4C29A

Crystal structure of high-affinity von willebrand factor a1 domain with disulfide mutation
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
201
structure length
201
Chain Sequence
PLHDFCRSRLLDLVFLLDGSSRLSEAEFEVLKAFVVDMMERLRISQKWVRVAVVEYHDGSHAYIGLKDRKRPSELRRIASQVKYAGSQVASTSEVLKYTLFQIFSKIDRPEASRIALLLMASQEPQRMSRNFVRYVQGLKKKKVIVIPVGIGPHANLKQIRLIEKQAPENKAFVLSSVDELEQQRDEIVSYLCDLAPEAPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Towards the Structural Basis of Regulation of Von Willebrand Factor Binding to Glycoprotein Ib
pubmed doi rcsb
source organism Homo sapiens
molecule tags Blood clotting
molecule keywords VON WILLEBRAND FACTOR
total genus 70
structure length 201
sequence length 201
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-08-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00092 VWA von Willebrand factor type A domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.410 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold von Willebrand factor, type A domain 4c29A00
2WW8A 1U8CB 3EOAI 5ES4B 2NUTA 1MJNA 2IUEA 4HQNA 1SHUX 3EOBI 4MMYB 1SHTX 4DMUB 3ZDXB 4O02B 1ZOPA 1FNSA 3IBSA 3N2NA 3ZQKA 4F1KA 4C2BA 3EFOA 5KYWA 3EH1A 3FCUB 1U0OC 2NVOA 3ZDYB 1N9ZA 4WK4B 1JEQA 1IDN1 3K6SB 4WFQA 3TW0A 2QTVA 1N3YA 3EG9A 3F74A 3QA3E 1ZONA 1NA5A 3BQNB 5LN1A 1YVRA 3EGXA 2I6QA 4HQLA 1V7PC 1Q0PA 2VDRB 1M1UA 1PD0A 2VDQB 4M76B 5HDBB 3K6SA 3BQMB 3GXBA 1OAKA 2VDOB 4MMZB 4Z7NB 5KYXB 3PPYA 2I6SA 3HXOA 3E2MA 1T6BY 3TCXB 3ZDZB 3V4PB 1MQ9A 3NIDB 4HQFA 3ZE1B 4F1JA 1YVPA 1AUQA 5HJ2A 3T3PB 2XGGA 3ZE2B 5KYUA 1CK4A 1XDDA 1RTKA 4BJ3A 1ATZA 3VI4B 3EGXB 3PPVA 1MHPA 4IXDA 5E6RB 1PT6A 4C2AA 3EG9B 4NENA 1BHO1 1CQPA 1TYEB 1RS0A 4UM8B 3PPWA 4FX5A 1XUOA 1DZIA 2ODPA 2NUPA 3F78A 1JEYA 2XWBF 1UEXC 3IJEB 4Z7OB 1XDGA 5E6UB 2WINI 5KYYA 4JDUA 1PCXA 3EGDA 2VDKB 4NEHB 1IJBA 1M1XB 1M2VB 1QC5A 2ADFA 3HXQA 2X5NA 4UM9D 2ICAA 5KYYB 2ODQA 2VDPB 1MQ8B 4CNBA 1FE8A 1MQAA 5E6RA 3M6FA 4C29A 2VC2B 1JV2B 2NUTB 5HGJA 1BHQ1 3VI3B 2VDNB 1IJKA 1M2VA 4WK2B 1PD1A 1QCYA 4XW2A 4A0QA 4Z7QB 1U0NA 3PPXA 4WK0B 3K71B 3RAGA 1JLMA 1LFAA 1ZOOA 2O7NA 2VDLB 5E6SB 3HI6A 3EGDB 3T3MB 3NIFB 5E6UA 5BV8A 1RD4A 4MMXB 4UM9B 1JEYB 2XWJI 2NUPB 1L5GB 3ZE0B 1DGQA 5E6SA 1AO3A 4IHKA 3NIGB 4HQKA 4HQOA 1JEQB 3V4VB 1T0PA 4PN7A 1IDOA 4IGIA 1MF7A 4WJKB 3BN3A 3FCSB 3Q3GE 3EFOB 5KYWB 1M10A 2B2XA 4CN8A 5KYNA 4NENB 2VDMB 1M2OA 1SQ0A 3EH2A 2M32A 5KYXA 1AOXA 1RRKA 4G1EB 3K72B 4G1MB 5KYUB 2I91A 3TXAA 3TVYA 4CN9A 1QC5B
chains in the Genus database with same CATH superfamily
4O8CA 4AKTA 2CXRA 4GYKA 5CB4B 2VHXA 2ZR0A 1CCWA 1SUIA 2QM0A 3HKDA 4XX1A 4LSGA 4DR1B 1WMSA 1Z8HA 2QI9C 2VN8A 1YRWA 1SPXA 2XDAA 2JFGA 3H11A 3QA9A 3DQQA 1T1GA 3BFKA 3LLSA 3P26A 5AW4A 4BTLA 4RGQA 2XCUA 3TTYA 3IVMA 1OXMA 4FR5A 1ICIA 3NQ41 3E9YA 2A1UB 4ZVSA 2G3YA 4OEHA 4Z0HO 1A7UA 3KQTA 3ICEA 2I2FA 1QZUA 1YS2X 5J5AA 4AJOA 4S2UA 3FKJA 1YD7A 3LKDA 3OT1A 4RXTA 4Y1RB 5EJ7A 1DJQA 3BGWA 4GYJA 1SA0B 1SUCA 4FX2A 3HCPA 3O4VA 3OEHD 3SSOA 4DILA 4E14A 5C4MA 1MIOB 1KMMA 1MH1A 1Y3AA 2GO7A 2MT9A 5HJEA 4H2DA 3IVCA 3N0XA 3TCXB 1MAUA 1DWPA 3NM5A 4R5HA 3HKEB 4G07A 4RKFA 3UJAA 3L8ZA 3HCNA 3ORHA 5AOBA 3H04A 4PLPA 5IUJC 1T0JB 4JWTA 5EZQA 3LLMA 3WNCA 5HPYB 1XTBA 4US0R 4CLRA 4F9FA 3ZZMA 4BN4A 1A7JA 3BKXA 2Y0DA 3G2HA 1LDBA 3GC6A 3L0SA 3MM4A 4O4IA 4OF4A 3EMBA 4FMDB 5FCDA 3VUEA 5BNIA 1OWPA 2PQMA 1P2SA 1CIJA 4IYRA 1G18A 3E9DA 2XOKD 1NI4A 1TZCA 3TLYA 3MWJA 3OOHA 5JS2A 4FWTA 3KJZA 5DNVA 1XLTC 2JCVA 1XYGA 3PPWA 4J2TA 5BOVA 3O26A 3QLUA 3U61B 3EFHA 2FJ0A 1WZIA 2VWGA 1VCIA 3NT4A 4TSFA 3Q7RA 5AMXA 3EE6A 1BWSA 1G55A 1LSOA 3GEDA 3U6KA 5HKKA 1J9EA 1SBTA 3PQDA 3LVFO 5BY2A 3MD9A 3G1TA 3EQ7A 3MJFA 3HDHA 1IM2A 1XQVA 3L2OB 2BVNA 3CX8A 5G2OA 1P0PA 2R1UA 3U56A 3DCJA 3ANMA 3UJPA 2WVJA 1PQWA 2AHRA 3BMCA 4N5DA 4YRGA 1GXSA 3K0FB 4I9FA 1V39A 3OWOA 4ZC1A 4K7JA 4N47A 3VNAA 5B4VA 4Y98A 1IJKA 1I6WA 3PXDA 2FOIA 4M9ZA 2ZB4A 3FB1A 4YAJA 2JAXA 3IE0A 5HFJA 2H1VA 4QQFA 3MT0A 3EXG2 4RF5A 3WG9A 1X80B 3A3PA 4FDMA 4RESA 1SCIA 2H4ZA 1G1MA 2EG5A 1XD2B 2BDTA 3EIFA 1Y8CA 1R4AA 1RRFA 3LO5A 4FE7A 2ZE8A 1N5KA 4MINA 5IUKC 1V48A 3UTCA 1BHSA 3KYBA 4BNUA 4BP1A 1JLRA 1CR2A 2V96A 1E7YA 1HTTA 1C7RA 2FEWB 1XF1A 2LD4A 2YIVX 3AV0B 4KQMA 2J9GA 2J1LA 3GNLA 4IDFA 1UXIA 1T2EA 2XTZA 4GG1A 1ZL2A 4CTNA 4DV6B 3EIQA 3WDMA 4XCXA 1XZCA 3KKKA 3O95A 3EQZA 2QSYA 1YJ5A 4ZHQB 1V8OA 4ZMBA 2GR9A 4Q24A 1WMAA 5A1TA 1AZLA 1EGAA 4HDOB 1Q7CA 3E27A 1JDPA 4D4MA 1UZLA 1WDWB 3BEDA 1T2DA 2HFJA 3TNDA 2HQ1A 2O8DA 1FFXB 2GBIA 5CXQA 4AKEA 3BICA 1IY1A 2DPXA 2CV2A 2VG8A 1S8OA 3B1ZA 3Q7SA 1S6YA 3Q2KA 4QOJA 2VWHA 4R9RA 5DJ5A 2ISSD 1PK9A 4GC5A 1KSJA 4GOKA 4QODA 1KOFA 2ODAA 1R0ZA 3CRW1 4Y2SA 4AROA 2VT6A 3ND9A 4HH4A 4WKPA 2O2XA 4RZSA 3Q3IA 4EI7A 3UWMA 4LSZA 1G7TA 2DSNA 3SQDA 1SKAA 1MGOA 1E2BA 3IKJA 3VR5D 1EUDB 1I0LA 2P2GA 3GLSA 4X6XA 1VFNA 4M1OA 1P0IA 3IOYA 1J70A 3AB8A 3LCJA 4BCCA 1EP9A 4BV9A 1QIFA 2W00A 3D7MA 1NN3A 4QDKA 5LUAA 3NEAA 1NPTO 1Q0ZA 1Z56C 5I7WA 1ZJZA 1XFAA 3A6GA 4J91A 3ZUPA 4DSNA 1I7QB 1YKSA 2GZAA 2VBCA 1DBWA 4JI8B 1I80A 1G0NA 4OKNA 4JX8A 2BFBB 4DV2B 3SQNA 1FOEB 1UZAA 3GJXC 4OXIA 3I5AA 3S3TA 4HFJA 1R8YA 3GNTA 2Q1UA 