4C29A

Crystal structure of high-affinity von willebrand factor a1 domain with disulfide mutation
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
201
structure length
201
Chain Sequence
PLHDFCRSRLLDLVFLLDGSSRLSEAEFEVLKAFVVDMMERLRISQKWVRVAVVEYHDGSHAYIGLKDRKRPSELRRIASQVKYAGSQVASTSEVLKYTLFQIFSKIDRPEASRIALLLMASQEPQRMSRNFVRYVQGLKKKKVIVIPVGIGPHANLKQIRLIEKQAPENKAFVLSSVDELEQQRDEIVSYLCDLAPEAPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords VON WILLEBRAND FACTOR
publication title Towards the Structural Basis of Regulation of Von Willebrand Factor Binding to Glycoprotein Ib
pubmed doi rcsb
source organism Homo sapiens
molecule tags Blood clotting
total genus 70
structure length 201
sequence length 201
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-08-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00092 VWA von Willebrand factor type A domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.410 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold von Willebrand factor, type A domain 4c29A00
5ES4B 1T0PA 4MMYB 3V4VB 5E6UB 3NIGB 4MMXB 3ZE1B 4MMZB 3IJEB 2NUTB 4JDUA 1RRKA 5HJ2A 5KYXA 3PPYA 5KYWA 3BN3A 3PPWA 5KYXB 1SQ0A 3HXOA 1YVPA 1SHUX 1N9ZA 2XWBF 1JLMA 1LFAA 4F1JA 1M2OA 4M76B 1ZOOA 3ZQKA 1M2VA 4HQFA 1ZONA 3ZE2B 1XDDA 3BQNB 2M32A 2NVOA 3QA3E 1M2VB 2VDPB 1QCYA 3EG9B 5E6UA 4WJKB 4HQNA 4NENA 4PN7A 3EH2A 2VDNB 1U0NA 3HI6A 2VDMB 3EGDA 2I6QA 4NENB 1AOXA 3E2MA 2VDKB 1DGQA 2IUEA 3NIDB 1JEYA 3F74A 1MJNA 2VC2B 2VDRB 3TW0A 3VI3B 3EGDB 1IDN1 1UEXC 2NUPA 3NIFB 3PPXA 1BHQ1 5HDBB 2I91A 3TCXB 1JEYB 3K71B 3ZE0B 5BV8A 2NUPB 3V4PB 2ADFA 1U0OC 1BHO1 1MHPA 4CN8A 4UM9B 3RAGA 3EG9A 2ODQA 1JEQB 4Z7OB 1IDOA 3ZDZB 3EH1A 2WINI 1XDGA 1YVRA 5KYUA 4DMUB 1AUQA 3EFOA 2VDQB 3N2NA 5HGJA 4WK0B 2XWJI 5KYUB 1M10A 3K6SA 3EFOB 1PD1A 1RD4A 1NA5A 4CN9A 4C29A 2O7NA 3HXQA 3K72B 3K6SB 3ZDXB 3PPVA 2I6SA 2ODPA 4WFQA 1M1XB 2ICAA 1MF7A 1FNSA 2XGGA 1JEQA 1TYEB 4HQKA 1PT6A 4IHKA 1M1UA 3VI4B 3IBSA 3T3PB 2X5NA 4G1MB 1Q0PA 1V7PC 1QC5A 4HQLA 1PD0A 3Q3GE 3FCSB 3M6FA 2QTVA 3EGXB 4WK4B 1SHTX 1MQ8B 5KYYA 4G1EB 1JV2B 5E6RB 1DZIA 2VDOB 4FX5A 1L5GB 1QC5B 3TXAA 2WW8A 2B2XA 4IXDA 4WK2B 4O02B 5KYYB 4C2AA 4BJ3A 4UM9D 4Z7NB 1MQAA 4XW2A 1FE8A 1ZOPA 3BQMB 1IJKA 4C2BA 5KYWB 5LN1A 1CK4A 1RTKA 1ATZA 4A0QA 1RS0A 3ZDYB 1MQ9A 3GXBA 5E6SA 3FCUB 1N3YA 4CNBA 4UM8B 4NEHB 1CQPA 4HQOA 3TVYA 1XUOA 1PCXA 4F1KA 1OAKA 3EGXA 3T3MB 1AO3A 1U8CB 2VDLB 4IGIA 3EOBI 3EOAI 5E6SB 5E6RA 3F78A 1IJBA 4Z7QB 2NUTA 1T6BY 5KYNA
chains in the Genus database with same CATH superfamily
3IUJA 1T4DA 3I6MA 1ZR2A 5AI8A 3L7DA 1P72A 5BV1A 1GPBA 3ANSA 4JGBA 2R4QA 2FWJA 3A3NA 1YAJA 3PFFA 2Y2VA 2HA6A 2XZDA 1P62B 2RGAA 3PGVA 7GPBA 2H5JA 2IOHA 1DBRA 4LTDA 3HDQA 4H7EA 2PH3A 1RWMA 4P6VF 3WLRA 1O0SA 2FUEA 5DX8A 3JQ6A 2JZNA 2YS6A 2H2FA 4ZTBA 1NU6A 1R4NA 1V1MB 1RRMA 2ZTUA 2QPTA 2FKAA 1M2VA 3NV9A 1H4VB 5F1PA 5LXTF 4EG8A 5CD1A 4GM4A 1GLNA 4GWGA 3UV7A 1GM5A 3T4PA 2QM0A 3UKDA 3U7FB 3DD1A 5TR9A 4BATA 1WQ4A 3WWYA 3O82A 4P4UA 3MCWA 5AXBA 1N3BA 2ZJ6A 3IPRA 3MB8A 4K9MA 5G2OA 5E3JA 5KJEA 1M5UA 3NAQA 3EEQA 4RVOA 2RC6A 5ER6A 3GEBA 4MUFA 2ODEA 2R0QC 1G18A 4EVIA 1GZVA 2ZYRA 5LBIA 1DQSA 3WWPA 2OO5C 3EGDA 1LC3A 1WPQA 1B8NA 1IUNA 2JCBA 4KXWA 2C5GA 4W1QA 3KQUA 4A1FA 4ESEA 3EB9A 1K75A 1JHPA 2BR3A 2O2GA 3FSGD 4M46A 4RZIA 4XSVA 3WLMA 1YFLA 4LWPA 3EMBA 1ZJ5A 1NPTO 4KIUA 2C42A 4UVGA 5E4YA 1XEWX 3Q15C 4XQCA 3RBXA 1UJ6A 5K0NA 1XNJA 2RIPA 3TM5A 3GLGE 1PK9A 5AXAA 1Q6YA 5ARBA 2BEJA 4P1ZA 4F85A 1JPNA 3PYMA 1YA6A 2JFYA 1GXSB 3V1TC 4BKOA 5JCZA 1G8SA 4BE4A 5K0BA 1Z2PX 2X19A 4GP6A 3UA4A 1ORDA 1ADYA 2GAIA 2L82A 2UVPB 3AQ4A 2PT5A 3ESBA 3IEPA 4I5IA 1I2DA 5AXDA 3AB8A 4F96A 1YFZA 1PTJA 2YBEA 1YR1A 4U2EA 1U8FO 2NTJA 3GWZA 2BE7A 3IH5A 1UBKS 2HM7A 2R8RA 3PFCA 1YZKA 3GG9A 4GXQA 4H4EA 4K6FA 3G8AA 3QY0A 1B6RA 1PDOA 4ZAXA 1I5EA 3ISVA 5G1PA 4BMVA 4EKEA 3AR6A 2ZK7A 3BRWA 3HCCA 3IUYA 3FBGA 4RZ2A 1OI7A 3V1UA 2GHIA 4OMUA 3SWWA 1QGZA 2X8WA 1UP4A 5LM3A 3V8BA 1JLLA 2EFJA 1JHAA 1L5NA 1TIBA 2HNAA 3B1YA 1WZEA 3C85A 4EGSA 1XPRA 1C4OA 2AN9A 4FCVA 2ZIXA 3RIEA 1CNMA 1RYMA 5KOJB 1SHTX 1EG7A 4HH4A 5JH7B 4KV9A 1E5DA 2WAAA 5K0ZA 2JD0A 3MK31 5THQA 4BLUA 3A9UA 3GUHA 2QN3A 4WESA 3NAZA 3ND5A 5ALQA 1HZZA 1SUCA 4FWIB 4ZU3A 3WLNA 4CKCA 2IYUA 2XNKA 4NBNA 1TZKA 5KS2A 1HGXA 1VSQA 1U80A 3IT2A 1XN1A 3H0KA 1SXJB 1QLWA 3KHUA 3BCRA 1SCIA 4MWCA 4GIBA 1MX9A 1MRNA 3X1DA 3GXBA 1RQ7A 4DSAA 2QAGA 2BTEA 3WO1A 5K0JA 4TL7A 2HA2A 1K7YA 4EY3A 4GOJA 4ZYZA 3AVUA 4ITRC 3MGAA 4ZZ1A 1XHLA 2Q21A 3W6PA 1KZ1A 1SOWA 2YVAA 3RWOA 1QCDA 4G8CA 2W0SA 5F77A 1M1YA 5FD8A 4BVFA 2JL1A 3R3WA 1C9YA 5K1ZA 1U8ZA 2HRDA 3TIGA 1QIJA 2BBWA 1OX4A 4EKGA 1GGJA 1KK2A 2W8BA 2O2CA 5G4LA 3PPYA 2P9HA 1TCCA 4UE2A 2R6CA 2E85A 4BO3A 3BHMA 4ND3A 1C9DB 4I5EA 2QBYA 1H22A 1DV2A 1YBAA 1T8RA 1A7UA 3GT3A 4KQMA 1QFMA 1NF2A 2OQ2A 1C3JA 1IQPA 1P3DA 2CDCA 1U90A 2NPIA 2AKYA 1ZH2A 2WHXA 3M1LA 4IICA 4M0MA 4KVZA 4B71A 3DKIA 3G8BA 2P4QA 4MS3B 3V1LA 3RTCA 1N2IA 3R5TA 5BYKA 2GF0A 2VAWA 2ZSFA 3V7YA 3EISA 3LCMA 4XGNA 2FFHA 2UYHA 4OJQA 3RBAA 1X9HA 1W4LA 2IYSA 1VIVA 3DEAA 4O4IB 3DF7A 4RY0A 3WY9A 3F4LA 2CFRA 1U3DA 5G3ZA 2V7QD 3VH4A 2ZR9A 3QG1A 