4C26A

Solution nmr structure of the hica toxin from burkholderia pseudomallei
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
66
structure length
66
Chain Sequence
DRTGSELMNSSKLIRMLEEDGWRLVRVTGSAHHFKHPKKPGLVTVPHPKKDLPIGTVKSIQKSAGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HICA
publication title The Hica Toxin from Burkholderia Pseudomallei Has a Role in Persister Cell Formation.
pubmed doi rcsb
source organism Burkholderia pseudomallei
molecule tags Toxin
total genus 14
structure length 66
sequence length 66
ec nomenclature
pdb deposition date 2013-08-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07927 HicA_toxin HicA toxin of bacterial toxin-antitoxin,
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.920.30 Alpha Beta 2-Layer Sandwich Metal Transport, Frataxin; Chain A Hypothetical protein. 4c26A00
4C26A 4P78C 1WHZA
chains in the Genus database with same CATH superfamily
2FQLA 3T3XA 3S5FA 3OEQA 3IAS7 3SSEA 3SSDA 3T3LA 3OERA 3T3KA 3IAM7 4P78C 3GD0A 4LK8A 3I9V7 3GD9A 1WHZA 3A5PA 1D2MA 4JPDA 1EW4A 4EC2A 1V5RA 1LY7A 3S5EA 2FUG7 3T3TA 4C26A 1SOYA 3T3JA 3S5DA 3IMOA 3SSCA 2GA5A 3S4MA 4LP1A 4HS5A 2EFFA 2P1XA 1EKGA 4HEA7
chains in the Genus database with same CATH topology
1S04A 1TE7A 4C26A 2DP9A 2KKUA 1XNEA 1WHZA 3IUWA 2Z0TA 1WK2A 2E5OA 4P78C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4C26 A;  4P78 C;  1WHZ A; 
#chains in the Genus database with same CATH topology
 2FQL A;  3T3X A;  3S5F A;  3OEQ A;  3IAS 7;  3SSE A;  3SSD A;  3T3L A;  3OER A;  3T3K A;  3IAM 7;  4P78 C;  3GD0 A;  4LK8 A;  3I9V 7;  3GD9 A;  1WHZ A;  3A5P A;  1D2M A;  4JPD A;  1EW4 A;  4EC2 A;  1V5R A;  1LY7 A;  3S5E A;  2FUG 7;  3T3T A;  4C26 A;  1SOY A;  3T3J A;  3S5D A;  3IMO A;  3SSC A;  2GA5 A;  3S4M A;  4LP1 A;  4HS5 A;  2EFF A;  2P1X A;  1EKG A;  4HEA 7; 
#chains in the Genus database with same CATH homology
 1S04 A;  1TE7 A;  4C26 A;  2DP9 A;  2KKU A;  1XNE A;  1WHZ A;  3IUW A;  2Z0T A;  1WK2 A;  2E5O A;  4P78 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...