2NW6A 4WADA 1GCGA 1UBKS 1XU7A 1C9JA 2CF6A 4KQ6A 4Z4EA 3I1FA 4F12A 5EN4A 5FWNA 3RT7A 5AW3A 4R1SA 3UV3A 4FBMA 1HL7A 2AXEA 4HEJA 3SC2B 5JFGA 3I5XA 4A2QA 1QO7A 1N77A 1Z8FA 2IHTA 3SYRA 5C4IA 2Z2ZA 1CY1A 1K4MA 1O8CA 2DE0X 2HBRA 2VK2A 3D4IA 4JJ4A 1PT6A 1X80A 4WH0A 5BQ5A 3SXUB 3U44A 3SVLA 4QUKA 3VMMA 3Q6NA 4JJIA 5GONB 2Q3CA 2OV2A 2ON6A 2ORIA 4QGFA 4QREA 4AP6A 1Z37A 3EIHA 2XR1A 3I4LA 1QR2A 4XH9B 5AW7A 5I8PA 1Z7GA 1IXZA 1XQXA 3VGJA 2PUCA 1X7YA 1CNEA 3G2NA 3VDQA 2OWDA 3M2PA 4A5SA 3RADC 2HSGA 2GAOA 1HYBA 1UKYA 3CUWA 4OHMA 2V3VA 1VJCA 3MSXA 3MS7A 1PQUA 3WZLA 4CTKA 1NMSA 1NUUA 1F17A 3PD7A 5TR9A 1XR3A 4NJMB 4X9XA 1MT3A 1JXOA 1G8HA 1AGYA 3DZHA 3IBFA 3HXQA 1K68A 1PWXA 3NVAA 1KHTA 3KZKA 3AI2A 4HQ0A 4LJ5A 1GSOA 2R79A 3PENA 3B3AA 4FOOA 3FVWA 4O4HF 5FP0A 3ELUA 2GO1A 3IPRA 4Q93A 5LNK1 4ID9A 4HJRA 1IHYA 1GKUB 2E3JA 2H18A 4WT7A 1PL7A 3B78A 5JWRA 5LOVA 3H42B 2NVWA 4MYHA 1NNLA 3CHYA 2ZETA 2O7NA 5DM60 4DCOA 1MEOA 2YRXA 3MQ2A 5M2QA 4ZO4A 2OWEA 5FBQB 4CMIB 1PP4A 3PGMA 3O9VA 3EDOA 1KBQA 2CNDA 4HB3A 2EC5A 3FOZA 1Z2DA 4G0YA 4M53A 3ZHCA 1EBBA 3PNMA 1E6CA 4P93A 3U7GA 1XTSA 3Q9LA 4EKIA 1C0IA 1MG5A 1GUAA 1M6EX 3FCXA 3OO0A 4EPWA 2N1BA 5FTLA 3MTEA 5JNSA 2W0MA 1IXKA 2BMWA 3JD4A 1DXOA 2JIQA 2BPOA 2FMFA 2VRWA 1T9AA 1FW8A 3RIXA 5LQAA 1I6MA 2P2LA 2QPTA 2I91A 1CUAA 2VZLA 1JG1A 2D2VA 3I01M 1FU7A 5CYGA 4NS1A 4KEAA 2GB4A 1NAHA 1SU6A 2GK7A 3R23A 3BS4A 3C5VA 3NWOA 2R1VA 3ICPA 1MC5A 1SOUA 4NDNE 3I6IA 1W5BA 4WNCA 3RVLA 5JXJA 5BQFA 3KG2A 3HWWA 4HSGA 1GQYA 1TNDA 1I6LA 4IMJB 3VDXA 3F7OA 1HDRA 3RTCA 1I3LA 3FDIA 5IM5A 3FMPB 3WWDA 1RJWA 1Z7EA 3ENQA 1RLJA 1W0JA 3ANTA 3FOBA 4FT2A 5D51S 1O2DA 1U7PA 3SYLA 4RDXA 1UJMA 5AKYA 4OMFG 1OXBB 4HGOA 4QC2A 3MVEA 4YCJA 3FYUC 1DEKA 3PQ3A 5CB0A 2VPWA 3EVNA 3H16A 1XRLA 4LMRA 3LSTA 2A1UA 2XMQA 1LF5A 1PU2A 2JGNA 3HA7A 1G9TA 1M9NA 2QF7A 4GP9A 1Y63A 2N3ZA 4BB6A 3GAAA 4JJEA 2ZSDA 3HYLA 4E1BA 3EAQA 3T4PA 4BN0A 3DR3A 2EF0A 2EFJA 1FMFA 3ESZA 5CT6A 1OD6A 4WN3A 4NQRA 3JD3A 4GKKB 3WQBA 2PWZA 3KXIA 3MELA 5DLPA 1WUIS 1I8TA 3KOMA 3NAGA 5DYTA 5E2AA 5AUNB 3VKHA 2BWJA 1YHNA 1GEGA 4CT0A 2C8JA 3DXXA 1DXQA 3F5MA 3IDOA 3NORA 5HVNA 5FL7A 3G6WA 4G09A 3EVDA 2B8NA 2ZZMA 4HX9A 4O63O 3FH0A 2PX5A 1V45E 4TKUB 4ZRNA 1C2YA 4GI3A 1GZ4A 1WHSB 1IWPB 4HEHA 4HWSA 2DFPA 3K70C 1W49A 1T5SA 2JGDB 2Z2XA 4TTJA 4HAVA 5AM5A 1RS0A 1XZFA 2GK6A 5D6NA 4EG7A 1X38A 4Y1GA 2CLCX 3S7ZA 2XODA 1ADCA 3M9XA 3ZU6A 4MIKA 3WAGA 2EEZA 1IXSB 3BD7A 5JCXA 3BZBA 4Q3BA 3VR1A 3LF2A 1MO3A 5K6AA 1KRWA 5T4BA 2E7ZA 3P9RA 2A7XA 3M4ZA 4HGYA 2QW8A 3TOVA 1D3AA 4E6PA 1TD9A 1VSQA 3TTSA 2ERXA 5L45A 4RPCA 3B2NA 3EMVA 2QENA 1XHEA 4ZCMA 4INZA 4NFSA 1YQGA 4I1OA 5EZ5A 2WKPA 2E85A 1QAOA 2MYNA 3AM1A 1T9GS 1R8XA 3E3LA 1MQ8B 1UM9A 1KI7A 1I4LD 5KHLB 5JROA 1SVIA 4IJ5A 4IICA 2XMPA 1MC1A 4EVQA 1U8ZA 3VI3B 4FOLA 1OLSA 4M86A 5L3SA 4CG1A 4ER5A 5KVAA 2FPRA 3LX4A 4DYDA 3M0EA 4URFA 1AC5A 3MRVA 4BB9A 2WJ3A 1LC3A 4FOSA 2SBTA 2J3JA 3D6TB 4HFRA 4LQDA 5AJXA 3OFNA 4HB4A 1J24A 2P27A 4H7IA 4F4JA 1KGSA 2CLSA 3QW2A 3E22B 1ZPDA 1YCDA 5CVJA 4CQNA 5EJIA 4MV1A 2EZ9A 1X42A 3NUQA 1YZKA 1XTTA 2C1EA 2V7XA 1FSGA 3N6XA 3Q3JB 4MQMA 4YC7A 4OHZA 1XLTA 3SSAA 1IHXA 2AXNA 3U7RA 3EODA 3UHPA 4MITA 3WWPA 3ZK9A 2WU3A 1G8FA 1N3BA 2GWRA 4UDOA 2BTQA 3BWYA 4A6EA 3A32A 5IABA 4OQQA 3F3SA 2A5LA 4RUKA 3QKTA 5F98A 5BQ3A 1VKOA 1BXRB 1E4VA 1HXHA 1NUTA 3HYSA 1TCAA 3AF3A 4L28A 2J0SA 1CKEA 4Z0NA 2Q1XA 1UMDB 2C96A 4CI0B 5CA0F 1W9MA 5ARDA 4IIVA 1S2DA 4KYVA 2CDAA 2JASA 2L2QA 3HXTA 4F9EA 1UBNA 1V8ZA 4UVIA 1Z2AA 2C4UA 2HBQA 1A69A 5K8VA 5LQCA 5DM1A 5BNTA 2WTMA 1BWQA 2X6RA 1T10A 4CV1A 1H2HA 4QTUB 4RZ3A 4FCWA 5GP1A 1XZPA 3AR5A 3LKZA 4PF1A 1D6SA 3GBVA 1CEYA 3SPXA 1CW2B 2Z04A 2BGTA 3QW4B 4L6AA 1HPLA 1YKFA 1T6BY 3ABIA 2WJ4A 3AEKB 3D8SA 1JX6A 2O7VA 4GNKA 4XM0A 4D99A 2YFYA 5HJ2A 3WI7A 1WXEA 3AVOA 5IM4F 1KY2A 2C2HA 3ZBTA 1KKUA 1KVTA 2ZSFA 5CEEA 3T4UA 1HRDA 5CX1A 3E9MA 4C7OB 2Y4OA 5LKRA 3GF4A 1NI3A 2IL1A 2OV4A 4KFSA 4YMTA 3AESB 3KUUA 1ZN2A 2DTEA 5EXPA 2Q5HA 1QH8A 4KX3A 1TW3A 2BP7B 3C5WP 4WVFA 1QVVA 2HQSA 2Z95A 3OVMA 3R7WB 2XUDA 4ASUD 2WLSA 4PNHA 3DDZX 4EB6A 4DGSA 3ICWA 5C0OE 5IP5A 2H9IA 2JGIA 4PCLA 1SOVA 4IZIA 1VM6A 4ZI7A 4RC9A 5CA1B 1Y80A 4C4RA 2YV3A 3RG2A 4C1BA 1DWOA 4H0CA 5LZ4A 3AHHA 1UMKA 3A9CA 3AUTA 2RK6A 1UJ6A 1IN8A 1Z5VA 4L27A 3KUCA 1YZGA 4UVDA 3GJRA 4ER3A 4DNFA 2V54A 4KXXA 2OORA 4BGUA 1TQ6A 5C18A 2XAAA 1PLLA 2XA2A 5LZ5A 1LK7A 2QTZA 1EWRA 2P75A 1ZM7A 3CLUC 1JEOA 1CF9A 2G08A 2Z8ZA 4O2LA 3DZ8A 3WLIA 4DKJA 2OB1A 2H85A 1VHTA 3AUSA 4AIIA 2QHXA 4IEFB 3U26A 1NQ5A 5BSWA 3T5TA 2VH2A 2JFYA 2ZR8A 1G0OA 5HIJA 1ECCA 5JZMA 1XNGA 2FXIA 5JUWA 2QMYA 2GZRA 4XSVA 4UHEA 5A02A 3RAEC 3W8DA 2XKAA 1Q19A 3EXIB 3V2IA 2FF7A 3E0QA 1CZUA 1OROA 3IAS1 4TKMA 1ZVMA 3U7IA 1IPFA 1E0SA 1OLSB 2RHJA 4OQNA 3R7WA 2OXRA 3KAPA 4KV9A 3GEPA 3EW7A 4KQJA 1XDUA 4WJKB 2AOVA 3AR9A 1RJFA 5EEGA 5JEDA 2B5WA 4D8TA 3L82B 1MC8A 3KC2A 1JKFA 1ITZA 1CEXA 4MAMA 1KEKA 2QNIA 3TAUA 2IK8A 2AS0A 4UPDA 5K0ZA 5K8IA 3OEYA 4MKHA 1AH2A 2VUSA 1YR9A 1ZOIA 1W5FA 2VA9A 3LBHA 3KHKA 4D0NA 3ZCVA 1M2OB 2CHEA 5T3YA 2OYSA 1UK8A 2HLDA 5KTNA 3QV1A 4LGVA 1XTZA 2DTDA 1ZXLA 2F1IA 3BREA 2VYNA 4U2DA 2XMBA 3B2EA 2F59A 3EYAA 4PS1A 1HEYA 3IQWA 3R8FA 2B2CA 