1PX2A 2CNOA 1M74A 3P45A 3OVMA 1EQUA 3TLYA 4QUBA 4DQUA 3H19A 5KJ1A 1JR4A 4EO9A 2W2PA 1JKIA 4DSTA 2ZYAA 4INJA 3ORHA 4FHGA 5JCOA 5A03A 3R7WB 2JAHA 3HADA 4MUGA 1Y9DA 1AUOA 1ODFA 1S6YA 1TD1A 5G53C 5C18A 4MQBA 5L9AA 2E18A 4R05A 1ZQ1A 3RYFA 2A3NA 3G0BA 1E18A 3EY4A 1Q1QA 1J2YA 1SEVA 5LQDA 2PY6A 1QH0A 2BM8A 4J0CA 3A9WA 3N2EA 1JSLA 4KMMA 3JYLA 4EECA 1ULUA 3U0BA 4D6PA 4QGSA 1J0BA 5D3QA 3NKVA 3QNWA 4P32A 4KKXB 3U5ZB 4LJRA 3OWHA 4E4TA 5C1BA 1C4KA 3BD6A 3CEMA 3FFWA 1QUFA 3HJUA 1W30A 1R0CA 4D26A 1CETA 2BKXA 3R3XA 4DOMA 1GTSA 2AF4C 2QRNA 3I28A 3IP5A 3GCZA 3PUVA 3D6HA 4BNHA 4NOJA 2FZKA 1CUSA 2HA4A 3MN1A 4HWGA 2EWWA 3SZGA 1KZYC 2NNWB 1A1VA 4HNQA 4PYIA 1Z8HA 3OOSA 1YHYA 2YRFA 3MGCA 5ALLA 4E3ZA 1W5TA 1RHQA 1SOUA 1LUAA 2D2IA 3CTMA 3DAHA 4EHDA 3NQ41 2NQTA 3OQ1A 3PI7A 4HAWA 4NL4H 2BC9A 2QMEA 3VO1A 1P6XA 1WLSA 2YQ5A 4BBJA 1ULZA 3OOEA 4JYMA 4GBGA 3G49A 3TKAA 3LQKA 4OAPA 3W5CA 4UW9A 3PICA 4XX1A 2V6MA 4QEZA 5DHSA 3T3IA 5BUZA 4BPBA 4FZRA 4PSVA 5TMBA 1KIMA 1W2WB 1YS2X 1E0SA 4MQ4A 1PYOA 1IM8A 2PT9A 3MTAA 4TS9A 2YXEA 3CLUD 4CNBA 3CZAA 5B5SA 2FKNA 4PHTA 2ZIVB 1YV9A 4GPEA 1NG1A 3OUTA 4FEEA 4YAGA 4UUBA 4NICA 2QX4A 2XNHA 4KK4A 3STVA 3WG9A 4HNVA 5ALRA 2J3LA 2PXAA 4Z49A 4K9RA 4HN4B 1LDEA 1BWQA 4QU0A 5JWOA 3B1ZA 4RZHA 2IITA 4V03A 4WKBA 5ALUA 1LLDA 4YUVA 2CCGA 1RWBA 4PGFA 2HPHA 3L8FA 2Q27A 3ETDA 5HWSA 1PR4A 4N40A 5AVSA 2NUTB 1JYSA 3R9WA 5KNBA 5F5LA 3SSMA 2QDKA 5EXPA 3AESB 2HN9A 4K40A 3UTDA 1X42A 2PM8A 4P3KA 3SDZA 2M9MA 5IJAA 10MHA 2F1IA 2P6UA 3U6KA 4G9GA 3M33A 4TWAA 4K7JA 4ALIA 4Z3KA 4F5YA 5LP6B 4EY8A 5JOQA 1EAYA 3A1TA 3BWEA 4RV5A 1XZAA 3V4ZA 3EPKA 1Q1ZA 3NXSA 2GFHA 5TGZA 4R69A 2KBFA 3BXPA 1BXGA 3VR4A 5CJJA 4R6XA 2B36A 4EVRA 2DH5A 2J0UB 2WNSA 1MIOB 1P91A 4Q3NA 5CVUA 4L4YA 5LZ4A 3WB1A 1O96B 4I3HA 1MB9A 1WUIS 3AL2A 3DCJA 3FZQA 1DG9A 3W8DA 4AJEA 1E6LA 4B3IA 3L4KA 3N2GB 2B8WA 3Q5DA 4JBXA 3VHRA 3ONFA 1UZNA 2HHAA 3JASA 3C14C 4QICA 3KSBC 2OVFA 2CWDA 2AHRA 2E6UX 2V4UA 1J90A 3KYDB 1JSRA 2W00A 3EXFA 3R3SA 2VF4X 5J5CA 4B3FX 4G4SO 3GLFE 4LI3X 2JBAB 2JGEA 2J9GA 3PNYA 2VP4A 4PYKA 5ALWA 3K71B 4PQEA 3E4DA 1RWOA 4G1UC 4EYKA 1UXHA 2F17A 1XFDA 4DIDA 1WSDA 2PL9A 4JUBA 3A31A 5KTMA 2Q9AA 3SVZA 2WWYA 3MBIA 2SECE 2CK3D 3BIOA 4PANA 2BKLA 1U2QA 3P2IA 4MSUA 4OP3A 3P8ZA 4A6EA 1QP7A 4KO3S 4R51A 2IXGA 3CV3A 4F21A 3GFFA 1GIAA 4PGAA 1H1TA 1VHWA 5CFLA 1ZAYA 4P7FA 3U9SA 4GEGA 1F51E 5E9JA 2CBGA 4D45A 5BWOA 4Z4QA 1H0SA 3NTUA 4MYSA 3HRIA 1JI0A 1ID1A 4B9EA 1J8FA 4HUJA 1ULBA 5HCNA 3WL4A 3K6SB 3IODA 1YBHA 2ODTX 5EZQA 2Z5LA 1J7JA 4OBWA 4F92B 4KLNA 4YP0A 3B3QA 1OD6A 3JQ9C 4NTZA 4ZN6A 3KFVA 4MV5A 3BMNB 4WADA 5CGZA 3WLHA 3SFZA 3W5IA 5JARA 4UMVA 4YLEA 3FTDA 4P7GA 3UMMA 4HNHA 3PRKE 4CYMA 1F2UA 1R88A 2D00A 2OFOA 3IC5A 4MPPA 4AKGA 4HWOA 3A0UA 1BDMA 2O2ZA 3MUEA 2QAIA 4HQLA 1Z7YA 2QTVA 2XWSA 3H5TA 3K1TA 2JCXA 3NHSA 3KLPX 5EKDA 4M1EA 2J3MA 3KK0A 3WSWA 4B3JA 4CF5A 4AKEA 1DRVA 1JMKC 1LA2A 4ND2A 3H4MA 5HEKA 4H7IA 2HHCA 4H59A 3AW8A 4JJ8A 3D0QA 4BB9A 1XU9A 1IJKA 1QQTA 3CH4B 1UK7A 4X1IB 3LX4A 3H9CA 3EIHA 4WQMA 3IOYA 1EVLA 4C2TA 4GXNA 5MHTA 4BKQA 2ZI7A 4F4DA 4W4TA 4UCFA 1N3YA 2V54A 1QP4A 5LQKA 1GAEO 1JAZA 1P2VA 3DTYA 4Y2YA 1IBCA 4PRKA 1X80A 5JD5A 5IFKA 1PT5A 3IDOA 1WCYA 4DC9A 3ANXA 3GCXA 3K4HA 3JQRA 4DMHA 4X6LA 4GAEA 4N8EA 1CZKA 3JQCA 3T1TA 4DDMA 1LQUA 1U7OA 1LY1A 4Q48A 4UHEA 4IV5A 5CJPA 4V39A 2UUBB 1DBSA 2I8AA 5DHTA 1XF1A 4ZZIA 4IXTA 2ZWAA 3BIFA 3AR2A 4QD3A 4C4OA 1WB9A 4Z53A 3UBTA 4X62B 1NG9A 2I99A 1WNFA 5EFZA 3B7WA 3PPWA 3K96A 1ZM2A 4NMWA 3TAHA 3LOQA 1Q0LA 5SICE 4KITB 1W4RA 2MHCA 3FNIA 4QNRA 2ZCVA 3UMSA 4HC4A 1W88A 3CX4A 2TRSB 4WL0A 3C7DB 4FMCB 3UHFA 3GRYA 3DNMA 4WHMA 5CCXA 4IFIA 3N8GA 4EUKA 4B6RA 2OZLB 2DGDA 3TXXA 1KDRA 4GPZA 4Q02A 2EARA 2QRLA 4C20A 5ALXA 2E4AA 1OH6A 3D31A 3Q2OA 1OLXA 4S1PA 1WDMA 4WLOA 4AMVA 1NN5A 2BISA 2PUTA 1IK4A 1UK8A 1XAIA 4TMWA 2CF6A 4LCJA 3OE7A 2WT4A 1NY6A 2CJWA 1KZ6A 3S2YA 1D2HA 2LKCA 3WQBA 4IP0A 4JKYA 4ENQA 1BX3A 4EAQA 5CLLA 2PWAA 1TPZA 3ZXUB 4ZCMA 2IZ0A 3CEAA 5M5BA 3W9BA 5I7UA 3LQQA 1UBHS 3ETNA 5FBWB 2M6LA 2QRVB 3M4JA 5HYVA 2F55A 3ZU6A 3ADPA 4DADA 3RIXA 2XNCA 3DZBA 4GMXA 2QN2A 5AD1A 2AQIA 1UCFA 1RE0A 2XMBA 4UNPA 3DE7X 4JP8A 1QHNA 1XL1A 2ET6A 4L02A 3ZCUA 2G71A 2QPOA 4RJLA 3L4SO 4O2AA 4QT4A 4CF7A 4ZO6A 2D1RA 2ZI4A 4I99A 4JITA 4OLHA 3NGMA 1EA7A 2EKBA 3DV9A 3MFQA 3N2GA 4GMKA 4YJGB 2C04A 2I5PO 4LZNA 4MHSA 5CURA 4KYVA 4YS6A 2BD0A 2SKEA 1WETA 1G17A 1CU1A 4MW6A 3K9LA 4CKEB 5DTEA 3OP4A 3ZLTA 4CEJA 1E2JA 3QX8A 5LKRA 3GD7A 1N6RA 1QM5A 4NULA 5EUBA 3W8FA 4C0XA 3G1UA 1JHUA 3Q1LA 4R7ZA 4D96A 3N6XA 3BWBA 1L7AA 4JBYA 3QEAZ 1L4YA 1P0FA 3FUVA 3ZC3A 5EI5A 4M8LA 3HE3A 4NU0A 3FPAA 5K8JB 4XGKA 3MMNA 1KJ8A 3HP4A 2JLQA 4INPA 4BV2A 2OAQ1 3BDAA 4MRRA 4NU5A 2P4UA 5ALOA 4B43A 1T26A 5CBPB 5FPKA 1A9QA 2O1XA 2ZSDA 3V8QA 4TV9B 3U4QB 3AIOA 1YJ8A 1Z4QA 1YS6A 3NDIA 1DJMA 1P0CA 4KVFA 1W85A 3B9QA 3NCTA 5EG5A 1QC5B 4FFMA 3T5BA 1HA3A 1R50A 5HE8A 4Y6QA 1EFCA 3KD2A 1TIKA 2SCUA 3GQBB 1DAHA 3KB6A 4F3YA 1PLJA 1E1QD 2GZSA 1IM2A 3THXA 3BMNA 5AK0A 2YQZA 2FDRA 1Z6QA 1GDDA 2A57A 2Q3BA 4NYMQ 5FWYB 3OPNA 1ZCBA 2Q28A 2FWNA 2KSQA 4ENTA 2P4HX 1Z0SA 3K8YA 1E4VA 4IMRA 5BMVA 4G0PA 4OREX 4OLBA 2POCA 4DB4A 2YNMA 4KXLA 3FLBA 