4C1UA

Structure of the xylo-oligosaccharide specific solute binding protein from bifidobacterium animalis subsp. lactis bl-04 in complex with arabinoxylobiose
Total Genus 137
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
137
sequence length
396
structure length
396
Chain Sequence
DDKTITFWHNASAGEGRQYWENLAKSFEEANPGTKVEIQAIQNEDFAGKLQTAMQDPASGPDVFMSLGGAKTKEMIDAGQVMDLTDKISDTVKTDMKTTLSAATFDGKVYGVPVSVEPGGMWYSKDLFKKAGVSDVPATYEELLADAKKLKDSGTDAIALGAKDAWPAAHWYYWLVLRECSPEVYDKSVQDHDFSNACWVNAGKKLQELKDLKVFNDGFLTTTAQQGANSSAGLLANHKAAMELMGAWEPGVLKDLTPDQKPMADLGFFAFPEVAGGEGEPGALMGGVTYFCVNPKASQTSIDFVNYMGEKKNQEDYAKAFSTIPASEPARAVVTDESLKQVIEYLDKAPSMQLWMDTALGTNIGNALNAAVVNMLSGQGSPEDIVKAMQDAAQKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for Arabinoxylo-Oligosaccharide Capture by the Probiotic Bifidobacterium Animalis Subsp. Lactis Bl-04
pubmed doi rcsb
molecule keywords SUGAR TRANSPORTER SOLUTE-BINDING PROTEIN
source organism Bifidobacterium animalis subsp. lactis bl-04
molecule tags Transport protein
total genus 137
structure length 396
sequence length 396
ec nomenclature
pdb deposition date 2013-08-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4c1uA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4c1uA02
3BBRA 3W9WA 4MF3A 1UTHA 1FTOA 1ZKBA 4OQOA 3OELA 4FEDA 1MXVA 4KI0E 3QSLA 4PFWA 2YJPA 5AA2D 1B32A 1FTJA 4WEPA 2QJEA 4TQUQ 2LAOA 4G77A 3MVYA 5AA3A 4NF5A 4PFYA 3B6TA 1HSLA 2QMXA 3TCGA 1AH5A 3LUYA 3CIJA 4EQ7A 1NMUA 2NVUB 4MLVA 3T9UA 4OERA 5AA4B 3EQ1A 4GQOA 4GVOA 4NWCA 2REJA 2I58A 4YMAA 3KZGA 3QAXA 3U1OA 3N5LA 2Z22A 3K1MA 3HN0A 4C1TA 4DXBA 4RK9A 2QS4A 3IOWA 2I3VA 5TU0A 4PE5B 2XXWA 1CE2A 4ELPA 1XS5A 4KYDA 3M8UA 3WAFA 2Q2CA 1LBCA 3TTMA 2GH9A 1PEBA 2ZYKA 1IXGA 3GBBA 4BDMA 2W7YA 2UYFA 3TTKA 1MRPA 4UA8A 1B05A 3K02A 2B3BA 1B58A 3N26A 1B7HA 1SYIA 2DWHA 3IB0A 3E3KA 1PBPA 2V84A 3GBAA 1TWYA 3KBRA 1F9BA 2PX1A 3LC8A 2F7AA 2Z8DA 4POXA 5EHSA 2H9BA 5FHOA 5CMMA 4GOTA 3CR9A 5H8FA 4GXAA 5TPAA 3Q27A 3FXQA 3OO9A 2B3FA 2XXRA 1MXYA 2Y7IA 4OXVA 1FQAA 1NNKA 3PUWE 4U4SA 2HZKA 3L6GA 3LBSA 3TUSA 1MH4A 2OZZA 3PUVE 3R6UA 5HPQA 1LAFE 3MAMA 3IOVA 4E0WA 4XTCQ 2I48A 4O3BA 4QFNA 1NFTA 1FQCA 4TOZA 3DM0A 3C4MA 2R6GE 4F2OA 1QKAA 2ZNTA 4DE8A 4TLMB 3H3GA 4LUBA 2G93A 3LSXA 3G3FA 4R72A 5TPAB 2XXPA 2DXYA 2XXQA 4F22A 4F1YA 1JW4A 2I0BA 1LLSA 1B7ZA 5KZTA 4R2FA 2F5XA 4M1VA 5FHMA 4DZ1A 3IL1B 1UTBB 3TCHA 1SW5A 2BJJX 3QUJA 3MP6A 3P7IA 4I1DA 3CSBA 4H0WA 4IO3A 3T22A 2P2AA 4F2QA 1NNFA 3TTLA 2ZNSA 1B5JA 2QS3A 4JWYA 4YZZA 1VR5A 2GHAA 2ZNUA 1MQGA 2NWJA 3ILTB 4GLIA 4MLQA 5L9SA 4H67A 1FCKA 1QVSA 2DP8A 1A7LA 4U1ZA 2D3IA 2GFEA 1N7WA 2ZYMA 3TCFA 3O28A 4NF4A 1SI0A 1MPCA 3TEPA 4FEBA 4NF8A 1QULA 3MC2A 1Y3PA 5DVJA 3VXBA 1AIVA 3S9EA 3KN3A 4ZECA 1Y20A 1O7TA 5H8HA 4NTLA 3UGWA 4KYSA 1II5A 3VVEA 4YB7A 1USYE 2PBWA 2UXAA 4AB6A 1B2HA 2OBGA 1R1NA 3K4UA 3A3UA 3V83A 1B5IA 4R74A 1MY0A 4KPTA 5I58B 1MQIA 3VV5A 2HAUA 4OFLA 2Z23A 1DPPA 5I2KB 4PP0A 3IO6A 3QUFA 3THIA 4TLLB 4YB5A 3PPQA 3W9VA 4NF4B 5KDTA 2Q89A 5I56A 2G29A 3DLNA 4R9GA 3K6WA 1IXCA 4AQ4A 4F1UA 3IJXB 2AL4A 3CFZA 1MQDA 3G3HA 3G7WA 5H8HB 2HZLA 4QFOA 4P0GA 3ZSFA 3FGSA 5ITOA 4X9TA 3V8XB 4LP2B 1DSNA 4R2BA 2O7IA 3FVKA 3G3JA 1YCJA 2F7BA 4DCXA 1PDAA 4YAHX 1NL5A 1A8FA 3IJOB 1UQWA 1I6AA 4KR5A 3C9HA 2OCUA 3M3KA 2CZLA 1T0KA 1R9LA 4JSOA 4BDLA 1R9QA 2QPQA 4F3PA 4F19A 2UYEA 5I56B 3WAEA 5CI5A 1S50A 3MJNA 1NKXA 1VFDA 3SKPA 4QSDA 1NNPA 4EF1A 5I2NB 2F97A 2NXOA 2AIXA 3MPLA 1BP5A 2HAVA 4DXUA 4H65A 3K0VA 2OWTA 4FE8A 5FTHA 4OENA 4RYAA 2Z8FA 3MBPA 1OLAA 1N3XA 5DEXA 1USYH 1B6HA 5JK4A 4YKPA 5CMBA 1MXWA 1N84A 3EHUA 4FIMA 1ZJLA 4FORA 2H98A 2XD3A 3MWBA 3ZKKA 1BTJA 4RPOA 3KOTA 2UVIA 3QIMA 5FTIA 3U94A 5BWJA 4IO2A 4ZE8A 1LB9A 2GRVA 3O6GA 3KFMA 4F1VA 3MVZA 1UIUA 2XX8A 2KLFA 1D9YA 3B6QA 1NH8A 4JSDA 3N94A 1NH7A 4YU0A 3O29A 5CMKA 3PPRA 3TQLA 2HEUA 1B3FA 4U2RA 4JXIA 5DTBA 4IY6A 3SEXA 2VHAA 5I57B 4EDPA 5AA2B 4EXKA 1QUKA 3AXFA 3LSWA 1A99A 1B4ZA 1Y3QA 5IKBA 1Q1KA 4I8CA 3PUYE 1BIYA 4FATA 1L5TA 3H4ZA 3K6VA 5EHMA 1JEVA 4BDNA 3ONMA 1FQEA 3FV2A 5M2VA 4RNSA 3FJ7A 4RK2A 1DMBA 2XXHA 1P1OA 1OVTA 2F78A 1POY1 2A5TA 4P0IA 3G3IA 2HCAA 3KOSA 4WKMA 3E9XA 2HFBA 3ODBA 1FQBA 1BLFA 3IK6B 4N13A 5HBCA 3PPPA 4G2ZA 2F6PA 1SI1A 3K6UA 3VFJA 1ATGA 2XX7A 3HCQA 2D5WA 1P1QA 2OWSA 1AOVA 3SEVA 3VLWA 1Y3NA 1UTHB 3RT8A 5L8DA 4OEVA 1D3KA 1H45A 3IB1A 3E4RA 2ESNA 3OXNA 3HSTA 2I3WA 2D21A 4PFUA 4NF5B 3QXMA 1A8EA 2V25A 3DELB 3EHTA 1OLCA 5ISUA 1H43A 2HQ0A 3A09A 4L17A 5DYHA 1LAGE 2THIA 1B9JA 1EU8A 3OENA 2DE2A 3OEMA 3K1NA 4OETA 2UVHA 2DVCA 4ZDMA 3PMVA 4ZS9A 2XX9A 2ZXTA 3L6HA 4KFQA 3VVFA 3MVXA 4GRKA 4YICA 3U72A 4FJPA 4QFPA 3KJ7A 3RY3A 4Q30B 4ZEIA 1MDQA 4OZ9A 3CFXA 3VLVA 4EF2A 4BDQA 1VE4A 5H8NA 5A5XA 3FUZA 3Q26A 4FAJA 2ONSA 3T9VA 4ELOA 2H25A 1YTVA 4U23A 3UA8A 3OEKA 2XXVA 1ZMGA 5HM4B 2DXRA 1WDNA 4JWXA 4RJZA 5CRYA 2ABHA 1FQFA 3KSJA 4KYEA 2E1SA 3U93A 4ELQA 1MQJA 1EZOA 2UVJA 3RT6B 2DVZA 5F1QA 3LSLA 3H6TA 2I0CA 4LQ5A 4ZZAA 3TODA 2AYSA 3S2VA 4GFRA 3KSXA 1XC1A 3RN8A 1PB8A 4QFLA 3FXUA 1LAXA 3KGCA 5H8NB 5A5XB 2OJTA 1B3HA 4LZ7A 3K1PA 4F31B 5H8FB 1IZ1A 3VDFA 2I4CA 4R6YA 2H4IA 2ONRA 3RGYA 3RQTA 3T96B 3EF7A 3RNNA 3QYTA 5L9OA 3R26A 1I6QA 2F6GA 3TDJA 4EUOA 1AMFA 3FVGA 4GIZA 3MZBA 4GD5A 3S4UA 2O84X 3PD9A 1EZPA 1WVJA 2V3QA 1M5EA 4EXLA 2V3UA 2XXUA 4F18A 3FVNA 4OFOA 3TZAA 3SESA 1O63A 3FV1A 1FW0A 4ONYA 2B65A 4KHZE 5I59A 2Q88A 2DE4A 1SVXB 2RINA 3IAZA 4NEDA 1JW5A 4K3FA 2X7QA 4HTGA 1MH3A 3RTWB 3KN7A 3O6IA 4FECA 3MZ1A 4YB6A 4NF6A 1M5DA 3S9NC 2X26A 4X1BA 4OYVA 2FNCA 3HHGA 5DVFA 4BLAA 3CG1A 4UACA 4DXCA 1MPDA 4IY5A 3USDA 2GHBA 4EQBA 2XXXA 4LZ5A 1LAHE 2I6EA 1J1NA 3RLFE 5I59B 1B3EA 4E0XA 3TMGA 3D4GA 4HW8A 3B7DA 3IO4A 3KEIA 1SW4A 4KCDA 3PPNA 4OEUA 2VD3A 4ZEKA 4QSEA 4HCWA 4ZEFA 4RXLA 1O64A 4R75A 5IAIA 1NNTA 3C34A 3CRBA 3EPEA 5J1DA 2REGA 1N7XA 4PETA 2ZYOA 3TTNA 1IQ7A 2ANJA 1MXUA 2F35A 4LATA 4RA1A 5H8QA 4F29A 3H7MA 1QKBA 4NF8B 2RKMA 5B7DA 2M8CA 1B51A 1QJMA 1MQHA 3FJMA 3VLUA 4OVJA 1TFAA 3C35A 4Z7EA 2PMSA 4OHNA 4MBPA 4XIGQ 2IA4A 3SDFA 1MPBA 4ZEBA 3TKDA 4XXUA 2F34A 3JYRA 3OO7A 1N76A 2O51A 1MY3A 4F3SA 1FTMA 4H8JA 3T9XB 5CBSA 1FQDA 3BFTA 4ESXA 5H8QB 5KDTB 2ONKE 3UIFA 1JVXA 4U4XA 2QSXA 4H1XA 4RPNA 4I62A 3Q28A 1D4NA 3VVDA 2DQVA 1DOTA 4GXSB 3FZVA 2Q8JA 2NOOA 3T9HB 1MY2A 1CB6A 1JVYA 4JBZA 3TTRA 2O6AA 3H6VA 2Y7WA 1SW1A 4RY1A 1HSJA 2I49A 4U22A 3IORA 3A3CA 1B40A 4QFKA 5ICQA 1PC3A 3PPOA 3V5AA 3GZGA 4F3GA 1EH3A 4DCYA 1QUJA 3R7XA 3JV9A 1RKMA 1OVBA 1SD3A 1H3DA 4YKJA 1FTKA 4QHQA 4HS7A 3RTFB 3PU5A 5DEXB 3SEUA 3PUXE 4XKRA 4NMYA 3FASA 1MM7A 4IO7A 2F36A 3KJTA 3PV0E 1N3WA 3K6XA 1US5A 1JEUA 1RYOA 1AL3A 3C36A 3T93B 4PFTA 4QRZA 3IOTA 4H6DA 2ALUA 3H6WA 3O97A 2H99A 5DVIA 1B1XA 3IOUA 1IXHA 4LQ2A 4LONB 2O7UA 3BKIB 2O69A 1PB9A 3FVOA 2QS1A 4AB5A 2A5SA 4O3CA 4DIGA 1Y4CA 4KD5A 4OESA 4C0RA 4POWA 3GLBA 1XHYA 1P99A 2Z8EA 4P11A 5AA4A 4F3BA 1TFDA 3K00A 1LFIA 3BFUA 2YPNA 3C31A 2Y7RA 1VFEA 2PVUA 3O9PA 2RF1A 1IIWA 4ND9A 4NWDA 4Q8RA 4U1OA 3F11A 1MS7A 3UN6A 1B0HA 3CSGA 1JNFA 1ZTYA 5DT6A 3PMWA 3UORA 1Y9UA 2P1SA 5CM6A 1MG1A 3MP8A 2F8DA 3LSFB 2DWJA 5B70A 1US4A 3OO6A 3TYHA 3FD3A 1IUDA 1SBPA 4YKKA 4MH5A 3IX1A 2A5TB 3FXRA 1MXZA 3SEYA 4G8NA 2IEEA 2DSFA 3H06B 3KN8A 1DTGA 2FA7A 3ZKLA 1LB8A 3Q29A 5K2YA 5LOMA 1TXFA 1IITA 4DLDA 2PT1A 1OQGA 4H8IA 4N6PA 2HXWA 3M3LA 2O1MA 3CVGA 3OD7A 4WEDA 4O3AA 5H8SA 1LSTA 2PT2A 5ELVA 1B5HA 3GXAA 3ILUB 1Z7NE 1H44A 4XKQA 4IO4A 4R6KA 1XVYA 3UK4A 1URSA 1PBQA 4ZE9A 1KWHA 2X7PA 4GF8A 3ECRA 3N6UA 5CBRA 1LCFA 4PQJA 1HSEA 2XXYA 3G3GA 1BKAA 4OWDA 3PD8A 3HHFA 4GL8A 1Y1ZA 3W15C 1VSOA 1MXXA 3VE1B 4XKNA 4OTEA 4JB7A 1LCTA 2PYYA 3OSQA 3FIRA 1IEJA 4G8HA 4YKIA 1S9TA 3MP1A 2DYXA 3G3KA 3O66A 5L9MA 2OK2A 3HPIA 1JQFA 1UTBA 2UVGA 2NUVA 3PMXA 2Q2AA 1B52A 4F39A 4ISUA 3QK6A 4R73A 3O2AA 3HV1A 4G8MA 2RCBA 1SDXA 1LGBC 3MZ9A 1UIVA 5I84A 1M5BA 4THIA 1OQHA 4ZEDA 4LZ8A 4QSCA 4M4GA 3EHSA 3DP8A 4LVQA 2CMOA 3O6HA 3D4CA 2YLNA 4N07A 4YMBA 4GWOA 2QMWA 4X1DA 1I69A 1A55A 5TP9A 3C32A 2RC7A 2DE3A 3S9MC 1IXIA 1P1NA 4NE4A 1A40A 4KQPA 3IB2A 2Y84A 1PB7A 3V89B 2XD2A 1WODA 4X48A 3TFLA 1D9VA 1OMPA 1B46A 1URDA 1ZIUA 3DP4A 3MUQA 1B7UA 4Q0CA 1M5FA 2VP1A 3U8QA 5I58A 1Y1MA 1ELJA 5I2KA 1H76A 1GGGA 1Z7ME 2QRYA 4Q5TA 1GR2A 4LA9A 1XVXA 4IGTA 4Z0IA 3CI8A 1TT1A 5TP9B 3RUMA 1LFGA 4ZZEA 3S9LC 5ITPA 5ICTA 3B6WA 1MY4A 1ANFA 4H5GA 3IR1A 2R71A 3RPWA 4NF6B 4EQ9A 2VOZA 4XKPA 2P0SA 1QW0A 4GL0A 3EN3A 2RC9A 5EYFA 2XHDA 2H5YA 1Y4TA 3H6UA 4G68A 4WXJA 5F7VA 1N04A 2FYIA 2QS2A 5AE4A 3LR1A 2OLBA 3DP6A 1ZU0A 2E0SA 3N6TA 1ZLQA 2DWAA 2DS9A 1QUIA 4U21A 1JW1A 5I2NA 1R6ZA 3JZJA 5AA1A 1GV8A 1XT8A 1OIBA 3M3FA 2Q9TA 1B3LA 5CMCA 1FTLA 5K2XA 3TAJA 2V93A 4JWOA 4QF9A 1P1UA 2RC8A 3CG3A 3I3VA 1YPNA 4IO6A 1LBBA 3I5OA 3MQ9A 4G68B 2V3TA 1B4HA 3FATA 2O68A 3HO7A 5JTYA 4IGRA 1SW2A 3OMBA 3SETA 5JEIA 1XOCA 1URGA 1SYHA 3C33A 1MM6A 3CFLA 3Q25A 5FHNA 2WKYA 2VGQA 2DOJA 3K2DA 1DPEA 1EZ9A 1JETA 2QL3A 1YAEA 1GVCA 2O1LA 1MY1A 4R9FA 4G68C 2F7CA 4I9DA 3I6VA 2DWIA 1S7YA 5CC2A 4BDRA 3K01A 1MDP1 1ZBMA 4R6HA 5JTYB 3VXCA 4OMBA 3TPAA 5I57A 2XXIA 3T66A 5AA2A 3TELA 2ZMBA 5KCJA 4H5FA 3PUZE 4OFJA 5BUUA 1SQYA 1M5CA 1Q35A 3TQWA 2XXTA 1POTA 3OSRA 4DDDA 3H03A 4IO5A 3MPKA 1I6BA 2Y7KA 1A54A 3KG2A 1RYXA 4IB2A 4ECFA 2VD2A 1N0TA 2I4BA 4ELRA 3SEWA 1LFHA 1DTZA 4ESWA 4KCCA 3UP9A 2Y7PA 4C1UA 3MVWA 1B3GA 4HCYA 1B0LA 4G4PA 3U92A 3OOAA 2RCAA 3MW0A 2AL5A 3PGFA 1B1HA 2ZYNA 5KCJB 4MFIA 3E13X 4JDFA 1GTKA 3FJGA 2R9JA 4BDOA 3OO8A 3ZS6A 1P1WA 3SERA