5C1BA 1YRBA 2KHZA 3SYKA 3RHZA 2ALJA 4I5DA 5H3CA 5E7JA 5DTRA 3PRYA 1H0SA 3WSVA 1PSZA 3ZBPA 4DVGA 1H9BA 1DARA 3CSSA 1BWRA 4CMBA 3JQEA 1OYWA 1B76A 1VRCA 2J0UA 1B8OA 2ZP1A 3OZSA 3R3JA 3UWDA 4ED9A 1LVGA 3IX7A 3FMOB 5K8LA 3KELA 2POCA 1QS0A 4IVNA 5AVKA 4XD7A 2A0KA 1UZNA 1TO1E 1V11B 2IP1A 2UZ1A 2XYGA 2RGRA 3VYTB 4JLOA 1LNQA 3DF9A 1ISFA 4XB6B 5HKLA 4E5PA 3C6QA 1VJDA 3T9DA 3NGXA 1PK8A 2REQB 3AK4A 1TMGE 2JCYA 2G0NA 5JMOA 5KNCD 5KMGA 4AS1A 1U3WA 2PX6A 2VCEA 2R66A 4MVCA 4NG4A 2EJCA 4KUGA 3E1KA 2OCIA 2P30A 1FNMA 1M2JA 2Y9PB 3CEJA 4FCCA 2BJVA 3H1GA 4OD0A 1AF7A 2VSFA 4IIJA 4Q39A 3LQQA 4N65A 3S2ZA 2VAPA 4LWQA 3QU2A 5G53C 4QQ8A 1BKDR 1JA0A 1S7GA 1F1BA 1ZD2P 2NYRA 1DO0A 4PRYA 2ZRDA 5BWMA 1LGYA 2J0EA 2EFCB 4IQGA 2PBRA 4QBKA 1C8VB 3N3BC 1E9AA 1J7KA 3T1VA 5AM3A 5HFNA 5EHIA 3PS9A 3D7NA 1ZJJA 2O0LA 2Q7DA 1K5DA 4L5CA 3KPJA 2ZRMA 3HMKA 3G1WA 1MABB 4JQYA 4UUQA 1UDCA 1PVDA 3F3YA 3F7NA 2HT1A 3K5PA 3K8OE 2VRCD 4Q9IA 3L4JA 1IOWA 1LXCA 3DEAA 3I23A 3CZ5A 5EIBC 2VYVD 4ZOLB 1TIBA 2IHNA 4N6GA 2HRCA 4RZ2A 3K9LA 2RKOA 4XVUA 2PQ6A 3C85A 5HE9A 3G8CA 1M34A 1QZZA 4B82A 2BDEA 3F3MA 4GBJA 2V5UA 5A3VA 1FYFA 2QQEA 2XYVA 1DOAA 5HEKA 1CY0A 4HN2A 1UXOA 4EOGA 3EDCA 4HH0A 4D79A 3LHIA 5FBLB 5C81A 3MCVA 3M5DA 3KCQA 3W4JA 2X76A 4RVCA 1ORRA 1RYMA 2VYQA 3WZMA 4YMVA 4YUWA 1VJ1A 3FFBA 3QVMA 1NXOA 4NOKA 1MAWA 3LUJA 4IWXA 2X2PA 2ZOSA 4GRAA 2HK9A 5EP2A 4TKVA 1V2HE 3EFOB 4BNZA 5CFZA 4KLRA 3VSBA 3GNQA 3I9NA 2VDMB 4LMAA 2WPDD 3LC7O 4C7MA 1GL7A 3PDHA 4KXWA 1Q6ZA 2OK7A 3D4BA 3IODA 5CLJA 4LOJA 5DO9A 3HBFA 1IBKB 4KBYA 4E5UA 1ZY2A 2E82A 1BHJA 5ESWA 1N7HA 3NYQA 4L76A 2QYOA 1P6XA 1A1SA 2Z83A 4CR6A 4DR5B 5DHTA 1RWKA 5I9IA 3WE7A 1RC1A 4F60A 3HHEA 3N6RA 3OM0A 2HA0A 1ZRMA 4JC5A 3EPPA 3B38A 3BIXA 3WXBA 3ESQA 3INYA 2IUUA 3NETA 1E63A 4C0HA 2LZ0A 4XYLA 5CD9A 5CDGA 5IF3A 3AUJB 1EZ1A 1UBLS 2TS1A 2YNMA 4KH1A 2G71A 3TIVA 4DM4A 1DIAA 3K0BA 2D4HA 3O4IA 3QJGA 1OQAA 1Y1RA 4MQFA 3TM5A 4HDRA 4AI6A 2VTDA 1N3YA 3AJDA 1CP3A 4ND5A 2C8KA 4LBWA 1P17A 4D46A 2VJMA 1TYDE 2WJPA 3GDOA 2YIJA 4UOEA 1QB8A 3DMGA 2PGXA 5J43A 2X23A 5JDIC 4QOEA 3MHTA 3JZFA 4JENA 1Y8QB 3PHBE 3Q0IA 3VSDA 1QWSA 5AHXA 5SYMA 3U44B 2J0VA 1W9HA 1N2CA 2G9UA 4UFOA 2VA8A 3K0AB 5GGXA 1KI2A 3S2YA 1JKMA 4LIPD 2H2DA 2FPOA 3HA5A 2FWPA 1IK4A 4I3GA 4P7BA 4QXOA 5B2ZA 2P9GA 2PQ2A 2D5BA 3A6ZA 3OTWA 3TFQA 2QLMA 3SC2A 1NYLA 1ZUNA 5EA2A 3K0EA 5CDSA 1QE3A 2QV0A 3FNBA 5A4KA 2P2ZA 1RTKA 1O8BA 3UGKA 2GLXA 3GK3A 1XIVA 4QGAA 2IUTA 3CO5A 1BMDA 1Z07A 1CHDA 3KBOA 4JJAA 4C07A 2WG0A 1BHO1 4YT5A 5LZ7A 4B31A 1IUKA 3DD5A 2GM5A 2CBZA 3PX7A 2MSDB 1P7VA 3IOMA 4MUAA 3SDSA 1KHHA 4R9UC 2B98A 3STYA 5FI3A 4BQEA 3USZA 4DV5B 3FF1A 3K9QO 4ZAVA 2J5BA 4CEIA 2QYTA 3AZOA 3KQQA 4AM8A 4Y1EA 3W5HA 4BEJA 3WY9A 1ONOA 2P41A 1FBTA 2XNKA 4ZQGA 4DHEA 3A31A 1YZLA 2WMYA 2XYHA 4PLGA 1CJBA 3LQ2A 4WKBA 3PE6A 5T3UA 4D81A 5IDXA 3AC0A 3B51X 3FDXA 3SU8A 3GEBA 3UENA 4DCVA 3CRMA 4DRYA 1KEZA 3P94A 3VO9A 4YJDA 3BE6A 3AL3A 4K28A 3BCHA 2VDJA 3PNYA 3QE9Y 3W1VA 2XXAA 2FSIA 1SGWA 4EJFA 2BISA 1ZKDA 4HAWA 4R1MA 4RJTA 4DMHA 5FO0A 5ALQA 1GNTA 4DUPA 1OFGA 3B13B 3L5OA 2OO3A 2PV0A 2PX8A 3PUWA 3CRZA 1V8PA 4OQXA 4WEOA 4Z8YA 1U80A 3QUCA 4Z4CA 4RKWA 1JRLA 2QB5A 1XPJA 1R5BA 2ZWVA 3WRXC 2ZSIA 4M1ZA 2FFJA 5JAMA 3N39C 1KZ6A 4IDHA 2IKSA 3RKUA 4AUEA 1JQJC 3N3AC 4OL9A 5BV2P 2ISQA 2I3ZA 4V0NA 3TEMA 3B52X 2JK1A 3T99A 2DPMA 3V8QA 4CLEA 2DHRA 4RSRA 3LZCA 3S2EA 1J21A 3FVQA 1II9A 3RSLA 5K4HA 5BRAA 1XMIA 4F46A 3N05A 4GZMA 1GAQA 1RCFA 5GJWC 1U2DC 2JI8A 2XMRA 4BFUA 1Q7GA 1W0KD 2ZJ5A 3OZWA 5J4LA 4DLLA 4X97A 3AJ9A 2HR1A 4D25A 1KBOA 3I01A 3TR0A 1YK0A 1M1NB 4PNZA 3V48A 4PYNA 3LZDA 3UK6A 1KY4A 1TXGA 3THOA 1NNI1 1YS1X 1MO5A 1SHZA 2O5VA 2OHJA 2YIMA 3DM9B 3BRCA 3F2IA 4C2BA 2W90A 4E13A 2HA4A 4UDYX 1SCNE 2ACKA 3DE1X 4E11A 2C59A 1FRVA 4K87A 5FOXA 1TTQB 2YINC 4X1KA 5H9VA 1E1NA 5DGDA 2QMOA 4ESEA 3AW9A 4J94A 1ULUA 1RYDA 2QG6A 3BFXA 5HCIA 4DJEC 5ES3A 2PKWA 4DV1B 1UPBA 3RANA 1JHDA 4CMJA 1H4TA 1F2DA 3KQWA 3VPSA 4BNTA 4CM5A 2X86A 2OVFA 1OKKA 4Y6LA 4E7PA 3VZBA 2YTZA 3V33A 3GXBA 3BH0A 2WUFA 5DSZA 1J8QA 1QIDA 3P19A 1N92A 2IV2X 3LOUA 3IUYA 3D7RA 2YMQA 1KC3A 1NPYA 4MI3A 4B8ZA 2D8AA 3M49A 3AHFA 4G01B 1AMNA 2PMEA 4JCOA 2H31A 1INLA 2GKGA 3COVA 2QDKA 5AJZA 2CNWA 4FMBB 1QHIA 4KB5A 2SKDA 3PNSA 6PFKA 3L07A 3PDIA 2A58A 3HGTA 4H3SA 2QLBA 4CZ2A 2FVXA 4F4FA 4Q7QA 4CEJA 3P9CA 3OZGA 1GLGA 5A7GA 5JSYA 4AW9A 4WNYA 2OCPA 4QEDA 1C3XA 1MENA 4JH0A 4Q00A 1W1UA 4ETIA 2AZMA 3KHSA 3KIPA 2W43A 4I46A 4DIOA 4OYYA 3H1AA 2GN8A 2I8AA 3X2FA 1BDHA 1J0EA 1CUXA 1L5ZA 2CXPA 3L7NA 621PA 1TJ5A 3B70A 2R6R1 2D3TA 4PWYA 3SY8A 3F46A 1D2NA 1QE5A 3MJHA 2VDUE 3WK7A 1C1YA 1YDHA 2NACA 5D8DA 3ISTA 3VKUA 2JCBA 3O4JA 2QU7A 4H3VA 4MTCA 1GGFA 3VTAA 4ODIA 4W5OA 2ZW9A 5L3RA 1RJGA 3QOYA 2NYAA 1GYRA 1EM8B 3GDFA 1IY9A 1EGQA 1HL3A 2GRAA 3IUQA 4HDNB 5IAGA 5LKAA 4KGXA 2GX6A 1M2VA 2IYTA 3OLVA 3V3TA 5CB4A 5IDWA 1P61B 3CT6A 3Q12A 5DASA 3RIEA 5ARBA 5GVSA 1V3UA 2P62A 3DL4A 5AK5A 3B1KA 2D06A 3W5BA 5CLLA 4GU5A 2E4ZA 3GX1A 2OCDA 2P4SA 1WTCA 3FNEA 4LHVA 3MUFA 2ILTA 3ZE0B 4J49A 4XJTA 4N3GA 4WMLA 4MIOA 1H2YA 5B2EA 4TRRA 3WMRA 4FNMA 5C52B 2Y6UA 5DWVA 2RHDA 3T38A 2P5SA 1OASA 3HQ4O 3LYLA 2GEUA 1CRZA 4PTYA 1HC7A 