3GXA A;  4Q0C A;  1YPN A;  3B6T A;  3LR1 A;  1I6A A;  4F18 A;  2NWJ A;  4U22 A;  1OQH A;  1MXX A;  4NX1 A;  5DTB A;  2QFL A;  3H6W A;  4OYV A;  2ZYM A;  2GHB A;  2XXH A;  3BBR A;  3MZ1 A;  1P1O A;  4GX4 A;  1US4 A;  2WYP A;  2PT1 A;  1B52 A;  5TP9 B;  1Z7M E;  4GL0 A;  2OJT A;  1NV7 A;  5IZ3 B;  4HS7 A;  3ZS6 A;  3TTR A;  2HXW A;  4P11 A;  2F3D A;  4QHQ A;  4H45 A;  1AWB A;  3S2V A;  2HEU A;  3C35 A;  3U65 A;  4L17 A;  5J16 A;  1VFD A;  3E78 A;  4IO3 A;  5JK4 A;  3C31 A;  1B3G A;  1B46 A;  3KN8 A;  3U8Q A;  4ELP A;  2CZH A;  3GZG A;  2YJP A;  3LC8 A;  5B70 A;  2KR0 A;  2GH9 A;  4NG7 A;  2RC9 A;  3TCH A;  1LFG A;  4N15 A;  1VE4 A;  2XWO A;  5H8Q B;  1MQD A;  3SEY A;  5AA2 B;  1DPP A;  1NNT A;  2DSF A;  3KOT A;  4F22 A;  4LAT A;  3VFJ A;  3MBP A;  5CI5 A;  4NHB A;  1AMF A;  2F6G A;  3GBA A;  3RNN A;  3L6H A;  1Y3Q A;  3OD7 A;  4WED A;  2F6P A;  4MFI A;  4ZED A;  3JV9 A;  5FBP A;  4NGU A;  4H5G A;  5IKB A;  2NOO A;  4GWS A;  3O9P A;  1R6Z A;  1Q9D A;  2E1S A;  3IFA A;  2I0B A;  3T9H B;  1S50 A;  5DVJ A;  4GBW A;  4G68 C;  1XVY A;  4ESW A;  1JP4 A;  3ZSF A;  5H8S A;  2H98 A;  3PUY E;  1MXW A;  2Q2C A;  3I6V A;  3C9H A;  4LZ7 A;  3NOH A;  4IO4 A;  2XHD A;  3SES A;  2V3Q A;  2ONR A;  4FED A;  2DYX A;  4AB5 A;  4ZE8 A;  4YKJ A;  4ZE9 A;  1CNQ A;  5AA4 A;  2BJI A;  4DCX A;  3CFZ A;  4I8C A;  4H8J A;  2YPN A;  1PBQ A;  3PMX A;  1JW1 A;  1FPL A;  1B5J A;  1ZIU A;  1OVB A;  2RCB A;  2B4L A;  4G61 A;  2IEE A;  4P56 A;  4F1V A;  3USD A;  1NNF A;  4PAI A;  2OLB A;  2B65 A;  4LZ8 A;  4POX A;  1SW2 A;  1ZBM A;  3Q29 A;  3UP9 A;  4RK2 A;  4NF8 B;  3TAJ A;  4X1D A;  3MUQ A;  1USY H;  1LAH E;  4GOT A;  4POW A;  3HHF A;  1FQD A;  4ZEF A;  2ZXT A;  4JVD A;  4GX3 A;  4OVP A;  2F7B A;  3K00 A;  4JBZ A;  1LBY A;  4ZS9 A;  2XA5 A;  4KCD A;  5FHO A;  3TTN A;  4I1D A;  1WVJ A;  4KQP A;  1YZ0 A;  2E0S A;  3FAS A;  3FJM A;  5F24 A;  1Y1M A;  3IJX B;  2BJJ X;  3B6Q A;  4F3S A;  3TTM A;  3B7D A;  3VDF A;  2M8C A;  4LQ2 A;  4NF6 B;  3PUV E;  4RXL A;  5KZT A;  4NF0 A;  2HZL A;  4XKP A;  4OWD A;  4ELQ A;  1LCF A;  1B7U A;  5LTC A;  1INP A;  3C33 A;  1ZMG A;  1L5T A;  2UYE A;  4XFE A;  1MXV A;  3CI8 A;  3LUY A;  1QGX A;  3QMF A;  2CZI A;  1DCU A;  3R6U A;  1MDP 1;  2DE4 A;  2KQZ A;  3O28 A;  2ZZV A;  2O84 X;  4GRK A;  4GWZ A;  4C0R A;  4R6Y A;  2GRV A;  2F8D A;  5FTI A;  3IFC A;  3KC1 A;  4PDD A;  4P9K A;  4FE8 A;  4QSC A;  2DWA A;  1RDY A;  4F3G A;  4MLV A;  3P7I A;  3KG2 A;  3BFU A;  3FAT A;  2RCA A;  1SD3 A;  1FPB A;  4QSD A;  2Q74 A;  4PBH A;  1Z7N E;  4PF6 A;  5I58 A;  1FTL A;  3IR1 A;  4Q5T A;  1LBX A;  4F3P A;  4R2F A;  1PB9 A;  1YYZ A;  5ISU A;  3IK6 B;  4RYA A;  5EHM A;  1TT1 A;  4Z7E A;  2XD3 A;  2V93 A;  1R9L A;  4OHN A;  2DS9 A;  1N7X A;  1EYK A;  1NV3 A;  3DP6 A;  3N6T A;  2XXP A;  2Q8J A;  3VXC A;  3PPR A;  5DEX B;  4I3E A;  3RPL B;  3S9L C;  2NVU B;  5AA2 D;  4LVQ A;  3FXQ A;  3JYR A;  3LBS A;  4OQO A;  2VPO A;  3HCQ A;  4X8R A;  3KZG A;  1RDX A;  2Y7K A;  4Z0I A;  4GXA A;  2F7A A;  2HQ0 A;  1SI0 A;  1VSO A;  1A55 A;  5T3J A;  4LQ5 A;  3I3V A;  3HPI A;  3LUZ A;  2QMW A;  3IAZ A;  1DBZ A;  2I58 A;  3RLF E;  3B8B A;  4O7I A;  4E0X A;  4DXB A;  1CE2 A;  3KEI A;  2QS3 A;  4I3Y A;  1US5 A;  2AYS A;  4NQ8 A;  4YB5 A;  