chains in the Genus database with same CATH superfamily
3BBRA 3W9WA 4MF3A 1UTHA 1FTOA 1ZKBA 4OQOA 3OELA 4FEDA 1MXVA 3GYYA 4KI0E 2Y5LA 3MYUA 3QSLA 2YJPA 4PFWA 5AA2D 1B32A 1FTJA 4WEPA 2QJEA 4TQUQ 1JP4A 2LAOA 4G77A 3MVYA 4P1EA 5AA3A 4NF5A 1FBGA 4PFYA 3B6TA 1HSLA 2QMXA 3TCGA 1AH5A 3LUYA 5F24A 3CIJA 4EQ7A 1NMUA 2NVUB 4MLVA 3T9UA 4OERA 5AA4B 3EQ1A 4GQOA 4GVOA 4NWCA 2REJA 2I58A 4YMAA 3KZGA 3QAXA 3U1OA 4GBVA 3N5LA 2Z22A 3K1MA 3HN0A 4C1TA 5J16A 4DXBA 4RK9A 2QS4A 4I3YA 3IOWA 2I3VA 5TU0A 1NV2A 4PE5B 2XXWA 1CE2A 4ELPA 1XS5A 2HXRA 4KYDA 3M8UA 3WAFA 2Q2CA 1LBCA 1FSAA 3TTMA 2GH9A 1PEBA 2ZYKA 1IXGA 3GBBA 4BDMA 2W7YA 2UYFA 3TTKA 2PFYA 1MRPA 4UA8A 1B05A 1YXIA 3K02A 2B3BA 1B58A 3N26A 1B7HA 1SYIA 2DWHA 3IB0A 4P1LA 3E3KA 1PBPA 2V84A 3GBAA 1TWYA 3KBRA 1F9BA 2PX1A 4OVQA 3LC8A 2P3VA 2F7AA 2Z8DA 5LTCA 4POXA 5EHSA 2H9BA 5FHOA 2CZKA 5CMMA 4GOTA 3CR9A 5H8FA 5FBPA 4GXAA 5TPAA 1IMEA 5IZZA 3Q27A 3FXQA 3OO9A 2B3FA 2XXRA 1MXYA 2Y7IA 4OXVA 1FQAA 1NNKA 3PUWE 4U4SA 2HZKA 4NGUA 3L6GA 3LBSA 3TUSA 1MH4A 2OZZA 3PUVE 3R6UA 5HPQA 1LAFE 3MAMA 3IOVA 4E0WA 4XTCQ 2I48A 4O3BA 4QFNA 1NFTA 1FQCA 4TOZA 1IMAA 3DM0A 3C4MA 1FBEA 4QBAA 2R6GE 4F2OA 1QKAA 2ZNTA 4DE8A 4TLMB 1DK4A 3ISPA 2Y5KA 3H3GA 4LUBA 2G93A 3LSXA 5EQ9A 3G3FA 4N8GA 4R72A 5TPAB 2XXPA 2DXYA 1DBZA 3U65A 2XXQA 4F22A 4F1YA 1JW4A 2I0BA 1LLSA 1B7ZA 5KZTA 4R2FA 2F5XA 4M1VA 5FHMA 4DZ1A 3IL1B 1FBFA 1UTBB 4PF6A 3TCHA 1SW5A 2BJJX 3QUJA 1LBWA 1FPDA 3MP6A 3P7IA 4I1DA 3CSBA 4H0WA 4IO3A 3T22A 2P2AA 4F2QA 1NNFA 3TTLA 2JJKA 2ZNSA 1B5JA 2QS3A 4JWYA 4YZZA 1VR5A 2GHAA 2ZNUA 1MQGA 2NWJA 3ILTB 4GLIA 2XA5A 2CEYA 4MLQA 1EYIA 5EYHA 5L9SA 4H67A 1FCKA 1QVSA 2DP8A 1A7LA 4U1ZA 2D3IA 2GFEA 1N7WA 2ZYMA 3TCFA 3O28A 4NF4A 1SI0A 1MPCA 3TEPA 1LBZA 4N81A 4FEBA 4NF8A 1QULA 3MC2A 1Y3PA 5DVJA 3VXBA 1AIVA 3S9EA 3KN3A 4ZECA 1Y20A 1LBVA 1O7TA 1K9ZA 2FIEA 5H8HA 4NTLA 3UGWA 4KYSA 1II5A 3VVEA 4YB7A 1USYE 4O8MA 2PBWA 2UXAA 4AB6A 1B2HA 2OBGA 1R1NA 3K4UA 3A3UA 3V83A 1B5IA 4R74A 1MY0A 4KPTA 5I58B 1MQIA 3VV5A 2Q8MA 2HAUA 4PC9A 4OFLA 2Z23A 1DPPA 5I2KB 4PP0A 3IO6A 4G61A 3QUFA 3THIA 1FPBA 4TLLB 1K9YA 4YB5A 4PDHA 3PPQA 3W9VA 4NF4B 4PF8A 5KDTA 2Q89A 5I56A 2G29A 3DLNA 4R9GA 3K6WA 1IXCA 4AQ4A 4F1UA 3IJXB 2AL4A 3CFZA 1MQDA 3G3HA 3G7WA 3KC0A 5H8HB 4N15A 2HZLA 4QFOA 4P0GA 3ZSFA 3FGSA 5ITOA 1IMDA 4X9TA 3V8XB 4LP2B 1DSNA 4R2BA 2O7IA 3FVKA 3G3JA 1YCJA 2F7BA 4DCXA 1PDAA 1KZ8A 4YAHX 1NL5A 1A8FA 3IJOB 1UQWA 1I6AA 4FBPA 4XEQA 4KR5A 3C9HA 2OCUA 4HXVA 4LN5A 3M3KA 2CZLA 1T0KA 1R9LA 4JSOA 4BDLA 1R9QA 2QPQA 4F3PA 4F19A 2UYEA 4XFEA 3HFUA 5I56B 3WAEA 5CI5A 1S50A 3MJNA 1VDWA 1NKXA 2WX9A 1FBPA 1VFDA 3SKPA 4QSDA 1NNPA 4EF1A 4GWSA 5I2NB 2F97A 2NXOA 2AIXA 3MPLA 1BP5A 2HAVA 4DXUA 4H65A 3K0VA 2OWTA 4FE8A 5FTHA 4OENA 4RYAA 2P3NA 2Z8FA 3MBPA 1OLAA 1N3XA 5DEXA 1USYH 1B6HA 5JK4A 4YKPA 5CMBA 1MXWA 1N84A 3EHUA 4FIMA 1ZJLA 4X04A 4FORA 2H98A 4UABA 2XD3A 2Q74A 3MWBA 3ZKKA 3RPLA 4PGPA 1BTJA 4RPOA 3KOTA 2UVIA 3QIMA 5FTIA 3T0JA 3U94A 4PFIA 5BWJA 4IO2A 1NV3A 4ZE8A 1LB9A 2GRVA 3O6GA 3KFMA 4F1VA 3MVZA 2CEXA 1UIUA 2QVVA 2XX8A 2KLFA 1D9YA 3B6QA 1NH8A 4JSDA 4PBHA 4IR8A 3N94A 4GX6A 1NH7A 4YU0A 3O29A 2XWOA 4PFRA 5CMKA 4JVIA 3PPRA 3TQLA 2HEUA 1B3FA 4U2RA 4JXIA 5DTBA 4IY6A 5I5PA 3SEXA 2VHAA 5I57B 3E78A 4EDPA 5AA2B 1NV1A 4EXKA 1QUKA 3AXFA 3LSWA 1A99A 1B4ZA 5LDZA 1Y3QA 5IKBA 2FBPA 1YZ0A 1Q1KA 3CHGA 4MNPA 4I8CA 3PUYE 1BIYA 4FATA 4I40A 1L5TA 3H4ZA 3D1RA 3K6VA 3LV0A 4H46A 5EHMA 1JEVA 2HPGA 2WEFA 4BDNA 3ONMA 1FQEA 3FV2A 5M2VA 4OVTA 4RNSA 3FJ7A 3KC1A 4RK2A 1DMBA 2XXHA 1P1OA 4MIJA 1OVTA 2F78A 1POY1 2A5TA 5IZ3A 4P0IA 3G3IA 2HCAA 3KOSA 4WKMA 3E9XA 3RYDA 2HFBA 3ODBA 1FQBA 2B4LA 1BLFA 3IK6B 1INPA 1IMBA 4N13A 5HBCA 3BIGA 3PPPA 4G2ZA 2F6PA 1SI1A 3K6UA 3VFJA 1ATGA 2XX7A 3HCQA 2D5WA 1P1QA 2OWSA 1AOVA 3SEVA 3VLWA 1Y3NA 1UTHB 3RT8A 5L8DA 4OEVA 1D3KA 3T1BA 1H45A 3IB1A 3E4RA 5ESYA 4NHBA 2B4MA 3IFAA 2ESNA 3OXNA 3HSTA 2I3WA 2D21A 4PFUA 4NF5B 3QXMA 1A8EA 2V25A 3DELB 3EHTA 1OLCA 5ISUA 1H43A 2HQ0A 2CZHA 3A09A 4L17A 5DYHA 2F3BA 1LAGE 2THIA 1B9JA 3BIHA 1EU8A 3OENA 4PTKA 2DE2A 3OEMA 3K1NA 2WBBA 4OETA 2UVHA 1FPKA 2DVCA 4ZDMA 3PMVA 4P8BA 4ZS9A 2XX9A 2ZXTA 3L6HA 3FXBA 4KFQA 3VVFA 3MVXA 5EYGA 4GRKA 4YICA 5I3SA 3U72A 4FJPA 4QFPA 3KJ7A 4MAGA 3RY3A 4Q30B 4ZEIA 1MDQA 4OZ9A 4GWYA 2F3DA 3CFXA 3VLVA 4EF2A 4BDQA 2FHYA 2WYKA 1VE4A 5H8NA 5A5XA 3FUZA 3Q26A 4PFBA 2PCRA 4FAJA 1LBYA 2ONSA 3T9VA 4ELOA 2H25A 1YTVA 4U23A 3UA8A 3OEKA 2XXVA 1ZMGA 5HM4B 2DXRA 1NV7A 1WDNA 4JWXA 4RJZA 5CRYA 2ABHA 1FQFA 4KYEA 3KSJA 2E1SA 3U93A 2QVRA 4ELQA 1MQJA 1EZOA 2UVJA 3RT6B 2DVZA 5F1QA 1QGXA 3LSLA 3H6TA 2I0CA 4LQ5A 4ZZAA 3TODA 2AYSA 3S2VA 4GFRA 3KSXA 1NV0A 1XC1A 3RN8A 1PB8A 4QFLA 1D9QA 3FXUA 4N91A 1LAXA 3KGCA 5H8NB 5A5XB 2OJTA 1B3HA 4LZ7A 2OWZA 3K1PA 4F31B 5H8FB 1IZ1A 3VDFA 2I4CA 4R6YA 2H4IA 2ONRA 3RGYA 3RQTA 3PTYA 3T96B 3EF7A 3RNNA 3QYTA 5ET5A 5L9OA 3R26A 4NAPA 1I6QA 1KA0A 2F6GA 3TDJA 4EUOA 4O7IA 1AMFA 1RDZA 1NV5A 3FVGA 4GIZA 3MZBA 4GD5A 3S4UA 2O84X 4JVCA 3PD9A 1EZPA 1WVJA 1Q9DA 2V3QA 1M5EA 4EXLA 2V3UA 2XXUA 4F18A 3FVNA 4OFOA 3TZAA 3SESA 1O63A 3FV1A 1FW0A 4ONYA 2B65A 4KHZE 5I59A 2Q88A 2DE4A 1SVXB 2RINA 3IAZA 4NEDA 1JW5A 5IZ1A 4K3FA 2X7QA 4HTGA 5EQ8A 4O7MA 1MH3A 3RTWB 3KN7A 3O6IA 4FECA 3MZ1A 4YB6A 1FBCA 4NF6A 1M5DA 3S9NC 2X26A 4HE0A 4X1BA 1RDYA 4OYVA 2FNCA 1FPGA 3HHGA 3A29A 5DVFA 4BLAA 3CG1A 4UACA 4DXCA 1MPDA 4IY5A 3USDA 1NUWA 2GHBA 4EQBA 2XXXA 4LZ5A 4AS5A 1LAHE 2I6EA 1J1NA 3RLFE 5I59B 1B3EA 4E0XA 3TMGA 3D4GA 4HW8A 3B7DA 3IO4A 3KEIA 1SW4A 4KCDA 3PPNA 4OEUA 1AWBA 4OA4A 2VD3A 4ZEKA 4QSEA 4HCWA 4ZEFA 4RXLA 1O64A 4R75A 5IAIA 1NNTA 2OX3A 3C34A 3CRBA 3EPEA 5J1DA 2REGA 1N7XA 4PETA 2ZYOA 3TTNA 1IQ7A 1IMCA 2ANJA 2XWKA 1MXUA 2F35A 4RA1A 4LATA 5H8QA 4F29A 3H7MA 1QKBA 4NF8B 2RKMA 5B7DA 2M8CA 4NF0A 1B51A 1QJMA 1MQHA 3FJMA 3VLUA 4OVJA 1TFAA 3C35A 4Z7EA 2PMSA 4OHNA 4MBPA 4XIGQ 2IA4A 2FVZA 1EYJA 3SDFA 1MPBA 3FBPA 4ZEBA 3TKDA 1EYKA 4XXUA 2F34A 3JYRA 3OO7A 1N76A 2O51A 1MY3A 4F3SA 1FTMA 4H8JA 3T9XB 5CBSA 1FQDA 1NV4A 3BFTA 4ESXA 5H8QB 5KDTB 1DCUA 2ONKE 4PCDA 3UIFA 1JVXA 4U4XA 2QSXA 4H1XA 4RPNA 4I62A 2VPNA 3Q28A 1D4NA 3VVDA 2DQVA 1DOTA 4GXSB 3FZVA 3SZPA 4P47A 2Q8JA 2NOOA 3T9HB 1MY2A 4OVRA 1CB6A 1JVYA 4JBZA 3TTRA 2O6AA 3H6VA 2Y7WA 4PGNA 1SW1A 4RY1A 1HSJA 4N6KA 4MX6A 4H45A 2I49A 1RDXA 4U22A 3IORA 3A3CA 1B40A 4QFKA 5ICQA 1PC3A 4MHFA 3PPOA 2XXKA 4GWZA 3V5AA 3GZGA 4F3GA 1EH3A 2DDKA 4NX1A 4DCYA 1QUJA 3R7XA 3JV9A 1FJ6A 1RKMA 1OVBA 1FPLA 1SD3A 1H3DA 4YKJA 5ET6A 1FTKA 4QHQA 4HS7A 3RTFB 3PU5A 5DEXB 3SEUA 3PUXE 4XKRA 2BJIA 4NMYA 3FASA 1MM7A 4IO7A 2F36A 3KJTA 3PV0E 1N3WA 3K6XA 1US5A 1JEUA 1RYOA 3RPLB 1AL3A 3C36A 3T93B 4DI4B 4PFTA 4QRZA 3IOTA 4H6DA 2ALUA 3H6WA 3O97A 2H99A 5DVIA 4NN3A 1B1XA 1CNQA 3IOUA 1IXHA 4LQ2A 4LONB 2O7UA 3BKIB 2O69A 1PB9A 3FVOA 1FRPA 4GBWA 2QS1A 4AB5A 2A5SA 4O3CA 4DIGA 1Y4CA 4KD5A 4HE2A 4OESA 4AS4A 4C0RA 4P3LA 4POWA 3GLBA 1XHYA 1P99A 2Z8EA 4P11A 5AA4A 4F3BA 1TFDA 3K00A 1LFIA 3BFUA 2YPNA 3C31A 2Y7RA 4OVSA 1VFEA 2ZZVA 1FJ9A 2PVUA 3O9PA 2RF1A 1IIWA 4ND9A 4NWDA 4Q8RA 5IM2A 4U1OA 3F11A 1MS7A 3UN6A 1B0HA 3CSGA 1JNFA 1ZTYA 5DT6A 3PMWA 3UORA 1Y9UA 2P1SA 5CM6A 1MG1A 3MP8A 2F8DA 3LSFB 2DWJA 1US4A 5B70A 2KQZA 3OO6A 3TYHA 5EQ7A 3FD3A 1IUDA 1SBPA 4YKKA 4MH5A 3IX1A 2A5TB 5IZ3B 3FXRA 1FPFA 1MXZA 3SEYA 4G8NA 2IEEA 2DSFA 3H06B 3KN8A 1DTGA 2FA7A 3ZKLA 1LB8A 3Q29A 5K2YA 5LOMA 1TXFA 1IITA 4DLDA 2PT1A 1OQGA 3QMFA 4H8IA 4N6PA 2HXWA 1YYZA 3M3LA 3KBZA 1FPEA 2O1MA 3CVGA 3OD7A 4WEDA 4HE1A 