4C29A

Crystal structure of high-affinity von willebrand factor a1 domain with disulfide mutation
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
201
structure length
201
Chain Sequence
b'PLHDFCRSRLLDLVFLLDGSSRLSEAEFEVLKAFVVDMMERLRISQKWVRVAVVEYHDGSHAYIGLKDRKRPSELRRIASQVKYAGSQVASTSEVLKYTLFQIFSKIDRPEASRIALLLMASQEPQRMSRNFVRYVQGLKKKKVIVIPVGIGPHANLKQIRLIEKQAPENKAFVLSSVDELEQQRDEIVSYLCDLAPEAPP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords VON WILLEBRAND FACTOR
publication title Towards the Structural Basis of Regulation of Von Willebrand Factor Binding to Glycoprotein Ib
pubmed doi rcsb
source organism Homo sapiens
molecule tags Blood clotting
total genus 70
structure length 201
sequence length 201
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-08-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00092 VWA von Willebrand factor type A domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.410 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold von Willebrand factor, type A domain 4c29A00
3V4PB 1Q0PA 2XWBF 4UM9B 5E6RA 2VDPB 3T3MB 1RD4A 5ES4B 3F78A 4WJKB 4WK0B 4C2AA 5E6UB 3EGXA 3EGDB 1PD0A 2VDOB 3PPYA 1JEQA 3EGDA 3EH2A 5E6UA 4G1EB 1DZIA 2IUEA 2ADFA 1XDDA 3EOAI 2VC2B 1NA5A 1LFAA 4NENB 3M6FA 2I6SA 1JEYB 2NUTB 4F1JA 4NENA 3E2MA 1JEYA 4JDUA 4HQOA 2NUTA 1MJNA 1AO3A 2VDNB 5HJ2A 4F1KA 3EG9B 3TXAA 3ZE0B 3EG9A 4UM8B 3HXOA 5KYWB 4MMXB 4M76B 4CNBA 1JV2B 4G1MB 4HQNA 4CN8A 1MHPA 1RS0A 5E6SA 4XW2A 4HQLA 1SHUX 1DGQA 1U0NA 1ZOOA 4IHKA 1M2OA 3T3PB 1T0PA 3K72B 2ICAA 1L5GB 3EOBI 3EFOB 1BHO1 1YVRA 3TVYA 1PD1A 2VDKB 1FE8A 3EFOA 4WFQA 4IXDA 3PPWA 1V7PC 4Z7OB 1MQ9A 3K6SB 1T6BY 1U8CB 1PT6A 1QCYA 3K6SA 2I91A 4C2BA 1N9ZA 1SHTX 5HDBB 1QC5B 4Z7QB 3GXBA 3ZDXB 1TYEB 1CQPA 5KYWA 1QC5A 2ODQA 4IGIA 3V4VB 1JLMA 3ZDZB 4C29A 1XUOA 2I6QA 3BQMB 4CN9A 5KYYB 2X5NA 2VDRB 3BN3A 1PCXA 1MF7A 3ZE1B 5KYYA 1SQ0A 2WINI 1FNSA 1CK4A 4HQKA 3NIFB 3ZDYB 4UM9D 1M1XB 4Z7NB 1M2VB 2NUPB 3FCUB 3VI3B 3TW0A 1M2VA 5BV8A 1AOXA 4FX5A 4WK4B 4BJ3A 1OAKA 5KYUB 1M1UA 2M32A 3TCXB 5KYUA 2VDMB 