3VYUB 3VSCA 4Q39A 4YXFA 1B6SA 1HE1C 3FXAA 1R16A 4WSOA 2AJLI 2DQYA 1LJUA 4XWKA 5JPIA 3OTWA 4MMXB 2Z98A 1U1IA 4HS9A 4B8WA 5CIWA 2PKQP 2BGIA 1RC8A 1U0JA 1ZH6A 4X1IA 1GARA 1RQLA 1UJMA 4PAQA 3TYXA 4B4OA 1NJFA 4MRNA 4C0SA 4TXNA 1R0KA 2PUCA 3MCZA 4F4CA 1QS0A 3CPSA 2OSBA 1GG2A 1UBEA 3N74A 3DOHA 3BWVA 3MLBA 3WSVA 8ABPA 3CRZA 4OHXA 2GN9A 1PJZA 2RONA 2NYAA 5JT1A 2N1BA 1WZNA 2JLSA 3B38A 3O03A 5AKIA 2L69A 4MVJM 1C1XB 1FU4A 2O6HA 1YRBA 1YONA 1Z18A 5DCUA 1DC3A 1NC1A 4UUPA 2PKEA 4MXDA 4G0WA 4JELA 3WGOA 2ANCA 2XUKA 1I1HA 1Q5PA 3KTDA 3OUZA 3VPBA 5DVZA 4JD5A 1G8KA 3CVOA 2QD3A 2WUFA 4KQCA 3WOHA 1V95A 1BMTA 2OZVA 2H57A 4UBIA 2VYNA 1BHQ1 2ZT7A 4MARA 4B3RB 1RJ9B 5JSKA 4FYJA 2JGLA 3O4HA 2QL7A 3S40A 3G0OA 1F12A 2W6ZA 1N5DA 2H54A 3B2QA 3DG9A 1QYVA 5L3VA 3RHSA 3RV4A 4NHEA 2H3HA 3ZCXA 1OC2A 1J2EA 1Q2XA 4GXTA 3H11B 4JX8A 3FRHA 1PFKA 3SM3A 1FFGA 1FSSA 4ZHQF 3Q7QA 3QVUA 3JAKA 3IFSA 1YHNA 4IJKA 1FEZA 4XIJA 1RAFA 2YVUA 5IF9A 3JTEA 3WAGA 1KR5A 2KB0A 1DWPA 4R2IA 4IIGA 3VNAA 5DM0A 5JQWA 3ZDEA 1G0NA 2VNSA 4NK5A 1TTQB 1SKAA 2XVZA 4OYYA 4D0RA 3P9SA 1ECLA 1LLFA 1PYGA 2FMHA 2QP9X 4PYNA 3NYIA 2PS0A 1JG2A 1WUYA 3RUPA 3WYEA 1XLUA 4M9QA 3WGHA 4MH0R 4R9VA 4IJVA 1T2AA 5HGXA 1J5EB 4NWIA 3G0HA 3RBVA 4ILKA 2AXQA 3H9QA 3KHSA 4QNNA 1BCRB 1V7PC 3MYYA 1Z26A 4IDNA 4YJGA 5JNTA 5J2TF 1PD0A 1J25A 5I9TA 1BIFA 3WXBA 3K9HA 2P5YA 3BICA 4KQHA 1RP1A 1ZLXA 2FPUA 2GVDC 2YV3A 4JLMA 1EWQA 3HB1A 4MPDA 5CVTA 4UE6A 1ATIA 2DUMA 1E9CA 1TMYA 3EF3A 1JBKA 3WRYC 1NBOA 1EB9A 3DLPX 3V34A 1H0HA 2CFOA 2RGDA 4PQYA 2Z2XA 5LA6B 4EF5A 2H1RA 3VSEA 4O4HF 3ZLBA 3H8SA 4C06A 1CUAA 1SXHA 2XYPA 221PA 1Z5GA 3CEPB 1ULHA 2XITA 4HXYA 1PUIA 4XVQA 3PCRB 1N8NA 2ABWA 3SC4A 3WWZA 1ULSA 1HNWB 2O2YA 3PC4A 5BWCA 4R2WA 3M34A 5HF8A 4BRSA 1AU9A 1OI2A 5KYNA 3BMQB 3HDJA 2DY1A 2LTAA 3GQBA 4EG5A 1HL3A 3O90A 2JKYA 1FW8A 3CIOA 2CZCA 2W2KB 3IEIA 4QT0A 1DUVG 2O07A 3R7DA 4AIIA 5ITWA 5AHOA 1SC9A 3JSXA 3T4XA 3GB9A 1JEOA 2XV1A 3UJAA 4GKKB 1XCGB 2E82A 4HEJA 3AHEA 3QITA 3T4UA 1VYHA 3UZUA 4Q05A 3ZCTA 3SVTA 2QLJA 5TMPA 4TLDA 2V9CA 3I2HA 2J1LA 4B0PA 5L3QA 3IAHA 2P27A 3ZKWA 2R65A 4HHEA 2IPOA 3ZWPA 3LHFA 1WOMA 1PSWA 421PA 4XGIA 2CV1A 1E63A 3RG2A 3AEUA 4FFRA 5SV2A 5K0FA 1PZMA 1UJCA 1UBFA 2ZT6A 1RBYA 3H1TA 4RGYA 4TMYA 5CFOA 5U9CA 4LYYA 5KTTA 3EBLA 3OMWA 1LF5A 4L5BA 3K0AB 5T7BA 1G3QA 4RE6A 1YNOA 1XPOA 1JFSA 1CY6A 2ZRPA 1ZK4A 2ZTSA 4IIHA 4PYRA 1W4ZA 3KXIA 1FTNA 5KSWB 4G07A 3RLIA 1A5ZA 4R1QA 3IP3A 4IOKA 1G7CA 3MWJA 4H3HB 4BGUA 3LIPA 1FNDA 2EW8A 3G5AA 3C74A 4GLLA 4FW8A 2ZKLA 2HLDD 1YZYA 2YJ4A 2B37A 1SQ5A 5KIAA 2A0FA 1WP9A 2NZJA 4AAYA 5EJ4A 4QDXA 1HYQA 4CI0B 4BFZA 2RG7A 2J48A 2PKQO 2FH5B 4TKUB 2YOFA 1T36B 2YZNA 4ZEWA 3ZEIA 1JFFA 4I2VA 1T8YA 3Q5GA 1N2JA 2ZI6A 2Z4RA 2C20A 2MCFA 4YRDA 4J0QA 1FA9A 3JYPA 4FDUA 3AF1A 1JHRA 1T1SA 2VWQA 3KOWA 3LUBA 2AMLA 4V0LA 1LNZA 3ZWYA 4QL3A 1JQAA 3HJAA 2X2PA 4YBZA 2YJ3A 1GILA 4OMFG 1RJ9A 1VJGA 5HS6A 4DBLC 4QTXA 4EEZA 5IN4A 1HNZB 4W5QA 4A3SA 4HGQA 2WTNA 2Y6VA 2BGNA 2QVZX 1E9DA 4L8VA 5EIBD 4D0NA 5EP3A 2WK1A 3R3JA 3RODA 4TT3A 4CMEC 3DO8A 1MPTA 1XD2B 3H11A 1PT7A 2IELA 1NBMA 3ZV3A 4G41A 2H2IA 3N76A 4JSYA 4PAGA 3QQ5A 4R54A 3VVBA 3OCVA 4HXEB 1HEIA 2C97A 1WB4A 3FF1A 3N3BC 4DJDC 3L6CA 4K5QA 1JKMA 4LJ7A 3UC9A 5DO9A 2H31A 3IMFA 5CIQA 4JT8A 2GDZA 4RKFA 4ZGGA 3T99A 4C30A 5B3JC 4LOHA 1E99A 1XEXB 2J30A 3CSSA 3MS4A 3QOFA 4WLNA 1AKRA 1B0UA 4TTRA 1GUYA 1PR1A 2JARA 3GJ3A 2OGUA 3MRXA 4BC0A 3BE4A 2M6SA 2WSBA 5M34A 3FN4A 1EX9A 3LBFA 5HBRA 3HBFA 1BCRA 2ZUDA 2Y6UA 1CUCA 1X92A 2WJIA 4UM7A 3G13A 4RGQA 4PLCA 1VI2A 3NHWA 1AO3A 3PV0A 1K27A 1RQGA 3DUFA 1ZRSA 3CNQS 1Z0ZA 5IAKA 1GUAA 3OEEA 4IZHA 2BE9A 1C7ZA 1ZKMA 4NPAA 3UXMA 2PDAA 4IDDA 4ZT5A 3VNVA 1NKTA 3TECE 3N5CA 2QLFA 1JLRA 4A4DA 3ZQJA 3DBHA 3PGJA 4R41A 3PE3A 2GNPA 1M34B 4KPGA 5AKKA 1BE6A 1GZ6A 3ZDBA 3T9FA 5LA6A 1OPRA 1NNLA 3NEJA 4ZI7A 1AMOA 3IEVA 4WCFA 4DC0A 4PPGA 5COBA 2VPXA 3QELA 5GM1A 1VBMA 1V5GA 1NR7A 3WLEA 1USUA 2AYYA 4DLKA 4HDSB 1JWAB 2E5WA 4IOLA 4K6CA 3HN7A 4JS0A 3NBXX 3BMQA 1AC5A 2ID4A 3OOJA 4KVGA 3RUIA 2ZJAA 3I01M 3P2MA 1M6WA 4RJJA 2ZKIA 5E1BA 5G1OA 4ISCA 4EPXA 2C2MA 5MGBA 4ACAA 2YWJA 1A72A 4NARA 5F2OA 4RL6A 4AO7A 1W76A 4JEUA 1UPFA 3R9KA 3CX6A 1PE0A 1EFRA 1Z63A 2V98A 4M98A 3OJWA 3Q7IA 1GEEA 3I6QA 5A4AA 2ECOA 4CMGA 4BVHA 3ASZA 2OR3A 4YFYA 4OPMA 4ZQCB 1K3FA 3HU3A 1HDXA 1SCBA 4EHFA 3VC7A 1J97A 5FHRA 1MXFA 3VPGA 3QE3A 2M98A 5LQSA 3W5VA 2P2SA 4H77A 3S5UA 2QZSA 3VYTB 3KCQA 4CR8A 1AGPA 2G1KA 3K0AA 3VU9B 1JA9A 4X60A 4ASUA 1JILA 2XYRA 3I23A 2ESRA 3KUXA 3CSDA 4KXYA 1KO7A 1G5QA 2Q8PA 1CSEE 2RHDA 5AJHA 4B48A 3KNZA 4RCYA 2ZRNA 1DSSG 3QLVA 5CAEB 4RPLA 2ZBGA 4AY5A 1MT3A 3NDBB 3LFUA 5AMXA 3ZZUA 4WUVA 1R9NA 3U4CA 1NY5A 1YJAA 4NJEB 3FNRA 4LFCB 4GO1A 1EZ4A 1JB1A 1EXNA 1DRWA 4RFLA 3PUHA 4BAZA 2QL6A 2BM0A 4HUQA 3S1AB 1NQVA 2J45A 4M9UA 2HR1A 3I32A 1ZHHA 2WJWA 1H2XA 1Y5MA 4QHTA 1I7PA 3EAFA 1LZKA 1HEUA 2B6HA 2I54A 1ES9A 1L7MA 3WBFA 1TEXA 1VA5A 3PUZA 1ZVVA 3PRHA 1TO1E 1UOEA 2PZ8A 3BDIA 3R6TA 4PLFA 2WF9A 1KWGA 2FNAA 1U0SY 5KVVA 4V02A 1R9JA 1FQWA 4UUMA 1K2VN 2OHXA 1WKBA 4P4NA 4YIHA 2YYSA 1OQAA 5BRJA 1TM3E 2FLWA 3OEHD 4M1ZA 2VSQA 1UMBB 3ZS9A 4BJ5A 1FVFA 2HGZA 1T24A 4H1TA 1ZJJA 3A1NA 5FOWA 