4O3AA 5H8SA 1LSTA 2PT2A 5ELVA 1B5HA 4MMPA 1KA1A 3GXAA 2PFZA 3ILUB 1Z7NE 1H44A 4XKQA 4IO4A 4R6KA 1XVYA 3UK4A 4XF5A 2ZZXA 4N6DA 1URSA 1NUXA 1NI9A 1PBQA 4ZE9A 1KWHA 2X7PA 1LEVA 2QVUA 4GF8A 3ECRA 3N6UA 1NV6A 4PAKA 5CBRA 1LCFA 4PQJA 1HSEA 2XXYA 3G3GA 1BKAA 4OWDA 3PD8A 2CZIA 3HHFA 4GL8A 1Y1ZA 3W15C 1VSOA 1MXXA 3VE1B 4XKNA 2ZZWA 4OTEA 4JB7A 1LCTA 2PYYA 3OSQA 3FIRA 1IEJA 4G8HA 1NUYA 4YKIA 1S9TA 3MP1A 2DYXA 3G3KA 3O66A 5L9MA 2OK2A 5DW8A 3HPIA 1JQFA 1UTBA 2UVGA 2NUVA 2WBDA 3PMXA 2Q2AA 1B52A 4F39A 4ISUA 3QK6A 4P56A 4R73A 3O2AA 3HV1A 4G8MA 2RCBA 4PE3A 1SDXA 1LGBC 3MZ9A 4O94A 1UIVA 5I84A 5ET8A 1M5BA 4THIA 1OQHA 4ZEDA 4LZ8A 4QSCA 4M4GA 3EHSA 2XWIA 3DP8A 4LVQA 2CMOA 3O6HA 3D4CA 2YLNA 2KR0A 4N07A 4YMBA 1BK4A 4GWOA 2QMWA 4MNIA 4X1DA 1I69A 4MCOA 5EQAA 1A55A 1FPJA 5TP9A 3C32A 2RC7A 2DE3A 4JVDA 5IGAA 3LUZA 3S9MC 1IXIA 4PBQA 1P1NA 4NE4A 1A40A 4KQPA 3IB2A 2Y84A 4N17A 1PB7A 3V89B 2XD2A 1WODA 4X48A 3TFLA 1D9VA 1OMPA 1B46A 1URDA 1ZIUA 3DP4A 3MUQA 1B7UA 4Q0CA 1M5FA 2VP1A 3U8QA 5I58A 1Y1MA 1ELJA 5I2KA 4MEVA 4GWXA 1H76A 1G0HA 1GGGA 1FBHA 1Z7ME 2QRYA 4Q5TA 1GR2A 4LA9A 1XVXA 4IGTA 4Z0IA 4N4UA 3CI8A 1TT1A 5TP9B 3RUMA 1LFGA 4ZZEA 3S9LC 5ITPA 5ICTA 3B6WA 1MY4A 1ANFA 4H5GA 3IR1A 2R71A 3RPWA 4PDDA 4NF6B 4EQ9A 2VOZA 4XKPA 2P0SA 1QW0A 4GL0A 2L5VA 3EN3A 2RC9A 2XWVA 4GWWA 4GWUA 4GX3A 5EYFA 2XHDA 2H5YA 1Y4TA 3H6UA 4G68A 4WXJA 4PAIA 5F7VA 1N04A 2FYIA 2QS2A 5AE4A 3LR1A 2OLBA 3DP6A 1ZU0A 2E0SA 3N6TA 4MJOA 1ZLQA 2DWAA 2DS9A 4KXPA 1QUIA 1NUZA 4U21A 1JW1A 5I2NA 1R6ZA 3JZJA 5AA1A 1GV8A 1XT8A 1OIBA 3M3FA 2VPOA 2Q9TA 1B3LA 5CMCA 1FTLA 5K2XA 3TAJA 2V93A 4JWOA 4QF9A 1P1UA 2RC8A 3CG3A 3I3VA 1YPNA 4IO6A 5ET7A 4I3EA 1LBBA 3I5OA 4NG7A 1FPIA 5A5LA 3MQ9A 4G68B 2V3TA 1B4HA 2FIXA 2O68A 3FATA 3HO7A 4P9KA 5JTYA 4IGRA 1SW2A 3OMBA 4GX4A 3SETA 5JEIA 1XOCA 1URGA 4NQ8A 1SYHA 3C33A 4OVPA 1MM6A 3CFLA 3Q25A 4MNCA 5FHNA 2WKYA 2VGQA 2DOJA 3K2DA 1DPEA 1SPIA 1EZ9A 1JETA 2QL3A 1YAEA 1GVCA 2O1LA 1FTAA 1MY1A 3E79A 4R9FA 3IFCA 4G68C 4OANA 1LBXA 2F7CA 4I9DA 3I6VA 3EKIA 2DWIA 1S7YA 5CC2A 4BDRA 3K01A 1MDP1 1ZBMA 4R6HA 5JTYB 3VXCA 4OMBA 3TPAA 5I57A 2XXIA 3T66A 5AA2A 4N8YA 3TELA 3NOHA 2ZMBA 5KCJA 4H5FA 3PUZE 2QFLA 4OFJA 5BUUA 1SQYA 1M5CA 4DI3D 1Q35A 3TQWA 2XXTA 1POTA 3OSRA 4DDDA 3MSTA 2GQ1A 2HHMA 3H03A 4IO5A 3ROJA 4PAFA 2R8TA 3MPKA 1I6BA 2Y7KA 1A54A 3KG2A 1RYXA 1XI6A 4IB2A 4ECFA 2VD2A 4QXDA 1N0TA 2I4BA 4ELRA 1G0IA 3B8BA 3SEWA 5T3JA 1LFHA 1DTZA 1FBDA 4ESWA 3B50A 4KCCA 3UP9A 2Y7PA 4C1UA 2WYPA 3MVWA 1B3GA 2V4CA 4HCYA 1B0LA 4G4PA 1IMFA 3U92A 3OOAA 4X8RA 2RCAA 3MW0A 2AL5A 3PGFA 1B1HA 2ZYNA 5KCJB 4MFIA 3E13X 4JDFA 1GTKA 3FJGA 2R9JA 4BDOA 2VT5A 3OO8A 3ZS6A 1P1WA 5I7IA 2MKZA 3SERA
chains in the Genus database with same CATH topology
3BBRA 3W9WA 4MF3A 1UTHA 1FTOA 1ZKBA 4OQOA 3OELA 4FEDA 1MXVA 4KI0E 3QSLA 4PFWA 2YJPA 5AA2D 1B32A 1FTJA 4WEPA 2QJEA 4TQUQ 2LAOA 4G77A 3MVYA 5AA3A 4NF5A 4PFYA 3B6TA 1HSLA 2QMXA 3TCGA 1AH5A 3LUYA 3CIJA 4EQ7A 1NMUA 2NVUB 4MLVA 3T9UA 4OERA 5AA4B 3EQ1A 4GQOA 4GVOA 4NWCA 2REJA 2I58A 4YMAA 3KZGA 3QAXA 3U1OA 3N5LA 2Z22A 3K1MA 3HN0A 4C1TA 4DXBA 4RK9A 2QS4A 3IOWA 2I3VA 5TU0A 4PE5B 2XXWA 1CE2A 4ELPA 1XS5A 4KYDA 3M8UA 3WAFA 2Q2CA 1LBCA 3TTMA 2GH9A 1PEBA 2ZYKA 1IXGA 3GBBA 4BDMA 2W7YA 2UYFA 3TTKA 1MRPA 4UA8A 1B05A 3K02A 2B3BA 1B58A 3N26A 1B7HA 1SYIA 2DWHA 3IB0A 3E3KA 1PBPA 2V84A 3GBAA 1TWYA 3KBRA 1F9BA 2PX1A 3LC8A 2F7AA 2Z8DA 4POXA 5EHSA 2H9BA 5FHOA 5CMMA 4GOTA 3CR9A 5H8FA 4GXAA 5TPAA 3Q27A 3FXQA 3OO9A 2B3FA 2XXRA 1MXYA 2Y7IA 4OXVA 1FQAA 1NNKA 3PUWE 4U4SA 2HZKA 3L6GA 3LBSA 3TUSA 1MH4A 2OZZA 3PUVE 3R6UA 5HPQA 1LAFE 3MAMA 3IOVA 4E0WA 4XTCQ 2I48A 4O3BA 4QFNA 1NFTA 1FQCA 4TOZA 3DM0A 3C4MA 2R6GE 4F2OA 1QKAA 2ZNTA 4DE8A 4TLMB 3H3GA 4LUBA 2G93A 3LSXA 3G3FA 4R72A 5TPAB 2XXPA 2DXYA 2XXQA 4F22A 4F1YA 1JW4A 2I0BA 1LLSA 1B7ZA 5KZTA 4R2FA 2F5XA 4M1VA 5FHMA 4DZ1A 3IL1B 1UTBB 3TCHA 1SW5A 2BJJX 3QUJA 3MP6A 3P7IA 4I1DA 3CSBA 4H0WA 4IO3A 3T22A 2P2AA 4F2QA 1NNFA 3TTLA 2ZNSA 1B5JA 2QS3A 4JWYA 4YZZA 1VR5A 2GHAA 2ZNUA 1MQGA 2NWJA 3ILTB 4GLIA 4MLQA 5L9SA 4H67A 1FCKA 1QVSA 2DP8A 1A7LA 4U1ZA 2D3IA 2GFEA 1N7WA 2ZYMA 3TCFA 3O28A 4NF4A 1SI0A 1MPCA 3TEPA 4FEBA 4NF8A 1QULA 3MC2A 1Y3PA 5DVJA 3VXBA 1AIVA 3S9EA 3KN3A 4ZECA 1Y20A 1O7TA 5H8HA 4NTLA 3UGWA 4KYSA 1II5A 3VVEA 4YB7A 1USYE 2PBWA 2UXAA 4AB6A 1B2HA 2OBGA 1R1NA 3K4UA 3A3UA 3V83A 1B5IA 4R74A 1MY0A 4KPTA 5I58B 1MQIA 3VV5A 2HAUA 4OFLA 2Z23A 1DPPA 5I2KB 4PP0A 3IO6A 3QUFA 3THIA 4TLLB 4YB5A 3PPQA 3W9VA 4NF4B 5KDTA 2Q89A 5I56A 2G29A 3DLNA 4R9GA 3K6WA 1IXCA 4AQ4A 4F1UA 3IJXB 2AL4A 3CFZA 1MQDA 3G3HA 3G7WA 5H8HB 2HZLA 4QFOA 4P0GA 3ZSFA 3FGSA 5ITOA 4X9TA 3V8XB 4LP2B 1DSNA 4R2BA 2O7IA 3FVKA 3G3JA 1YCJA 2F7BA 4DCXA 1PDAA 4YAHX 1NL5A 1A8FA 3IJOB 1UQWA 1I6AA 4KR5A 3C9HA 2OCUA 3M3KA 2CZLA 1T0KA 1R9LA 4JSOA 4BDLA 1R9QA 2QPQA 4F3PA 4F19A 2UYEA 5I56B 3WAEA 5CI5A 1S50A 3MJNA 1NKXA 1VFDA 3SKPA 4QSDA 1NNPA 4EF1A 5I2NB 2F97A 2NXOA 2AIXA 3MPLA 1BP5A 2HAVA 4DXUA 4H65A 3K0VA 2OWTA 4FE8A 5FTHA 4OENA 4RYAA 2Z8FA 3MBPA 1OLAA 1N3XA 5DEXA 1USYH 1B6HA 5JK4A 4YKPA 5CMBA 1MXWA 1N84A 3EHUA 4FIMA 1ZJLA 4FORA 2H98A 2XD3A 3MWBA 3ZKKA 1BTJA 4RPOA 3KOTA 2UVIA 3QIMA 5FTIA 3U94A 5BWJA 4IO2A 4ZE8A 1LB9A 2GRVA 3O6GA 3KFMA 4F1VA 3MVZA 1UIUA 2XX8A 2KLFA 1D9YA 3B6QA 1NH8A 4JSDA 3N94A 1NH7A 4YU0A 3O29A 5CMKA 3PPRA 3TQLA 2HEUA 1B3FA 4U2RA 4JXIA 5DTBA 4IY6A 3SEXA 2VHAA 5I57B 4EDPA 5AA2B 4EXKA 1QUKA 3AXFA 3LSWA 1A99A 1B4ZA 1Y3QA 5IKBA 1Q1KA 4I8CA 3PUYE 1BIYA 4FATA 1L5TA 3H4ZA 3K6VA 5EHMA 1JEVA 4BDNA 3ONMA 1FQEA 3FV2A 5M2VA 4RNSA 3FJ7A 4RK2A 1DMBA 2XXHA 1P1OA 1OVTA 2F78A 1POY1 2A5TA 4P0IA 3G3IA 2HCAA 3KOSA 4WKMA 3E9XA 2HFBA 3ODBA 1FQBA 1BLFA 3IK6B 4N13A 5HBCA 3PPPA 4G2ZA 2F6PA 1SI1A 3K6UA 3VFJA 1ATGA 2XX7A 3HCQA 2D5WA 1P1QA 2OWSA 1AOVA 3SEVA 3VLWA 1Y3NA 1UTHB 3RT8A 5L8DA 4OEVA 1D3KA 1H45A 3IB1A 3E4RA 2ESNA 3OXNA 3HSTA 2I3WA 2D21A 4PFUA 4NF5B 3QXMA 1A8EA 2V25A 3DELB 3EHTA 1OLCA 5ISUA 1H43A 2HQ0A 3A09A 4L17A 5DYHA 1LAGE 2THIA 1B9JA 1EU8A 3OENA 2DE2A 3OEMA 3K1NA 4OETA 2UVHA 2DVCA 4ZDMA 3PMVA 4ZS9A 2XX9A 2ZXTA 3L6HA 4KFQA 3VVFA 3MVXA 4GRKA 4YICA 3U72A 4FJPA 4QFPA 3KJ7A 3RY3A 4Q30B 4ZEIA 1MDQA 4OZ9A 3CFXA 3VLVA 4EF2A 4BDQA 1VE4A 5H8NA 5A5XA 3FUZA 3Q26A 4FAJA 2ONSA 3T9VA 4ELOA 2H25A 1YTVA 4U23A 3UA8A 3OEKA 2XXVA 1ZMGA 5HM4B 2DXRA 1WDNA 4JWXA 4RJZA 5CRYA 2ABHA 1FQFA 3KSJA 4KYEA 2E1SA 3U93A 4ELQA 1MQJA 1EZOA 2UVJA 3RT6B 2DVZA 5F1QA 3LSLA 3H6TA 2I0CA 4LQ5A 4ZZAA 3TODA 2AYSA 3S2VA 4GFRA 3KSXA 1XC1A 3RN8A 1PB8A 4QFLA 3FXUA 1LAXA 3KGCA 5H8NB 5A5XB 2OJTA 1B3HA 4LZ7A 3K1PA 4F31B 5H8FB 1IZ1A 3VDFA 2I4CA 4R6YA 2H4IA 2ONRA 3RGYA 3RQTA 3T96B 3EF7A 3RNNA 3QYTA 5L9OA 3R26A 1I6QA 2F6GA 3TDJA 4EUOA 1AMFA 3FVGA 4GIZA 3MZBA 4GD5A 3S4UA 2O84X 3PD9A 1EZPA 1WVJA 2V3QA 1M5EA 4EXLA 2V3UA 2XXUA 4F18A 3FVNA 4OFOA 3TZAA 3SESA 1O63A 3FV1A 1FW0A 4ONYA 2B65A 4KHZE 5I59A 2Q88A 2DE4A 1SVXB 2RINA 3IAZA 4NEDA 1JW5A 4K3FA 2X7QA 4HTGA 1MH3A 3RTWB 3KN7A 3O6IA 4FECA 3MZ1A 4YB6A 4NF6A 1M5DA 3S9NC 2X26A 4X1BA 4OYVA 2FNCA 3HHGA 5DVFA 4BLAA 3CG1A 4UACA 4DXCA 1MPDA 4IY5A 3USDA 2GHBA 4EQBA 2XXXA 4LZ5A 1LAHE 2I6EA 1J1NA 3RLFE 5I59B 1B3EA 4E0XA 3TMGA 3D4GA 4HW8A 3B7DA 3IO4A 3KEIA 1SW4A 4KCDA 3PPNA 4OEUA 2VD3A 4ZEKA 4QSEA 4HCWA 4ZEFA 4RXLA 1O64A 4R75A 5IAIA 1NNTA 3C34A 3CRBA 3EPEA 5J1DA 2REGA 1N7XA 4PETA 2ZYOA 3TTNA 1IQ7A 2ANJA 1MXUA 2F35A 4LATA 4RA1A 5H8QA 4F29A 3H7MA 1QKBA 4NF8B 2RKMA 5B7DA 2M8CA 1B51A 1QJMA 1MQHA 3FJMA 3VLUA 4OVJA 1TFAA 3C35A 4Z7EA 2PMSA 4OHNA 4MBPA 4XIGQ 2IA4A 3SDFA 1MPBA 4ZEBA 3TKDA 4XXUA 2F34A 3JYRA 3OO7A 1N76A 2O51A 1MY3A 4F3SA 1FTMA 4H8JA 3T9XB 5CBSA 1FQDA 3BFTA 4ESXA 5H8QB 5KDTB 2ONKE 3UIFA 1JVXA 4U4XA 2QSXA 4H1XA 4RPNA 4I62A 3Q28A 1D4NA 3VVDA 2DQVA 1DOTA 4GXSB 3FZVA 2Q8JA 2NOOA 3T9HB 1MY2A 1CB6A 1JVYA 4JBZA 3TTRA 2O6AA 3H6VA 2Y7WA 1SW1A 4RY1A 1HSJA 2I49A 4U22A 3IORA 3A3CA 1B40A 4QFKA 5ICQA 1PC3A 3PPOA 3V5AA 3GZGA 4F3GA 1EH3A 4DCYA 1QUJA 3R7XA 3JV9A 1RKMA 1OVBA 1SD3A 1H3DA 4YKJA 1FTKA 4QHQA 4HS7A 3RTFB 3PU5A 5DEXB 3SEUA 3PUXE 4XKRA 4NMYA 3FASA 1MM7A 4IO7A 2F36A 3KJTA 3PV0E 1N3WA 3K6XA 1US5A 1JEUA 1RYOA 1AL3A 3C36A 3T93B 4PFTA 4QRZA 3IOTA 4H6DA 2ALUA 3H6WA 3O97A 2H99A 5DVIA 1B1XA 3IOUA 1IXHA 4LQ2A 4LONB 2O7UA 3BKIB 2O69A 1PB9A 3FVOA 2QS1A 4AB5A 2A5SA 4O3CA 4DIGA 1Y4CA 4KD5A 4OESA 4C0RA 4POWA 3GLBA 1XHYA 1P99A 2Z8EA 4P11A 5AA4A 4F3BA 1TFDA 3K00A 1LFIA 3BFUA 2YPNA 3C31A 2Y7RA 1VFEA 2PVUA 3O9PA 2RF1A 1IIWA 4ND9A 4NWDA 4Q8RA 4U1OA 3F11A 1MS7A 3UN6A 1B0HA 