3OSQ A;  3SDF A;  4ND9 A;  1AOV A;  3OO6 A;  4LON B;  1M5D A;  5KCJ A;  1FBF A;  3KJT A;  3KN7 A;  3SEX A;  4FBP A;  1PBP A;  3ZKK A;  5IM2 A;  3IOU A;  3HFU A;  4DI4 B;  4GXS B;  3W9V A;  2GHA A;  3MP6 A;  5H8H B;  1Y3N A;  3H3G A;  4NED A;  5EQA A;  4R72 A;  4RY1 A;  3TEL A;  1USY E;  1FTK A;  2FA7 A;  4HE0 A;  4N6D A;  5TP9 A;  4GLI A;  4WXJ A;  1Y1Z A;  1OQG A;  1ZKB A;  5IZ3 A;  4GWY A;  4O3B A;  2PT2 A;  2AL5 A;  3QAX A;  2D5W A;  2R6G E;  2JJK A;  1RYO A;  3EHU A;  5TPA B;  2QRY A;  3D4C A;  1SI1 A;  3LSL A;  3TYH A;  2WKY A;  3MZ9 A;  1B0L A;  3B6W A;  4GWO A;  4NWD A;  3ILU B;  3EPE A;  2H4I A;  4OMB A;  4UAB A;  3PMW A;  1FQF A;  4XKR A;  1B5I A;  2B3F A;  1FPG A;  4XKN A;  3TPA A;  4OVS A;  2ZNU A;  3V83 A;  4KHZ E;  3KJ7 A;  4R74 A;  5CMK A;  2ZYK A;  1RDZ A;  1ZU0 A;  4IGT A;  3RPW A;  3HV1 A;  1NV2 A;  5AA2 A;  3M3L A;  4N6P A;  3PPN A;  4PGP A;  3CG3 A;  3WAF A;  1MY2 A;  4PC9 A;  4IB2 A;  4KFQ A;  1CB6 A;  1H44 A;  3H06 B;  3IL1 B;  4U1O A;  3C4M A;  1D4N A;  1EU8 A;  2F7C A;  4R73 A;  2A5S A;  4GWW A;  1ZTY A;  3U1O A;  2ESN A;  5KDT B;  2ONK E;  4H1X A;  3N6U A;  4NF5 B;  3FGS A;  3FIR A;  4G77 A;  3EN3 A;  2P2A A;  4IY5 A;  2W7Y A;  3Q26 A;  2Z23 A;  1XOC A;  1MPD A;  5ET7 A;  3M3F A;  2VP1 A;  3VE1 B;  3E79 A;  4UA8 A;  3ODB A;  4JWY A;  3QYT A;  4ESX A;  2QVU A;  2AIX A;  1MDQ A;  5HPQ A;  1QUJ A;  4BDM A;  3SET A;  3CSG A;  3KC0 A;  1DMB A;  4ZZA A;  4OVJ A;  3PUZ E;  2PX1 A;  5L9M A;  1P1N A;  2XX8 A;  2QJE A;  4BLA A;  2FBP A;  5DT6 A;  4KYE A;  3PU5 A;  2OX3 A;  4IO2 A;  2Z8D A;  5I2N A;  1TFA A;  2OZZ A;  2F97 A;  4XIG Q;  3IO6 A;  4QFN A;  4HCY A;  2OCU A;  2VD3 A;  4NF8 A;  4FJP A;  3FVK A;  3O6H A;  4G4P A;  3THI A;  1SW5 A;  3FVG A;  1FSA A;  3RTF B;  3MPK A;  2Z22 A;  3H7M A;  3S9N C;  1FBH A;  3V5A A;  4F1Y A;  4DIG A;  4TOZ A;  2DWJ A;  5I2K B;  1FPD A;  4PFT A;  4KD5 A;  1DOT A;  1NV6 A;  4GBV A;  4BDO A;  1URG A;  3FJ7 A;  4KYS A;  1MY3 A;  2O69 A;  2Z8F A;  4NF6 A;  5L9S A;  4HE1 A;  4K3F A;  4JWX A;  4OA4 A;  1FPF A;  1N7W A;  4G2Z A;  4N91 A;  1R9Q A;  1IMD A;  1YCJ A;  1QUL A;  1MQI A;  3S9E A;  3TZA A;  3FJG A;  4P1E A;  1EZ9 A;  3ECR A;  1FBC A;  2Y5K A;  2XXK A;  3E4R A;  4LUB A;  1G0H A;  4RK9 A;  4F3B A;  1D9Q A;  3FBP A;  3IOV A;  2D3I A;  1NMU A;  3OO8 A;  1M5C A;  2VOZ A;  2P3V A;  5K2Y A;  2G93 A;  2UXA A;  4YKI A;  3K6W A;  2H9B A;  3LSF B;  4YB7 A;  3SEU A;  3ISP A;  1PDA A;  3PMV A;  4F39 A;  3V8X B;  3TCF A;  1ZLQ A;  3N94 A;  2REG A;  1PEB A;  4JDF A;  1MY0 A;  3MWB A;  4UAC A;  4MCO A;  4Q30 B;  3VLU A;  3VVE A;  1JEV A;  1FTM A;  3RT6 B;  1I6Q A;  4HTG A;  4JWO A;  5JEI A;  3PTY A;  4KYD A;  3O66 A;  3SER A;  2ZNT A;  4FEC A;  3T93 B;  2PYY A;  5DEX A;  3SEV A;  1JQF A;  3N5L A;  3Q25 A;  3DM0 A;  4O7M A;  3RPL A;  1LAX A;  3ZKL A;  3UIF A;  4U4X A;  5CMB A;  3CFX A;  1SBP A;  1GVC A;  3RQT A;  1GGG A;  1T0K A;  1VFE A;  4ELR A;  4F2O A;  3T0J A;  2Y7W A;  3CRB A;  3KBR A;  1LGB C;  1FPJ A;  2O1M A;  3RN8 A;  4LA9 A;  3K02 A;  4FIM A;  5IAI A;  4OER A;  2IA4 A;  4H65 A;  1MM6 A;  3CG1 A;  4C1T A;  1UTB B;  1YXI A;  4G8N A;  4YMA A;  2HZK A;  1S9T A;  4U1Z A;  1XI6 A;  1LBV A;  1AL3 A;  3G3F A;  1FQA A;  5H8F B;  3K6U A;  2XWV A;  1D3K A;  