1ETHA 3NI2A 1IEWA 2ZYHA 4ZO7A 1R5JA 4DCPA 3PRJA 2ONZA 5FORA 3GBSA 4AMZA 4QQKA 4HLCA 4CFZA 5E7MA 1UJBA 2VYND 4Q5IA 3RASA 4D41A 1CIVA 2PSDA 1ENZA 3EISA 4X3CA 4F5DA 4EGSA 4YDQA 1SCDA 1FTYA 4B6SA 1U7HA 3NM6B 1A72A 1ZI8A 5ALZA 1FP4A 3ESRA 3T8YA 3WGKA 1HDEA 4FJ1A 3ZY6A 3PXXA 1NBMA 4HADA 2ECKA 1U8UA 2VP9A 4QRDA 4TRJA 5A0TA 1FMJA 4QSMA 1N5IA 1X1QA 4JI0B 3PVCA 1WCIB 4FYYA 2JJ1D 2C5FA 2YZKA 4Q3EA 1QUEA 4P34A 2NTYC 5LDHA 1AKUA 1L4NA 1V5WA 4KPUB 4KWTA 1ZOSA 2WWHA 3ASYA 3FYCA 1PGPA 5JSUA 2ZAMA 4KXUA 1QE0A 4BU1A 1Q15A 3HLTA 3HWX1 1RQRA 3AEQB 3N2KA 2BKLA 4JLNA 3PQCA 4NU5A 4QPZA 4LGYA 1D6MA 3U13A 2B1JA 4C3OB 3RKSA 1C4XA 4YAIA 1Q0PA 2AC2A 4C0AC 1ZGJA 1WPQA 3L6DA 2NU7B 1IHOA 2K6GA 1E94E 2Y05A 3CKKA 3K9NA 3PR3A 5JYBA 3ECCA 4B0PA 4TS9A 3U4DA 1K5HA 2ZZKA 1KYTA 3FPGA 3QXHA 1JE0A 5A6SA 4PVCA 3H7AA 4CMCA 3V4PB 3NX4A 5HOQA 1SWWA 2XRFA 4DQXA 1C2TA 5FULA 4KN9S 2QE7A 5JZ9A 5K3AA 2X4GA 2ZRCA 4LZPA 2P0EA 2Q6LA 1PR2A 2MSWA 1DXYA 3Q1LA 3AM5A 2BV3A 4LRUA 2GYVA 3Q7PA 4JGGA 4HHEA 3TAXA 4PX3A 3P2IA 3U6BA 3HGQA 1RI2A 4WLUA 1KOGA 3MPUA 1VGQA 5LP1A 3N5CA 1Y0BA 2J59A 5KYGA 1R9MA 2QLFA 2I33A 2JEYA 3QLTA 3OEWA 5CPBA 4JGBA 2P11A 4R01A 3RDPA 1R0KA 3SCZA 3DT6A 1GPMA 3RYFB 3UV7A 5LQJA 3DFZA 3WGJA 4R2KA 1Y9ZA 2BGUA 4MV9A 4R8SA 3ESAA 4BNGA 2R751 1ZXXA 4C1NA 1S4MA 1E18A 2BMEA 1YTLA 2BKUA 4YUZA 2OCXA 1RPAA 1U8YA 1JNYA 2G04A 3IE2A 4RL4A 3UCEA 4DNXA 5AVSA 1I36A 2H5LA 1G3QA 1M5UA 1UDXA 3EHDA 1IZZA 1E2MA 1K97A 5KTKA 4W5NA 5JJCA 2CVHA 1NMZA 2R6JA 1K4YA 1XLVA 1N6IA 2V97A 4CF5A 3WYAA 1XVVA 4HRVA 4UUMA 4BO6A 3AXSA 1XQ6A 2GTPA 2WNHA 5DM4A 5KX5F 2Y27A 5BSHA 5ALJA 2PZBA 1LU9A 3FZQA 3ITKA 1BX3A 5MN4A 3EDMA 4ZPXA 2QE7D 2OXTA 2X8WA 4FZRA 5E6UA 4ZV9A 1RD4A 4ARCA 4U7FA 1O87A 2HL6A 3E4CA 2CF5A 3ND6A 1IEQA 2HPHA 3H5NA 4R1NA 3FJ1A 4BVGA 4DSZA 3S1SA 2PS9A 3VDNB 1Z39A 4RHTA 3RNLA 1TU4A 3V4VB 3DE0X 3HXPA 4GE3A 4LDAA 4FSHA 5E8RA 1QQTA 3KR1A 3P0HA 3WOVA 2VNSA 1U7ZA 4R1LA 1PFKA 3E84A 2QQ5A 4RY8A 4DE5A 4DLRA 5JASA 4BWGA 1KGDA 5T7BA 1T26A 3FTDA 3I12A 3LK7A 4LWZA 1E3QA 1ISRA 1U7TA 1FQOA 2DULA 2PBFA 4GS5A 3UIEA 1SKMA 3HM2A 2IOFK 3I42A 4G9BA 3UWSA 1KORA 3RRFA 1K5PA 3GJ6A 4D9KA 3FHOA 3OZAA 4X1IA 4AY6A 1GQRA 2ACEA 2AI2A 3IKVA 2AJDA 4B73A 4IQ4A 4E5DA 3W7BA 1S96A 4ZI7B 1RADA 2W37A 4RVSA 3G0HA 3IMCA 3LUGA 1FFEA 1Y9AA 1DBQA 5EE9A 1BX0A 4R2XA 2JLXA 1QR6A 2QUHA 1GFZA 2MSLA 1E2LA 1RBQA 2HWKA 2D5LA 2VAXA 2WD9A 3A7DA 1MB4A 4I7EA 5DK4A 5TQ0A 4CCSA 4DR4B 4RXUA 2DFLA 2VZ8A 1G6HA 4YFVA 3SHQA 3ICQB 3SVZA 4D9FA 2YV4A 2XQIA 4P92A 3ETEA 1MGPA 1F8UA 1BJKA 2OZVA 2ACVA 3VHLB 3HDVA 3GEIA 1M1ZA 1X7GA 2PK3A 5ALEA 4DIFA 3TW4A 1YV9A 2V6IA 2XUGA 2JLYA 4TTTS 3DOHA 2BT4A 5EZYF 1GADO 2PRSA 3UO8B 2W98A 2NSLA 3FAZA 3VU3A 4EYEA 1J2EA 1LWOA 3ZDZB 4WK6A 3TRHA 4BMYA 1MCZA 3AQIA 4HTFA 4HG2A 1JEDA 5B7PA 4MK4A 2OILA 3ZY4A 1AGXA 1LH0A 1UKZA 2EJTA 2F8LA 3CX7A 3KWFA 4M88A 4CWAA 4BPBA 3F6CA 2NVUA 4UHBA 1GN9A 1H66A 2UYGA 1TM3E 1JJAA 3I9V1 2B4QA 4MO9A 3AR2A 2CUZA 4UHJA 2C07A 5E6RB 4BNJA 3R0XA 2YW9A 5HBGA 5A9TA 4X65B 4FUQA 4JC8A 4D9NA 4LYHA 1V43A 3TKAA 2X0EA 1XA3A 4EELA 3WA6A 3DVSX 2BCEA 4TWJA 1ZR2A 2BFWA 4KOAA 3QE4A 3TCNA 1MO2A 1CUZA 2JD1A 3L0ZA 2G0TA 1ZHOA 4L3VA 4G5QA 1SG0A 2O8FA 2K7ZA 2W6ZA 1U5BB 1CXZA 1PI3A 1Z4NA 1UKEA 2I2AA 4HDMB 4MV4A 3WV5A 1YQQA 1NX9A 3RS2A 5IZ4A 4NBVA 1CULC 3RS3A 1WZUA 1CJVC 4EENA 4LXXA 4LCJA 2E87A 5EVJA 3COYA 2VPQA 3PI6A 1XDZA 3CTPA 4DDUA 2WIGA 4N5HX 2VJCA 4Q1EA 2ONKA 5CBPA 3KAKA 1NIJA 2IGBA 2IXAA 1J22A 4PG5A 3DMRA 2WSSD 1TD1A 3GYBA 3WQQA 4DKXA 5C3UA 4AWAA 3OTQA 2I76A 4KXLA 4IAOA 1VRVA 2GCNA 2F9MA 2B8TA 2NAPA 1JHXA 3TRIA 4EQZA 1U3VA 1KFCB 1QX3A 2XX3A 3C6ZA 1T8PA 4QKQA 3EWSA 3INNA 4OV6B 1U6IA 1XG5A 3GLFA 2VDLB 5DHFA 4ZFNA 5C8VA 3BJEA 3I9FA 3Q5EA 2EWVA 4G5XA 1Y89A 4RLQA 1W4AA 4AU1A 5KTTA 3PCTA 4TV8F 4P3XA 2J07A 3RK0A 1UR5A 2VCHA 4C6HA 1VHWA 3ABRB 2BM8A 3MINA 3O8DA 4M36A 3B6MA 2VJPA 2VR1A 1WZNA 2HU7A 2Q6OA 3N58A 4JEUA 1R6BX 3T0FA 2F7SA 3LHFA 4HQKA 1BS2A 4IL5A 4YJKA 5AJHA 3DMTC 2JCXA 2QS9A 4BCBA 2NPFA 4OHPA 4IHJF 3F1LA 4NZMA 5KYWB 5JPCA 2H06A 2ZE7A 2BFEB 1TZKA 2PE5A 4KQ9A 3PXCX 1Z12A 1AE1A 1JIJA 3HDYA 2R5NA 2FCRA 1NRIA 5HF5A 3W2HA 4B6PA 1WL8A 4EA7A 1KO1A 2RH9B 4GPAA 421PA 1P2FA 1OY1A 1T0IA 3CW9A 4I1VA 4TQGA 1JT2A 3JQFA 4E15A 4O4LB 5E9JA 4QU9A 1UPTA 2PZEA 3JVVA 4S1TA 3VPCA 4BPRA 4CIAA 5HR5A 4LFBB 3A6HA 3D6MA 4QNRA 4O4JF 2ZJ2A 4OQFA 1RHKA 1V9SA 3AFOA 4KO2S 2WOJA 3RUFA 3RSOA 2VF4X 3GEHA 4MA5A 4PZ0A 4QGGA 1CQIB 3EBLA 3UJHA 3ZHYA 3B85A 4PXSA 3ZHXA 5LMUB 5F9MA 3LPAA 1WOMA 4QU0A 1E0JA 1BMQA 1JDTA 1N9GB 3V1TC 1HTWA 4JXKA 3CW2A 3K9GA 5IJ9B 1GUYA 1HMYA 3SX4A 3ZWYA 1V7PC 2P2DA 2FGJA 2JI6A 1RTTA 2NZVG 1D2EA 4QXQA 5CTAA 1QK5A 2FW0A 1FLNA 1RYNA 4F0JA 4DV7B 2PZFA 2YYAA 3JQRA 3TQRA 1J4AA 4KH0A 4ALIA 3GMIA 3GRYA 1KETA 1RXUA 2WHPB 3ABZA 3OLXA 1YBHA 4H1TA 3R7LA 4ARAA 1HYGA 2XNJA 1CUCA 4HZUA 3WMEA 2ZJ6A 3PICA 2GAIA 1NVUQ 1KDPA 5DBIA 3DTVB 1NMQA 5IVPA 4RYLA 1FMTA 2F8SA 3TD6A 4MDYA 4D80A 1Q3TA 1POWA 1ZM2A 3RRXA 3VHQA 2H0QA 4JASB 4EJSC 2K2QB 2JNWA 1KMHA 2QI9F 4OM7A 1E98A 3WYFA 1J39A 2XDYA 4JI4B 1LPPA 2PG3A 2B20A 3AZPA 3BFVA 4JLAA 1FQWA 1YR7A 2Q28A 3IB6A 5AXCA 3LUAA 1X8XA 5FI0B 4JP5A 4FBGA 2J09A 1OXSC 4F3TA 4B2PA 4J2OA 2YS6A 