3CSGA 1JNFA 1ZTYA 5DT6A 3PMWA 3UORA 1Y9UA 2P1SA 5CM6A 1MG1A 3MP8A 2F8DA 3LSFB 2DWJA 5B70A 1US4A 3OO6A 3TYHA 3FD3A 1IUDA 1SBPA 4YKKA 4MH5A 3IX1A 2A5TB 3FXRA 1MXZA 3SEYA 4G8NA 2IEEA 2DSFA 3H06B 3KN8A 1DTGA 2FA7A 3ZKLA 1LB8A 3Q29A 5K2YA 5LOMA 1TXFA 1IITA 4DLDA 2PT1A 1OQGA 4H8IA 4N6PA 2HXWA 3M3LA 2O1MA 3CVGA 3OD7A 4WEDA 4O3AA 5H8SA 1LSTA 2PT2A 5ELVA 1B5HA 3GXAA 3ILUB 1Z7NE 1H44A 4XKQA 4IO4A 4R6KA 1XVYA 3UK4A 1URSA 1PBQA 4ZE9A 1KWHA 2X7PA 4GF8A 3ECRA 3N6UA 5CBRA 1LCFA 4PQJA 1HSEA 2XXYA 3G3GA 1BKAA 4OWDA 3PD8A 3HHFA 4GL8A 1Y1ZA 3W15C 1VSOA 1MXXA 3VE1B 4XKNA 4OTEA 4JB7A 1LCTA 2PYYA 3OSQA 3FIRA 1IEJA 4G8HA 4YKIA 1S9TA 3MP1A 2DYXA 3G3KA 3O66A 5L9MA 2OK2A 3HPIA 1JQFA 1UTBA 2UVGA 2NUVA 3PMXA 2Q2AA 1B52A 4F39A 4ISUA 3QK6A 4R73A 3O2AA 3HV1A 4G8MA 2RCBA 1SDXA 1LGBC 3MZ9A 1UIVA 5I84A 1M5BA 4THIA 1OQHA 4ZEDA 4LZ8A 4QSCA 4M4GA 3EHSA 3DP8A 4LVQA 2CMOA 3O6HA 3D4CA 2YLNA 4N07A 4YMBA 4GWOA 2QMWA 4X1DA 1I69A 1A55A 5TP9A 3C32A 2RC7A 2DE3A 3S9MC 1IXIA 1P1NA 4NE4A 1A40A 4KQPA 3IB2A 2Y84A 1PB7A 3V89B 2XD2A 1WODA 4X48A 3TFLA 1D9VA 1OMPA 1B46A 1URDA 1ZIUA 3DP4A 3MUQA 1B7UA 4Q0CA 1M5FA 2VP1A 3U8QA 5I58A 1Y1MA 1ELJA 5I2KA 1H76A 1GGGA 1Z7ME 2QRYA 4Q5TA 1GR2A 4LA9A 1XVXA 4IGTA 4Z0IA 3CI8A 1TT1A 5TP9B 3RUMA 1LFGA 4ZZEA 3S9LC 5ITPA 5ICTA 3B6WA 1MY4A 1ANFA 4H5GA 3IR1A 2R71A 3RPWA 4NF6B 4EQ9A 2VOZA 4XKPA 2P0SA 1QW0A 4GL0A 3EN3A 2RC9A 5EYFA 2XHDA 2H5YA 1Y4TA 3H6UA 4G68A 4WXJA 5F7VA 1N04A 2FYIA 2QS2A 5AE4A 3LR1A 2OLBA 3DP6A 1ZU0A 2E0SA 3N6TA 1ZLQA 2DWAA 2DS9A 1QUIA 4U21A 1JW1A 5I2NA 1R6ZA 3JZJA 5AA1A 1GV8A 1XT8A 1OIBA 3M3FA 2Q9TA 1B3LA 5CMCA 1FTLA 5K2XA 3TAJA 2V93A 4JWOA 4QF9A 1P1UA 2RC8A 3CG3A 3I3VA 1YPNA 4IO6A 1LBBA 3I5OA 3MQ9A 4G68B 2V3TA 1B4HA 3FATA 2O68A 3HO7A 5JTYA 4IGRA 1SW2A 3OMBA 3SETA 5JEIA 1XOCA 1URGA 1SYHA 3C33A 1MM6A 3CFLA 3Q25A 5FHNA 2WKYA 2VGQA 2DOJA 3K2DA 1DPEA 1EZ9A 1JETA 2QL3A 1YAEA 1GVCA 2O1LA 1MY1A 4R9FA 4G68C 2F7CA 4I9DA 3I6VA 2DWIA 1S7YA 5CC2A 4BDRA 3K01A 1MDP1 1ZBMA 4R6HA 5JTYB 3VXCA 4OMBA 3TPAA 5I57A 2XXIA 3T66A 5AA2A 3TELA 2ZMBA 5KCJA 4H5FA 3PUZE 4OFJA 5BUUA 1SQYA 1M5CA 1Q35A 3TQWA 2XXTA 1POTA 3OSRA 4DDDA 3H03A 4IO5A 3MPKA 1I6BA 2Y7KA 1A54A 3KG2A 1RYXA 4IB2A 4ECFA 2VD2A 1N0TA 2I4BA 4ELRA 3SEWA 1LFHA 1DTZA 4ESWA 4KCCA 3UP9A 2Y7PA 4C1UA 3MVWA 1B3GA 4HCYA 1B0LA 4G4PA 3U92A 3OOAA 2RCAA 3MW0A 2AL5A 3PGFA 1B1HA 2ZYNA 5KCJB 4MFIA 3E13X 4JDFA 1GTKA 3FJGA 2R9JA 4BDOA 3OO8A 3ZS6A 1P1WA 3SERA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BBR A;  3W9W A;  4MF3 A;  1UTH A;  1FTO A;  1ZKB A;  4OQO A;  3OEL A;  4FED A;  1MXV A;  4KI0 E;  3QSL A;  4PFW A;  2YJP A;  5AA2 D;  1B32 A;  1FTJ A;  4WEP A;  2QJE A;  4TQU Q;  2LAO A;  4G77 A;  3MVY A;  5AA3 A;  4NF5 A;  4PFY A;  3B6T A;  1HSL A;  2QMX A;  3TCG A;  1AH5 A;  3LUY A;  3CIJ A;  4EQ7 A;  1NMU A;  2NVU B;  4MLV A;  3T9U A;  4OER A;  5AA4 B;  3EQ1 A;  4GQO A;  4GVO A;  4NWC A;  2REJ A;  2I58 A;  4YMA A;  3KZG A;  3QAX A;  3U1O A;  3N5L A;  2Z22 A;  3K1M A;  3HN0 A;  4C1T A;  4DXB A;  4RK9 A;  2QS4 A;  3IOW A;  2I3V A;  5TU0 A;  4PE5 B;  2XXW A;  1CE2 A;  4ELP A;  1XS5 A;  4KYD A;  3M8U A;  3WAF A;  2Q2C A;  1LBC A;  3TTM A;  2GH9 A;  1PEB A;  2ZYK A;  1IXG A;  3GBB A;  4BDM A;  2W7Y A;  2UYF A;  3TTK A;  1MRP A;  4UA8 A;  1B05 A;  3K02 A;  2B3B A;  1B58 A;  3N26 A;  1B7H A;  1SYI A;  2DWH A;  3IB0 A;  3E3K A;  1PBP A;  2V84 A;  3GBA A;  1TWY A;  3KBR A;  1F9B A;  2PX1 A;  3LC8 A;  2F7A A;  2Z8D A;  4POX A;  5EHS A;  2H9B A;  5FHO A;  5CMM A;  4GOT A;  3CR9 A;  5H8F A;  4GXA A;  5TPA A;  3Q27 A;  3FXQ A;  3OO9 A;  2B3F A;  2XXR A;  1MXY A;  2Y7I A;  4OXV A;  1FQA A;  1NNK A;  3PUW E;  4U4S A;  2HZK A;  3L6G A;  3LBS A;  3TUS A;  1MH4 A;  2OZZ A;  3PUV E;  3R6U A;  5HPQ A;  1LAF E;  3MAM A;  3IOV A;  4E0W A;  4XTC Q;  2I48 A;  4O3B A;  4QFN A;  1NFT A;  1FQC A;  4TOZ A;  3DM0 A;  3C4M A;  2R6G E;  4F2O A;  1QKA A;  2ZNT A;  4DE8 A;  4TLM B;  3H3G A;  4LUB A;  2G93 A;  3LSX A;  3G3F A;  4R72 A;  5TPA B;  2XXP A;  2DXY A;  2XXQ A;  4F22 A;  4F1Y A;  1JW4 A;  2I0B A;  1LLS A;  1B7Z A;  5KZT A;  4R2F A;  2F5X A;  4M1V A;  5FHM A;  4DZ1 A;  3IL1 B;  1UTB B;  3TCH A;  1SW5 A;  2BJJ X;  3QUJ A;  3MP6 A;  3P7I A;  4I1D A;  3CSB A;  4H0W A;  4IO3 A;  3T22 A;  2P2A A;  4F2Q A;  1NNF A;  3TTL A;  2ZNS A;  1B5J A;  2QS3 A;  4JWY A;  4YZZ A;  1VR5 A;  2GHA A;  2ZNU A;  1MQG A;  2NWJ A;  3ILT B;  4GLI A;  4MLQ A;  5L9S A;  4H67 A;  1FCK A;  1QVS A;  2DP8 A;  1A7L A;  4U1Z A;  2D3I A;  2GFE A;  1N7W A;  2ZYM A;  3TCF A;  3O28 A;  4NF4 A;  1SI0 A;  1MPC A;  3TEP A;  4FEB A;  4NF8 A;  1QUL A;  3MC2 A;  1Y3P A;  5DVJ A;  3VXB A;  1AIV A;  3S9E A;  3KN3 A;  4ZEC A;  1Y20 A;  1O7T A;  5H8H A;  4NTL A;  3UGW A;  4KYS A;  1II5 A;  3VVE A;  4YB7 A;  1USY E;  2PBW A;  2UXA A;  4AB6 A;  1B2H A;  2OBG A;  1R1N A;  3K4U A;  3A3U A;  3V83 A;  1B5I A;  4R74 A;  1MY0 A;  4KPT A;  5I58 B;  1MQI A;  3VV5 A;  2HAU A;  4OFL A;  2Z23 A;  1DPP A;  5I2K B;  4PP0 A;  3IO6 A;  3QUF A;  3THI A;  4TLL B;  4YB5 A;  3PPQ A;  3W9V A;  4NF4 B;  5KDT A;  2Q89 A;  5I56 A;  2G29 A;  3DLN A;  4R9G A;  3K6W A;  1IXC A;  4AQ4 A;  4F1U A;  3IJX B;  2AL4 A;  3CFZ A;  1MQD A;  3G3H A;  3G7W A;  5H8H B;  2HZL A;  4QFO A;  4P0G A;  3ZSF A;  3FGS A;  5ITO A;  4X9T A;  3V8X B;  4LP2 B;  1DSN A;  4R2B A;  2O7I A;  3FVK A;  3G3J A;  1YCJ A;  2F7B A;  4DCX A;  1PDA A;  4YAH X;  1NL5 A;  1A8F A;  3IJO B;  1UQW A;  1I6A A;  4KR5 A;  3C9H A;  2OCU A;  3M3K A;  2CZL A;  1T0K A;  1R9L A;  4JSO A;  4BDL A;  1R9Q A;  2QPQ A;  4F3P A;  4F19 A;  2UYE A;  5I56 B;  3WAE A;  5CI5 A;  1S50 A;  3MJN A;  1NKX A;  1VFD A;  3SKP A;  4QSD A;  1NNP A;  4EF1 A;  5I2N B;  2F97 A;  2NXO A;  2AIX A;  3MPL A;  1BP5 A;  2HAV A;  4DXU A;  4H65 A;  3K0V A;  2OWT A;  4FE8 A;  5FTH A;  4OEN A;  4RYA A;  2Z8F A;  3MBP A;  1OLA A;  1N3X A;  5DEX A;  1USY H;  1B6H A;  5JK4 A;  4YKP A;  5CMB A;  1MXW A;  1N84 A;  3EHU A;  4FIM A;  1ZJL A;  4FOR A;  2H98 A;  2XD3 A;  3MWB A;  3ZKK A;  1BTJ A;  4RPO A;  3KOT A;  2UVI A;  3QIM A;  5FTI A;  3U94 A;  5BWJ A;  4IO2 A;  4ZE8 A;  1LB9 A;  2GRV A;  3O6G A;  3KFM A;  4F1V A;  3MVZ A;  1UIU A;  2XX8 A;  2KLF A;  1D9Y A;  3B6Q A;  1NH8 A;  4JSD A;  3N94 A;  1NH7 A;  4YU0 A;  3O29 A;  5CMK A;  3PPR A;  3TQL A;  2HEU A;  1B3F A;  4U2R A;  4JXI A;  5DTB A;  4IY6 A;  3SEX A;  2VHA A;  5I57 B;  4EDP A;  5AA2 B;  4EXK A;  1QUK A;  3AXF A;  3LSW A;  1A99 A;  1B4Z A;  1Y3Q A;  5IKB A;  1Q1K A;  4I8C A;  3PUY E;  1BIY A;  4FAT A;  1L5T A;  3H4Z A;  3K6V A;  5EHM A;  1JEV A;  4BDN A;  3ONM A;  1FQE A;  3FV2 A;  5M2V A;  4RNS A;  3FJ7 A;  4RK2 A;  1DMB A;  2XXH A;  1P1O A;  1OVT A;  2F78 A;  1POY 1;  2A5T A;  4P0I A;  3G3I A;  2HCA A;  3KOS A;  4WKM A;  3E9X A;  2HFB A;  3ODB A;  1FQB A;  1BLF A;  3IK6 B;  4N13 A;  5HBC A;  3PPP A;  4G2Z A;  2F6P A;  1SI1 A;  3K6U A;  3VFJ A;  1ATG A;  2XX7 A;  3HCQ A;  2D5W A;  1P1Q A;  2OWS A;  1AOV A;  3SEV A;  3VLW A;  1Y3N A;  1UTH B;  3RT8 A;  5L8D A;  4OEV A;  1D3K A;  1H45 A;  3IB1 A;  3E4R A;  2ESN A;  3OXN A;  3HST A;  2I3W A;  2D21 A;  4PFU A;  4NF5 B;  3QXM A;  1A8E A;  2V25 A;  3DEL B;  3EHT A;  1OLC A;  5ISU A;  1H43 A;  2HQ0 A;  3A09 A;  4L17 A;  5DYH A;  1LAG E;  2THI A;  1B9J A;  1EU8 A;  3OEN A;  2DE2 A;  3OEM A;  3K1N A;  4OET A;  2UVH A;  2DVC A;  4ZDM A;  3PMV A;  4ZS9 A;  2XX9 A;  2ZXT A;  3L6H A;  4KFQ A;  3VVF A;  3MVX A;  4GRK A;  4YIC A;  3U72 A;  4FJP A;  4QFP A;  3KJ7 A;  3RY3 A;  4Q30 B;  4ZEI A;  1MDQ A;  4OZ9 A;  3CFX A;  3VLV A;  4EF2 A;  4BDQ A;  1VE4 A;  5H8N A;  5A5X A;  3FUZ A;  3Q26 A;  4FAJ A;  2ONS A;  3T9V A;  4ELO A;  2H25 A;  1YTV A;  4U23 A;  3UA8 A;  3OEK A;  2XXV A;  1ZMG A;  5HM4 B;  2DXR A;  1WDN A;  4JWX A;  4RJZ A;  5CRY A;  2ABH A;  1FQF A;  3KSJ A;  4KYE A;  2E1S A;  3U93 A;  4ELQ A;  1MQJ A;  1EZO A;  2UVJ A;  3RT6 B;  2DVZ A;  5F1Q A;  3LSL A;  3H6T A;  2I0C A;  4LQ5 A;  4ZZA A;  3TOD A;  2AYS A;  3S2V A;  4GFR A;  3KSX A;  1XC1 A;  3RN8 A;  1PB8 A;  4QFL A;  3FXU A;  1LAX A;  3KGC A;  5H8N B;  5A5X B;  2OJT A;  1B3H A;  4LZ7 A;  3K1P A;  4F31 B;  5H8F B;  1IZ1 A;  3VDF A;  2I4C A;  4R6Y A;  2H4I A;  2ONR A;  3RGY A;  3RQT A;  3T96 B;  3EF7 A;  3RNN A;  3QYT A;  5L9O A;  3R26 A;  1I6Q A;  2F6G A;  3TDJ A;  4EUO A;  1AMF A;  3FVG A;  4GIZ A;  3MZB A;  4GD5 A;  3S4U A;  2O84 