1TFD A;  2H5Y A;  2Z8E A;  4JVI A;  3IX1 A;  4NTL A;  4KI0 E;  2O51 A;  2QPQ A;  3MZB A;  3GYY A;  1B1H A;  2FIE A;  3HHG A;  3HST A;  1MQH A;  1I69 A;  1SW4 A;  3G3J A;  1EYJ A;  2RF1 A;  1XVX A;  1NKX A;  3E3K A;  1LST A;  4F29 A;  4WKM A;  3OOA A;  3FXR A;  1N3X A;  4P0I A;  3CR9 A;  2ZYN A;  3W9W A;  5F1Q A;  3CFL A;  4DLD A;  2F5X A;  5CMC A;  4X04 A;  2PFY A;  4H67 A;  4MLQ A;  4U21 A;  4ONY A;  3RYD A;  5TPA A;  3VLV A;  2ZZW A;  4O94 A;  3LSX A;  4QBA A;  4F1U A;  1RKM A;  4PFU A;  1O7T A;  2V25 A;  5ET5 A;  2XXU A;  3K1P A;  5LOM A;  1FPK A;  1IMC A;  4LP2 B;  4R6K A;  1ANF A;  4R75 A;  3GBB A;  2NXO A;  1IMB A;  3UA8 A;  5ELV A;  5J1D A;  3RGY A;  4MNC A;  2RC7 A;  4ZZE A;  5L9O A;  2O7I A;  3VVD A;  3M8U A;  1B7H A;  3MST A;  1II5 A;  5M2V A;  4PGN A;  2VPN A;  1URD A;  2AL4 A;  1LBB A;  1MH3 A;  1B32 A;  1DPE A;  5ESY A;  2O68 A;  2WBD A;  2I3V A;  1B6H A;  2THI A;  4NWC A;  1NUW A;  3MC2 A;  3MPL A;  4ISU A;  4QF9 A;  3UK4 A;  4ZEI A;  3TCG A;  3MVY A;  1XS5 A;  1B4Z A;  3TOD A;  1KA0 A;  2HPG A;  5JTY B;  5KDT A;  1SVX B;  4M1V A;  4YU0 A;  3K2D A;  5ITP A;  3EHT A;  3MVZ A;  5ET8 A;  1MXU A;  1KZ8 A;  1WDN A;  4R2B A;  4U23 A;  1KA1 A;  4PAK A;  2QMX A;  1MM7 A;  3IOR A;  3TUS A;  2P0S A;  3O6G A;  4EF1 A;  5A5L A;  4OFO A;  1B7Z A;  3QXM A;  4GX6 A;  3PGF A;  4HXV A;  3EKI A;  2I4B A;  2X7Q A;  4KPT A;  2XXV A;  4QFP A;  3H6U A;  4QXD A;  1FRP A;  4DZ1 A;  2V84 A;  4YIC A;  2WYK A;  4OVT A;  3A3U A;  3VXB A;  4THI A;  2DOJ A;  1J1N A;  4PAF A;  3A09 A;  3I5O A;  5F7V A;  1GTK A;  4ZEK A;  3WAE A;  1NI9 A;  3A3C A;  3O29 A;  5LDZ A;  4QFO A;  4PFB A;  4BDL A;  3KSJ A;  4R9F A;  5EQ8 A;  4NF4 B;  3SZP A;  4MF3 A;  1LBC A;  2HAV A;  4AS5 A;  4P3L A;  4H8I A;  1HSJ A;  1NFT A;  3IB0 A;  3KFM A;  5I2K A;  4MNP A;  3OSR A;  3MYU A;  5CBR A;  4YMB A;  1VDW A;  5CBS A;  1KWH A;  1BP5 A;  3ONM A;  1QUI A;  1NV0 A;  1SPI A;  3MAM A;  2QS1 A;  2F36 A;  1Y4T A;  2B4M A;  2REJ A;  4LZ5 A;  1IEJ A;  4PBQ A;  1DTG A;  5ICT A;  1N3W A;  5AA1 A;  2DXY A;  3QIM A;  4P47 A;  1DTZ A;  1B3L A;  3K0V A;  4NE4 A;  1UIV A;  1IIT A;  2FIX A;  2QL3 A;  4N81 A;  5EQ7 A;  1VR5 A;  5B7D A;  3KGC A;  1GR2 A;  2DWI A;  1LBW A;  4ZEB A;  1P1W A;  2V3U A;  5CC2 A;  4MEV A;  2I4C A;  5CRY A;  2QSX A;  4PFI A;  1FJ6 A;  3KSX A;  3T1B A;  2GFE A;  2ANJ A;  4C1U A;  2DQV A;  2QVV A;  1NV4 A;  1D9V A;  2FYI A;  4EXK A;  4PFR A;  4XXU A;  4JSD A;  3PD9 A;  2L5V A;  1TWY A;  5H8Q A;  3FZV A;  3K1M A;  1NH8 A;  1MRP A;  1H45 A;  4PF8 A;  1IME A;  4G68 B;  1BKA A;  2LAO A;  4IR8 A;  2F3B A;  1B2H A;  3PUX E;  2I49 A;  3D1R A;  1EH3 A;  4EQB A;  1PC3 A;  1LB8 A;  1A8E A;  2O6A A;  1BLF A;  4OES A;  3TTL A;  4MX6 A;  2RIN A;  3T9U A;  2DXR A;  4JB7 A;  4HW8 A;  1JW5 A;  2RKM A;  4ZEC A;  1SYI A;  4GD5 A;  4GWU A;  1ELJ A;  4IO6 A;  1LEV A;  1MPC A;  3K1N A;  4QSE A;  1IUD A;  1NNK A;  5ET6 A;  2RC8 A;  2QS4 A;  2ZMB A;  2KLF A;  4I62 A;  1UTB A;  1MS7 A;  1H76 A;  3RUM A;  3T9X B;  1B3F A;  3HO7 A;  5H8F A;  2XWK A;  3L6G A;  3HN0 A;  1FTA A;  2Q89 A;  3F11 A;  2Y7I A;  3PPQ A;  4RPO A;  4FOR A;  1YAE A;  4HE2 A;  3D4G A;  4DXU A;  3DP4 A;  2B3B A;  2Q9T A;  1FBG A;  4O8M A;  2HAU A;  2XX9 A;  1LFH A;  2UVH A;  1EZP A;  4TLL