2RARA 2KX7A 4YRTA 4CE6A 5ELMA 1LV8A 4RNDB 4LC9A 1HYHA 1LTQA 3X1KA 1WSBA 1EBUA 4XUDA 3VNQA 4EKDA 2LCIA 2HRBA 3GDWA 4GI5A 1YR8A 2QR3A 4CU2A 1MZVA 1NQUA 2FW6A 4ZHQF 4UMDA 1KYXA 1WZCA 3W3AA 3Q3CA 4L1KA 3QXGA 4N49A 4X44A 3I83A 3RSFA 2DBRA 2VDPB 1AKNA 3PXBA 1DBVO 1R74A 4OYHA 4V03A 1L7VC 2GJKA 1PTJC 4AN1A 5LXTB 1OPRA 4MUBA 2RC6A 3DLBA 2I2WA 3QHQA 2YS7A 3K92A 3QFTA 4L73A 2VZ0A 3K15A 2MIIA 4H08A 3ANLA 4K1LA 1M8GA 2P6PA 4L0CA 1AQUA 4MR9B 4NL4H 3TLJA 3IDSA 1M1YE 1LPNA 3NTRA 1KDTA 2HQBA 3FLBA 1S9DA 2JDID 3CH5A 5IBRA 2HM7A 1M67A 3V34A 3G88A 4CMIA 2ZJ1A 3HN7A 2FQYA 3C6BA 3HADA 5GZ6A 1F7UA 3EF3A 1TT5B 1U0FA 2D2EA 5K3OA 1WLYA 2LDBA 4JXXA 4IIJF 1R4MB 1HT1E 2HDHA 1UT8A 3DKIA 4PQFA 3RUDA 3TYXA 5D00A 4BWVA 1CIPA 1EE1A 5KYNA 1PJ8A 3N1UA 1GTJ1 4LY0A 4D4IA 4BMZA 2HMYB 3PIRA 2W4MA 3F6EX 4FN4A 4YACA 3WBFA 1VL8A 4IIXA 3ZK8A 3ZTWA 4V1CB 9LDBA 1UMCB 3OIFA 1RDFA 4JR2A 1OBOA 5JD3A 1CZRA 2P40A 3D2BA 2BSAA 3UW3A 4PN3A 1CR6A 2BOVA 4AO8A 3DWEX 3K31A 4ZVTA 5A4IS 5JNWA 2IH2A 4XVRA 1ZOPA 4WOJA 3ASVA 3CVXA 1F9AA 1Y9JA 2CKDA 4QU5A 1E0KA 2DKNA 3WGYA 1W4RA 4OLHA 4DN6A 2NIPA 4C04A 1X0VA 1QIIA 9ABPA 1L8QA 3NUGA 5HZHA 3U3RA 4WK4B 1T9CA 1P8JA 2JGMA 1A9RA 5GONA 2C31A 2QG9A 5DGTA 4M7OA 2PEYA 1YA8A 3V8NA 3PHJA 4JBWA 3ZQ6A 5TJHA 4D6PA 5A2GA 5KOHA 5FEUA 1BAPA 4M8NE 4XPIA 4EIWA 4RHCA 1HZZA 2W2KA 3FGOA 1Y8AA 2B61A 4IJQA 3RUHA 2B2NA 2FZGA 1U2EA 3N53A 1OHHD 1J33A 4DMKA 4O2RA 3MWYW 2Z5VA 1RKVA 3BHIA 1PT5A 3HR8A 2C4KA 2FRVA 2Y92A 1JG4A 4M8IA 4XQGA 3CNQS 3V97A 1ILEA 4EPTA 3H2IA 4EF4A 1JHQA 4WZAA 2Q3HA 2ZUVA 4YRBA 1S01A 2O9JA 2XGSA 3OAAA 4REMA 1WVIA 3NC4A 2Z6QA 2YUIA 3X1YA 2DBQA 3SZLA 3DG9A 1GM5A 1R10A 2BGJA 2QSJA 3ZTTA 3DTVD 4BQFA 3TG8A 1E99A 1KKLA 3TUIC 3WOHA 2OOKA 4D26A 5CB8A 2C2GA 1QVAA 4WOKA 1B00A 1R9JA 3TLBA 3WRYC 1QX4A 2B4YA 3GELA 2ZAGA 4E2XA 2EKZA 4OBWA 3WL7A 2PUBA 3ZLJA 3PXGA 1DZIA 2EJVA 1ID1A 2PSEA 1RT9A 2V4MA 3I64A 4JL8A 1ZGZA 3FDZA 3ENNA 3EG5A 4MLDA 4ZDJA 2FRXA 3OBBA 2IEBA 2HLPA 4ZDKA 3EGDA 1SQFA 4NEHB 4JL6A 2O8EA 4HN9A 2Q6TA 4TTIA 1O5IA 1UZUA 2N42A 2P9TA 2ZTUA 4N5NA 5I7FA 3P27A 4D02A 3EARA 3E18A 4L4UA 4FLEA 4OGGA 4QOFA 1TAQA 1AKWA 5B55A 2BFOA 5CM2Z 3MFQA 4RY0A 4TTQA 1JVSA 2X2OA 1Z8NA 2DQSA 2PBLA 3C3YA 4HSEA 3M9LA 4KQWA 4GMFA 3UPDA 3JU3A 3AOEC 3NU1A 4OJMX 3TSOA 3AU8A 3TMAA 3DOCA 3C0KA 2ZSUA 1FFAA 1V6CA 4R81A 4EQ6A 4KU4A 1QOZA 4MRVA 2BFFB 1EEHA 2QE6A 2OXIA 1HUQA 1ZWKA 1XU9A 4QJBA 2ODEA 3SJAA 2VT7A 3JX9A 1QG0A 3FZGA 4E5SA 2ZIXB 3C1AA 4L2IB 4TL6A 3ONFA 1BKSB 1XRNA 3MT9A 1E1CB 1U1EA 1DCTA 1BH2A 2MJLA 5TVGA 1SC3A 1GRQA 1IWBB 4BQRA 1JR3A 1Z2NX 2AQHA 2FZ4A 2XQKA 3COZA 2J9ZB 5AQEA 4MGEA 5K2MA 2HF9A 2G9NA 3CJQA 4D9IA 4OXYA 4DJAA 1AUPA 3ED1A 1WIWA 4JB3A 2ISCA 2PPLA 2DAPA 2X9GA 1PE0A 3KB6A 3KWLA 5A04A 2GZ3A 3NTQA 3EK2A 3LC2O 4NHOA 1ESNA 3MTJA 3TE6A 1O94D 2EBWA 2ZBDA 5F5LA 4QYXA 4AULA 1VC2A 3O8QA 1KU6A 4HWOA 4G26A 1UANA 3FTQA 4JY7A 3ST7A 1SU8A 4AZTA 3KSUA 5FBVB 4NOMA 1FNSA 1DP4A 1ND6A 1KO4A 3OEED 4D7AA 3RD5A 3ZCSA 3CG4A 1VGRA 1MEJA 4WLFA 5GOZA 4PPYA 2HMVA 5CVEA 1E5QA 3AFGA 3GLKA 3F9CA 1TT7A 3P2KA 3PEVA 4LCEA 1OXVA 1T25A 8AT1A 4MW9A 3PSHA 2MINA 3DW3X 4O4IB 4FDVA 4HXEB 4LJ6A 1ES9A 3N70A 4EHIA 1CD5A 1ETUA 1Z33A 3F7TA 5A4AA 1E1RD 2IC5A 4M98A 1E5VA 2QWXA 2Y1KA 3BTSA 2CJYA 1PS8A 2HJHA 1FB5A 3OF3A 1NXPA 2BFPA 4INJA 3SJBA 4DDVA 1B8PA 2FUG1 2FSFA 2ID7A 4MYSA 3IQXA 4QIHA 5KQGA 3DWIA 1DBIA 13PKA 2AFIB 3DZCA 4HATA 4PHGA 4A26A 5BN3A 1H1LA 2IHBA 4I99A 1VE5A 3HDGA 1T1EA 1MABA 3DLAA 1HQKA 2ZG6A 4FR0A 3HJGA 3GZNA 2IY9A 3V1MA 5K45A 2AFHE 5B1SA 4MPJA 2HH9A 4YP1A 4PZZA 4FZJA 3HWRA 4I4TF 2GEDA 2R7KA 3GWZA 1NT2A 2V4ZA 1TEVA 2VATA 4Z9BA 2J48A 4L0DA 2VT3A 5BXQC 3LX8A 4D4HA 2FWBA 4O2AB 3TOXA 1DU4A 2PZAA 3U4GA 3ZGNA 4YX9A 5B7QA 2VRBA 4AQYB 3PDCA 1YAJA 2FPSA 2FPXA 3AINA 3JQ8A 4NCKA 2BEVB 4V0OA 1MRSA 1EXVA 4XWTA 2OKGA 3IP5A 5K0FA 1QGYA 3H9BA 4DWWA 1RWPA 4FIZA 2XGOA 5CK4A 3GD7A 4Q3LA 2VKTA 2GAJA 1YOVA 3OUUA 2B69A 4Z99A 5EESA 2OBFA 1Q1EA 3OQ6A 4PQGA 2AC7A 3TVTA 3P2EA 3SQMA 3QV2A 3PC8A 1GPBA 2NO5A 4K9QA 1PL0A 3OAAD 5DF1A 2O0HA 2V7GA 2Q1YA 3KD2A 2D1SA 3R5TA 4NU8X 4RABA 4Y2RA 3QTLA 3SZRA 4AL4A 3ZW8A 4F8YA 2PXXA 4GOND 3JR7A 2OHOA 2P69A 4UCWA 3VXKA 2C84A 1AGNA 2WQ7A 1C8LA 3QKRA 2ZB3A 4NBLA 2A2ZA 1QK3A 3M83A 2JI4A 3CNNA 5KKNB 2HYDA 3LM8A 4OI1A 1G8JA 3USES 1BG6A 2WLTA 2IS6A 2GKOA 1TUEA 3M4JA 4R2WA 2VHEA 5AVJA 1OIVA 4YYEA 2CWDA 2SHKA 4LXGA 4X95A 4KV7A 4E31A 1FFCA 4YRCA 1PHPA 1MF7A 2DQ4A 2G5GX 4E03A 2QQ0A 3PQ7A 3H84A 2GPWA 4ENRA 2D59A 2IIBA 3DBOB 2OFFA 3B48A 1GRNA 1R0XA 2VEOA 3R4VA 4EY8A 4ZT5A 3LY7A 3UTDA 2HBYA 1WXDA 1T6YA 4MI1A 1J2RA 1Q0QA 1UMCA 1WUKS 3TTXA 3NIBA 3QFSA 1K7SN 3L46A 3QY0A 5D7BA 3C3CA 4X71A 4RD3A 5TGDA 2FN8A 4P2GA 2R84A 3E2PA 3PZBA 3L8YA 1KFEB 1S2OA 3OIVA 2VHQA 2XXAB 1QV7A 2NPIA 5I9NA 4PPGA 2HMSA 3GVPA 2P6MA 3DMPA 3FCUB 4QUAA 4CTOA 5K4GA 2OEPA 2F8MA 4I55A 1AQIA 4DADA 4REOA 4PY2A 2AYYA 3F47A 4RD2A 3SBEA 1ZONA 1NF8A 1Z74A 2ZYIA 3AIIA 3IUMA 1YFJA 3D7LA 3B9QA 1N2HA 1EKXA 1JSZA 4CM4B 3EGXA 2BZGA 3I04A 4PANA 2JGFA 2ZRJA 3CLVA 4I19A 4BGIA 4ITUA 1XZBA 4BP8A 4II2A 2V6JA 3NHSA 3O47A 3QX8A 3TLGB 1ZVJA 3LQ4A 1E9EA 1ZD9A 4CM8A 1SRQA 3LY8A 1EE9A 2C0QA 2FRDA 1H23A 3VPFA 2OTCA 5AICA 4EFDA 3CLSC 