X;  3PD9 A;  1EZP A;  1WVJ A;  2V3Q A;  1M5E A;  4EXL A;  2V3U A;  2XXU A;  4F18 A;  3FVN A;  4OFO A;  3TZA A;  3SES A;  1O63 A;  3FV1 A;  1FW0 A;  4ONY A;  2B65 A;  4KHZ E;  5I59 A;  2Q88 A;  2DE4 A;  1SVX B;  2RIN A;  3IAZ A;  4NED A;  1JW5 A;  4K3F A;  2X7Q A;  4HTG A;  1MH3 A;  3RTW B;  3KN7 A;  3O6I A;  4FEC A;  3MZ1 A;  4YB6 A;  4NF6 A;  1M5D A;  3S9N C;  2X26 A;  4X1B A;  4OYV A;  2FNC A;  3HHG A;  5DVF A;  4BLA A;  3CG1 A;  4UAC A;  4DXC A;  1MPD A;  4IY5 A;  3USD A;  2GHB A;  4EQB A;  2XXX A;  4LZ5 A;  1LAH E;  2I6E A;  1J1N A;  3RLF E;  5I59 B;  1B3E A;  4E0X A;  3TMG A;  3D4G A;  4HW8 A;  3B7D A;  3IO4 A;  3KEI A;  1SW4 A;  4KCD A;  3PPN A;  4OEU A;  2VD3 A;  4ZEK A;  4QSE A;  4HCW A;  4ZEF A;  4RXL A;  1O64 A;  4R75 A;  5IAI A;  1NNT A;  3C34 A;  3CRB A;  3EPE A;  5J1D A;  2REG A;  1N7X A;  4PET A;  2ZYO A;  3TTN A;  1IQ7 A;  2ANJ A;  1MXU A;  2F35 A;  4LAT A;  4RA1 A;  5H8Q A;  4F29 A;  3H7M A;  1QKB A;  4NF8 B;  2RKM A;  5B7D A;  2M8C A;  1B51 A;  1QJM A;  1MQH A;  3FJM A;  3VLU A;  4OVJ A;  1TFA A;  3C35 A;  4Z7E A;  2PMS A;  4OHN A;  4MBP A;  4XIG Q;  2IA4 A;  3SDF A;  1MPB A;  4ZEB A;  3TKD A;  4XXU A;  2F34 A;  3JYR A;  3OO7 A;  1N76 A;  2O51 A;  1MY3 A;  4F3S A;  1FTM A;  4H8J A;  3T9X B;  5CBS A;  1FQD A;  3BFT A;  4ESX A;  5H8Q B;  5KDT B;  2ONK E;  3UIF A;  1JVX A;  4U4X A;  2QSX A;  4H1X A;  4RPN A;  4I62 A;  3Q28 A;  1D4N A;  3VVD A;  2DQV A;  1DOT A;  4GXS B;  3FZV A;  2Q8J A;  2NOO A;  3T9H B;  1MY2 A;  1CB6 A;  1JVY A;  4JBZ A;  3TTR A;  2O6A A;  3H6V A;  2Y7W A;  1SW1 A;  4RY1 A;  1HSJ A;  2I49 A;  4U22 A;  3IOR A;  3A3C A;  1B40 A;  4QFK A;  5ICQ A;  1PC3 A;  3PPO A;  3V5A A;  3GZG A;  4F3G A;  1EH3 A;  4DCY A;  1QUJ A;  3R7X A;  3JV9 A;  1RKM A;  1OVB A;  1SD3 A;  1H3D A;  4YKJ A;  1FTK A;  4QHQ A;  4HS7 A;  3RTF B;  3PU5 A;  5DEX B;  3SEU A;  3PUX E;  4XKR A;  4NMY A;  3FAS A;  1MM7 A;  4IO7 A;  2F36 A;  3KJT A;  3PV0 E;  1N3W A;  3K6X A;  1US5 A;  1JEU A;  1RYO A;  1AL3 A;  3C36 A;  3T93 B;  4PFT A;  4QRZ A;  3IOT A;  4H6D A;  2ALU A;  3H6W A;  3O97 A;  2H99 A;  5DVI A;  1B1X A;  3IOU A;  1IXH A;  4LQ2 A;  4LON B;  2O7U A;  3BKI B;  2O69 A;  1PB9 A;  3FVO A;  2QS1 A;  4AB5 A;  2A5S A;  4O3C A;  4DIG A;  1Y4C A;  4KD5 A;  4OES A;  4C0R A;  4POW A;  3GLB A;  1XHY A;  1P99 A;  2Z8E A;  4P11 A;  5AA4 A;  4F3B A;  1TFD A;  3K00 A;  1LFI A;  3BFU A;  2YPN A;  3C31 A;  2Y7R A;  1VFE A;  2PVU A;  3O9P A;  2RF1 A;  1IIW A;  4ND9 A;  4NWD A;  4Q8R A;  4U1O A;  3F11 A;  1MS7 A;  3UN6 A;  1B0H A;  3CSG A;  1JNF A;  1ZTY A;  5DT6 A;  3PMW A;  3UOR A;  1Y9U A;  2P1S A;  5CM6 A;  1MG1 A;  3MP8 A;  2F8D A;  3LSF B;  2DWJ A;  5B70 A;  1US4 A;  3OO6 A;  3TYH A;  3FD3 A;  1IUD A;  1SBP A;  4YKK A;  4MH5 A;  3IX1 A;  2A5T B;  3FXR A;  1MXZ A;  3SEY A;  4G8N A;  2IEE A;  2DSF A;  3H06 B;  3KN8 A;  1DTG A;  2FA7 A;  3ZKL A;  1LB8 A;  3Q29 A;  5K2Y A;  5LOM A;  1TXF A;  1IIT A;  4DLD A;  2PT1 A;  1OQG A;  4H8I A;  4N6P A;  2HXW A;  3M3L A;  2O1M A;  3CVG A;  3OD7 A;  4WED A;  4O3A A;  5H8S A;  1LST A;  2PT2 A;  5ELV A;  1B5H A;  3GXA A;  3ILU B;  1Z7N E;  1H44 A;  4XKQ A;  4IO4 A;  4R6K A;  1XVY A;  3UK4 A;  1URS A;  1PBQ A;  4ZE9 A;  1KWH A;  2X7P A;  4GF8 A;  3ECR A;  3N6U A;  5CBR A;  1LCF A;  4PQJ A;  1HSE A;  2XXY A;  3G3G A;  1BKA A;  4OWD A;  3PD8 A;  3HHF A;  4GL8 A;  1Y1Z A;  3W15 C;  1VSO A;  1MXX A;  3VE1 B;  4XKN A;  4OTE A;  4JB7 A;  1LCT A;  2PYY A;  3OSQ A;  3FIR A;  1IEJ A;  4G8H A;  4YKI A;  1S9T A;  3MP1 A;  2DYX A;  3G3K A;  3O66 A;  5L9M A;  2OK2 A;  3HPI A;  1JQF A;  1UTB A;  2UVG A;  2NUV A;  3PMX A;  2Q2A A;  1B52 A;  4F39 A;  4ISU A;  3QK6 A;  4R73 A;  3O2A A;  3HV1 A;  4G8M A;  2RCB A;  1SDX A;  1LGB C;  3MZ9 A;  1UIV A;  5I84 A;  1M5B A;  4THI A;  1OQH A;  4ZED A;  4LZ8 A;  4QSC A;  4M4G A;  3EHS A;  3DP8 A;  4LVQ A;  2CMO A;  3O6H A;  3D4C A;  2YLN A;  4N07 A;  4YMB A;  4GWO A;  2QMW A;  4X1D A;  1I69 A;  1A55 A;  5TP9 A;  3C32 A;  2RC7 A;  2DE3 A;  3S9M C;  1IXI A;  1P1N A;  4NE4 A;  1A40 A;  4KQP A;  3IB2 A;  2Y84 A;  1PB7 A;  3V89 B;  2XD2 A;  1WOD A;  4X48 A;  3TFL A;  1D9V A;  1OMP A;  1B46 A;  1URD A;  1ZIU A;  3DP4 A;  3MUQ A;  1B7U A;  4Q0C A;  1M5F A;  2VP1 A;  3U8Q A;  5I58 A;  1Y1M A;  1ELJ A;  5I2K A;  1H76 A;  1GGG A;  1Z7M E;  2QRY A;  4Q5T A;  1GR2 A;  4LA9 A;  1XVX A;  4IGT A;  4Z0I A;  3CI8 A;  1TT1 A;  5TP9 B;  3RUM A;  1LFG A;  4ZZE A;  3S9L C;  5ITP A;  5ICT A;  3B6W A;  1MY4 A;  1ANF A;  4H5G A;  3IR1 A;  2R71 A;  3RPW A;  4NF6 B;  4EQ9 A;  2VOZ A;  4XKP A;  2P0S A;  1QW0 A;  4GL0 A;  3EN3 A;  2RC9 A;  5EYF A;  2XHD A;  2H5Y A;  1Y4T A;  3H6U A;  4G68 A;  4WXJ A;  5F7V A;  1N04 A;  2FYI A;  2QS2 A;  5AE4 A;  3LR1 A;  2OLB A;  3DP6 A;  1ZU0 A;  2E0S A;  3N6T A;  1ZLQ A;  2DWA A;  2DS9 A;  1QUI A;  4U21 A;  1JW1 A;  5I2N A;  1R6Z A;  3JZJ A;  5AA1 A;  1GV8 A;  1XT8 A;  1OIB A;  3M3F A;  2Q9T A;  1B3L A;  5CMC A;  1FTL A;  5K2X A;  3TAJ A;  2V93 A;  4JWO A;  4QF9 A;  1P1U A;  2RC8 A;  3CG3 A;  3I3V A;  1YPN A;  4IO6 A;  1LBB A;  3I5O A;  3MQ9 A;  4G68 B;  2V3T A;  1B4H A;  3FAT A;  2O68 A;  3HO7 A;  5JTY A;  4IGR A;  1SW2 A;  3OMB A;  3SET A;  5JEI A;  1XOC A;  1URG A;  1SYH A;  3C33 A;  1MM6 A;  3CFL A;  3Q25 A;  5FHN A;  2WKY A;  2VGQ A;  2DOJ A;  3K2D A;  1DPE A;  1EZ9 A;  1JET A;  2QL3 A;  1YAE A;  1GVC A;  2O1L A;  1MY1 A;  4R9F A;  4G68 C;  2F7C A;  4I9D A;  3I6V A;  2DWI A;  1S7Y A;  5CC2 A;  4BDR A;  3K01 A;  1MDP 1;  1ZBM A;  4R6H A;  5JTY B;  3VXC A;  4OMB A;  3TPA A;  5I57 A;  2XXI A;  3T66 A;  5AA2 A;  3TEL A;  2ZMB A;  5KCJ A;  4H5F A;  3PUZ E;  4OFJ A;  5BUU A;  1SQY A;  1M5C A;  1Q35 A;  3TQW A;  2XXT A;  1POT A;  3OSR A;  4DDD A;  3H03 A;  4IO5 A;  3MPK A;  1I6B A;  2Y7K A;  1A54 A;  3KG2 A;  1RYX A;  4IB2 A;  4ECF A;  2VD2 A;  1N0T A;  2I4B A;  4ELR A;  3SEW A;  1LFH A;  1DTZ A;  4ESW A;  4KCC A;  3UP9 A;  2Y7P A;  4C1U A;  3MVW A;  1B3G A;  4HCY A;  1B0L A;  4G4P A;  3U92 A;  3OOA A;  2RCA A;  3MW0 A;  2AL5 A;  3PGF A;  1B1H A;  2ZYN A;  5KCJ B;  4MFI A;  3E13 X;  4JDF A;  1GTK A;  3FJG A;  2R9J A;  4BDO A;  3OO8 A;  3ZS6 A;  1P1W A;  3SER A; 
#chains in the Genus database with same CATH topology
 3BBR A;  3W9W A;  4MF3 A;  1UTH A;  1FTO A;  1ZKB A;  4OQO A;  3OEL A;  4FED A;  1MXV A;  3GYY A;  4KI0 E;  2Y5L A;  3MYU A;  3QSL A;  2YJP A;  4PFW A;  5AA2 D;  1B32 A;  1FTJ A;  4WEP A;  2QJE A;  4TQU Q;  1JP4 A;  2LAO A;  4G77 A;  3MVY A;  4P1E A;  5AA3 A;  4NF5 A;  1FBG A;  4PFY A;  3B6T A;  1HSL A;  2QMX A;  3TCG A;  1AH5 A;  3LUY A;  5F24 A;  3CIJ A;  4EQ7 A;  1NMU A;  2NVU B;  4MLV A;  3T9U A;  4OER A;  5AA4 B;  3EQ1 A;  4GQO A;  4GVO A;  4NWC A;  2REJ A;  2I58 A;  4YMA A;  3KZG A;  3QAX A;  3U1O A;  4GBV A;  3N5L A;  2Z22 A;  3K1M A;  3HN0 A;  4C1T A;  5J16 A;  4DXB A;  4RK9 A;  2QS4 A;  4I3Y A;  3IOW A;  2I3V A;  5TU0 A;  1NV2 A;  4PE5 B;  2XXW A;  1CE2 A;  4ELP A;  1XS5 A;  2HXR A;  4KYD A;  3M8U A;  3WAF A;  2Q2C A;  1LBC A;  1FSA A;  3TTM A;  2GH9 A;  1PEB A;  2ZYK A;  1IXG A;  3GBB A;  4BDM A;  2W7Y A;  2UYF A;  3TTK A;  2PFY A;  1MRP A;  4UA8 A;  1B05 A;  1YXI A;  3K02 A;  2B3B A;  1B58 A;  3N26 A;  1B7H A;  1SYI A;  2DWH A;  3IB0 A;  4P1L A;  3E3K A;  1PBP A;  2V84 A;  3GBA A;  1TWY A;  3KBR A;  1F9B A;  2PX1 A;  4OVQ A;  3LC8 A;  2P3V A;  2F7A A;  2Z8D A;  5LTC A;  4POX A;  5EHS A;  2H9B A;  5FHO A;  2CZK A;  5CMM A;  4GOT A;  3CR9 A;  5H8F A;  5FBP A;  4GXA A;  5TPA A;  1IME A;  5IZZ A;  3Q27 A;  3FXQ A;  3OO9 A;  2B3F A;  2XXR A;  1MXY A;  2Y7I A;  4OXV A;  1FQA A;  1NNK A;  3PUW E;  4U4S A;  2HZK A;  4NGU A;  3L6G A;  3LBS A;  3TUS A;  1MH4 A;  2OZZ A;  3PUV E;  3R6U A;  5HPQ A;  1LAF E;  3MAM A;  3IOV A;  4E0W A;  4XTC Q;  2I48 A;  4O3B A;  4QFN A;  1NFT A;  1FQC A;  4TOZ A;  1IMA A;  3DM0 A;  3C4M A;  1FBE A;  4QBA A;  2R6G E;  4F2O A;  1QKA A;  2ZNT A;  4DE8 A;  4TLM B;  1DK4 A;  3ISP A;  2Y5K A;  3H3G A;  4LUB A;  2G93 A;  3LSX A;  5EQ9 A;  3G3F A;  4N8G A;  4R72 A;  5TPA B;  2XXP A;  2DXY A;  1DBZ A;  3U65 A;  2XXQ A;  4F22 A;  4F1Y A;  1JW4 A;  2I0B A;  1LLS A;  1B7Z A;  5KZT A;  4R2F A;  2F5X A;  4M1V A;  5FHM A;  4DZ1 A;  3IL1 B;  1FBF A;  1UTB B;  4PF6 A;  3TCH A;  1SW5 A;  2BJJ X;  3QUJ A;  1LBW A;  1FPD A;  3MP6 A;  3P7I A;  