1ACMA 2FWRA 2GPBA 5ES3A 2WDZA 2XW6A 3DAFA 4K9DA 4NYJQ 4B31A 2WTUA 5HS4A 2DF8A 3VSBA 3UMYA 4H9GA 3EXEB 2PX6A 1YC2A 2R87A 2BFOA 2Y1EA 3U13A 3FPGA 5K2MA 4DVJA 1C0EA 1IONA 1IOWA 2OVBA 1JDNA 2HSWA 3ROKA 4AICA 4X6UA 2HF7A 1I7QB 3D1VA 3ID6C 2J9FB 1VL2A 2QTBA 3IHTA 3NWBA 1AY0A 4NONA 4Z86A 1YZNA 5E1DA 4AS2A 1J8QA 3EA4A 3ICEA 2PGJA 3R4CA 5HMMA 4LYGA 1NTRA 2JHGA 2HC9A 4OH1A 1OILA 4A8TA 3LH5A 1TYBE 2FV8A 3G2NA 5HSGA 3O4IA 3U7QA 5JCJD 1WD5A 3JQAA 1EIWA 4X97A 4HDMB 2YZ7A 2PGNA 2ENWA 3K9GA 1VLVA 2YWFA 3DEHA 4MCAA 5TEWA 1XHFA 2FPXA 8ADHA 3AHJA 3MSXA 5TQ2A 5JCPA 2ZTMA 3MWKA 2YHIB 1CS0B 1NV9A 2PKCA 4KYTA 3O38A 4M83A 2B30A 1VSTA 2D1TA 2GI4A 3C5EA 3L77A 4K28A 4F6RB 2X9QA 2YMQA 1ABFA 1TVKA 3E58A 4IIEA 3TR6A 3UJ7A 3W6OA 3KEQA 3KQPA 3LKBA 4B44A 1V11B 3WDMA 4ZV4A 1NI5A 2HF9A 4GMHA 4N9WA 4JUIA 4I4TF 5CPFA 3KQKA 3P9IA 4BBAA 5INTA 2XVYA 1JL3A 1G7RA 3T61A 1PSZA 1G3MA 1M34A 1QDUA 2VIIA 3MINA 3UH1A 4TN5A 5CP8A 4HJXA 1Y42X 1GZ5A 2VJDA 3EWIA 3P2EA 4PO3X 1ZZGA 2X13A 2Y99A 3M3DA 1I1NA 4AS3A 3DOUA 5AOCA 2BELA 4JGIA 4YXWA 4ED9A 3OQNA 3JQPA 3WKBA 3CXUA 4P4GA 1QZUA 3LCVB 4DBVO 1JVSA 2PNFA 1TCAA 2IKSA 1VHDA 3L8YA 4HDSA 1Y1QA 3ZNNA 1DE0A 2WB4A 1D1PA 1O57A 5H4HA 4KNYA 1IM5A 1JHVA 3FCEA 3K0CC 2GZDA 2P2ZA 1E0KA 2Q07A 3DBIA 3KOOA 2WJGA 3C3PA 3QYAA 2AVNA 4IUDS 1G2OA 1LJLA 3HA3A 5IH3A 4C88A 1GN8A 4P8RA 1Q7EA 5JLAA 1VG9B 2CUTA 2BJVA 2HB6A 4YGXB 4PAWA 5HKKD 2A6PA 4O2BA 1GSIA 4I1VA 2VTBA 3RVRA 4Y9RA 3VZRA 1KH2A 1AM4D 1KZGB 1ZNZA 1DCKA 1U2DA 3L1UA 1YD7A 1EVQA 1O8BA 4YAFA 4B34A 5BSKA 3IHWA 3U3DA 2IPMA 3S81A 1JWLA 1MDFA 2QTRA 3W2GA 1K6JA 1EPUA 4KR2A 3SKVA 1DIHA 1XVVA 3PIRA 4R68A 1NF9A 2X41A 1YIOA 3AM4A 1CIPA 3IVGA 2BCJQ 4NPHA 3JR3A 3I6IA 1ZINA 1KPGA 3FMOB 5EJFA 1TO2E 3TH5A 4AIRA 1GA4A 4JYCA 1BD4A 1VCMA 2ZJFA 1F6WA 3OD5A 2Z5FA 5FNVA 5A0TA 3K1YA 5DZSA 4U63A 2X58A 2Q5LA 1W34A 1GV1A 2FEAA 3IO3A 3NUZA 2QXUA 4IWYA 2ZAYA 5DGHA 1U3FA 3R3ZA 4OAOA 2FFRA 4A2PA 4BJ6A 1L5GB 5DTQA 4QPNA 2VP0A 3HZOA 5CGQB 3ZJTA 4G2TA 1FLNA 4DJTA 4H1UA 5DWQA 4MQLA 4LYEA 1MQAA 2VR1A 4XWOA 4MPJA 1ISSA 2H48A 2PO7A 2YUIA 2ZSBA 2JJ1A 5A3RA 1BS1A 1L5HB 1F60A 5IXJA 3THWB 2I4LA 4K03A 4EX6A 5HZMA 3HKDB 1MAUA 3DBOB 3V8VA 2V3VA 1QYXA 2IYRA 2V0NA 2P5UA 1OASA 2J59A 3ORQA 1RJEA 1PT8A 1S4QA 4IWNA 4UUNA 2UUAB 1WAMA 4YMLA 1XZNA 5DNEA 3H8WA 4CM7A 3QMPA 5CT9A 2IPXA 3TSYA 1BWPA 4Z7QB 4UU8A 1EXWA 4FOPA 4GBMA 3CLSD 4CLRB 4C05A 3IALA 2C0CA 5GONA 1QZTA 1UMBA 3JVUA 3DDSA 4G63A 5KSOA 4BEVA 1T8WA 3FZNA 4AQ7A 2P0AA 2QUHA 1IHYA 2GF9A 3KV3O 3PYXA 2RBKA 3BRWD 3SX4A 4FOSA 4ZV7A 1AHNA 2GYUA 4ND7A 2ONYA 3BCUA 1N9ZA 1IXSB 1D6JA 1EFPB 1VB5A 2XGOA 3GZNA 4JVLA 3EIEA 2FZWA 4PLTA 3SI7A 1E4OA 2F9LA 2VT3A 4KCGA 5TGDA 4LXYA 2DTXA 3PNKA 2FTKE 4HNUA 3UK1A 1P2UA 3R8CA 1PL7A 1KP3A 4QFBA 4MQ5A 1NRWA 3VXKA 5JY6A 2VZ9A 4GI1A 1SZDA 5FYDA 1O54A 3SNKA 2Q3FA 3OLCX 4REQA 4M7RA 2RGNC 1OY1A 1NNSA 2DZDA 1XTQA 2QN7A 3BVPA 3K3PA 3OZEA 2I6QA 2XUAA 3D3EA 4HDMA 3H3JA 2J5RA 3GDWA 3ZJYA 4MR7B 3I6YA 2P68A 1V48A 3EK2A 4YROA 1TGYA 1JR3D 3RYCA 5BMOA 1A69A 3P7MA 5H82A 1GPDG 2YHIA 1QTNA 3PYLA 4JT4A 1P1FA 2QD1A 1EJBA 1G9XA 4OKSA 2X15A 2XA9A 3OTHA 3QKSB 1X1CA 5FHQA 3GJTA 3BIJA 4N3NA 3IEMA 2QSUA 1P7YA 3A1DA 1E1KA 2ZBRA 4GX0A 7REQA 4RLSA 4F2PA 5JROA 1FX0B 3CRVA 1XL0A 4GC5A 2OKCA 2YRWA 1IN1A 5TIIA 1S3GA 1V1RB 1JR3E 3KTAB 4YRKA 4WV3A 3GLHA 3IIJA 4NDZA 3ERCA 2IVZA 3ICOA 1QFSA 3MT8A 1AURA 4BCCA 4DZRA 5JZMA 3RRXA 1GUBA 4JLSA 3S6JA 4DNQA 1NOJA 2HRQA 3EZYA 2FMKA 1R2QA 1EHCA 2F3RA 1UQRA 1IJFA 2OECA 5M3BA 4F45A 5IAOA 4D8UA 3SF8A 2I1LA 3PR1A 1VHLA 4XQ0A 2LE0A 3GGPA 4K9KA 3H1BA 3A6FA 5HZHA 5I8ZA 1S2LA 2YQ4A 5B53A 2GJAA 1N36B 1JQ5A 3WIUA 1ZX1A 1PT6A 1CX9B 4L9RA 3NI2A 5JRZA 1G8PA 3P26A 5EKTA 4R2HA 5IWCA 1QGUB 4Z1MD 3DMYA 3L92A 1FJ2A 4RUKA 1GTVA 3PEVA 3WIDA 4LSGA 1MAWA 3HKCB 4AXBA 2SHKA 1V1JA 1L8QA 2JJ8A 1ORTA 1GCUA 2NTYC 4AUMA 2VYCA 2QUAA 2HSGA 2WKPA 3CMCO 4PQRA 3OZWA 2VSYA 2W4MA 1GAXA 1TM7E 4RVFA 5TT1A 4C2AA 4DAEA 1C0KA 5KSZA 5I9IA 3U7HB 2VQ3A 5DNAA 3TZEA 2YFHA 2Z4SA 4QUEA 3QU5A 3ZOKA 1NDQA 1E3QA 2R8YA 3TZHA 1HT3A 1QPGA 2OBBA 1GGFA 3NVAA 4ZOLB 3VR2D 1C29B 2I7VA 1TO6A 1VPVA 3USCS 3EODA 3HN6A 4RHCA 1SBZA 1LH0A 4CG3A 3HYSA 5GJBA 4KH0A 1FTSA 4JQSA 5KOHA 4HVTA 2OLJA 3CONA 3BULA 2QT9A 4KC0A 3GEMA 4W7SA 4MGEA 4JAVC 4OSEA 1SOVA 5A5EA 3EJWA 1ABEA 1S5PA 2J87A 3GW8A 5KDDA 2O2EA 4DMMA 3AJEA 2GHQA 2UZ1A 2YWCA 4U3JA 4X90A 4IGEA 5AVQA 1G63A 3DMFA 3GDHA 4I3GA 1F0KA 3HFGA 2ZTVA 1L5HA 3THWA 1WOYA 2NO1A 3ZWQA 1LD3A 2PD6A 1KBQA 3QLTA 3HKDA 5KYGA 1E2HA 4YCCA 4WKOA 5IZ4A 5MF6A 3S3TA 4EENA 2YHAA 1ORHA 3HFRA 1B43A 4V0SA 5LIRA 3B5EA 3PENA 3RAEC 2AIRA 4PN3A 4E2ZA 3M2TA 3ROGA 4X3PA 5IU6A 1ZFNA 2PLWA 3F98A 1M5RA 2ZRAA 1JDSA 1AUVA 2AZ4A 2ILTA 1NRXA 5F1YA 3THYB 4ZFNA 3FDFA 1OAOA 3NXKA 1GKUB 3E3NA 3GGOA 3UPDA 1JDPA 3QPDA 1EZZA 3U60B 2XKKA 4MHOA 1FU7A 2O3QA 1ZIXA 4YREA 1IBMB 1PHPA 4RKQA 2JANA 3EGCA 5E3IA 4AQYB 1G8HA 5F12A 2C2XA 1JEYA 5ALPA 3SJBA 4EVQA 4TQAA 3HU5A 3ROQA 4BQPA 2PSDA 1JG7A 1LCIA 3B6IA 3H2ZA 4MWEA 1TPYA 3G1WA 1RU3A 2VNKA 2QN1A 1VBKA 2X1HA 3OC0A 1Z6YA 2C4NA 3BJZA 1P2DA 1URPA 2GLUA 2GO1A 1T13A 4TKZA 5D00A 5DLYA 4BL5A 1F2DA 4QFMA 3PLAE 1LWOA 5L8VA 3BWMA 3HCPA 4BNKA 4M0KA 1QYIA 1WCWA 2ZU6A 