B;  3PPP A;  5I84 A;  5I3S A;  1B1X A;  5AE4 A;  4F2Q A;  4GIZ A;  4EQ9 A;  2I3W A;  2DVZ A;  3GLB A;  2YLN A;  5CM6 A;  4HCW A;  1Q1K A;  4Q8R A;  5I59 B;  5IZZ A;  3FVO A;  4GL8 A;  1B5H A;  1XHY A;  4JVC A;  2A5T B;  3G3K A;  1LBZ A;  1IXG A;  4AQ4 A;  1AH5 A;  1UQW A;  4BDR A;  4U4S A;  3FUZ A;  3CSB A;  4YB6 A;  3K6X A;  1LFI A;  1SYH A;  4E0W A;  3Q27 A;  4N4U A;  1NUZ A;  4O3A A;  1N04 A;  4OET A;  2UVI A;  1B3H A;  1M5E A;  3PD8 A;  1QKB A;  1NV1 A;  5L8D A;  3H6V A;  2I0C A;  1XC1 A;  1IIW A;  1QVS A;  3BFT A;  4NAP A;  4YKK A;  2ONS A;  1NUY A;  2I48 A;  1G0I A;  3OEM A;  4EQ7 A;  1P1U A;  3LV0 A;  5JTY A;  3O97 A;  2F78 A;  1POY 1;  2HCA A;  1DSN A;  3O2A A;  4P1L A;  2PCR A;  2WBB A;  4N8Y A;  1NV5 A;  2O7U A;  5FHM A;  4BDN A;  4OXV A;  2XX7 A;  2VHA A;  2F34 A;  1IXH A;  4OEN A;  4AS4 A;  4IY6 A;  2PBW A;  1K9Z A;  4GFR A;  1FTJ A;  1IXI A;  3CHG A;  1Y20 A;  1NNP A;  3FV1 A;  2GQ1 A;  3EQ1 A;  1QUK A;  1PB7 A;  5CMM A;  4R9G A;  4I9D A;  4H5F A;  1H3D A;  3K01 A;  4OVR A;  3O6I A;  2DP8 A;  1FBD A;  5DVF A;  2V3T A;  3QUF A;  3FD3 A;  2DVC A;  3TQL A;  2XXX A;  4O3C A;  3M3K A;  4GQO A;  4NF4 A;  2QS2 A;  1PB8 A;  3T66 A;  2OWS A;  1JET A;  2PFZ A;  3OMB A;  1IMA A;  1FQB A;  1B3E A;  2XXY A;  3G3H A;  2VT5 A;  1Y9U A;  2ZNS A;  2CZL A;  2XWI A;  1UTH B;  4H6D A;  4DXC A;  1FQC A;  4OZ9 A;  3T9V A;  3CVG A;  3VV5 A;  1MXZ A;  2R71 A;  3T96 B;  1FQE A;  5I56 B;  4M4G A;  2HFB A;  4OEV A;  5H8N B;  4RJZ A;  4RPN A;  5H8H A;  1B0H A;  2X26 A;  4X48 A;  5I2N B;  4BDQ A;  1OMP A;  4JSO A;  3R7X A;  5A5X B;  1ZJL A;  1HSE A;  3RT8 A;  3MP8 A;  3QK6 A;  3DLN A;  3N26 A;  2NUV A;  1IMF A;  3MP1 A;  4YZZ A;  4P8B A;  4I40 A;  4MAG A;  3E13 X;  2CEY A;  1M5F A;  3R26 A;  1WOD A;  1FPI A;  2R8T A;  5I57 B;  3E9X A;  1D9Y A;  5IGA A;  5K2X A;  4XF5 A;  1B40 A;  3KOS A;  1AIV A;  3VLW A;  2FNC A;  3IOW A;  1MQJ A;  2DWH A;  1IZ1 A;  2XXI A;  4RNS A;  3IO4 A;  3U93 A;  4GVO A;  2WEF A;  2OWT A;  2ZZX A;  1P1Q A;  4PE5 B;  4DI3 D;  4G68 A;  2XXR A;  2OWZ A;  1A99 A;  5ICQ A;  3TMG A;  3UGW A;  1SW1 A;  4PQJ A;  2F35 A;  3UN6 A;  3Q28 A;  3VVF A;  1LAG E;  2I6E A;  3C32 A;  1N0T A;  4ECF A;  3OEK A;  4MIJ A;  5DVI A;  2UYF A;  3FVN A;  4EF2 A;  5DYH A;  4NF5 A;  1JEU A;  5HBC A;  5TU0 A;  4MHF A;  1SQY A;  3FV2 A;  2PVU A;  4MNI A;  3AXF A;  5EYG A;  2V4C A;  4G8M A;  1JNF A;  1A54 A;  4MJO A;  4LN5 A;  1UIU A;  3CIJ A;  3S4U A;  2HXR A;  3KN3 A;  4PET A;  3U92 A;  4IGR A;  1F9B A;  2UVJ A;  4QRZ A;  2XXQ A;  1Y4C A;  1N84 A;  2XXT A;  1OLC A;  4N13 A;  4N07 A;  3C36 A;  4YKP A;  4DCY A;  3H03 A;  4OTE A;  1MG1 A;  3IOT A;  3IB2 A;  1R1N A;  4GF8 A;  1MPB A;  3EF7 A;  1B05 A;  3RTW B;  4MH5 A;  4U2R A;  2H25 A;  3DEL B;  1QJM A;  3C34 A;  4PDH A;  3BIH A;  4YAH X;  1NL5 A;  4EXL A;  2WX9 A;  1OLA A;  4PTK A;  4KXP A;  4H0W A;  1A7L A;  5FHN A;  5AA4 B;  5BUU A;  4EDP A;  1IQ7 A;  4H46 A;  3QUJ A;  4OVQ A;  3EHS A;  5I59 A;  1JW4 A;  1JVX A;  4MMP A;  3ROJ A;  5BWJ A;  4ZDM A;  3IB1 A;  2QVR A;  3PPO A;  2Q8M A;  1RYX A;  2A5T A;  1MY4 A;  3TFL A;  2ZYO A;  3W15 C;  3QSL A;  4PCD A;  1FCK A;  4NN3 A;  1OIB A;  1A40 A;  2OK2 A;  4G8H A;  4KCC A;  2CZK A;  3H4Z A;  2Q2A A;  1B9J A;  2VGQ A;  3T22 