4I1D A;  3CSB A;  4H0W A;  4IO3 A;  3T22 A;  2P2A A;  4F2Q A;  1NNF A;  3TTL A;  2JJK A;  2ZNS A;  1B5J A;  2QS3 A;  4JWY A;  4YZZ A;  1VR5 A;  2GHA A;  2ZNU A;  1MQG A;  2NWJ A;  3ILT B;  4GLI A;  2XA5 A;  2CEY A;  4MLQ A;  1EYI A;  5EYH A;  5L9S A;  4H67 A;  1FCK A;  1QVS A;  2DP8 A;  1A7L A;  4U1Z A;  2D3I A;  2GFE A;  1N7W A;  2ZYM A;  3TCF A;  3O28 A;  4NF4 A;  1SI0 A;  1MPC A;  3TEP A;  1LBZ A;  4N81 A;  4FEB A;  4NF8 A;  1QUL A;  3MC2 A;  1Y3P A;  5DVJ A;  3VXB A;  1AIV A;  3S9E A;  3KN3 A;  4ZEC A;  1Y20 A;  1LBV A;  1O7T A;  1K9Z A;  2FIE A;  5H8H A;  4NTL A;  3UGW A;  4KYS A;  1II5 A;  3VVE A;  4YB7 A;  1USY E;  4O8M A;  2PBW A;  2UXA A;  4AB6 A;  1B2H A;  2OBG A;  1R1N A;  3K4U A;  3A3U A;  3V83 A;  1B5I A;  4R74 A;  1MY0 A;  4KPT A;  5I58 B;  1MQI A;  3VV5 A;  2Q8M A;  2HAU A;  4PC9 A;  4OFL A;  2Z23 A;  1DPP A;  5I2K B;  4PP0 A;  3IO6 A;  4G61 A;  3QUF A;  3THI A;  1FPB A;  4TLL B;  1K9Y A;  4YB5 A;  4PDH A;  3PPQ A;  3W9V A;  4NF4 B;  4PF8 A;  5KDT A;  2Q89 A;  5I56 A;  2G29 A;  3DLN A;  4R9G A;  3K6W A;  1IXC A;  4AQ4 A;  4F1U A;  3IJX B;  2AL4 A;  3CFZ A;  1MQD A;  3G3H A;  3G7W A;  3KC0 A;  5H8H B;  4N15 A;  2HZL A;  4QFO A;  4P0G A;  3ZSF A;  3FGS A;  5ITO A;  1IMD A;  4X9T A;  3V8X B;  4LP2 B;  1DSN A;  4R2B A;  2O7I A;  3FVK A;  3G3J A;  1YCJ A;  2F7B A;  4DCX A;  1PDA A;  1KZ8 A;  4YAH X;  1NL5 A;  1A8F A;  3IJO B;  1UQW A;  1I6A A;  4FBP A;  4XEQ A;  4KR5 A;  3C9H A;  2OCU A;  4HXV A;  4LN5 A;  3M3K A;  2CZL A;  1T0K A;  1R9L A;  4JSO A;  4BDL A;  1R9Q A;  2QPQ A;  4F3P A;  4F19 A;  2UYE A;  4XFE A;  3HFU A;  5I56 B;  3WAE A;  5CI5 A;  1S50 A;  3MJN A;  1VDW A;  1NKX A;  2WX9 A;  1FBP A;  1VFD A;  3SKP A;  4QSD A;  1NNP A;  4EF1 A;  4GWS A;  5I2N B;  2F97 A;  2NXO A;  2AIX A;  3MPL A;  1BP5 A;  2HAV A;  4DXU A;  4H65 A;  3K0V A;  2OWT A;  4FE8 A;  5FTH A;  4OEN A;  4RYA A;  2P3N A;  2Z8F A;  3MBP A;  1OLA A;  1N3X A;  5DEX A;  1USY H;  1B6H A;  5JK4 A;  4YKP A;  5CMB A;  1MXW A;  1N84 A;  3EHU A;  4FIM A;  1ZJL A;  4X04 A;  4FOR A;  2H98 A;  4UAB A;  2XD3 A;  2Q74 A;  3MWB A;  3ZKK A;  3RPL A;  4PGP A;  1BTJ A;  4RPO A;  3KOT A;  2UVI A;  3QIM A;  5FTI A;  3T0J A;  3U94 A;  4PFI A;  5BWJ A;  4IO2 A;  1NV3 A;  4ZE8 A;  1LB9 A;  2GRV A;  3O6G A;  3KFM A;  4F1V A;  3MVZ A;  2CEX A;  1UIU A;  2QVV A;  2XX8 A;  2KLF A;  1D9Y A;  3B6Q A;  1NH8 A;  4JSD A;  4PBH A;  4IR8 A;  3N94 A;  4GX6 A;  1NH7 A;  4YU0 A;  3O29 A;  2XWO A;  4PFR A;  5CMK A;  4JVI A;  3PPR A;  3TQL A;  2HEU A;  1B3F A;  4U2R A;  4JXI A;  5DTB A;  4IY6 A;  5I5P A;  3SEX A;  2VHA A;  5I57 B;  3E78 A;  4EDP A;  5AA2 B;  1NV1 A;  4EXK A;  1QUK A;  3AXF A;  3LSW A;  1A99 A;  1B4Z A;  5LDZ A;  1Y3Q A;  5IKB A;  2FBP A;  1YZ0 A;  1Q1K A;  3CHG A;  4MNP A;  4I8C A;  3PUY E;  1BIY A;  4FAT A;  4I40 A;  1L5T A;  3H4Z A;  3D1R A;  3K6V A;  3LV0 A;  4H46 A;  5EHM A;  1JEV A;  2HPG A;  2WEF A;  4BDN A;  3ONM A;  1FQE A;  3FV2 A;  5M2V A;  4OVT A;  4RNS A;  3FJ7 A;  3KC1 A;  4RK2 A;  1DMB A;  2XXH A;  1P1O A;  4MIJ A;  1OVT A;  2F78 A;  1POY 1;  2A5T A;  5IZ3 A;  4P0I A;  3G3I A;  2HCA A;  3KOS A;  4WKM A;  3E9X A;  3RYD A;  2HFB A;  3ODB A;  1FQB A;  2B4L A;  1BLF A;  3IK6 B;  1INP A;  1IMB A;  4N13 A;  5HBC A;  3BIG A;  3PPP A;  4G2Z A;  2F6P A;  1SI1 A;  3K6U A;  3VFJ A;  1ATG A;  2XX7 A;  3HCQ A;  2D5W A;  1P1Q A;  2OWS A;  1AOV A;  3SEV A;  3VLW A;  1Y3N A;  1UTH B;  3RT8 A;  5L8D A;  4OEV A;  1D3K A;  3T1B A;  1H45 A;  3IB1 A;  3E4R A;  5ESY A;  4NHB A;  2B4M A;  3IFA A;  2ESN A;  3OXN A;  3HST A;  2I3W A;  2D21 A;  4PFU A;  4NF5 B;  3QXM A;  1A8E A;  2V25 A;  3DEL B;  3EHT A;  1OLC A;  5ISU A;  1H43 A;  2HQ0 A;  2CZH A;  3A09 A;  4L17 A;  5DYH A;  2F3B A;  1LAG E;  2THI A;  1B9J A;  3BIH A;  1EU8 A;  3OEN A;  4PTK A;  2DE2 A;  3OEM A;  3K1N A;  2WBB A;  4OET A;  2UVH A;  1FPK A;  2DVC A;  4ZDM A;  3PMV A;  4P8B A;  4ZS9 A;  2XX9 A;  2ZXT A;  3L6H A;  3FXB A;  4KFQ A;  3VVF A;  3MVX A;  5EYG A;  4GRK A;  4YIC A;  5I3S A;  3U72 A;  4FJP A;  4QFP A;  3KJ7 A;  4MAG A;  3RY3 A;  4Q30 B;  4ZEI A;  1MDQ A;  4OZ9 A;  4GWY A;  2F3D A;  3CFX A;  3VLV A;  4EF2 A;  4BDQ A;  2FHY A;  2WYK A;  1VE4 A;  5H8N A;  5A5X A;  3FUZ A;  3Q26 A;  4PFB A;  2PCR A;  4FAJ A;  1LBY A;  2ONS A;  3T9V A;  4ELO A;  2H25 A;  1YTV A;  4U23 A;  3UA8 A;  3OEK A;  2XXV A;  1ZMG A;  5HM4 B;  2DXR A;  1NV7 A;  1WDN A;  4JWX A;  4RJZ A;  5CRY A;  2ABH A;  1FQF A;  4KYE A;  3KSJ A;  2E1S A;  3U93 A;  2QVR A;  4ELQ A;  1MQJ A;  1EZO A;  2UVJ A;  3RT6 B;  2DVZ A;  5F1Q A;  1QGX A;  3LSL A;  3H6T A;  2I0C A;  4LQ5 A;  4ZZA A;  3TOD A;  2AYS A;  3S2V A;  4GFR A;  3KSX A;  1NV0 A;  1XC1 A;  3RN8 A;  1PB8 A;  4QFL A;  1D9Q A;  3FXU A;  4N91 A;  1LAX A;  3KGC A;  5H8N B;  5A5X B;  2OJT A;  1B3H A;  4LZ7 A;  2OWZ A;  3K1P A;  4F31 B;  5H8F B;  1IZ1 A;  3VDF A;  2I4C A;  4R6Y A;  2H4I A;  2ONR A;  3RGY A;  3RQT A;  3PTY A;  3T96 B;  3EF7 A;  3RNN A;  3QYT A;  5ET5 A;  5L9O A;  3R26 A;  4NAP A;  1I6Q A;  1KA0 A;  2F6G A;  3TDJ A;  4EUO A;  4O7I A;  1AMF A;  1RDZ A;  1NV5 A;  3FVG A;  4GIZ A;  3MZB A;  4GD5 A;  3S4U A;  2O84 X;  4JVC A;  3PD9 A;  1EZP A;  1WVJ A;  1Q9D A;  2V3Q A;  1M5E A;  4EXL A;  2V3U A;  2XXU A;  4F18 A;  3FVN A;  4OFO A;  3TZA A;  3SES A;  1O63 A;  3FV1 A;  1FW0 A;  4ONY A;  2B65 A;  4KHZ E;  5I59 A;  2Q88 A;  2DE4 A;  1SVX B;  2RIN A;  3IAZ A;  4NED A;  1JW5 A;  5IZ1 A;  4K3F A;  2X7Q A;  4HTG A;  5EQ8 A;  4O7M A;  1MH3 A;  3RTW B;  3KN7 A;  3O6I A;  4FEC A;  3MZ1 A;  4YB6 A;  1FBC A;  4NF6 A;  1M5D A;  3S9N C;  2X26 A;  4HE0 A;  4X1B A;  1RDY A;  4OYV A;  2FNC A;  1FPG A;  3HHG A;  3A29 A;  5DVF A;  4BLA A;  3CG1 A;  4UAC A;  4DXC A;  1MPD A;  4IY5 A;  3USD A;  1NUW A;  2GHB A;  4EQB A;  2XXX A;  4LZ5 A;  4AS5 A;  1LAH E;  2I6E A;  1J1N A;  3RLF E;  5I59 B;  1B3E A;  4E0X A;  3TMG A;  3D4G A;  4HW8 A;  3B7D A;  3IO4 A;  3KEI A;  1SW4 A;  4KCD A;  3PPN A;  4OEU A;  1AWB A;  4OA4 A;  2VD3 A;  4ZEK A;  4QSE A;  4HCW A;  4ZEF A;  4RXL A;  1O64 A;  4R75 A;  5IAI A;  1NNT A;  2OX3 A;  3C34 A;  3CRB A;  3EPE A;  5J1D A;  2REG A;  1N7X A;  4PET A;  2ZYO A;  3TTN A;  1IQ7 A;  1IMC A;  2ANJ A;  2XWK A;  1MXU A;  2F35 A;  4RA1 A;  4LAT A;  5H8Q A;  4F29 A;  3H7M A;  1QKB A;  4NF8 B;  2RKM A;  5B7D A;  2M8C A;  4NF0 A;  1B51 A;  1QJM A;  1MQH A;  3FJM A;  3VLU A;  4OVJ A;  1TFA A;  3C35 A;  4Z7E A;  2PMS A;  4OHN A;  4MBP A;  4XIG Q;  2IA4 A;  2FVZ A;  1EYJ A;  3SDF A;  1MPB A;  3FBP A;  4ZEB A;  3TKD A;  1EYK A;  4XXU A;  2F34 A;  3JYR A;  3OO7 A;  1N76 A;  2O51 A;  1MY3 A;  4F3S A;  1FTM A;  4H8J A;  3T9X B;  5CBS A;  1FQD A;  1NV4 A;  3BFT A;  4ESX A;  5H8Q B;  5KDT B;  1DCU A;  2ONK E;  4PCD A;  3UIF A;  1JVX A;  4U4X A;  2QSX A;  4H1X A;  4RPN A;  4I62 A;  2VPN A;  3Q28 A;  1D4N A;  3VVD A;  2DQV A;  1DOT A;  4GXS B;  3FZV A;  3SZP A;  4P47 A;  2Q8J A;  2NOO A;  3T9H B;  1MY2 A;  4OVR A;  1CB6 A;  1JVY A;  4JBZ A;  3TTR A;  2O6A A;  3H6V A;  2Y7W A;  4PGN A;  1SW1 A;  4RY1 A;  1HSJ A;  4N6K A;  4MX6 A;  4H45 A;  2I49 A;  1RDX A;  4U22 A;  3IOR A;  3A3C A;  1B40 A;  4QFK A;  5ICQ A;  1PC3 A;  4MHF A;  3PPO A;  2XXK A;  4GWZ A;  3V5A A;  3GZG A;  4F3G A;  1EH3 A;  2DDK A;  4NX1 A;  4DCY A;  1QUJ A;  3R7X A;  3JV9 A;  1FJ6 A;  1RKM A;  1OVB A;  1FPL A;  1SD3 A;  1H3D A;  4YKJ A;  5ET6 A;  1FTK A;  4QHQ A;  4HS7 A;  3RTF B;  3PU5 A;  5DEX B;  3SEU A;  3PUX E;  4XKR A;  2BJI A;  4NMY A;  3FAS A;  1MM7 A;  4IO7 A;  2F36 A;  3KJT A;  3PV0 E;  1N3W A;  3K6X A;  1US5 A;  1JEU A;  1RYO A;  3RPL B;  1AL3 A;  3C36 A;  3T93 B;  4DI4 B;  4PFT A;  4QRZ A;  3IOT A;  4H6D A;  2ALU A;  3H6W A;  3O97 A;  2H99 A;  5DVI A;  4NN3 A;  1B1X A;  1CNQ A;  3IOU A;  1IXH A;  4LQ2 A;  4LON B;  2O7U A;  3BKI B;  2O69 A;  1PB9 A;  3FVO A;  1FRP A;  4GBW A;  2QS1 A;  4AB5 A;  2A5S A;  4O3C A;  4DIG A;  1Y4C A;  4KD5 A;  4HE2 A;  4OES A;  4AS4 A;  4C0R A;  4P3L A;  4POW A;  3GLB A;  1XHY A;  1P99 A;  2Z8E A;  4P11 A;  5AA4 A;  4F3B A;  1TFD A;  3K00 A;  1LFI A;  3BFU A;  2YPN A;  3C31 A;  2Y7R A;  4OVS A;  1VFE A;  2ZZV A;  1FJ9 A;  2PVU A;  3O9P A;  2RF1 A;  1IIW A;  4ND9 A;  4NWD A;  4Q8R A;  5IM2 A;  4U1O A;  3F11 A;  1MS7 A;  3UN6 A;  1B0H A;  3CSG A;  1JNF A;  1ZTY A;  5DT6 A;  3PMW A;  3UOR A;  1Y9U A;  