2VDWB 4LBYA 4NMXB 1AUQA 5TMEA 4MDYA 5JSFA 2QP4A 2R11A 4LXIA 5KUTA 3A6PC 3VRHA 1T3SA 1L5QA 1MEJA 5KNBD 3RR2A 5JNSA 4WD3A 3GI1A 4YMTA 2PU5A 4JC5A 3L7NA 4TSFD 4NF2A 3ICPA 4KE7A 1W7AA 3ZGLA 1H9AA 4BLOA 1MKYA 2AC7A 1YTUA 1MX3A 3KL2A 2H16A 3AU8A 5CXSA 5ENVA 1NW8A 3LYUA 3M49A 2B6NA 3QKSA 1FZTA 1TK9A 4MEJA 3K2BA 5NULA 4J0JA 4H7HA 5DBHX 4J1NA 4HTFB 1FRQA 5FLXA 1X2BA 4YMWA 2A9KA 1E64A 2AJ8A 1FBTA 3JD0A 4KR0A 4F71A 3IPYA 3VR4D 4DVGA 2X14A 2WTAA 1XZKA 4LMRA 4U0JA 3J81A 3IQFA 4KOAA 4R71A 3A6HA 4E70A 4E5UA 3REGA 2WVAA 3WMFA 4FDMA 5E4TA 1KSJA 1WMBA 2TYSB 4XYEA 5E7IA 3Q85A 1VMEA 4L73A 2QQ5A 3PDCA 5SYNA 4V0OA 4Z1OA 2AS0A 2CVQA 3GFTA 2R84A 3ESQA 4HAOA 4N39A 3UWPA 1GHTA 2QL5A 4X24A 2FMTA 5LYJA 3H9BA 4X84A 1DARA 1JP7A 3KQSA 3ABIA 2I33A 2XQIA 3D4OA 3GH3A 4XW2A 2C83A 1JJFA 3KETA 4TN1A 5KDOA 4KQEA 3ICVA 3OD1A 1A4XA 4PWZA 3DMRA 4KDEA 5A5DA 1R37A 3CM0A 4FR0A 2Z09A 1G5FA 2GAOA 3BZWA 3DYBA 5BQ5A 4PQGA 3TLBA 3TZKA 1IYZA 1M2KA 4HAVA 3KT3A 3M5WA 2HNKA 5J1TB 3URKA 4FEAA 2B99A 3V55A 4B4WA 3QFHA 3AM3A 3GBPA 3HKCA 2DR2A 1XXLA 1LV7A 3DAYA 2CVPA 3H4TA 4IGIA 5JYDA 1IVNA 3IA2A 3PA6A 1OZ0A 1SVNA 5ER9A 1RBZA 1ZI9A 1FTGA 2JI4A 3L01A 4GI3A 1Z4MA 2W83A 1TJ4A 2WMNB 2PRIA 1K5GA 3FTEA 3DSRA 4W8OA 1Z13A 2ZTHA 3AR4A 4HF7A 5FQNA 5BV0A 1PL8A 1ILEA 1UOQA 1RBMA 1C7QA 3R24A 3QPWA 4ZOLA 3D9QX 5KC9A 1KS2A 2WJZB 4JL8A 1G7TA 4CLOA 3CINA 4EEKA 1P7CA 1ZGAA 2C7BA 3T5CA 3TL3A 1KMMA 4EW2A 2XUGA 2FSGA 3KB1A 3M5CA 3PNVA 3ZY2A 2IHTA 2XDAA 3QV1A 5FX2A 1T2FA 1UQUA 2H2GA 2VP6A 4TTTS 4YAJA 4GBJA 3HR4A 4X85A 4Q4LA 3QKIA 3U49A 3FB4A 4PLPA 4B6JA 3CF6R 4V0QA 2Q3DA 1XP5A 3WWCA 2GKSA 2HQRA 1NJ8A 2P4SA 4OQXA 5TQJA 5KVSA 2IZ1A 1YT5A 4DN6A 4OL0A 1BW9A 4B3DA 3GNLA 2ZQYA 4N7RA 2BI7A 1QAQA 2FB9A 4AROA 1GGKA 2C84A 1SHZA 3EE6A 4P5EA 1T9CA 3DE0X 1UC8A 2ZU0C 3I8OA 1F06A 1IUOA 2NUPA 4G1FA 1V37A 3O2SB 1H1LB 3OZXA 3I62A 4PBSA 1QBKC 1IBSA 4I4CA 4YMIA 1SCQA 4I9GA 3THYA 1S8AA 2V55B 1BSVA 3ZCVA 5IJZA 4ESVA 2GT1A 5IJ0B 4TTSA 3L7AA 1KO1A 5B6PA 1ESCA 2Y2UA 1XDGA 4IVNA 3ZKAA 4D81A 4RQBA 3IEUA 4JIMA 1UJ5A 1RZRD 1SZJG 2Q6TA 4DEYA 5FUQA 1LTQA 3IMKA 1YUBA 4HWTA 5IJ9B 1TVMA 1JSCA 2Z2JA 1SVLA 3TQTA 4O59O 1L1FA 4B2LA 4YEDA 4FKBA 1DG1G 1HT0A 3HB5X 4S0XA 5CM9C 4RTMA 5FOTA 5KNDH 1T6XA 4BFVA 4GL2A 2HZBA 1L4HA 1YXMA 1PQ4A 2WLTA 3VU8A 3MAJA 1CJUC 3O91A 4C3UA 3FNFA 1Y8QA 4CCSA 4Q9IA 1I36A 5EL0A 4YT8A 1R12A 5FWXB 3GBSA 2ZYGA 2RI0A 3JCZA 2I03A 2JAQA 3LHSA 1J9ZA 4QOIA 2VHXA 4R2JA 1GQ2A 1KAGA 4TMKA 3TSAA 1E1NA 1Y1SA 2V8OA 3ZHXA 4F4FA 3KXLA 3OE7D 4JJAA 2WG2A 1U0FA 4K0KB 3W2IA 4GOND 1V71A 2DHCA 3RANA 3W34A 1X94A 3IE2A 4S0ZA 1A5SB 1BWRA 3ZWMA 1KH1A 3E9RA 5EHQA 3X1KA 4DRYA 4PG5A 3ILHA 3NPAA 3KX2A 4AJ2A 1L4FA 4EPVA 3LE8A 3GAFA 4HWKA 3GXOA 1WDWB 1Z0UA 1W73A 1ZH0A 3I3OA 4CMBA 4G5SA 1ZGGA 3NFRA 1E94E 4I81A 3B3GA 5C8YB 4YRIA 1KYXA 1CQPA 2PJDA 3GP3A 3E9ZA 3EZGA 4H7JA 5JZOA 2OUIA 3DF9A 1DKPA 2GRUA 2KI5A 2G83A 2VDLB 3F6BX 4C7XA 1YB1A 4CTOA 1Z22A 2C1EA 2MJLA 3G68A 4P7KA 4RV4A 3PNPA 1GPUA 1N6OA 5FI0B 3UJ9A 2CV2A 2PUFA 3EPRA 3IXQA 2ZFUA 4MEAA 4ZDWA 5H9WA 1PT9A 5JS2A 1YDEA 3HO1A 2XCOA 4M55A 2A9PA 5C1PA 2EFYA 1RRKA 1WF6A 2I4MA 2OMEA 3DL4A 4LJLA 5AW8A 1YDMA 1DMRA 1NW9B 1UJ2A 2G17A 3OH8A 3QYPA 1OC4A 3ZEAA 2GCEA 4IDPA 3D64A 1USVA 1NJ6A 3OETA 2NIPA 1THZA 4KQIA 4QIHA 3E1KA 2O8VA 2BH9A 1BJRE 2ZJ8A 2XCSB 3RB8A 2BHLA 1VXOA 4J1QA 4B74A 4TUYB 4POOA 1YOVA 4WZAB 3U0VA 1NASA 3JATB 3LK7A 1JA0A 2NU6A 4LWQA 3JRNA 3Q72A 4IVQA 1N2XA 4OQQA 2C2BA 3ASYA 3H1GA 4K6HA 1X8JA 5D86A 1VCIA 3RVPA 3L05A 1I3NA 3F9IA 4WLFA 3UEOA 3IRVA 3CH5A 4NI5A 2DTDA 2QT1A 3IESA 2J67A 4GGOA 1DIOB 1ZVJA 4OK6A 4WY5A 3RSQA 3K70D 3RTEA 3CVVA 4XCVA 3U2QA 1USWA 3ASVA 2VJNA 4B6SA 2P2NA 1U28C 3H75A 5EMHA 5G3YA 2Z9CA 1MO2A 1NMZA 1FP7A 2OFWA 1VI5A 3NNNA 5IAJA 2HSJA 2K4MA 2JLYA 4OP2A 3PB3A 1OH7A 1VCNA 4R8SA 4AFNA 3CX8A 5I4BA 1VHJA 3HEBA 2YNMD 1GY8A 2ADFA 2A7XA 1NQ5A 1BHO1 2WA2A 4P34A 5IHXA 2DX7A 4QYMA 3STHA 4OQLA 2YY7A 3CBQA 3N0XA 1R9MA 3EULA 4WH0A 1O0CA 1YBVA 5HIJA 1FZQA 4JI4B 4D0GA 1BMDA 1UC4B 2BSXA 2H1VA 2PO5A 4LYDA 5H80A 5EE0A 2Q3CA 3ZNPA 2EP7A 3AKCA 3B13B 3EUAA 1OJ7A 4TZTA 1LBQA 3A1FA 3D0RA 2X7JA 3HYRA 5DM1A 1WIWA 2ORWA 5C5EA 3TAXA 1FP4A 1Z0JA 1CT9A 1NFQA 3QBDA 1RLOA 2FG5A 4FFNA 2Q3JA 4GZ5A 4OQNA 4LF7B 2Q5JA 5D3KA 4C6RA 1TQHA 4DDWA 1SMKA 4KRFA 1D5WA 1A9OA 3DYIA 3REQB 4CUZA 3LXUX 2UV8A 1WEHA 5KKAA 4MJ7A 5IJ0A 3OWOA 3QPVA 3K30A 1PTKA 3PHBE 4OUDB 3CUSA 2J9RA 3INGA 1L4KA 1Z68A 4AKIA 5CTJA 1PNOA 3EG5A 2FQXA 2X6TA 2ACVA 5E7QA 3TZLA 5TEVA 4LXHA 4MQEB 4KQJA 4N49A 5KU1A 5IJ9A 3HBMA 4G65A 2EZTA 1NW3A 1YHZA 3BK1A 2ZVQX 3G8YA 5FL7A 5BR4A 3AEQB 1ESNA 3WJ2A 4DFDA 1X1RA 4I55F 2RHGB 2W11A 2D6FA 2OGWA 4GRAA 2ONCA 3AILA 3JARB 3L82B 1MRSA 5DTIA 4WA7A 1EGAA 1ZHFA 2AR0A 3O0TA 4DMGA 3JZDA 2VJLA 5FWNA 3BQMB 5LBTA 4UMDA 2BEVB 3GRPA 2JG3A 3RPEA 1YE5A 1T35A 1WXHA 4Q3DA 3SFTA 4YJ2F 2QGFA 3FNQA 5J5VA 3UK2A 1WSWA 2CVFA 1X70A 3S27A 4DCJA 2BVNA 1NBAA 1USGA 3IBFA 4IJQA 2WZQA 4YCSA 1PJ2A 1D2CA 2GM3A 2FW9A 2QTCA 2XDQB 3KKQA 4MA4A 5HJ7A 1E62A 1M3SA 3IA7A 3LTEA 4I1PA 3A6LA 2CLHB 2E4VA 1NVBA 3SEZA 1D4ZA 1NOIA 2FSIA 5DHQA 1X7ZB 3MWEA 4NBTA 4URYR 4CQMA 2HQSA 2JFQA 2EFGA 3LD9A 3N0WA 1XJ5A 2HPZA 2R6ZA 4EKYA 5AUOB 1LNQA 4XVCA 1EDBA 2R7NA 1ELOA 1STOA 1QVZA 2EZ8A 1FFXA 4PIPA 4TLMB 4W99A 3KJIA 3QH4A 3T7JA 3H5LA 5FPHA 2WF6A 4IXNA 1MJGM 4N0PA 3K0BA 2E9SA 2NU8B 1WTAA 3BQNB 1N1DA 3DXXA 4P80A 1NBEA 4YRNA 1O94A 1PEAA 1UDCA 2ZDQA 3TO5A 4ZQBA 5D51S 2XDYA 2Z43A 1X7WB 2PS3A 4R84A 2B8TA 1NXSA 3PHIA 4E32A 1QK5A 1E9RA 2ZYHA 4FFWA 3JYHA 4U02A 4XM2A 3VDNB 3EEOA 4MCHA 4I9UA 2PYZA 2G6BA 4EX7A 2B1RA 2QRJA 5DYNA 2ORIA 3VR5A 3C7CB 2GVZC 1W87A 2FYTA 2C5FA 4ER0A 4FB4A 2GD0A 1VPLA 4I50B 4ZVOA 1T6NA 1PEKE 3E9MA 4QYIB 3MWLA 3OHMA 1W1UA 3LRTA 3LG2A 4DA0A 5KHLB 3WTCA 3QI7A 3NDPA 2ZXFA 3DONA 1J42A 3HC7A 2I2DA 2A1IA 4UTVA 1NW5A 1OMOA 4DLUA 1PAUA 1GAQA 4GI5A 4G0UA 1TT7A 4K6KA 4KNWA 1VKNA 3V2UA 2AK2A 1Q0QA 1OLUB 4RTJA 2HCTA 4UNNA 3OPYA 3JTMA 4WJLA 3JQGA 2FPRA 2WD8A 2UXCB 2FEOA 3VOSA 4E08A 4ZVKA 4U7DA 2IYYA 4JLDA 5GOZA 2XJ9A 1E8DA 1T8SA 2BFAA 4F7DA 1U1FA 2MSKA 4LV5B 1QFYA 2TMKA 4CCYA 5JALA 4AKHA 3AFHA 4LISA 2FQ1A 2XHEA 1DTWB 4FLFA 1MX5A 5HE9A 4ESHA 3D1JA 4DXHA 3WYFA 3DYVA 4BO2A 2CD7A 3BTOA 3AB3A 2Q0HA 1E1YA 2PRJA 2VAPA 3EYAA 4LRSB 5KAPA 4W6ZA 4YAOA 3RVNA 2GBGA 3U4GA 1YS7A 4CMIA 4HNAB 1ZSNA 2OHFA 4FE7A 3OTIA 2PYIA 4CDGA 2MYNA 1OUMA 5ITZB 4ABTA 2I4OA 1O9BA 1UBCA 4FMDB 3LSTA 2IXBA 1HTWA 3ZQ6A 1FW6A 1QPZA 4HH0A 3TRHA 2GZRA 1CJBA 4ARZA 1ZM9A 2C3YA 2MSDB 2OO5A 1RXYA 4JP1A 4KMRA 2VHCA 3DULA 4ZCQA 3WAKA 3SS9X 3F2VA 3HGQA 1V35A 3IOEA 2BBTA 2VO1A 3OZSA 3UWKA 1JLSA 3RS3A 1FFEA 2Y4OA 3GLIE 4JP2A 4YV7A 5LDDC 4O02B 3HABA 3ESAA 3FETA 4MGKR 4XTRA 1Y3IA 3VC1A 1G8MA 2C7QA 1SURA 1KVUA 2MYTA 3FMPB 4JC4A 3UT5B 3T1QA 2EQAA 7ABPA 1VLQA 4L6CA 4M9CA 4V1CB 1II0A 2ZIUB 1JA1A 4MKGA 3MOSA 4F2WA 1KYTA 3RCBA 2DFNA 5KWEA 1MZPA 3MJEA 3P5SA 4BB6A 1P1BA 3DMNA 3MMXA 1V4NA 1UAYA 4MQEA 1K7CA 1TZ2A 3HV0A 3KVRA 4PZPA 4DIOA 1W9HA 2VF7A 1Y6GA 1UZUA 3TBHA 1N1EA 2H9IA 1PJRA 2ZT8A 3LSYA 3G7UA 3E2IA 3WMRA 2F1OA 2GR9A 2C4TA 3KAJA 3EIWA 1M8KA 4IQ4A 2ETXA 2HYDA 3FGPA 3KJQA 1QIHA 4ZOBA 5CLJA 1U9IC 2WKRA 2Q49A 3LS2A 4MKFA 2A5FA 1WB5A 2Z04A 3LW7A 3WZ2A 2PEZA 5J4YA 3W6ZA 2H1LA 1W0CA 4LDPA 4P4SB 4CQJA 4IXMA 1ZJ6A 1H6DA 3UH0A 5ISMA 4OXQA 2V3CC 2YV5A 1JLMA 1OXBB 1U9CA 3A32A 1ZOOA 5AK6A 4BLQA 4R3WA 4EQ6A 4HAXA 4YCDA 3DAPA 3CE6A 3U7RA 4KGDA 1XMVA 4MIYA 4AZ0B 3DQPA 4RVNA 2PCJA 2PGOA 2YX1A 4GLBA 4UFOA 4W5WA 2PMDA 3TEJA 4CIDA 4RWEA 1X7ZA 5H4GA 3E15A 1R9GA 1PR3A 1GQSA 2BFPA 2JJYA 4WKNA 3REFA 1GR0A 1LRJA 1G0OA 1RAEA 1RM3A 4BP8A 3Q3VA 3E22B 3EVGA 4M0EA 4I8DA 4YJ3B 2O50A 3PUXA 3VHXB 4DL9A 2P9QA 3ZBTA 3VZQA 4YRFA 4E14A 1S2OA 3LDAA 1Y63A 2CFSA 3KSDO 3SLGA 4BV9A 4ER6A 2COKA 2VRWA 1A7AA 3AF2A 2Q4DA 3E84A 3E9CA 3N8IA 3SJAA 2NU8A 1YIAA 3RE1A 1IH8A 4KO8A 4DANA 3UIEA 1RRGA 4RDCA 3V4PB 4G36A 1XO1A 5DNWA 4FGKA 1WW2A 3OMXA 4ZMRA 5TPWB 4LJ6A 2W6PA 2PN1A 5JBQA 1X7WA 4MW2A 5IWAB 3SQOA 1RMYA 2RHBA 3ADOA 3EFOA 5EIAA 4XD2A 1XGKA 5M29A 3L7YA 4DILA 2Y1GA 3AW9A 3IX7A 3WK8A 5A1TA 2IRWA 1C4XA 2P2YA 4NBSA 4C0JA 4U9IS 4YUZA 2E1RA 2VF5X 5J1SB 2P9JA 1KYVA 3PQCA 1BX0A 5CVCA 3EZXA 2O7NA 4PCUA 3VAAA 1OX5A 4U1RA 1PDVA 1XMPA 3W1VA 3EEIA 4IFBA 1L8AA 5IAAA 3R9XA 3TPFA 1UKZA 3E27A 4NBUA 3A4VA 2BFFA 3PHCA 3V2GA 5IM4A 4K8OA 3NDRA 2X4IA 4QE3A 1OLUA 4YECA 4RCZA 4RQUA 4DNFA 4YWHA 3MD0A 4IS2A 4AZTA 4DNXA 1ZESA 2JHCA 3IVCA 3CN9A 1ILWA 2OV4A 4BNDA 3BJMA 4OGGA 1AX9A 1GT91 4R01A 4C0QC 2CLEB 1DB3A 1SD2A 1XNHA 4F3NA 2CL5A 2XMPA 3WNBA 5C7OO 3OQOA 2HUNA 3O83A 2H4XA 2QRKA 3EHDA 4LNUA 4LGVA 4F4UA 1RAGA 5CLIA 5HA5A 2ECFA 1DTWA 1TLLA 4BLSA 5I4KA 2JGMA 3RC2A 3PS9A 1FS5A 3GLKA 1X19A 2Q6OA 2XADA 4TSRA 5IHPA 1W5BA 1P0IA 4LZWA 3WE7A 2BR5A 4EW3A 1DJOA 1GU0A 5LMZA 3QVGB 4FEYA 4JJ6A 1E1LA 4HNAA 3NHYA 4WLVA 2G1PA 1GPNA 5CB4A 3SMQA 4BEWA 1HLFA 4BNYA 2HDWA 2WT8A 3L2OB 5J5AA 4UREA 4JP5A 5DH9A 4ASUD 4A0HA 4IVRA 3TVYA 4KR3A 2BKAA 3TTSA 4D3YA 4EI9A 1RKVA 3MB5A 3DV0A 2PX3A 3PPIA 4BVEA 4RTSA 4H4DA 1U8CB 3A6KA 3CE9A 3VMMA 3LUGA 4MA5A 4AMYA 1Z4JA 3T0IA 6REQB 1XZGA 3PGA1 1W4AA 3OJ0A 1QJCA 3VZCA 2GXQA 4NE9A 1PR5A 4OMDA 3O31A 3PRYA 2QE6A 1HSOA 1VP9A 5HPYB 3G2HA 4BECA 2XXBA 4UU7A 4D4KA 3AHDA 3MCAA 4GMFA 1A3CA 1Z2DA 2WQ6A 2X2EA 3HXOA 2P5SA 5HIKA 3AI7A 3R8FA 3CGWA 4BYMA 3ZHYA 3RADC 4J4HA 2KQUA 4DCCA 1XDDA 2AJBA 2R47A 1KDPA 2ZR8A 3LGXA 3K5HA 3NWJA 3QWAA 3R2JA 4DCUA 3CLTD 5HM8A 5CLGA 4GSKA 3VISA 2I65A 2QE7D 1ORWA 5FOXA 4PO1A 5G41A 2CLLB 4L75A 5JNWA 1U31A 1TNDA 3FYUA 5DSXA 4RSGA 2HCJB 4DKJA 1EX1A 3OICA 4PPYA 4HDKB 2A1UA 4TL9A 5SZKB 5ADVA 1FC0A 3ABRB 4KXMA 1W19A 4O4JF 1SHKA 4V38A 2ZPAA 2IWHA 1E9BA 4EUSA 5CA1B 5TS2A 3RVLA 3GWGA 3SZMA 3P9RA 1AKMA 3M9XA 4N18A 4NOKA 3T7AA 3ZTTA 4K6GA 2H9YA 5CYGA 3I53A 1SD5A 1NT4A 2PIDA 2VCEA 2WM9B 4ECAA 2VRNA 2WSLA 3UT6A 2OSVA 3MIZA 3MUOA 4LDNA 4P31A 4JKIA 5F7ZA 3GROA 2IT1A 1NXPA 5EZ6B 2VPTA 2BGLA 1GU7A 4MWDA 4BAGA 2IIVA 3V33A 5B1YA 4WECA 2AL7A 5JRJA 4QBGB 5IUKC 3EVNA 4IPTA 1OIVA 4ZPJA 5FTWA 3E22A 1QMPA 5HCIA 4F2GA 3GLIB 3D4BA 2VPPA 3JQAD 1L6IA 1SHJA 5IYZF 2O5EA 2HK9A 4OHWA 4QM6A 1EBFA 3G2KA 2BTOA 1NJ1A 1OBVA 1MO6A 3KR2A 1NMXA 2GZAA 3AETA 3FJOA 4N5LA 5T3UA 3UATA 4ANFA 5C80A 3S2SA 5HUHA 5I8PA 4ECEA 5JDIA 2DM6A 1MV8A 2ZYIA 2F48A 1ZUNA 4H0NA 1RIFA 2ZYDA 4GWKA 1P0MA 2ICAA 4D9GA 5EA2A 2FMIA 5H9VA 3UJHA 3DP9A 4AJNA 4BU0A 1NXXA 4Y0VA 1JAHA 3AUXA 2ZZKA 1W36C 4OSOA 