A;  3U94 A;  3K4U A;  3OEN A;  4TLM B;  1FBE A;  4FEB A;  5EHS A;  1O64 A;  1QW0 A;  1BIY A;  1LCT A;  2UVG A;  1ATG A;  5I7I A;  1I6B A;  3V89 B;  1MXY A;  3IJO B;  1POT A;  1XT8 A;  1NUX A;  3MJN A;  2VD2 A;  2DDK A;  1QKA A;  2P3N A;  4N17 A;  1FBP A;  2CEX A;  5I5P A;  1JVY A;  3G3I A;  5DW8 A;  3SKP A;  3OEL A;  2FHY A;  5HM4 B;  1S7Y A;  3U72 A;  4IO7 A;  1OVT A;  1EZO A;  3PV0 E;  1IXC A;  3FXU A;  1Q35 A;  4OAN A;  2Y7P A;  4X9T A;  3TEP A;  1YTV A;  1DK4 A;  4NMY A;  2G29 A;  3DP8 A;  5EYH A;  1EYI A;  4FAJ A;  2OBG A;  1LLS A;  3BIG A;  1NH7 A;  3B50 A;  4PFY A;  1FPE A;  4QFL A;  4FAT A;  1N76 A;  1GV8 A;  2D21 A;  2X7P A;  2CMO A;  1URS A;  2R9J A;  1B51 A;  4OFJ A;  4XEQ A;  4DDD A;  5I58 B;  3JZJ A;  3SEW A;  1H43 A;  4TQU Q;  3G3G A;  1BK4 A;  5FTH A;  2DE2 A;  4OFL A;  2HHM A;  2P1S A;  3OXN A;  3MVW A;  1LAF E;  4PE3 A;  3TKD A;  3OO9 A;  2Q88 A;  2ALU A;  1O63 A;  1TXF A;  4MBP A;  3RY3 A;  4AB6 A;  4KR5 A;  5ITO A;  1A8F A; 
#chains in the Genus database with same CATH homology
 3TQW A;  1B4H A;  5EYF A;  2XD2 A;  1UTH A;  2DE3 A;  4XTC Q;  3MVX A;  3H6T A;  1MY1 A;  2Y7R A;  3LSW A;  1LB9 A;  5I56 A;  5H8N A;  2O1L A;  3OO7 A;  3BKI B;  3K6V A;  1B58 A;  1SDX A;  4EUO A;  1BTJ A;  3TDJ A;  4R6H A;  4IO5 A;  3G7W A;  4OEU A;  2PMS A;  4QFK A;  4ELO A;  4F19 A;  5A5X A;  2XXW A;  2ABH A;  4X1B A;  5AA3 A;  4PFW A;  4WEP A;  3PUW E;  1FTO A;  1Y3P A;  1M5B A;  1FW0 A;  4DE8 A;  1MQG A;  4JXI A;  4PP0 A;  3ILT B;  1HSL A;  4XKQ A;  3UOR A;  3MW0 A;  5I57 A;  3TTK A;  2Y84 A;  3S9M C;  2H99 A;  5KCJ B;  4F31 B;  1P99 A;  1MH4 A;  4RA1 A;  3MQ9 A;  4P0G A;  3GXA A;  4Q0C A;  1YPN A;  3B6T A;  3LR1 A;  1I6A A;  4F18 A;  2NWJ A;  4U22 A;  1OQH A;  1MXX A;  5DTB A;  3H6W A;  4OYV A;  2ZYM A;  2GHB A;  2XXH A;  3BBR A;  3MZ1 A;  1P1O A;  1US4 A;  2PT1 A;  1B52 A;  5TP9 B;  1Z7M E;  4GL0 A;  2OJT A;  3ZS6 A;  4HS7 A;  3TTR A;  2HXW A;  4P11 A;  4QHQ A;  3S2V A;  2HEU A;  3C35 A;  4L17 A;  1VFD A;  4IO3 A;  5JK4 A;  3C31 A;  1B3G A;  1B46 A;  3KN8 A;  3U8Q A;  4ELP A;  3GZG A;  2YJP A;  3LC8 A;  5B70 A;  2GH9 A;  2RC9 A;  3TCH A;  1LFG A;  1VE4 A;  5H8Q B;  1MQD A;  3SEY A;  5AA2 B;  1DPP A;  1NNT A;  2DSF A;  3KOT A;  4F22 A;  4LAT A;  3VFJ A;  3MBP A;  5CI5 A;  1AMF A;  2F6G A;  3GBA A;  3RNN A;  3L6H A;  1Y3Q A;  3OD7 A;  4WED A;  2F6P A;  4MFI A;  4ZED A;  3JV9 A;  4H5G A;  5IKB A;  2NOO A;  3O9P A;  1R6Z A;  2E1S A;  2I0B A;  3T9H B;  1S50 A;  5DVJ A;  4G68 C;  1XVY A;  4ESW A;  3ZSF A;  5H8S A;  2H98 A;  3PUY E;  1MXW A;  2Q2C A;  3I6V A;  3C9H A;  4LZ7 A;  4IO4 A;  2XHD A;  3SES A;  2V3Q A;  2ONR A;  4FED A;  2DYX A;  4AB5 A;  4ZE8 A;  4YKJ A;  4ZE9 A;  5AA4 A;  4DCX A;  3CFZ A;  4I8C A;  4H8J A;  2YPN A;  1PBQ A;  3PMX A;  1JW1 A;  1B5J A;  1ZIU A;  1OVB A;  2RCB A;  2IEE A;  4F1V A;  3USD A;  1NNF A;  2OLB A;  2B65 A;  4LZ8 A;  4POX A;  1SW2 A;  1ZBM A;  3Q29 A;  3UP9 A;  4RK2 A;  4NF8 B;  3TAJ A;  4X1D A;  3MUQ A;  1USY H;  1LAH E;  4GOT A;  4POW A;  3HHF A;  1FQD A;  4ZEF A;  2ZXT A;  2F7B A;  3K00 A;  4JBZ A;  4ZS9 A;  4KCD A;  5FHO A;  3TTN A;  4I1D A;  1WVJ A;  4KQP A;  2E0S A;  3FAS A;  3FJM A;  1Y1M A;  3IJX B;  2BJJ X;  3B6Q A;  4F3S A;  3TTM A;  3B7D A;  3VDF A;  2M8C