2P1S A;  5CM6 A;  1MG1 A;  3MP8 A;  2F8D A;  3LSF B;  2DWJ A;  1US4 A;  5B70 A;  2KQZ A;  3OO6 A;  3TYH A;  5EQ7 A;  3FD3 A;  1IUD A;  1SBP A;  4YKK A;  4MH5 A;  3IX1 A;  2A5T B;  5IZ3 B;  3FXR A;  1FPF A;  1MXZ A;  3SEY A;  4G8N A;  2IEE A;  2DSF A;  3H06 B;  3KN8 A;  1DTG A;  2FA7 A;  3ZKL A;  1LB8 A;  3Q29 A;  5K2Y A;  5LOM A;  1TXF A;  1IIT A;  4DLD A;  2PT1 A;  1OQG A;  3QMF A;  4H8I A;  4N6P A;  2HXW A;  1YYZ A;  3M3L A;  3KBZ A;  1FPE A;  2O1M A;  3CVG A;  3OD7 A;  4WED A;  4HE1 A;  4O3A A;  5H8S A;  1LST A;  2PT2 A;  5ELV A;  1B5H A;  4MMP A;  1KA1 A;  3GXA A;  2PFZ A;  3ILU B;  1Z7N E;  1H44 A;  4XKQ A;  4IO4 A;  4R6K A;  1XVY A;  3UK4 A;  4XF5 A;  2ZZX A;  4N6D A;  1URS A;  1NUX A;  1NI9 A;  1PBQ A;  4ZE9 A;  1KWH A;  2X7P A;  1LEV A;  2QVU A;  4GF8 A;  3ECR A;  3N6U A;  1NV6 A;  4PAK A;  5CBR A;  1LCF A;  4PQJ A;  1HSE A;  2XXY A;  3G3G A;  1BKA A;  4OWD A;  3PD8 A;  2CZI A;  3HHF A;  4GL8 A;  1Y1Z A;  3W15 C;  1VSO A;  1MXX A;  3VE1 B;  4XKN A;  2ZZW A;  4OTE A;  4JB7 A;  1LCT A;  2PYY A;  3OSQ A;  3FIR A;  1IEJ A;  4G8H A;  1NUY A;  4YKI A;  1S9T A;  3MP1 A;  2DYX A;  3G3K A;  3O66 A;  5L9M A;  2OK2 A;  5DW8 A;  3HPI A;  1JQF A;  1UTB A;  2UVG A;  2NUV A;  2WBD A;  3PMX A;  2Q2A A;  1B52 A;  4F39 A;  4ISU A;  3QK6 A;  4P56 A;  4R73 A;  3O2A A;  3HV1 A;  4G8M A;  2RCB A;  4PE3 A;  1SDX A;  1LGB C;  3MZ9 A;  4O94 A;  1UIV A;  5I84 A;  5ET8 A;  1M5B A;  4THI A;  1OQH A;  4ZED A;  4LZ8 A;  4QSC A;  4M4G A;  3EHS A;  2XWI A;  3DP8 A;  4LVQ A;  2CMO A;  3O6H A;  3D4C A;  2YLN A;  2KR0 A;  4N07 A;  4YMB A;  1BK4 A;  4GWO A;  2QMW A;  4MNI A;  4X1D A;  1I69 A;  4MCO A;  5EQA A;  1A55 A;  1FPJ A;  5TP9 A;  3C32 A;  2RC7 A;  2DE3 A;  4JVD A;  5IGA A;  3LUZ A;  3S9M C;  1IXI A;  4PBQ A;  1P1N A;  4NE4 A;  1A40 A;  4KQP A;  3IB2 A;  2Y84 A;  4N17 A;  1PB7 A;  3V89 B;  2XD2 A;  1WOD A;  4X48 A;  3TFL A;  1D9V A;  1OMP A;  1B46 A;  1URD A;  1ZIU A;  3DP4 A;  3MUQ A;  1B7U A;  4Q0C A;  1M5F A;  2VP1 A;  3U8Q A;  5I58 A;  1Y1M A;  1ELJ A;  5I2K A;  4MEV A;  4GWX A;  1H76 A;  1G0H A;  1GGG A;  1FBH A;  1Z7M E;  2QRY A;  4Q5T A;  1GR2 A;  4LA9 A;  1XVX A;  4IGT A;  4Z0I A;  4N4U A;  3CI8 A;  1TT1 A;  5TP9 B;  3RUM A;  1LFG A;  4ZZE A;  3S9L C;  5ITP A;  5ICT A;  3B6W A;  1MY4 A;  1ANF A;  4H5G A;  3IR1 A;  2R71 A;  3RPW A;  4PDD A;  4NF6 B;  4EQ9 A;  2VOZ A;  4XKP A;  2P0S A;  1QW0 A;  4GL0 A;  2L5V A;  3EN3 A;  2RC9 A;  2XWV A;  4GWW A;  4GWU A;  4GX3 A;  5EYF A;  2XHD A;  2H5Y A;  1Y4T A;  3H6U A;  4G68 A;  4WXJ A;  4PAI A;  5F7V A;  1N04 A;  2FYI A;  2QS2 A;  5AE4 A;  3LR1 A;  2OLB A;  3DP6 A;  1ZU0 A;  2E0S A;  3N6T A;  4MJO A;  1ZLQ A;  2DWA A;  2DS9 A;  4KXP A;  1QUI A;  1NUZ A;  4U21 A;  1JW1 A;  5I2N A;  1R6Z A;  3JZJ A;  5AA1 A;  1GV8 A;  1XT8 A;  1OIB A;  3M3F A;  2VPO A;  2Q9T A;  1B3L A;  5CMC A;  1FTL A;  5K2X A;  3TAJ A;  2V93 A;  4JWO A;  4QF9 A;  1P1U A;  2RC8 A;  3CG3 A;  3I3V A;  1YPN A;  4IO6 A;  5ET7 A;  4I3E A;  1LBB A;  3I5O A;  4NG7 A;  1FPI A;  5A5L A;  3MQ9 A;  4G68 B;  2V3T A;  1B4H A;  2FIX A;  2O68 A;  3FAT A;  3HO7 A;  4P9K A;  5JTY A;  4IGR A;  1SW2 A;  3OMB A;  4GX4 A;  3SET A;  5JEI A;  1XOC A;  1URG A;  4NQ8 A;  1SYH A;  3C33 A;  4OVP A;  1MM6 A;  3CFL A;  3Q25 A;  4MNC A;  5FHN A;  2WKY A;  2VGQ A;  2DOJ A;  3K2D A;  1DPE A;  1SPI A;  1EZ9 A;  1JET A;  2QL3 A;  1YAE A;  1GVC A;  2O1L A;  1FTA A;  1MY1 A;  3E79 A;  4R9F A;  3IFC A;  4G68 C;  4OAN A;  1LBX A;  2F7C A;  4I9D A;  3I6V A;  3EKI A;  2DWI A;  1S7Y A;  5CC2 A;  4BDR A;  3K01 A;  1MDP 1;  1ZBM A;  4R6H A;  5JTY B;  3VXC A;  4OMB A;  3TPA A;  5I57 A;  2XXI A;  3T66 A;  5AA2 A;  4N8Y A;  3TEL A;  3NOH A;  2ZMB A;  5KCJ A;  4H5F A;  3PUZ E;  2QFL A;  4OFJ A;  5BUU A;  1SQY A;  1M5C A;  4DI3 D;  1Q35 A;  3TQW A;  2XXT A;  1POT A;  3OSR A;  4DDD A;  3MST A;  2GQ1 A;  2HHM A;  3H03 A;  4IO5 A;  3ROJ A;  4PAF A;  2R8T A;  3MPK A;  1I6B A;  2Y7K A;  1A54 A;  3KG2 A;  1RYX A;  1XI6 A;  4IB2 A;  4ECF A;  2VD2 A;  4QXD A;  1N0T A;  2I4B A;  4ELR A;  1G0I A;  3B8B A;  3SEW A;  5T3J A;  1LFH A;  1DTZ A;  1FBD A;  4ESW A;  3B50 A;  4KCC A;  3UP9 A;  2Y7P A;  4C1U A;  2WYP A;  3MVW A;  1B3G A;  2V4C A;  4HCY A;  1B0L A;  4G4P A;  1IMF A;  3U92 A;  3OOA A;  4X8R A;  2RCA A;  3MW0 A;  2AL5 A;  3PGF A;  1B1H A;  2ZYN A;  5KCJ B;  4MFI A;  3E13 X;  4JDF A;  1GTK A;  3FJG A;  2R9J A;  4BDO A;  2VT5 A;  3OO8 A;  3ZS6 A;  1P1W A;  5I7I A;  2MKZ A;  3SER A; 
#chains in the Genus database with same CATH homology
 3BBR A;  3W9W A;  4MF3 A;  1UTH A;  1FTO A;  1ZKB A;  4OQO A;  3OEL A;  4FED A;  1MXV A;  4KI0 E;  3QSL A;  4PFW A;  2YJP A;  5AA2 D;  1B32 A;  1FTJ A;  4WEP A;  2QJE A;  4TQU Q;  2LAO A;  4G77 A;  3MVY A;  5AA3 A;  4NF5 A;  4PFY A;  3B6T A;  1HSL A;  2QMX A;  3TCG A;  1AH5 A;  3LUY A;  3CIJ A;  4EQ7 A;  1NMU A;  2NVU B;  4MLV A;  3T9U A;  4OER A;  5AA4 B;  3EQ1 A;  4GQO A;  4GVO A;  4NWC A;  2REJ A;  2I58 A;  4YMA A;  3KZG A;  3QAX A;  3U1O A;  3N5L A;  2Z22 A;  3K1M A;  3HN0 A;  4C1T A;  4DXB A;  4RK9 A;  2QS4 A;  3IOW A;  2I3V A;  5TU0 A;  4PE5 B;  2XXW A;  1CE2 A;  4ELP A;  1XS5 A;  4KYD A;  3M8U A;  3WAF A;  2Q2C A;  1LBC A;  3TTM A;  2GH9 A;  1PEB A;  2ZYK A;  1IXG A;  3GBB A;  4BDM A;  2W7Y A;  2UYF A;  3TTK A;  1MRP A;  4UA8 A;  1B05 A;  3K02 A;  2B3B A;  1B58 A;  3N26 A;  1B7H A;  1SYI A;  2DWH A;  3IB0 A;  3E3K A;  1PBP A;  2V84 A;  3GBA A;  1TWY A;  3KBR A;  1F9B A;  2PX1 A;  3LC8 A;  2F7A A;  2Z8D A;  4POX A;  5EHS A;  2H9B A;  5FHO A;  5CMM A;  4GOT A;  3CR9 A;  5H8F A;  4GXA A;  5TPA A;  3Q27 A;  3FXQ A;  3OO9 A;  2B3F A;  2XXR A;  1MXY A;  2Y7I A;  4OXV A;  1FQA A;  1NNK A;  3PUW E;  4U4S A;  2HZK A;  3L6G A;  3LBS A;  3TUS A;  1MH4 A;  2OZZ A;  3PUV E;  3R6U A;  5HPQ A;  1LAF E;  3MAM A;  3IOV A;  4E0W A;  4XTC Q;  2I48 A;  4O3B A;  4QFN A;  1NFT A;  1FQC A;  4TOZ A;  3DM0 A;  3C4M A;  2R6G E;  4F2O A;  1QKA A;  2ZNT A;  4DE8 A;  4TLM B;  3H3G A;  4LUB A;  2G93 A;  3LSX A;  3G3F A;  4R72 A;  5TPA B;  2XXP A;  2DXY A;  2XXQ A;  4F22 A;  4F1Y A;  1JW4 A;  2I0B A;  1LLS A;  1B7Z A;  5KZT A;  4R2F A;  2F5X A;  4M1V A;  5FHM A;  4DZ1 A;  3IL1 B;  1UTB B;  3TCH A;  1SW5 A;  2BJJ X;  3QUJ A;  3MP6 A;  3P7I A;  4I1D A;  3CSB A;  4H0W A;  4IO3 A;  3T22 A;  2P2A A;  4F2Q A;  1NNF A;  3TTL A;  2ZNS A;  1B5J A;  2QS3 A;  4JWY A;  4YZZ A;  1VR5 A;  2GHA A;  2ZNU A;  1MQG A;  2NWJ A;  3ILT B;  4GLI A;  4MLQ A;  5L9S A;  4H67 A;  1FCK A;  1QVS A;  2DP8 A;  1A7L A;  4U1Z A;  2D3I A;  2GFE A;  1N7W A;  2ZYM A;  3TCF A;  3O28 A;  4NF4 A;  1SI0 A;  1MPC A;  3TEP A;  4FEB A;  4NF8 A;  1QUL A;  3MC2 A;  1Y3P A;  5DVJ A;  3VXB A;  1AIV A;  3S9E A;  3KN3 A;  4ZEC A;  1Y20 A;  1O7T A;  5H8H A;  4NTL A;  3UGW A;  4KYS A;  1II5 A;  3VVE A;  4YB7 A;  1USY E;  2PBW A;  2UXA A;  4AB6 A;  1B2H A;  2OBG A;  1R1N A;  3K4U A;  3A3U A;  3V83 A;  1B5I A;  4R74 A;  1MY0 A;  4KPT A;  5I58 B;  1MQI A;  3VV5 A;  2HAU A;  4OFL A;  2Z23 A;  1DPP A;  5I2K B;  4PP0 A;  3IO6 A;  3QUF A;  3THI A;  4TLL B;  4YB5 A;  3PPQ A;  3W9V A;  4NF4 B;  5KDT A;  2Q89 A;  5I56 A;  2G29 A;  3DLN A;  4R9G A;  3K6W A;  1IXC A;  4AQ4 A;  4F1U A;  3IJX B;  2AL4 A;  3CFZ A;  1MQD A;  3G3H A;  3G7W A;  5H8H B;  2HZL A;  4QFO A;  4P0G A;  3ZSF A;  3FGS A;  5ITO A;  4X9T A;  3V8X B;  4LP2 B;  1DSN A;  4R2B A;  2O7I A;  3FVK A;  3G3J A;  1YCJ A;  2F7B A;  4DCX A;  1PDA A;  4YAH X;  1NL5 A;  1A8F A;  3IJO B;  1UQW A;  1I6A A;  4KR5 A;  3C9H A;  2OCU A;  3M3K A;  2CZL A;  1T0K A;  1R9L A;  4JSO A;  4BDL A;  1R9Q A;  2QPQ A;  4F3P A;  4F19 A;  2UYE A;  5I56 B;  3WAE A;  5CI5 A;  1S50 A;  3MJN A;  1NKX A;  1VFD A;  3SKP A;  4QSD A;  1NNP A;  4EF1 A;  5I2N B;  2F97 A;  2NXO A;  2AIX A;  3MPL A;  1BP5 A;  2HAV A;  4DXU A;  4H65 A;  3K0V A;  2OWT A;  4FE8 A;  5FTH A;  4OEN A;  4RYA A;  2Z8F A;  3MBP A;  1OLA A;  1N3X A;  5DEX A;  1USY H;  1B6H A;  5JK4 A;  4YKP A;  5CMB A;  1MXW A;  1N84 A;  3EHU A;  4FIM A;  1ZJL A;  4FOR A;  2H98 A;  2XD3 A;  3MWB A;  3ZKK A;  1BTJ A;  4RPO A;  3KOT A;  2UVI A;  3QIM A;  5FTI A;  3U94 A;  5BWJ A;  4IO2 A;  4ZE8 A;  1LB9 A;  2GRV A;  3O6G A;  3KFM A;  4F1V A;  3MVZ A;  1UIU A;  2XX8 A;  2KLF A;  1D9Y A;  3B6Q A;  1NH8 A;  4JSD A;  3N94 A;  1NH7 A;  4YU0 A;  3O29 A;  5CMK A;  