3WLLA 4K88A 1W0CA 4I3HA 4BNLA 4CVNA 5DWQA 4XIFA 2ZUBA 1PN3A 4BNNA 1MKYA 1YZFA 4EW1A 4P4SB 4Q1CA 4BRZA 2IYLD 1RSZA 3SNHA 3HKCB 4L4SA 4OL0A 2VBGA 1GN8A 2ATXA 2VK4A 4YV7A 1Z0JA 3CF4G 4H7KA 5DI3A 4M0FA 2CVOA 5AOAA 4Z9YA 4ZCSA 3P71T 3EBPA 4ZO9A 3BJRA 3WWCA 5DX8A 5FNVB 2W2XA 4UCQA 3T7RA 3C5EA 5NLLA 5L53A 1A9ZA 3DV0A 3KPUA 3II6X 4FD3A 3GGOA 3IIJA 2A5JA 4EHHA 3UKJA 5JCZA 2VRNA 4IV5A 1BC5A 2KYRA 2BFMA 1ZD8A 3CMCO 4TLMB 3OE7D 4BO7A 5DLQC 2LBPA 3GCZA 5BVHB 1QU3A 1G291 3AGPA 1O58A 3PUJA 4P84A 3T4EA 3K70D 2YJGA 5JJLA 2NNWB 1JAIA 4GR9A 2HK7A 4Y9UA 1A8PA 1JQEA 4UEOA 4EA6A 2YRWA 4GR4A 5LU9A 1JHPA 1WY7A 2DQKA 2HUNA 5J1TB 4M83A 2RI1A 3LUFA 5EJ6A 1TM1E 3CC8A 4EVIA 2VKQA 4QYMA 2QGFA 1P9LA 1DBPA 1GTL1 1NU8A 1SULA 3DMFA 3UA4A 1KMHB 5JDIA 3EGOA 2E9SA 3KL2A 3KYCB 5F33A 3ITDA 2CDRA 4WK2B 5T67A 4S1WA 2VPYA 4WBSA 3NUZA 2NUAB 2XZLA 3PWZA 3C4VA 4N0EA 1TVKA 4IFBA 2PIDA 3E82A 3LECA 4CYMA 1RXEA 3HJUA 3C8MA 5E2BA 3FPSA 2Z8XA 2UZ3A 3V6LA 1Z4LA 1EQAA 1G3MA 1E9VA 4R83A 3DE3X 4YWJA 5JBQA 6ABPA 3HYTA 3Q3EA 2QL7A 1ZH0A 2I7TA 1WB4A 3K05A 3L7AA 3H1PA 3ROGA 3LS2A 1ZMTA 4LHXA 1HOTA 3UMFA 2B2XA 3Q2OA 2FG6C 1TKCA 1YC2A 3H1TA 3LBAA 4OP2A 4R3NA 4BO4A 4P2BA 4BMSA 3AVUA 4OB8A 2XKKA 3R1IA 3TLKA 4AJ4A 4UZFA 1SB9A 2B0JA 2PL9A 1UC8A 3N2YA 3HVHA 4J1NA 3ZV5A 4GIBA 3LBNA 3FCCA 3TLXA 5DP2A 1QC5B 2GBLA 2R5FA 4MVJI 4B09A 3ADKA 1TVMA 4G1BA 1M34B 3GPIA 4DLTA 1W34A 3EWNA 2CD9A 2H4FA 4AS3A 2X7HA 1NASA 4Q4AA 1NF3A 2HXSA 1MAAA 2OY0A 1HFWA 3QF4A 1QDUA 3W8RA 3LOPA 3I32A 3HA2A 1T6ZA 4W6QA 2O0JA 4KZPA 4CBVA 4EY5A 5KYWA 1J9GA 4NEGA 4O4LF 4GKJB 2NU9B 4GSKA 5C8YF 1E8DA 5BQOA 4B34A 1BEEA 1IDN1 1JHYA 3A2MA 3CYFA 4E33A 3EXHA 1PQPA 3MJ4A 3F74A 1LQUA 3T3HA 2ZWIA 3M4XA 1Q0TA 4MCIA 2Y2VA 4PRZA 2ZYVX 4YCBA 4TOIA 4C0XA 1UBUS 3RBVA 4C4XA 2PRZA 1PL8A 5AKJA 4D0GA 3SM9A 2YMMA 2VDRB 3K32A 1EE2A 1WP4A 1SIBE 4M7WA 1G8KA 4YRIA 1C41A 1O97C 2JGRA 2Q5EA 1RXVA 3GCXA 4M0KA 3VHXA 3ISVA 1QHGA 1F9EA 2AEEA 3GPDG 3MWEA 4HF7A 5EFOA 1VJGA 1VSBA 1NSYA 3I9KA 5KTRA 2DFDA 1B8VA 1US8B 2R7MA 5A3SA 4AKGA 3MF4A 4F1JA 3VNVA 1BCRA 3IS3A 2R68A 5DW0A 4AYWA 4RF4A 1R8JA 2AHOA 4CQLB 1EFDN 3ABOB 2P0AA 4NQZA 1I0IA 4FPXA 4ZAWA 2GVDC 1C1DA 4ZU6X 5ED4A 3WL3A 4BOYA 5I4BA 2J3KA 2QYHA 2WSLA 4XR9A 2JAWA 4J9UE 5REQA 4DR6B 1PNRA 4BXOB 2Z9DA 1GGNA 3C8HA 4MA4A 3U3MA 2H7YA 2CZGA 3PTAA 2I2BA 1KVRA 1O1YA 4KIUA 5E3IA 4NIMA 3TL6A 3VU1A 1ZVQA 4S1VA 1YMQA 2NTNA 4XLTA 1O89A 5JFOA 2V1UA 3SF8A 4BX2A 2Q99A 3CNEA 4WKOA 2HHJA 1Z7BA 4NAHA 2CD7A 4QTZA 4BKUA 3IAHA 1FYEA 4MVWA 4R51A 5CFRA 2OGUA 2ZS7A 2NN3C 3DBRB 4FKBA 4MSUA 1X7XB 1T5TA 1GNPA 1UEXC 4YJGA 1UPUA 1UJ4A 5HKAA 3A9RA 5KVSA 1DAHA 3TDNA 2VP3A 5EWLB 5AXBA 2BR4A 4NP6A 3IEPA 2WAOA 5IX8A 4EHAA 4ACBA 4H60A 2IYVA 3FGZA 2OGWA 4D0SA 4F92B 3K70B 1H6BA 2ZJ0A 1SBHA 2EU8A 3O9ZA 6Q21A 1PJLA 1XXLA 1C29B 3ZOZA 3C16C 3WMGA 5EZSA 2N1MA 1DAPA 2Q1SA 3O2SB 1UBHS 3I34X 4LQLA 4I50A 4A2CA 5ICGA 5HNKA 3W06A 4CQLA 5LP6F 1KK2A 1VTKA 2HF8A 2V6BA 3H9CA 1BCRB 1DL5A 3LYHA 3T3OA 1Q95A 3VH1A 4LOAA 4RH1A 2PKRA 3HDJA 1S7CA 1M6NA 1BIFA 2F3PA 1TJNA 1PWHA 2RHBA 3AR3A 2JKYA 5JE8A 4U0KA 4OKIA 5LXTF 2V7WA 2GN0A 2PH3A 4FYMA 3WICA 1JMKC 4WLOA 1JWBB 3N2LA 2W6MA 2V7TA 1XU4A 4EUEA 1Q0RA 4G8DA 3D1VA 1AN0A 3HH8A 5BMVA 3EJWA 4N48A 1U9IA 1WHTB 1WBDA 1XZMA 4AJ9A 4ZZ0A 1JU4A 3DL7A 2JFPA 3IVGA 1NW7A 3ESCA 2WIKA 3KLBA 5TXGA 1DVRA 3N8GA 5L7YA 1LFDB 5TRTA 4A8HA 2Q2NA 1FL9A 1TQ2A 4U4AA 3BTVA 2P9BA 3NNDA 4G0NA 4NMHA 5BUZA 2NG1A 2OCLA 1QP8A 3R24A 3AF6A 1ZH6A 4Y6QA 3KL4A 1SIWA 3SLGA 1P62B 3JWJA 3WRVA 4CRWB 1Z17A 3QLVC 3QRWA 2SKEA 4HNRA 3R8CA 1F12A 1TA9A 1JFFA 5EQJB 3MG9A 4ND4A 1J00A 3H8SA 3WWYA 4EYQA 4B7UA 3UGJA 2WG1A 4TLCA 3CEAA 4MEAA 4R9VA 3U49A 2WIBA 2Z2KA 1C8KA 1UBRS 4RULA 1L5RA 1ML3A 2ZSKA 4UVGA 3WJAA 4EUSA 4UKDA 4MV0A 3O91A 1Y1KE 4Z51A 3DQPA 3ZCQA 4B7AA 3HRKA 4B4DA 4CLOB 1IAVA 5JG7A 4DW8A 5KPJA 2WB2A 1E79A 5I6DA 2J33A 3V4RA 4FS8A 4EI8A 3LYAA 3CIOA 2W7TA 4YGXB 2Z9CA 5C8ZA 2CCKA 5GQSA 3C5CA 1PD0A 1YRQA 1IEXA 1DDIA 1V4NA 3E70C 5KNDH 3ORQA 2XH8A 5K3FA 3ZWKA 1JTEA 2O19A 3ROKA 1LPOA 2FN7A 5F35A 5KQLA 5EUQB 1KJYA 4AX8A 4P4UA 5IN4A 4LWPA 3BL6A 2H0AA 1JH9A 5JQGF 4GI2A 4L8WB 3SIPA 1N6LA 1IBSA 3F71A 4AZVA 3G3EA 1ENYA 3HCDA 2ZJAA 4OH1A 4DEYA 5KPDA 3I0MA 1YKGA 1IFXA 2DT8A 2ET6A 2H00A 1VPLA 4MGKR 4U7JA 5ESXA 3VR3D 4M3NA 3LCUA 3QXSA 4PTLA 1CFZA 5C7YA 3C4JA 4QD3A 5JJIA 5DXJA 3D2CA 4YJ3A 2HCBA 4BNVA 1CUJA 4E70A 5KVCA 1D2CA 2MYPA 1F3LA 1VQ1A 2RONA 2G25A 2QVGA 1DAKA 2VVTA 3DYVA 1Q5PA 1ML4A 1E69A 4KMRA 5DTIA 3SIRA 1P7ZA 5TQ2A 1OH8A 3ZYZA 1XNQB 3DFKA 2ZB2A 4UVHA 2O50A 4Z86A 1SC1A 3JYQA 3FHTA 1LBSA 2Q2WA 5CH3A 1KAOA 1ZICA 4UHHA 5AM0A 3GLHA 1UH5A 3MLEA 4EKGA 1YJBA 3G0IA 3D4PA 3NHMA 2YVAA 3UXYA 5AVOA 1FIUA 3BXFA 3DUFA 1ECBA 3DLCA 3BWEA 2QTNA 1JFTA 1YRLA 3DV9A 3V7NA 1KOJA 4ZI2A 1NVMB 1FFWA 1WMDA 2E4UA 2Q8QA 4P33A 2YC2C 5B3JA 1S5PA 5CAEB 3TZHA 4C2UA 1SR8A 1NUQA 3A70A 4CF3A 2C5AA 4YH1A 4QG3A 3LYUA 2HA2A 5ALYA 1ESDA 1TZMA 2ZKIA 4Q4CA 1DUIA 4ZCLA 3S28A 1NUHA 4HAIA 3U1BA 1VKZA 1I4OA 2Q6KA 1RXWA 3GO4A 2JRLA 2UKDA 3GFTA 1AUVA 2VHZA 3EF1A 3MXTA 1CJMA 4PPFA 1DUSA 4AG6A 4KPUA 1QANA 3GLQA 2OAP1 2V98A 3N0WA 4LMPA 5EQTA 4ZWNA 1CZHA 1SG9A 3A1NA 2B8WA 3CZ9A 3GUYA 2FKNA 4JAVC 