A;  4LQ2 A;  4NF6 B;  3PUV E;  4RXL A;  5KZT A;  2HZL A;  4XKP A;  4OWD A;  4ELQ A;  1LCF A;  1B7U A;  3C33 A;  1ZMG A;  1L5T A;  2UYE A;  1MXV A;  3CI8 A;  3LUY A;  3R6U A;  1MDP 1;  2DE4 A;  3O28 A;  2O84 X;  4GRK A;  4C0R A;  4R6Y A;  2GRV A;  2F8D A;  5FTI A;  4FE8 A;  4QSC A;  2DWA A;  4F3G A;  4MLV A;  3P7I A;  3KG2 A;  3BFU A;  3FAT A;  2RCA A;  1SD3 A;  4QSD A;  1Z7N E;  5I58 A;  1FTL A;  3IR1 A;  4Q5T A;  4F3P A;  4R2F A;  1PB9 A;  5ISU A;  3IK6 B;  4RYA A;  5EHM A;  1TT1 A;  4Z7E A;  2XD3 A;  2V93 A;  1R9L A;  4OHN A;  2DS9 A;  1N7X A;  3DP6 A;  3N6T A;  2XXP A;  2Q8J A;  3VXC A;  3PPR A;  5DEX B;  3S9L C;  2NVU B;  5AA2 D;  4LVQ A;  3FXQ A;  3JYR A;  3LBS A;  4OQO A;  3HCQ A;  3KZG A;  2Y7K A;  4Z0I A;  4GXA A;  2F7A A;  2HQ0 A;  1SI0 A;  1VSO A;  1A55 A;  3I3V A;  4LQ5 A;  3HPI A;  2QMW A;  3IAZ A;  2I58 A;  3RLF E;  4E0X A;  4DXB A;  1CE2 A;  3KEI A;  2QS3 A;  1US5 A;  2AYS A;  4YB5 A;  3OSQ A;  3SDF A;  4ND9 A;  1AOV A;  3OO6 A;  4LON B;  1M5D A;  5KCJ A;  3KJT A;  3KN7 A;  3SEX A;  1PBP A;  3ZKK A;  3IOU A;  4GXS B;  3W9V A;  2GHA A;  3MP6 A;  5H8H B;  1Y3N A;  3H3G A;  4NED A;  4R72 A;  4RY1 A;  3TEL A;  1USY E;  1FTK A;  2FA7 A;  5TP9 A;  4GLI A;  4WXJ A;  1Y1Z A;  1OQG A;  1ZKB A;  4O3B A;  2PT2 A;  2AL5 A;  3QAX A;  2D5W A;  2R6G E;  1RYO A;  3EHU A;  5TPA B;  2QRY A;  3D4C A;  1SI1 A;  3LSL A;  3TYH A;  2WKY A;  3MZ9 A;  1B0L A;  3B6W A;  4GWO A;  4NWD A;  3ILU B;  3EPE A;  2H4I A;  4OMB A;  3PMW A;  1FQF A;  4XKR A;  1B5I A;  2B3F A;  4XKN A;  3TPA A;  2ZNU A;  3V83 A;  4KHZ E;  3KJ7 A;  4R74 A;  5CMK A;  2ZYK A;  1ZU0 A;  4IGT A;  3RPW A;  3HV1 A;  5AA2 A;  3M3L A;  4N6P A;  3PPN A;  3CG3 A;  3WAF A;  1MY2 A;  4IB2 A;  4KFQ A;  1CB6 A;  1H44 A;  3H06 B;  3IL1 B;  4U1O A;  3C4M A;  1D4N A;  1EU8 A;  2F7C A;  4R73 A;  2A5S A;  1ZTY A;  3U1O A;  2ESN A;  5KDT B;  2ONK E;  4H1X A;  3N6U A;  4NF5 B;  3FGS A;  3FIR A;  4G77 A;  3EN3 A;  2P2A A;  4IY5 A;  2W7Y A;  3Q26 A;  2Z23 A;  1XOC A;  1MPD A;  3M3F A;  2VP1 A;  3VE1 B;  4UA8 A;  3ODB A;  4JWY A;  3QYT A;  4ESX A;  2AIX A;  1MDQ A;  5HPQ A;  1QUJ A;  4BDM A;  3SET A;  3CSG A;  1DMB A;  4ZZA A;  4OVJ A;  3PUZ E;  2PX1 A;  5L9M A;  1P1N A;  2XX8 A;  2QJE A;  4BLA A;  5DT6 A;  4KYE A;  3PU5 A;  4IO2 A;  2Z8D A;  5I2N A;  1TFA A;  2OZZ A;  2F97 A;  4XIG Q;  3IO6 A;  4QFN A;  4HCY A;  2OCU A;  2VD3 A;  4NF8 A;  4FJP A;  3FVK A;  3O6H A;  4G4P A;  3THI A;  1SW5 A;  3FVG A;  3RTF B;  3MPK A;  2Z22 A;  3H7M A;  3S9N C;  3V5A A;  4F1Y A;  4DIG A;  4TOZ A;  2DWJ A;  5I2K B;  4PFT A;  4BDO A;  1DOT A;  4KD5 A;  1URG A;  3FJ7 A;  4KYS A;  1MY3 A;  2O69 A;  2Z8F A;  4NF6 A;  5L9S A;  4K3F A;  4JWX A;  1N7W A;  4G2Z A;  1R9Q A;  1YCJ A;  1QUL A;  1MQI A;  3S9E A;  3TZA A;  3FJG A;  1EZ9 A;  3ECR A;  3E4R A;  4LUB A;  4RK9 A;  4F3B A;  3IOV A;  2D3I A;  1NMU A;  3OO8 A;  1M5C A;  2VOZ A;  5K2Y A;  2G93 A;  2UXA A;  4YKI A;  3K6W A;  2H9B A;  3LSF B;  4YB7 A;  3SEU A;  1PDA A;  3PMV A;  4F39 A;  3V8X B;  3TCF A;  1ZLQ A;  3N94 A;  2REG A;  1PEB A;  4JDF A;  1MY0 A;  3MWB A;  4UAC A;  4Q30 B;  3VLU A;  3VVE A;  1JEV A;  1FTM A;  3RT6 B;  1I6Q A;  4HTG A;  4JWO A;  5JEI A;  4KYD A;  3O66 A;  3SER A;  2ZNT A;  4FEC A;  3T93 B;  2PYY A;  5DEX