1ZAKA 1IZZA 1N0HA 1S8FA 2C5BA 3KQTA 3DHNA 1GD1O 2NADA 5FI5A 1REQB 2SNIE 4LSZA 5E4FA 2WF7A 3PC3A 1PG0A 2P3OA 4BNVA 1QP0A 3HJCA 2VPZA 4IILA 4HVAA 2NZ2A 2Q3HA 2XGMA 2Y71A 3LDGA 4S35A 2GBIA 1NE7A 2CL7X 4ZVVA 3TWOA 1PZFA 3VOBA 1HX7A 1IU9A 4ZVSA 2GH1A 4HB0A 1Z15A 1WD7A 2FCRA 2VUSA 5CW2A 4KWIA 4ZVQA 2ZAIA 4F3KA 1PQUA 4JBNA 2XGSA 2UDPA 3PIIA 4BNJA 4EHBA 1DFIA 3GJQA 3H0CA 1PVOA 3JWGA 3RASA 2LCIA 3AJ9A 3QXHA 1SG9A 4GEKA 3IQZA 3DHWC 4EI8A 4IMPA 4RESA 4JXKA 3FWKA 5SY4A 4UM8B 4E07A 2QSZA 1QHHB 1P5FA 2B61A 2WC1A 3PX3A 4XB2A 4ZGWA 3U09A 5ERYA 5FTKA 5TNXA 4NFYA 1ISMA 5E0KB 4RYLA 2C8LA 5AJUA 5JVDB 5EJ9A 5LIPA 3FFXA 2QVLA 4QTUB 3MSCA 3QEOA 3IDSA 1EAMA 1NONA 1KEZA 1QHGA 2XRYA 3ND9A 2QTAA 4MVWA 1WL8A 2PFGA 5KNCD 4MVJD 1XZ8A 3B8HA 1ZXBA 1M8PA 4YT2A 4P81A 1TXGA 1HG1A 4ROTA 2QZZA 3RFUA 2P1RA 2AG1A 4GX5A 3UV6A 4EYSA 1U0BB 2AOUB 4XAQA 1VXRA 3OJCA 4CHTA 3CUYA 3SYKA 4DUGA 1KAEA 4HNRA 7YASA 1L7QA 7MHTA 1M2OA 1R4ZA 2BP7A 1ZONA 1H69A 2GEDA 2SKCA 4RY2A 3VU3A 2YN2A 4MVJE 3FMGA 4RA9A 4XFDA 3C3CA 1IQ0A 3L1JA 2AZTA 4GD3Q 4X1KB 1QVVA 3BXZA 1C30B 1G21B 4DEXA 1HTTA 4NZOA 1KIAA 4TT8A 4Y6GB 2PLNA 4GR5A 3HXKA 4MX8A 4X00A 1AUXA 5H68A 2ZDGA 3FYCA 3WGIA 3UJNA 2OENG 1TX4B 3EN0A 2B69A 3L8DA 4XGRA 2P65A 2JJ1D 5CM2Z 1G4HA 3K31A 3W4KA 1JDBC 3DCNA 2ZRLA 4FI3F 5C46F 3KP1A 5BSFA 1KFJB 2VUIB 2EWMA 2VAMA 4B6FA 2CLOB 4ZCLA 3CS3A 2PGLA 3HJBA 4HK4A 4ZJPA 3TLKA 4UM9B 3DKPA 2FSUA 3F8SA 3TDNA 3EZ2A 5BXYA 3VZPA 1PYDA 1LX6A 3OBBA 4AZVA 4AZ3B 3IPLA 4NDNE 4YDHB 5BN1A 1QG6A 1XALA 2HA0A 2JD2A 4Q5IA 3NS7A 2ZIAA 1SBQA 3PUYA 1X7XB 2HK6A 4LRXA 3FAKA 4X66B 3FOEC 4LBZA 2JGAA 5AW4A 1WCV1 2XOXA 3B5JA 1J7KA 5BV2P 3OFKA 3D7RA 4BUJA 2H4WA 3B1VA 4C4SA 2VBCA 2C2OA 3FIUA 5JNLA 3U4MA 2CXQA 2ZRHA 4Q6WA 3DPIA 5DBGA 3M4XA 4MWOA 4EKDA 1MOQA 2OKGA 1FFWA 4OB6A 1TGVA 1E66A 2ASVA 1ZXXA 5DJ5A 4GYJA 3V9PA 4EGJA 1UP6A 1ODJA 2AZMA 2ZI3A 2VDJA 3QLJA 4GG1A 3C45A 4UJ5A 5EHXA 1LF0A 4HP8A 3W1EA 3TMKA 4N54A 1YRLA 1I13A 1JU3A 4J94A 4CQLB 1IEWA 1GG5A 1QRAA 3ZV7A 1SG6A 3F67A 5ILQA 1LTKA 2B4KA 2J7PA 1UQTA 5TQ0A 3W3AH 2Q4OA 2LIVA 3FYTA 2A4MA 4I8XA 1NVAA 3ZJ5A 4ZZ0A 2JH3A 5ICSA 4F3CA 4MUXA 1IL0A 3E35A 3KQYA 3O4VA 1BC5A 2XNJA 5DEIA 4MR8B 4BNIA 1IB6A 4BBPA 1H2BA 3C87A 3HMKA 4CT4B 1LPMA 2OBMA 3JVDA 3UUFA 3QEKA 2ODAA 4I4NA 1A9RA 4NPCA 4F3RA 1LSOA 3W5BA 3RFFA 4P3OA 4EEXA 4LKOA 5CVVA 1IJBA 1A5TA 1F4PA 2P0YA 2DU8A 3L40A 2ZWPA 4HN9A 3BBLA 1U0GA 1SH7A 1P1IA 4KTVE 5E6UB 1F0PA 5EEHA 4U7HA 5E7MA 5HJ2A 3MHTA 3ACDA 1X1BA 3PJRA 1G3RA 3CZRA 4N5IX 1P1KA 5K0CA 5CNJA 3U62A 2HYIC 1MMFB 2G8NA 2FMFA 3AV0B 4B17A 2H08A 2QX6A 1Q95A 1P3JA 5CA0A 2EG9A 4K46A 3UWSA 1YVPA 1RVV1 2CVOA 3GRUA 1KSGA 3R7SA 5KQPA 2QMYA 2B8JA 2PUHA 1ZD1A 3BDVA 3HVUA 4F93B 2MMCA 3DNFA 3SZUA 1YB6A 4F5EA 3SP1A 1EK6A 4I2NA 3UMCA 4Z9YA 2PA0A 5CEEA 1GPH1 4TYYA 2JD1A 1WXGA 5JHHB 3GHHA 3GUUA 2XWPA 1XWIA 4OHFA 5IP5A 1Q16A 2RDMA 3A4MA 2OFFA 4F84A 4Y2JA 1ENZA 3JWJA 4DE5A 4EHHA 3QBEA 4I1YA 2PMKA 1B8VA 2EKQA 1NFFA 3TEFA 5KTPA 2OT3B 1SUAA 1V6SA 2WWIA 1FPQA 3IP9A 3ZIUA 4HKTA 4ALKA 4C43A 5HK8A 3V8MA 5JO0A 4HLUA 5IKXA 1RQRA 3ZZTA 3CUWA 1RI4A 1EFTA 3HR8A 3IQIX 4YUXA 2IP1A 4PO8A 1UBNA 3DBLA 5JZBA 4ZTUB 4NC9A 2PANA 4G0QA 5DV9A 2FX5A 4DCVA 1Z47A 3CBGA 3OOYA 5A3VA 5KI6A 1OI4A 3UCFA 1G21A 1POWA 2IYOA 4L5CA 1KQFA 4YJKA 4YV2A 3BZBA 1RI3A 2H5EA 3S70A 5HOQA 2W4IA 3GNTA 1UR5A 3GMIA 1Z88A 3GPIA 1JYEA 3I9OA 3IAAA 3N2ZB 3QHAA 5K3FA 3QVJA 3ZOZA 3E2PA 2H5IA 3E7XA 2GAAA 1EZ1A 4OGKA 4Y18A 4RELA 5BWNA 2J6BA 2CVZA 1CNFA 1M2WA 1NVDA 4BXOB 3AHIA 4MJXA 4BOYA 2GZMA 4H7KA 4JLVA 4IMIB 3GPDG 1C3VA 4MVXA 4BNXA 1VHTA 4RY8A 1XVAA 3O2JA 3W3ZB 1Y8RB 2O0MA 4WBNA 1HNXB 1NQWA 7MDHA 3IV7A 4ZV9A 1D2EA 3D8HA 1G3UA 2AH5A 4CF4A 3PF9A 1ZM3A 4GKBA 2Y76A 3FMFA 1X7HA 4A0FA 3SS8A 2WU8A 4AZ3A 2A5YB 4LDRA 3PQ4A 5HF6A 3SJUA 5C8YF 3LC7O 1TECE 1IRXA 1CVIA 1Y89A 4AD8A 1NKSA 1N5OX 3FI0A 2Q6KA 4GZ6A 3GRVA 4E21A 2C94A 1AQNA 2JAPA 2XAUA 4IXDA 4GP9A 4RMIA 3WI7A 2PRKA 4L8FA 4N5NA 1H66A 3EBPA 5GWXA 1TJPB 2CHFA 4HOYA 4P92A 5CB6A 3AGPA 1JQBA 2AN1A 3LT0A 4HRVA 1KI2A 2IZ6A 2HW8A 5CRIA 2ZIGA 3LX8A 5DT2A 3IIMA 1QBGA 3IAFA 3HB9A 2X5OA 4QBFA 1CQXA 1XZEA 2DH6A 2P91A 4LGCA 4Q1FA 3S0JA 1TUBB 4GZMA 5CU7A 1QRUA 4IIJF 4WLEA 3GPCA 4FD2A 4TUYF 2H4ZA 1JI3A 3V4FA 1TCBA 1E7RA 3WLPA 2HFJA 4JQCA 5JAMA 1ZVKA 2AVDA 2GAJA 3L6OO 2AW5A 2VA8A 4C87A 1L5MA 4L6IA 1J8MF 4RL4A 3PUKA 2VWHA 3F7OA 3IJEB 5JAZA 1NHWA 3T7IA 4HPJB 2PUGA 3KZ1E 3W5UA 2NYUA 4MR8A 4HEHA 2BIFA 4ZQHA 4BWVA 3U9TA 2OP0A 1KYYA 3IB3A 1P33A 1UMCA 1ZCZA 2EJTA 3K8OE 4CV2A 1E32A 2QZPA 3GAAA 4F7WA 1NLUA 3F5FA 5G40A 3WAJA 3V7NA 3C3KA 4I9FA 1NE2A 3QWBA 1QH9A 1KJ9A 1QGED 4J76A 3L0SA 3LOPA 4CCAA 1PGJA 2V9ZA 3QF7A 3TLGA 4MUIA 2VDPB 1O95C 2JLBA 3SAJA 4EG3A 4TPKA 4M89A 1RRFA 5E6UA 5ELLA 1P4AA 4ZYWA 4WXEA 4H35A 4LDZA 4M49A 3COVA 3K9CA 1YS1X 1E3IA 4KLCA 5BOSB 1CY2A 3NGLA 1HXHA 3ROTA 1U3TA 2H65A 1W0JA 4UHFA 1R6AA 4J1TC 1P9OA 1EFLA 4Y2TA 3GOQA 3RAJA 3VH2A 1MO4A 1LKZA 5FTMA 1J23A 1QYCA 3OEYA 3TNDA 1QZ3A 2N75A 7AT1A 2YYZA 3PX7A 2HWYA 3OAAA 3E9DA 2EERA 1MTOA 1U3GA 4U7PB 4N4AA 4MJLA 2J07A 2FLVA 4OHUA 2BH2A 5SZJA 5JR3A 3CH7A 2YMLA 5CD9A 4QUJA 4YJFA 5BN5B 4PBTA 5L95A 3JYOA 3RS7A 2FP3A 3FGOA 2NMVA 2GCGA 1UM9B 5LU9A 