2H5EA 4QFMA 3GJZA 3EHEA 3G2KA 1ZLXA 3BDAA 3AEXA 1RRKA 1U8AA 3EZXA 4DT1A 2FZCA 3PGJA 3AY7A 4G4IA 3N74A 2OKCA 4WXMA 5I47A 5K0BA 5CHEA 1KBZA 2WW8A 3MGBA 1PQYA 4H4DA 3EC2A 3STXA 2D5AA 3LT5A 4KRYA 4HDAA 3SC3A 1NC1A 3MMSA 3VPHA 4EAAA 4UHKA 1QP7A 3MPOA 2QTVB 5D1NA 2DJ5A 3A9VA 3N07A 1OLUB 4K6KA 2BEKA 4LZLA 4HFNA 2W70A 4WZBE 4DDHA 3U7HB 1AUOA 3KOYA 4ZK6A 3TF5A 2GBGA 1BE8A 2IOFA 1H0RA 1XRQA 1I4DD 2WJJA 1EFVB 1W4LA 4NPHA 3T7KA 4CKYA 5FTKA 1OBHA 1ADGA 1YS4A 5FUMA 3H4TA 3C3MA 1Y9EA 1I3KA 4DBLC 1UJ2A 2H1HA 4XR4A 2DLNA 1TOAA 2I1VB 4E46A 5K09A 4RH0A 5K03A 2B7CA 2OFOA 1B2LA 1JA1A 2V8OA 1URPA 3SDBA 3OETA 4HYTA 3CRRA 1FVXA 1R88A 4QBGB 1CY8A 1HDCA 1EWTA 2F1OA 1QTRA 1R4NB 3ZXXA 1JEEA 4MRRA 4F11A 3L0PA 2E6KA 1HWYA 4EFLA 4YCAA 4HUJA 3RG8A 4D9CA 1XMXA 3M3PA 3JVUA 1SXJD 1H05A 2IZ6A 4YT4A 4RPLA 1LDYA 3CZ4A 1MJGA 2EDCA 4IXDA 2XE7A 2JFFA 1W87A 1AURA 4RHFA 5CJ2A 4PSVA 4TUYA 4G97A 5H70A 4EQ6B 4IS2A 1SURA 3LUCA 3P4UA 1VPTA 1ZS9A 3CVOA 3WFIA 1X7YB 4D5EA 4WBNF 2R1TB 5JXWA 3T5GA 1HLGA 3WIBA 4B84A 2H1SA 3VR6H 2EWWA 5D2CA 2CXHA 3OWHA 1NVDA 4LF9B 5FIUA 1ISHA 3EXFA 4BVKA 5AH0A 4DUGA 1J9ZA 1Z47A 5BSEA 5KU7A 3VZQA 4MS3B 2VP6A 5KKAA 4NCXA 4CEJB 2NVBA 2X19A 2QJTA 5C51B 4S2EA 4QXMA 4ZQIA 3JTEA 1DDGA 2WNIA 3DDHA 2HQOA 4QBFA 1KE1A 2NXJA 3SEAA 5K9ZA 4BZQA 1N5OX 1SBYA 3KALA 1K8ZB 2Q8NA 4D6XA 4CEHA 2ZSAA 3UYLA 1QQBA 1XZJA 1PFGA 3CN7A 4N54A 3D6FA 3TPFA 1SVWA 2YJTD 2A67A 1N2GA 3Q3HA 2JAQA 4A15A 4XGRA 2PXHA 3MTGA 3N28A 1E7QA 4XWYA 4C29A 4E09A 1FMCA 3E6AA 3L8HA 3VR3A 4S0XA 3QKSA 1B74A 2RIRA 3WFZA 3UM9A 5E0KB 4BQIA 4HYEA 1O6CA 2VTEA 3OU2A 5GWXA 3SS7X 3D3QA 2I3DA 3L7KA 3BSWA 3VR6D 5J1SB 2R96A 5DTJA 3FFAA 4D43A 3SI7A 1XO1A 3BCUA 4JUDX 5JANA 3BBPA 4YFYA 2VH5R 1VLHA 1CVRA 1K6MA 3OX3A 1WUYA 5KEIA 1W6UA 1FDUA 1VMIA 2WZBA 2IRWA 4I9UA 4K3VA 5EQFA 1E8NA 3A0RB 4HAUA 4PHHA 7AT1A 1OUMA 3ILSA 4JB0A 3CGGA 4UU1A 2F3UA 3ROPA 4Q3NA 1ABBA 3FWYA 4HDQB 4YCCA 2CK3A 4NBRA 4E21A 4F2HA 4JI5B 4ZCIA 2Z1DA 3N2IA 3Q41A 3WDSA 5LB2A 3H8VA 2W2KB 1KPIA 2CFSA 1TAGA 5LMCA 2WKSA 4M4SA 1ZH2A 1IHUA 4G4JA 4Q6WA 3UMMA 3M4NA 1P18A 5HFAA 3R75A 4DWOA 3SKYA 4CTJA 3I2JA 2D2XA 3KUDA 4QJ5A 5JNTA 1WMEA 4TWIA 4CMAA 5F4BA 4D56A 2VF2A 1QDLB 4R7GA 3W5UA 1EMDA 4FQ5A 4MKFA 1WPRA 3UCFA 1EK0A 4G81A 2EFEB 3C70A 4LTDA 4M9UA 3QMMA 4GGPA 4RD6A 4J90A 1CRPA 3K8YA 3KJNA 4L2IA 4CIXA 3M6AA 3IP8A 4CODB 4M0LA 1NA5A 2IV7A 1JHUA 1WR8A 3NAQA 3PGVA 4DSTA 2AMVA 1E2FA 4FSDA 1FP7A 3I62A 1FDOA 1F0NA 4S35A 4H7FA 4IMIB 1ZMOA 1ECGA 3WDLA 1YIOA 2HWWA 3AUKA 3IT0A 3ZDFA 2XTMA 3E3NA 4CUKA 1EX9A 4EECA 4IGAA 4DCNA 1Y6FA 1W4ZA 1P2GA 1EGHA 1X1SA 1LD3A 3HN2A 4PZAA 4UXIA 3WHKA 4J7UA 4D3ZA 1MU0A 4MJ7A 2OUKA 4NATA 3HU5A 1F06A 2NP6A 1SC9A 4JLWA 1C3VA 3WKBA 5JPDA 2E6UX 5AW0A 3HJFA 3GLIE 4RSMA 3RU2A 1ONNA 4C0SA 5D5QA 1KS9A 3KT8A 3A36A 1J2UA 3VTFA 3KSAC 2ECPA 3IBYA 3GJYA 4GAEA 1CY7A 1GG8A 1ADFA 1EX1A 4BFTA 2DPHA 2COUA 1QAQA 2ZTLA 3BJIC 3PUIA 3R3SA 1AA9A 5JECA 1HK7A 5HBRA 4DLXA 5M29A 4XLZA 2GZ1A 1Q57A 4D5GA 2E4WA 1XUOA 3I1JA 4XGIA 4DR7B 3OC0A 3QFFA 3A4NA 4NC9A 3K5WA 3Q10A 3I2FA 4JA2A 3H9QA 4PLZA 2QMUA 2WWIA 3QTTA 3CVWA 2QD2A 3EMKA 5COAA 2OMEA 4DLYA 2ZB7A 2H7XA 4V0LA 3K0KA 4LCBA 1L3BA 1BD3A 4MR9A 5EXEA 3SBXA 4ROTA 1XZLA 1VIVA 2XB2A 5CYPA 1E2KA 3OOJA 4ETWA 3FMIA 1FP6A 3V3KA 3V4LA 3EFBA 3NFRA 5IDVA 1IM5A 2A57A 3UG7A 3VV2A 3VZSA 5K8TA 5ADWA 2RBEA 4DLPA 4RVHA 3I76A 4ZAFA 3RVDA 3AYXB 4RTOA 4RKQA 3IPYA 3DB2A 2HMWA 3W3ZB 3FSGA 3ZVKA 3RSZA 3LNCA 2C54A 4AT1A 5GV7A 4W5WA 4BLSA 1ZSNA 1WE2A 4ON9A 1HEUA 4OCZA 3WYBA 2JFVA 2QN9A 4L7QA 4ZO6A 5JNLA 2M98A 4BNDB 2WYIA 1JEYB 1HI9A 2N47A 5T4EA 3U5ZB 2V59A 4IJVA 2AF3C 4D3FA 2FV8A 2PBZA 1F5NA 1TEZA 3M1LA 2WD7A 2WY2D 4QFCA 1ZH4A 3DO5A 4C21A 1J2TA 1M7GA 2A86A 2ZTMA 4GKAA 4LDZA 4OHCA 4DSOA 5M5BA 4J0KA 1LF0A 4KK3A 2OBXA 2I29A 2PEZA 2Q29A 3GAFA 4OO3A 2VJMB 1Q7BA 3EEOA 2SECE 4Q19A 4ND8A 1MAHA 1PK7A 4EJMA 1UC5B 2ZT6A 1UBOS 2C8VA 5TS3A 4B5LA 1CG6A 5AUQA 4BKRA 4X7BA 2FVYA 1ZAYA 1G6Q1 2VOEA 1JIQA 1NW3A 5CXXA 5K20A 1SHTX 2JIZD 3TLEA 3Q8LA 6GPBA 1EDDA 1A0OA 4GWGA 2FEPA 2HZBA 3MCTA 2ZAYA 5HMMA 2DZDA 3U3KA 1NJ6A 3V8PA 5KC8A 1CQIA 2FWRA 4MKRA 2WJYA 1Z2CA 5D01A 1B0ZA 2V5VA 4U7HA 1J90A 1UPFA 4M0PA 3RTGA 1I0ZA 4JODA 2GD1O 2XB8A 4G0ZA 1NONA 4ZT2A 1ZIDA 2C4HA 3TUZC 3LUBA 5HE8A 2DU8A 2HIHA 3IR7A 4EUKA 3TNJA 1D4AA 1GTZA 2AFRA 3HUUA 3OQVA 4RIFA 1KFBB 2QZSA 4FR2A 3BMNB 5DWDA 1VJ5A 1X0XA 1XTIA 4JVOA 5ALWA 1JE1A 3HJAA 4LQ4A 5DKFA 1BE0A 4ISBA 4OQPA 1AK2A 1PJ3A 4LAFA 4DPLA 3T3NA 4C08A 2HK6A 3S2FA 3S1LA 1CUYA 4GM1A 3HCOA 4DXHA 4ATNA 2RJOA 3DE2X 3W5AA 3BHMA 1WB5A 1A9OA 3ZE1B 4MV7A 4LJAA 4U7WA 2IT1A 4XIJA 4MH0R 4IVRA 1QFXA 1EWYA 1XRJA 3BWBA 1VL0A 4GXTA 1LBEA 3FWHA 5SICE 2GERA 3CURA 3ZIAA 3M6XA 1NW8A 4U9IS 3TSWA 4PR3A 3UEOA 3ZHQA 2WT8A 2QVBA 5L6LB 3HWSA 1XMPA 1Y48E 3AIOA 3AKCA 4AKSA 1G59A 3ZIUA 5HIKA 3AKDA 5TF0A 4WY2A 3ME5A 4JHLA 3EX7C 3PDJA 4QG7A 3W7VA 1VL5A 2GTHA 4CKXA 4HK4A 4TXMA 5TVKA 2E21A 2Y0PA 4BX3A 1DMSA 4DJDC 4RY2A 3O0DA 2UV8A 1WU7A 3WSTA 4KAXA 3JQAB 3RYIB 3DBLA 3ZU3A 3L1UA 1Y7PA 2HLHA 4XDZA 5C5IA 2GKSA 4JKOA 1UMBB 2MSNA 5B37A 1KYZA 4EMUA 4LMBA 1D6NA 3GJ8A 2FUNB 5CDYA 1U5BA 4HDMA 3M1IA 2YH2A 4X8LA 5KMGB 1NXSA 4RAOA 1GG2A 3DCNA 2WVGA 