3PPR A;  3TQL A;  2HEU A;  1B3F A;  4U2R A;  4JXI A;  5DTB A;  4IY6 A;  3SEX A;  2VHA A;  5I57 B;  4EDP A;  5AA2 B;  4EXK A;  1QUK A;  3AXF A;  3LSW A;  1A99 A;  1B4Z A;  1Y3Q A;  5IKB A;  1Q1K A;  4I8C A;  3PUY E;  1BIY A;  4FAT A;  1L5T A;  3H4Z A;  3K6V A;  5EHM A;  1JEV A;  4BDN A;  3ONM A;  1FQE A;  3FV2 A;  5M2V A;  4RNS A;  3FJ7 A;  4RK2 A;  1DMB A;  2XXH A;  1P1O A;  1OVT A;  2F78 A;  1POY 1;  2A5T A;  4P0I A;  3G3I A;  2HCA A;  3KOS A;  4WKM A;  3E9X A;  2HFB A;  3ODB A;  1FQB A;  1BLF A;  3IK6 B;  4N13 A;  5HBC A;  3PPP A;  4G2Z A;  2F6P A;  1SI1 A;  3K6U A;  3VFJ A;  1ATG A;  2XX7 A;  3HCQ A;  2D5W A;  1P1Q A;  2OWS A;  1AOV A;  3SEV A;  3VLW A;  1Y3N A;  1UTH B;  3RT8 A;  5L8D A;  4OEV A;  1D3K A;  1H45 A;  3IB1 A;  3E4R A;  2ESN A;  3OXN A;  3HST A;  2I3W A;  2D21 A;  4PFU A;  4NF5 B;  3QXM A;  1A8E A;  2V25 A;  3DEL B;  3EHT A;  1OLC A;  5ISU A;  1H43 A;  2HQ0 A;  3A09 A;  4L17 A;  5DYH A;  1LAG E;  2THI A;  1B9J A;  1EU8 A;  3OEN A;  2DE2 A;  3OEM A;  3K1N A;  4OET A;  2UVH A;  2DVC A;  4ZDM A;  3PMV A;  4ZS9 A;  2XX9 A;  2ZXT A;  3L6H A;  4KFQ A;  3VVF A;  3MVX A;  4GRK A;  4YIC A;  3U72 A;  4FJP A;  4QFP A;  3KJ7 A;  3RY3 A;  4Q30 B;  4ZEI A;  1MDQ A;  4OZ9 A;  3CFX A;  3VLV A;  4EF2 A;  4BDQ A;  1VE4 A;  5H8N A;  5A5X A;  3FUZ A;  3Q26 A;  4FAJ A;  2ONS A;  3T9V A;  4ELO A;  2H25 A;  1YTV A;  4U23 A;  3UA8 A;  3OEK A;  2XXV A;  1ZMG A;  5HM4 B;  2DXR A;  1WDN A;  4JWX A;  4RJZ A;  5CRY A;  2ABH A;  1FQF A;  3KSJ A;  4KYE A;  2E1S A;  3U93 A;  4ELQ A;  1MQJ A;  1EZO A;  2UVJ A;  3RT6 B;  2DVZ A;  5F1Q A;  3LSL A;  3H6T A;  2I0C A;  4LQ5 A;  4ZZA A;  3TOD A;  2AYS A;  3S2V A;  4GFR A;  3KSX A;  1XC1 A;  3RN8 A;  1PB8 A;  4QFL A;  3FXU A;  1LAX A;  3KGC A;  5H8N B;  5A5X B;  2OJT A;  1B3H A;  4LZ7 A;  3K1P A;  4F31 B;  5H8F B;  1IZ1 A;  3VDF A;  2I4C A;  4R6Y A;  2H4I A;  2ONR A;  3RGY A;  3RQT A;  3T96 B;  3EF7 A;  3RNN A;  3QYT A;  5L9O A;  3R26 A;  1I6Q A;  2F6G A;  3TDJ A;  4EUO A;  1AMF A;  3FVG A;  4GIZ A;  3MZB A;  4GD5 A;  3S4U A;  2O84 X;  3PD9 A;  1EZP A;  1WVJ A;  2V3Q A;  1M5E A;  4EXL A;  2V3U A;  2XXU A;  4F18 A;  3FVN A;  4OFO A;  3TZA A;  3SES A;  1O63 A;  3FV1 A;  1FW0 A;  4ONY A;  2B65 A;  4KHZ E;  5I59 A;  2Q88 A;  2DE4 A;  1SVX B;  2RIN A;  3IAZ A;  4NED A;  1JW5 A;  4K3F A;  2X7Q A;  4HTG A;  1MH3 A;  3RTW B;  3KN7 A;  3O6I A;  4FEC A;  3MZ1 A;  4YB6 A;  4NF6 A;  1M5D A;  3S9N C;  2X26 A;  4X1B A;  4OYV A;  2FNC A;  3HHG A;  5DVF A;  4BLA A;  3CG1 A;  4UAC A;  4DXC A;  1MPD A;  4IY5 A;  3USD A;  2GHB A;  4EQB A;  2XXX A;  4LZ5 A;  1LAH E;  2I6E A;  1J1N A;  3RLF E;  5I59 B;  1B3E A;  4E0X A;  3TMG A;  3D4G A;  4HW8 A;  3B7D A;  3IO4 A;  3KEI A;  1SW4 A;  4KCD A;  3PPN A;  4OEU A;  2VD3 A;  4ZEK A;  4QSE A;  4HCW A;  4ZEF A;  4RXL A;  1O64 A;  4R75 A;  5IAI A;  1NNT A;  3C34 A;  3CRB A;  3EPE A;  5J1D A;  2REG A;  1N7X A;  4PET A;  2ZYO A;  3TTN A;  1IQ7 A;  2ANJ A;  1MXU A;  2F35 A;  4LAT A;  4RA1 A;  5H8Q A;  4F29 A;  3H7M A;  1QKB A;  4NF8 B;  2RKM A;  5B7D A;  2M8C A;  1B51 A;  1QJM A;  1MQH A;  3FJM A;  3VLU A;  4OVJ A;  1TFA A;  3C35 A;  4Z7E A;  2PMS A;  4OHN A;  4MBP A;  4XIG Q;  2IA4 A;  3SDF A;  1MPB A;  4ZEB A;  3TKD A;  4XXU A;  2F34 A;  3JYR A;  3OO7 A;  1N76 A;  2O51 A;  1MY3 A;  4F3S A;  1FTM A;  4H8J A;  3T9X B;  5CBS A;  1FQD A;  3BFT A;  4ESX A;  5H8Q B;  5KDT B;  2ONK E;  3UIF A;  1JVX A;  4U4X A;  2QSX A;  4H1X A;  4RPN A;  4I62 A;  3Q28 A;  1D4N A;  3VVD A;  2DQV A;  1DOT A;  4GXS B;  3FZV A;  2Q8J A;  2NOO A;  3T9H B;  1MY2 A;  1CB6 A;  1JVY A;  4JBZ A;  3TTR A;  2O6A A;  3H6V A;  2Y7W A;  1SW1 A;  4RY1 A;  1HSJ A;  2I49 A;  4U22 A;  3IOR A;  3A3C A;  1B40 A;  4QFK A;  5ICQ A;  1PC3 A;  3PPO A;  3V5A A;  3GZG A;  4F3G A;  1EH3 A;  4DCY A;  1QUJ A;  3R7X A;  3JV9 A;  1RKM A;  1OVB A;  1SD3 A;  1H3D A;  4YKJ A;  1FTK A;  4QHQ A;  4HS7 A;  3RTF B;  3PU5 A;  5DEX B;  3SEU A;  3PUX E;  4XKR A;  4NMY A;  3FAS A;  1MM7 A;  4IO7 A;  2F36 A;  3KJT A;  3PV0 E;  1N3W A;  3K6X A;  1US5 A;  1JEU A;  1RYO A;  1AL3 A;  3C36 A;  3T93 B;  4PFT A;  4QRZ A;  3IOT A;  4H6D A;  2ALU A;  3H6W A;  3O97 A;  2H99 A;  5DVI A;  1B1X A;  3IOU A;  1IXH A;  4LQ2 A;  4LON B;  2O7U A;  3BKI B;  2O69 A;  1PB9 A;  3FVO A;  2QS1 A;  4AB5 A;  2A5S A;  4O3C A;  4DIG A;  1Y4C A;  4KD5 A;  4OES A;  4C0R A;  4POW A;  3GLB A;  1XHY A;  1P99 A;  2Z8E A;  4P11 A;  5AA4 A;  4F3B A;  1TFD A;  3K00 A;  1LFI A;  3BFU A;  2YPN A;  3C31 A;  2Y7R A;  1VFE A;  2PVU A;  3O9P A;  2RF1 A;  1IIW A;  4ND9 A;  4NWD A;  4Q8R A;  4U1O A;  3F11 A;  1MS7 A;  3UN6 A;  1B0H A;  3CSG A;  1JNF A;  1ZTY A;  5DT6 A;  3PMW A;  3UOR A;  1Y9U A;  2P1S A;  5CM6 A;  1MG1 A;  3MP8 A;  2F8D A;  3LSF B;  2DWJ A;  5B70 A;  1US4 A;  3OO6 A;  3TYH A;  3FD3 A;  1IUD A;  1SBP A;  4YKK A;  4MH5 A;  3IX1 A;  2A5T B;  3FXR A;  1MXZ A;  3SEY A;  4G8N A;  2IEE A;  2DSF A;  3H06 B;  3KN8 A;  1DTG A;  2FA7 A;  3ZKL A;  1LB8 A;  3Q29 A;  5K2Y A;  5LOM A;  1TXF A;  1IIT A;  4DLD A;  2PT1 A;  1OQG A;  4H8I A;  4N6P A;  2HXW A;  3M3L A;  2O1M A;  3CVG A;  3OD7 A;  4WED A;  4O3A A;  5H8S A;  1LST A;  2PT2 A;  5ELV A;  1B5H A;  3GXA A;  3ILU B;  1Z7N E;  1H44 A;  4XKQ A;  4IO4 A;  4R6K A;  1XVY A;  3UK4 A;  1URS A;  1PBQ A;  4ZE9 A;  1KWH A;  2X7P A;  4GF8 A;  3ECR A;  3N6U A;  5CBR A;  1LCF A;  4PQJ A;  1HSE A;  2XXY A;  3G3G A;  1BKA A;  4OWD A;  3PD8 A;  3HHF A;  4GL8 A;  1Y1Z A;  3W15 C;  1VSO A;  1MXX A;  3VE1 B;  4XKN A;  4OTE A;  4JB7 A;  1LCT A;  2PYY A;  3OSQ A;  3FIR A;  1IEJ A;  4G8H A;  4YKI A;  1S9T A;  3MP1 A;  2DYX A;  3G3K A;  3O66 A;  5L9M A;  2OK2 A;  3HPI A;  1JQF A;  1UTB A;  2UVG A;  2NUV A;  3PMX A;  2Q2A A;  1B52 A;  4F39 A;  4ISU A;  3QK6 A;  4R73 A;  3O2A A;  3HV1 A;  4G8M A;  2RCB A;  1SDX A;  1LGB C;  3MZ9 A;  1UIV A;  5I84 A;  1M5B A;  4THI A;  1OQH A;  4ZED A;  4LZ8 A;  4QSC A;  4M4G A;  3EHS A;  3DP8 A;  4LVQ A;  2CMO A;  3O6H A;  3D4C A;  2YLN A;  4N07 A;  4YMB A;  4GWO A;  2QMW A;  4X1D A;  1I69 A;  1A55 A;  5TP9 A;  3C32 A;  2RC7 A;  2DE3 A;  3S9M C;  1IXI A;  1P1N A;  4NE4 A;  1A40 A;  4KQP A;  3IB2 A;  2Y84 A;  1PB7 A;  3V89 B;  2XD2 A;  1WOD A;  4X48 A;  3TFL A;  1D9V A;  1OMP A;  1B46 A;  1URD A;  1ZIU A;  3DP4 A;  3MUQ A;  1B7U A;  4Q0C A;  1M5F A;  2VP1 A;  3U8Q A;  5I58 A;  1Y1M A;  1ELJ A;  5I2K A;  1H76 A;  1GGG A;  1Z7M E;  2QRY A;  4Q5T A;  1GR2 A;  4LA9 A;  1XVX A;  4IGT A;  4Z0I A;  3CI8 A;  1TT1 A;  5TP9 B;  3RUM A;  1LFG A;  4ZZE A;  3S9L C;  5ITP A;  5ICT A;  3B6W A;  1MY4 A;  1ANF A;  4H5G A;  3IR1 A;  2R71 A;  3RPW A;  4NF6 B;  4EQ9 A;  2VOZ A;  4XKP A;  2P0S A;  1QW0 A;  4GL0 A;  3EN3 A;  2RC9 A;  5EYF A;  2XHD A;  2H5Y A;  1Y4T A;  3H6U A;  4G68 A;  4WXJ A;  5F7V A;  1N04 A;  2FYI A;  2QS2 A;  5AE4 A;  3LR1 A;  2OLB A;  3DP6 A;  1ZU0 A;  2E0S A;  3N6T A;  1ZLQ A;  2DWA A;  2DS9 A;  1QUI A;  4U21 A;  1JW1 A;  5I2N A;  1R6Z A;  3JZJ A;  5AA1 A;  1GV8 A;  1XT8 A;  1OIB A;  3M3F A;  2Q9T A;  1B3L A;  5CMC A;  1FTL A;  5K2X A;  3TAJ A;  2V93 A;  4JWO A;  4QF9 A;  1P1U A;  2RC8 A;  3CG3 A;  3I3V A;  1YPN A;  4IO6 A;  1LBB A;  3I5O A;  3MQ9 A;  4G68 B;  2V3T A;  1B4H A;  3FAT A;  2O68 A;  3HO7 A;  5JTY A;  4IGR A;  1SW2 A;  3OMB A;  3SET A;  5JEI A;  1XOC A;  1URG A;  1SYH A;  3C33 A;  1MM6 A;  3CFL A;  3Q25 A;  5FHN A;  2WKY A;  2VGQ A;  2DOJ A;  3K2D A;  1DPE A;  1EZ9 A;  1JET A;  2QL3 A;  1YAE A;  1GVC A;  2O1L A;  1MY1 A;  4R9F A;  4G68 C;  2F7C A;  4I9D A;  3I6V A;  2DWI A;  1S7Y A;  5CC2 A;  4BDR A;  3K01 A;  1MDP 1;  1ZBM A;  4R6H A;  5JTY B;  3VXC A;  4OMB A;  3TPA A;  5I57 A;  2XXI A;  3T66 A;  5AA2 A;  3TEL A;  2ZMB A;  5KCJ A;  4H5F A;  3PUZ E;  4OFJ A;  5BUU A;  1SQY A;  1M5C A;  1Q35 A;  3TQW A;  2XXT A;  1POT A;  3OSR A;  4DDD A;  3H03 A;  4IO5 A;  3MPK A;  1I6B A;  2Y7K A;  1A54 A;  3KG2 A;  1RYX A;  4IB2 A;  4ECF A;  2VD2 A;  1N0T A;  2I4B A;  4ELR A;  3SEW A;  1LFH A;  1DTZ A;  4ESW A;  4KCC A;  3UP9 A;  2Y7P A;  4C1U A;  3MVW A;  1B3G A;  4HCY A;  1B0L A;  4G4P A;  3U92 A;  3OOA A;  2RCA A;  3MW0 A;  2AL5 A;  3PGF A;  1B1H A;  2ZYN A;  5KCJ B;  4MFI A;  3E13 X;  4JDF A;  1GTK A;  3FJG A;  2R9J A;  4BDO A;  3OO8 A;  3ZS6 A;  1P1W A;  3SER A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...