A;  3SEV A;  1JQF A;  3N5L A;  3Q25 A;  3DM0 A;  1LAX A;  3ZKL A;  3UIF A;  4U4X A;  5CMB A;  3CFX A;  1SBP A;  1GVC A;  3RQT A;  1GGG A;  1T0K A;  1VFE A;  4ELR A;  4F2O A;  2Y7W A;  3CRB A;  3KBR A;  1LGB C;  2O1M A;  3RN8 A;  4LA9 A;  3K02 A;  4FIM A;  5IAI A;  4OER A;  2IA4 A;  4H65 A;  1MM6 A;  3CG1 A;  4C1T A;  1UTB B;  4G8N A;  4YMA A;  2HZK A;  1S9T A;  4U1Z A;  3G3F A;  1AL3 A;  1FQA A;  5H8F B;  3K6U A;  1D3K A;  1TFD A;  2H5Y A;  2Z8E A;  3IX1 A;  4NTL A;  4KI0 E;  2O51 A;  2QPQ A;  3MZB A;  1B1H A;  3HHG A;  3HST A;  1MQH A;  1I69 A;  1SW4 A;  3G3J A;  2RF1 A;  1XVX A;  1NKX A;  3E3K A;  1LST A;  4F29 A;  4WKM A;  3OOA A;  3FXR A;  1N3X A;  4P0I A;  3CR9 A;  2ZYN A;  3W9W A;  5F1Q A;  3CFL A;  4DLD A;  2F5X A;  5CMC A;  4H67 A;  4MLQ A;  4U21 A;  4ONY A;  5TPA A;  3VLV A;  3LSX A;  4F1U A;  1RKM A;  4PFU A;  1O7T A;  2V25 A;  2XXU A;  3K1P A;  5LOM A;  4LP2 B;  4R6K A;  1ANF A;  4R75 A;  3GBB A;  2NXO A;  3UA8 A;  5ELV A;  5J1D A;  3RGY A;  2RC7 A;  4ZZE A;  5L9O A;  2O7I A;  3VVD A;  3M8U A;  1B7H A;  1II5 A;  5M2V A;  1URD A;  2AL4 A;  1LBB A;  1MH3 A;  1B32 A;  1DPE A;  2O68 A;  2I3V A;  1B6H A;  2THI A;  4NWC A;  3MC2 A;  3MPL A;  4ISU A;  4QF9 A;  3UK4 A;  4ZEI A;  3TCG A;  3MVY A;  1XS5 A;  1B4Z A;  3TOD A;  5JTY B;  5KDT A;  1SVX B;  4M1V A;  4YU0 A;  3K2D A;  5ITP A;  3EHT A;  3MVZ A;  1MXU A;  1WDN A;  4R2B A;  4U23 A;  2QMX A;  1MM7 A;  3IOR A;  3TUS A;  2P0S A;  3O6G A;  4EF1 A;  4OFO A;  1B7Z A;  3QXM A;  3PGF A;  2I4B A;  2X7Q A;  4KPT A;  2XXV A;  4QFP A;  3H6U A;  4DZ1 A;  2V84 A;  4YIC A;  3A3U A;  3VXB A;  4THI A;  2DOJ A;  1J1N A;  3A09 A;  3I5O A;  5F7V A;  1GTK A;  4ZEK A;  3WAE A;  3A3C A;  3O29 A;  4QFO A;  4BDL A;  3KSJ A;  4R9F A;  4NF4 B;  4MF3 A;  1LBC A;  2HAV A;  4H8I A;  1HSJ A;  1NFT A;  3IB0 A;  3KFM A;  5I2K A;  3OSR A;  5CBR A;  4YMB A;  5CBS A;  1KWH A;  1BP5 A;  3ONM A;  1QUI A;  3MAM A;  2QS1 A;  2F36 A;  1Y4T A;  2REJ A;  4LZ5 A;  1IEJ A;  1DTG A;  5ICT A;  1N3W A;  5AA1 A;  2DXY A;  3QIM A;  1DTZ A;  1B3L A;  3K0V A;  4NE4 A;  1UIV A;  1IIT A;  2QL3 A;  1VR5 A;  5B7D A;  3KGC A;  1GR2 A;  2DWI A;  4ZEB A;  1P1W A;  2V3U A;  5CC2 A;  2I4C A;  5CRY A;  2QSX A;  3KSX A;  2GFE A;  2ANJ A;  4C1U A;  2DQV A;  1D9V A;  2FYI A;  4EXK A;  4XXU A;  4JSD A;  3PD9 A;  1TWY A;  5H8Q A;  3FZV A;  3K1M A;  1NH8 A;  1MRP A;  1H45 A;  4G68 B;  1BKA A;  2LAO A;  1B2H A;  3PUX E;  2I49 A;  1EH3 A;  4EQB A;  1PC3 A;  1LB8 A;  1A8E A;  2O6A A;  1BLF A;  4OES A;  3TTL A;  2RIN A;  3T9U A;  2DXR A;  4JB7 A;  4HW8 A;  1JW5 A;  2RKM A;  4ZEC A;  1SYI A;  4GD5 A;  1ELJ A;  4IO6 A;  1MPC A;  3K1N A;  4QSE A;  1IUD A;  1NNK A;  2RC8 A;  2QS4 A;  2ZMB A;  2KLF A;  4I62 A;  1UTB A;  1MS7 A;  1H76 A;  3RUM A;  3T9X B;  1B3F A;  3HO7 A;  5H8F A;  3L6G A;  3HN0 A;  2Q89 A;  3F11 A;  2Y7I A;  3PPQ A;  4RPO A;  4FOR A;  1YAE A;  3D4G A;  4DXU A;  3DP4 A;  2B3B A;  2Q9T A;  2HAU A;  2XX9 A;  1LFH A;  2UVH A;  1EZP A;  4TLL B;  3PPP A;  5I84 A;  1B1X A;  5AE4 A;  4F2Q A;  4GIZ A;  4EQ9 A;  2I3W A;  2DVZ A;  3GLB A;  2YLN A;  5CM6 A;  4HCW A;  1Q1K A;  4Q8R A;  5I59 B;  3FVO A;  4GL8 A;  1B5H A;  1XHY A;  2A5T B;  3G3K A;  1IXG A;  4AQ4 A;  1AH5 A;  1UQW A;  4BDR A;  4U4S A;  3FUZ A;  3CSB A;  4YB6 A;  3K6X A;  1LFI A;  1SYH A;  4E0W A;  3Q27 A;  4O3A A;  1N04 A;  4OET A;  2UVI A;  1B3H A;  1M5E A;  3PD8 A;  1QKB A;  5L8D A;  3H6V A;  2I0C A;  1XC1 A;  1IIW A;  1QVS A;  3BFT A;  4YKK A;  2ONS A;  2I48 A;  3OEM A;  4EQ7 A;  1P1U A;  5JTY A;  3O97 A;  2F78 A;  1POY 1;  2HCA A;  1DSN A;  3O2A A;  2O7U A;  5FHM A;  4BDN A;  4OXV A;  2XX7 A;  2VHA A;  2F34 A;  1IXH A;  4OEN A;  4IY6 A;  2PBW A;  4GFR A;  1FTJ A;  1IXI A;  1Y20 A;  1NNP A;  3FV1 A;  3EQ1 A;  1QUK A;  1PB7 A;  5CMM A;  4R9G A;  4I9D A;  4H5F A;  1H3D A;  3K01 A;  3O6I A;  2DP8 A;  5DVF A;  2V3T A;  3QUF A;  3FD3 A;  2DVC A;  3TQL A;  2XXX A;  4O3C A;  3M3K A;  4GQO A;  4NF4 A;  2QS2 A;  1PB8 A;  3T66 A;  2OWS A;  1JET A;  3OMB A;  1FQB A;  1B3E A;  2XXY A;  3G3H A;  1Y9U A;  2ZNS A;  2CZL A;  1UTH B;  4H6D A;  4DXC A;  1FQC A;  4OZ9 A;  3T9V A;  3CVG A;  3VV5 A;  1MXZ A;  2R71 A;  3T96 B;  1FQE A;  5I56 B;  4M4G A;  2HFB A;  4OEV A;  5H8N B;  4RJZ A;  4RPN A;  5H8H A;  1B0H A;  2X26 A;  4X48 A;  5I2N B;  4BDQ A;  1OMP A;  4JSO A;  3R7X A;  5A5X B;  1ZJL A;  1HSE A;  3RT8 A;  3MP8 A;  3QK6 A;  3DLN A;  3N26 A;  2NUV A;  3MP1 A;  4YZZ A;  3E13 X;  1M5F A;  3R26 A;  1WOD A;  5I57 B;  3E9X A;  1D9Y A;  5K2X A;  1B40 A;  3KOS A;  1AIV A;  3VLW A;  2FNC A;  3IOW A;  1MQJ A;  2DWH A;  1IZ1 A;  2XXI A;  4RNS A;  3IO4 A;  3U93 A;  4GVO A;  2OWT A;  1P1Q A;  4PE5 B;  4G68 A;  2XXR A;  1A99 A;  5ICQ A;  3TMG A;  3UGW A;  1SW1 A;  4PQJ A;  2F35 A;  3UN6 A;  3Q28 A;  3VVF A;  1LAG E;  2I6E A;  3C32 A;  1N0T A;  4ECF A;  3OEK A;  5DVI A;  2UYF A;  3FVN A;  4EF2 A;  5DYH A;  4NF5 A;  1JEU A;  5HBC A;  5TU0 A;  1SQY A;  3FV2 A;  2PVU A;  3AXF A;  4G8M A;  1JNF A;  1A54 A;  1UIU A;  3CIJ A;  3S4U A;  3KN3 A;  4PET A;  3U92 A;  4IGR A;  1F9B A;  2UVJ A;  4QRZ A;  2XXQ A;  1Y4C A;  1N84 A;  2XXT A;  1OLC A;  4YKP A;  4N13 A;  4DCY A;  3C36 A;  4N07 A;  3H03 A;  4OTE A;  1MG1 A;  3IOT A;  3IB2 A;  1R1N A;  4GF8 A;  1MPB A;  3EF7 A;  1B05 A;  3RTW B;  4MH5 A;  4U2R A;  2H25 A;  3DEL B;  1QJM A;  3C34 A;  4YAH X;  1NL5 A;  4EXL A;  1OLA A;  4H0W A;  1A7L A;  5FHN A;  5AA4 B;  5BUU A;  4EDP A;  1IQ7 A;  3QUJ A;  3EHS A;  5I59 A;  1JW4 A;  1JVX A;  5BWJ A;  4ZDM A;  3IB1 A;  3PPO A;  1RYX A;  2A5T A;  1MY4 A;  3TFL A;  2ZYO A;  3W15 C;  3QSL A;  1FCK A;  1OIB A;  1A40 A;  2OK2 A;  4G8H A;  4KCC A;  3H4Z A;  2Q2A A;  1B9J A;  2VGQ A;  3T22 A;  3U94 A;  3K4U A;  3OEN A;  4TLM B;  4FEB A;  5EHS A;  1O64 A;  1QW0 A;  1BIY A;  1LCT A;  2UVG A;  1ATG A;  1I6B A;  3V89 B;  1MXY A;  3IJO B;  1POT A;  1XT8 A;  3MJN A;  2VD2 A;  1QKA A;  1JVY A;  3G3I A;  3SKP A;  3OEL A;  5HM4 B;  1S7Y A;  3U72 A;  4IO7 A;  1OVT A;  1EZO A;  3PV0 E;  1IXC A;  3FXU A;  1Q35 A;  2Y7P A;  4X9T A;  3TEP A;  1YTV A;  4NMY A;  2G29 A;  3DP8 A;  4FAJ A;  2OBG A;  1LLS A;  1NH7 A;  4PFY A;  4QFL A;  4FAT A;  1N76 A;  1GV8 A;  2D21 A;  2X7P A;  2CMO A;  1URS A;  2R9J A;  1B51 A;  4OFJ A;  4DDD A;  5I58 B;  3JZJ A;  3SEW A;  1H43 A;  4TQU Q;  3G3G A;  5FTH A;  2DE2 A;  4OFL A;  2P1S A;  3OXN A;  3MVW A;  1LAF E;  3TKD A;  3OO9 A;  2Q88 A;  2ALU A;  1O63 A;  1TXF A;  4MBP A;  3RY3 A;  4AB6 A;  4KR5 A;  5ITO A;  1A8F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...