3DTNA 2QPOA 4Z7QB 3MQFA 2WMNB 4KO4S 1G64A 1N7JA 5A2QA 5JO0A 4IWYA 4NCNA 4YCMA 5INTA 1WCWA 1A77A 2DY1A 3DBRA 3IBTA 1X94A 4H59A 2OXFA 3UKDA 4PLYA 4P98A 2J32A 4R3WA 3VH2A 2SICE 5LM3A 5L4SA 1ESMA 2QX6A 1EVJA 3TIIA 1ANKA 1IB0A 4JL5A 3Q8MA 3TECE 3GPLA 4A36A 2VNJA 4LZZA 2RIPA 1RPTA 4IJ6A 1U7DA 4DAOA 3PTZA 1I2MA 3L7BA 4CL3A 4F3YA 1N36B 2X77A 4BFLA 5AKHA 3G5LA 4FU0A 2MSKA 1ZVKA 3OKPA 1UWLA 2G70A 5A0FA 4M1KA 5F1KA 4DDTA 4D2IA 4ITRC 1G6OA 3KKMA 1P3Y1 3BXPA 3TVYA 4LOHA 1JILA 3DAPA 2FQXA 2PR2A 4J2HA 4FYPA 2ZTVA 4DMGA 5KQPA 1UEJA 2H48A 2QRZA 3CLRC 2ZIGA 4Z2YA 2QUZA 3L92A 2ZBEA 1YQDA 4TMKA 1CUSA 5D6OA 1GAJA 3ZD7A 1KP2A 5EIXA 2GFIA 3CH7A 1NURA 3T41A 2BZSA 1MXHA 4F71A 1ZM3A 1FUIA 1SFRA 2CBGA 3CR7A 3RHTA 1S3FA 5JCJD 4ZDWA 4ZCRA 5K8UA 2HN9A 2HWUA 1ZN9A 2EFHB 2ZJ3A 4TL8A 1VLVA 1J8MF 4B83A 4TVOA 1ISJA 1D2MA 5KS2A 3ODGA 4JJGA 4NOLA 5C2JB 1TMYA 5F52A 4D1YA 1JQKA 5IJ0A 4QGBA 4RTKA 4C4TA 3KEOA 3TB6A 1PJCA 1RZVA 2IEGA 2O3UA 4AD8A 4GVLA 5CDFE 3J81k 2WTXA 1AHIA 1U9YA 2CB0A 2Y0CA 3OFSA 1E1QA 2QRJA 1IY0A 4JBXA 4JVMA 4CIVA 1TZ2A 4GLBA 4QYWA 4M6WB 2C9YA 3N8HA 3GLHE 5JVDF 7REQB 4DLSA 2ZJFA 1HE8B 3VOSA 4BGVA 4B71A 2IUYA 3GUCA 2DFVA 3BMNA 3JQCA 1RWQA 1HLDA 2D7CA 4ZYVA 2I1LA 1DKOA 1SO8A 4LNUA 1VHLA 3U3XA 1IXRC 4BJ3A 5JLAA 5CCXA 3A2NA 1IY8A 4LXUA 3D0RA 3VOTA 1L7DA 1NSFA 1TF2A 2GLTA 1T1SA 2GVNA 3G9TA 1XMSA 4TZKA 2XYQA 4P86A 2Y77A 1HE1C 2Z1NA 1QH1A 1KI9A 1H8ED 2X1MA 4HS9A 3WJ7A 4CMKA 4KAAA 2UXCB 5AKZA 2VAVA 3OZUA 4HAYA 3UAVA 2BMDA 5KHAA 1W36D 4K46A 4LY3A 4W5QA 2GDJA 5EIOA 2YWJA 4OHVA 3N76A 4U6QA 5G0TA 3VU8A 5C37A 1D6JA 2YOHA 4PG4A 1XKLA 4KWIA 3R7DA 5AW6A 3HVJA 4MO2A 5FADA 1TVKB 2F00A 1Y4ZA 4H7DA 3OOEA 1RAGA 3IJEB 1G38A 2LIPA 2CNKA 4ZOCA 2Q5FA 1A50B 2XCSB 1S2IA 2GJSA 4QO8A 4KR7A 4ZYUA 3KXLA 3JVIA 3PT5A 4RDCA 3N2ZB 4R0NA 2RJNA 4AJKA 4X92A 1JQLB 2IV3A 3PQFA 4JB2A 2X5KO 4DBLE 4WXYB 4EMTA 3ADOA 5A62A 2XCIA 1MEEA 3CF4A 3GLUA 5ALRA 4ZAGA 3FRIA 2H9AA 1AX9A 3DQZA 5E6RA 4EDFA 3V8EA 4KFUA 2FWMX 1ZQ1A 3LHSA 5BXYA 1NYRA 2P2CA 3I8OA 1V4BA 4JX9A 2M9MA 1X3LA 1J8DA 1BYIA 2I5PO 5EJ4A 3K71B 4KVFA 2H1WA 2QUBA 3P2JA 4JP1A 3WGHA 5FTNA 1ZGGA 1U1IA 3NIFB 3FZNA 4ZD6A 4URXR 1P1HA 4FOPA 2ZCUA 4Q02A 1Y34E 3OY7A 3WHLA 3O1LA 1IOVA 4H7JA 4J1TC 4B9AA 2JS7A 1GYQA 1SC4A 2X5XA 3NV9A 2IIQA 5EMMA 4B4UA 4IFTA 5JLJA 1N75A 3KE9A 3WK9A 1RRPA 4B47A 4CU5A 4DA9A 2FW9A 2D62A 3UGQA 4QICA 3S2GA 4GHWA 1Z28A 4CV0A 2FXVA 5FPSA 4KZKA 2HJ9A 2R8EA 2PU7A 16PKA 2HU2A 1UFRA 4C6TB 2JLCA 1AOXA 3JQGA 4JQOA 2Q9AA 2PUGA 2XCQA 2QRQA 3E5HA 3FUXA 3MWGA 3TLGA 4EBBA 1ADBA 4HR7A 1GARA 1H0HA 3FNFA 5THXA 4DJTA 4C4YA 3IAUA 2XCRB 1DAFA 3CRVA 2FDXA 1FY2A 1BVUA 2O54A 2HMTA 4FNAA 1SVMA 4FWIB 4N0QA 2XYPA 3OKFA 1IIRA 3BAZA 3ZU5A 3BH6A 3X43A 3ZHVA 1LBHA 2L17A 4PZUA 3B9PA 1CJKC 3B89A 4QPNA 1ISMA 3UMCA 5KQMA 1VDZA 5CEJA 1NN0A 5L7WA 1XOIA 1IUNA 3QP9A 3P20A 1WCIA 3WNZA 2QLJA 2VJYA 2HOQA 4QRHA 5JXHA 1Y81A 2F17A 3HI4A 4OJYA 2PNFA 3LCMA 4IDQA 4BO5A 2XKBA 3OESA 1X1RA 4XRGA 4JSTA 1E61A 1NBIA 1P73A 3JQ6A 5AVQA 5I9BA 3DD1A 4MPTA 1BH6A 2ZYSA 2GF0A 3ZHRA 3F6SA 5LQNA 4FDUA 1LI4A 5HRCA 2NQ8A 2XV1A 2ZIEA 3L02A 1RACA 1FXWA 3NTXA 2R6ZA 4TT8A 1LS6A 1MH9A 2AWNA 1V7CA 1W2GA 3PBKA 1QCDA 1EK2A 1UM9B 1GPWB 1P1JA 3KR0A 4WLVA 4X61A 4HN4B 1B8UA 3QU9A 1KC1A 2EAUA 4HD8A 3KB2A 4IOMA 3MBOA 2G80A 3LTEA 2QK4A 1FSFA 4Q3DA 4BE7B 3M9WA 4IHAA 1AVTA 3NHRA 1R8SA 1EPUA 1E5LA 1LPMA 1VPEA 4DIDA 2P2SA 1I6KA 4MI6A 3GFSA 5EP1A 1RU3A 4FFWA 5IDQA 4OBEA 1Q1QA 1IJFA 4O3FA 4UMVA 1B16A 4NENA 3QBTA 2NM0A 4INPA 5LBUA 5LLTA 3KAQA 1ESEA 1JG2A 2YV1A 4C76A 1VCNA 4J29A 3QUAA 3FGNA 5AJTA 4F6LA 4IMRA 4UNPA 3DULA 3OCJA 5K0SA 4CQMB 4FQ8A 1CVLA 2ERYA 3QKRB 2WAMA 1T1IA 2WYOA 2XE4A 4Q6BA 4GWLA 4A0SA 5TMPA 2YY6A 4PGFA 2XRZA 2BGRA 2YBEA 1CSEE 5FOSA 2MYTA 1DLIA 3RQIA 4JLDA 4Z4HA 1WB9A 1JG7A 2Y68A 2YXBA 1KVSA 4JT4A 4O2BF 1B2RA 4P8RA 3JV7A 4EA9A 3TTVA 1U0TA 1I2CA 4GWKA 1D5CA 4P0TA 4ESOA 3HHPA 3HL4A 5LFAA 4HDSA 1A8QA 3P1JA 1L4EA 1V16B 2O2IA 3PQ6A 1LA2A 4HAXA 1U31A 3LUPA 4MUNA 4CM9A 2AJCA 4CKBA 3LE8A 2QORA 3IV6A 2ZQZA 1OI2A 1YZVA 2IDZA 4MV3A 1ZH8A 4HNUA 2C58A 2YZMA 2IEAA 2GETA 1J8VA 1U0LA 2UZIR 4PCUA 4NBUA 1BEZA 2WWGA 1G20B 1NDHA 4FI3F 2A9FA 3THYA 2PAFA 2FR1A 4M87A 1D2HA 3OLQA 4E5NA 1DRUA 3SZ3A 4U3JB 4UPEA 4QDXA 2O2SA 4L72A 4BYGA 3UMGA 1KO8A 2I99A 4OHBA 1BDBA 1KL7A 1T0BA 1JNXX 2KI5A 4R1QA 4MRNA 4I14A 4NK4A 5F77A 221PA 3FYTA 5CT8A 1L7OA 3WLRA 3MOSA 4GT1A 2VDWA 2VAMA 1OC4A 5HGXA 2VHVA 1YZQA 2OV6A 4HI0E 1UBMS 3ZIDA 3OA2A 5IM4A 4EJSB 2ID8A 1YI0A 4NJEB 1CF2O 3VU9B 2ORYA 4EFNA 1XXHA 1Q21A 4QXRA 1VIYA 3E0XA 1I1HA 3HCEA 4WCVA 4QATA 3OEEA 2C95A 5K0LA 1E20A 2W5UA 3MLBA 3DC7A 4Y2HA 1LJLA 2BKAA 3S40A 2PD6A 2XNHA 1AZWA 1VIAA 1KTIA 3C39A 2B94A 5ICFA 2P8JA 1JHOA 3COSA 1P80A 1C1XB 1FJ2A 3C7AA 3USCS 1EVKA 4TKLA 5DM0A 5EYPA 2FSHA 1GSAA 2P9QA 1R5NA 3TOZA 3W6PA 4BWYA 2Q41A 5BSVA 3T35A 3TSCA 3A2LA 2B21A 1U0HC 1JECA 3TUJC 5BR8B 1OYOA 1IN4A 4US2R 2UU9B 2WSSA 4LXYA 2UZ0A 4NWIA 3KSRA 1U4OA 3QHAA 2HPAA 3O8QB 4F2PA 1J5XA 3H5WA 5JY6A 4V0SA 5DRYA 1Z63A 3MB8A 5BQXA 5FDFA 1QYIA 2DFKB 2YWXA 4LF5B 1MW9X 2QEQA 5IBCA 1TECE 1Z4IA 1LDGA 1YQXA 2JH8A 3A4LA 3OP4A 1RYFA 4CR8A 4M55A 3AVVA 2H8KA 4IY1A 1JLSA 1AS2A 3IQFA 1CZNA<