4JBHA 2EWVA 1HE8B 3VUFA 1KL7A 4C9BA 4DREA 3ONEA 3UMGA 3WZMA 1RPTA 2VBFA 2VT7A 3FPEA 2A9VA 1PQWA 3D59A 3E5NA 3HBLA 1WF3A 4PEVA 3D7SA 6Q21A 1CYEA 4BHTA 3BH0A 3ZE6A 1X7GA 1KQNA 3IIEA 5TDHA 1RTTA 2BUBA 2FUG6 3FAZA 3MTJA 3H5VA 3SBEA 3ZGOA 3CEHA 3D6JA 5IKMA 4Q7LA 1VDMA 3DA8A 4UBOA 3WLFA 1RFLA 4B3XA 1FTQA 2VSXA 3GEEA 4XX0B 5SZIA 2PT7A 2P9GA 1A2KC 4QJ4A 1AKEA 1M7BA 2O05A 5DKFA 2AG6A 1ZLYA 3L84A 3PGLA 4BXOA 3RNOA 1XZCA 3HPQA 5F9HA 1DZIA 1T2DA 2W43A 2XMSA 3EDQA 1TD9A 3FFAA 3VAZA 5C3UA 5KYYB 3D5EA 1YU6A 3PTLA 3AERA 1P2FA 1YACA 3GFSA 4FMPA 4WWHA 1FUIA 3DT6A 4Y6RA 1R0BA 4JNCA 4M0FA 1P1CA 4ZCSA 4O3MA 3ADBA 2WNIA 3FA2A 4XKJA 3HKEA 4PSAA 4FUTA 4LN1A 4JI7B 1HKUA 3X3HA 2YMPA 4J0IA 4ZPXA 1X7DA 5CT5A 3WGJA 1IIRA 2AFHB 2RGXA 4NEHB 3TFOA 1FDTA 4U2BA 1EEXB 1YQ9A 4Q3CA 5IH7A 1EESA 2OE2A 3TB4A 3HRHA 2XZTA 4NQZA 1D0IA 3ITKA 4NYMR 1OTYA 5BNIA 4DA9A 3UGTA 4NMMA 1YZVA 4D44A 3EASA 4J49A 4YI5A 4DDHA 5J63A 4HLCA 1AQIA 1YKGA 3PF8A 5AKEA 2UXDB 4JK3A 3HDHA 1NLYA 3RAPR 2EEPA 2WWRA 1CQJB 2GNAA 3QFRA 3HDVA 4QYTA 2HK8A 5JMPA 1ZQ9A 2EBFX 4GT1A 5JXGA 2I8LA 2H63A 2E5LB 2BFCB 3JVIA 1YO6A 5DE3A 1TUBA 4I6GA 1EK0A 1YK0A 3G3EA 2Z08A 1DTEA 1MOSA 3OOHA 2XNDA 3ZDQA 1PZEA 2C07A 2OD9A 1I6LA 3BGIA 3DOJA 1HBJA 1FX1A 4Y2GA 1IAVA 3CKLA 5EGSA 3TPCA 5HRAA 1JUDA 4UEKA 5F5NA 2EDCA 4DV1B 1R7RA 3T5DA 4JWTA 1TQ8A 3TSCA 3LHIA 2Q5OA 4F91B 5GPBA 3KFLA 3MJFA 1XK7A 4O33A 5ITVA 1MDBA 3RAFC 1FLAA 3A9SA 3K0EA 3RTDA 4YP1A 1L7VC 3PQ5A 4L50A 4UAGA 3T0GA 4FILA 4TMZA 4JB3A 4DY4A 1RQXA 1A97A 3W0LB 4I8IA 4M0PA 1AXRA 2GPWA 2VC2B 1Z34A 4AYWA 2GYVA 2P41A 3QNUA 3DMPA 3FD8A 2NX2A 2JNWA 2ZPUA 4V0KA 4NBKA 5BW5A 1N57A 3TJMA 1Z6GA 2WZBA 2R7AA 2AX3A 5FBHA 3RF6A 1LQTA 3PEEA 4BLRA 5FAKA 1KI6B 4UBNA 2J0SA 3RDPA 3FTPA 1PJBA 4BZZA 1OHHD 3DMDA 1Z2NX 5BVHA 1TM5E 2BHNA 1Z62A 2WINI 5COAA 1BH6A 4UOQA 5J2UA 3MIIA 1N2CA 3TJRA 1MJHA 2DHRA 3G6WA 3SIPA 3EZLA 2R4UA 3AFGA 1CZLA 1JR2A 3EYWA 3JQBA 2X5JO 1UOPA 3G0IA 2ENUA 5DOZA 3PQ7A 3TL6A 1M0SA 1K88A 1WB6A 1FNMA 1OWNA 3KZNA 1K2WA 4KK3A 4MS4B 3RT9A 3OF5A 1KVSA 3R8XA 2QMHA 2II6A 4HUTA 3HQ4O 1RAIA 4WLUA 2PZJA 4WZBB 4QWWA 4DMCA 1J1ZA 3B85A 3L0DA 1L5KA 2PUAA 3HJGA 2HEIA 4K2HA 4TVKA 3UOGA 3VPFA 4BNGA 1EU1A 1HV8A 2Q1YA 3EMDA 1OFGA 5BN5A 1IEXA 4EHIA 3DEKA 4RXTA 4NCIA 2G7ZA 4JNKA 1W75A 1Q0HA 3KPUA 3TLEA 1UM9A 5CLFA 2BZSA 2UKDA 2VXCA 2JA2A 2P9BA 3DZIA 3LWZA 3QMMA 2I2FA 2MU1A 1DAGA 3CRMA 4TTPA 2WKSA 1DC4A 1HYEA 1P80A 4Q9NA 1QKIA 1XZMA 3B5IA 3ITNA 4HAIA 2QVXX 1DU4A 4N0DA 3DDWA 1T0JB 3NOVA 2PV0A 3BQ9A 4MZDA 1IXKA 2J0QA 4JVNA 3CSUA 4BFUA 3K92A 4V1CI 4XARA 1DOAA 3LY5A 4G24A 2HIMA 2PUBA 1N5MA 2ETVA 4QDUA 4YB8A 4A5SA 2ZVPX 4N7BA 1PWHA 3T7RA 5LZ5A 4DA8A 4A2WA 2KS6A 3KQHA 2IEYA 2ZR7A 4X63A 1FB5A 3CUEF 3Q7TA 3SEFA 5JSYA 2IUFA 3ZN2A 1YFKA 2DPMA 2OZPA 1FTYA 1BG6A 4FFLA 4DSOA 2R86A 4X54A 3NIGB 1H2FA 3KM0A 5BNFA 4ZZ3A 5KTOA 5BMVF 4HGNA 2IZZA 4YC7A 1NULA 1DT5A 4X3CA 4AY6A 1JZQA 4FHFA 4KYUA 3BRCA 4YJ3F 5ETJA 4YMHA 1YMVA 3KYCB 3HEAA 2KLBA 1MB4A 2Z57A 2C9MA 3HHEA 4JJFA 2XNSA 4O4LA 4PTYA 5FTJA 4S1VA 4N9QA 1GNLA 1V8FA 2AFHA 2HIAA 3QVTA 1VE5A 1EUCB 3ZE8A 3HS3A 4YALA 3KQQA 3NP7A 4RFSA 5EMMA 1ZPDA 2IEZA 4NBLA 2GKOA 2N42A 1GZ4A 4H3VA 4PXSA 1LI5A 2ZIWB 3SYNA 4RTQA 3BOSA 2GCOB 1I0IA 5ALFA 1OBHA 2J9YB 3CLUC 3EH2A 4X7BA 1JF8A 4JLBA 3M4YA 1V6AA 1I30A 1CLEA 2TMYA 1J4AA 3U4HA 2BDTA 1L5FA 5JS8A 3VOTA 1GDTA 3JAWA 2BFCA 5FR2A 3KE8A 3LECA 3PFKA 4S1TA 3L8EA 2Y1OA 3DXFA 2W42A 4OI0A 1JDZA 6ADHA 3I2IA 2QRMA 4UHCA 1S3FA 4WKGA 2NV2B 3AHHA 5FDFA 4XWWA 5HMLA 1P61B 1DXOA 1M8GA 5ELXA 1SC3A 3LCCA 2FPWA 3KIPA 2H18A 1QCZA 1NI4A 5FEMA 4KHZA 2XUZA 1IG3A 2GNOA 2QNIA 1OT3A 1H6BA 1SZPA 3B78A 4HX2A 2O2HA 4AN0A 5K3OA 3TGWA 3SQXA 2ASEA 3PSHA 2DEUA 3U7GA 1OGJA 3JQFC 1C9JA 3QXCA 3ZU4A 2OCGA 3QLUC 3RIYA 4CQMD 3BA1A 1B3BA 1K0FA 4OHYA 3ABZA 2YYAA 3L4BC 2JI8A 2P77A 4INOA 2REQB 1JECA 2ZSAA 3NIBA 4EW1A 3L06A 1PFWA 4HDNA 2RMKA 2YY5A 4LZPA 4M7PA 3EWNA 2XBMA 2Z8XA 3PPVA 5K0SA 4D79A 3I1FA 1IN7A 4MOWA 5TPZA 1U81A 3PT5A 4LX8A 4HL6A 3T3GA 4CLXA 2K2QB 1W4BA 5FNZA 1O94D 1DJPA 4J43A 2MSEB 3A1SA 1YIDA 1NZJA 2HO4A 3UW3A 3WLAA 4MLZA 3ASUA 2CFTA 2IIQA 2J0EA 2P75A 4B82A 4A9AA 4JQYA 1KSHA 3HGTA 4MJ3A 2OXEA 5CVJA 1CQWA 1QPBA 1XEFA 4U2DA 4B7ZA 1L5YA 5JNRA 5K45A 3SZOA 2JDID 2QZ4A 2C2ZA 4P3PA 2E4ZA 1E4YA 3M5DA 4AXXA 3L7CA 5GVRA 3FUWA 1P0QA 2IPAB 5AHWA 4DWOA 3OQJA 3OIVA 3EC2A 3QFCA 3QI2A 3MWYW 4CEHB 3HM9A 1Z5PA 1CFJA 1SKQA 2XA2A 3B6ZA 3FVVA 5DASA 1E5XA 2CB0A 2F7SA 3B6JA 5A7GA 3TI7A 1GNVA 3ZLVA 1CZRA 3FW1A 4ZZ2A 2KLHA 1V8OA 5EGNA 3UHAA 2OHHA 1ZO8A 3G0CA 3OO1A 4IG9A 4BVBA 3WBBA 4KWHA 2IV2X 4KFRA 1XWFA 2J6HA 1KHTA 4PG7A 4H6VA 3GFGA 4XCXA 2OD2A 1U7WA 1X1SA 2IF2A 1COWD 2H59A 1C9EA 2ZE5A 1XYVA 4IS3A 1U8YA 1X8LA 3TNYA 4ATNA 5ES4B 2Q2OA 5KQGA 2DQ4A 4ZQFA 3DZKA 1J0XO 2JIOA 5CTAA 2GPYA 2NP6A 1EVKA 3VR3D 5ENDA 3ZJUA 4UQOA 2D54A 1V16B 1EVIA 2DKOA 5CA1F 2Z1MA 4CV3A 4XR9A 3A4LA 2XT9A 4X1YB 4U5XA 3RS2A 4XWGA 2OV1A 5JHGB 3GUVA 4KIGA 1F5NA 1D9XA 2VJKA 1RRPA 3Q87B 1T8UA 2QV7A 2IV7A 1Q83A 1KAQA 2EKPA 4W5JA 3FHJA 4D9BA 1S2DA 4GOKA 1G6KA 4ER5A 3ZTWA 1OXTA 3BG5A 3LQYA 1LK5A 4XQGA 5DHRA 5B4UA 4E2WA 3DR5A 3QM1A 3OLVA 2WQZA 1EK5A 5T5QA 4Z3OA 3LA6A 1XDBA 5L3SA 2F6RA 2PZMA