1XDGA 3FCSB 5HGJA 4NEHB 3PPVA 1U0OC 1ZONA 2VDLB 3NIGB 1IDOA 2QTVA 4WK2B 1YVPA 1IJBA 3Q3GE 5E6RB 4PN7A 3ZE2B 3IJEB 1BHQ1 3EGXB 2WW8A 4MMZB 4O02B 1JEQB 2VDQB 3HXQA 1ZOPA 2ODPA 3VI4B 1IDN1 3RAGA 3BQNB 1RRKA 4MMYB 3K71B 2NUPA 3EH1A 2NVOA 5KYXB 3ZQKA 3N2NA 5KYXA 1MQAA 3QA3E 1N3YA 2O7NA 1ATZA 2XWJI 1RTKA 4HQFA 4DMUB 3F74A 3IBSA 1IJKA 2XGGA 5LN1A 1M10A 1MQ8B 2B2XA 3HI6A 5KYNA 1UEXC 3NIDB 3PPXA 4A0QA 5E6SB 1AUQA
chains in the Genus database with same CATH superfamily
3JTMA 4DYHA 4R7GA 4ZK2A 3FYUB 4QTYA 4KREA 3FDFA 4RD0A 2BFOA 1REQB 2P4QA 3GJ7A 4XEUA 1E7YA 4BQEA 2VDOB 3CUSA 3T61A 1A04A 4F0JA 4Z2YA 3MWGA 3RUDA 4XCVA 2G8NA 1KFBB 4JLVA 3F46A 4ZO6A 2EJTA 3AKEA 4QXOA 1W85B 4YA6A 2AFHB 4MKXA 4IXMA 5JNTA 3KT0A 1TLTA 1WE2A 4U7WA 3AKZA 1WOMA 2W2MA 4OH7A 4Q05A 4RORA 4YP7A 2G1PA 4BEVA 3PQEA 2XNJA 2NU7A 3CPHA 2ZYVX 1E9SA 4XAQA 1ISGA 1CPYA 4QJ5A 4ZO4A 3LFUA 3WRYC 2PXXA 1U5CA 4FILA 3H05A 3EGEA 3HO6A 2VJMA 2V55B 2GD6A 1NMZA 2BTQA 3PFGA 4Q4DA 2YMLA 2X4DA 3KJFA 5EP2A 5DCWA 3S8MA 1G9TA 4K9LA 3UV6A 5JCJD 3S44A 2UZ4A 3R0VA 1R15A 2NO7A 5U9CA 1H5QA 4WBNA 1LUAA 1IZ9A 3OQ6A 1LH0A 5BNFA 3VSBA 1WLYA 1LBEA 3LUFA 3S8YA 3WDKA 4FEAA 4WECA 3A9WA 4W8HA 2HIMA 4TX1A 2B30A 2NQTA 3UTCA 4D57A 3NC0C 4WNYA 5AVYA 3OOYA 4GGMX 1J0BA 3WB1A 4F8EA 1K97A 4RA9A 4OI0A 4MICA 1NV8A 4MIKA 5E2IA 1Q1EA 1W35A 1Z47A 1HFWA 2FMFA 2DHDA 4PC2A 3EXFB 3MMNA 4CL3A 3ZU4A 1KI2A 2VTBA 2H1HA 2OHJA 4HPWA 1ZNQO 3P96A 2ZR0A 4EVQA 1YR8A 5L40A 2HGSA 2OZLB 4MQEB 5A5EA 3EPLA 4B3FX 3HCWA 3R7BA 4IIHA 2J32A 4MW4A 2GN9A 4DS3A 3B82A 3TTUA 4F04A 5LKRA 5A62A 2AJTA 2I4NA 2PX4A 3CVOA 1D2MA 5DK6A 2YC2C 1GZ5A 1PVDA 1PFQA 4DXHA 1E6KA 1BAPA 3L3BA 3IV6A 1G8AA 2W0MA 2XHEA 1NI5A 3DUFA 2GHQA 3EULA 3INTA 4JI5B 1A76A 1QE0A 1RVDA 3C5WP 5JCPA 2NU6B 2Q29A 2PS3A 2VSQA 3E9NA 4G5FA 3H3JA 1YHZA 4KK4A 3DHWC 2IC5A 4ETNA 5ITZA 1KEEA 1ZJZA 4MTLA 5E6RB 4KE8A 1NVXQ 2F7SA 2QJFA 4PSDA 4K81B 4YCCA 3DW3X 4UDXX 2ZBFA 5BYJA 2QTMA 1ZA2A 3BQ9A 4RGQA 4C05A 2A0FA 3PUJA 4EJ2A 3M3PA 3QSYA 3FTCA 3UKJA 4LRQA 4AWAA 3QUQA 4F46A 4UVGA 4TZ6A 4ZCQA 1RHQA 2NADA 2RCNA 3LHKA 5IBQA 1PYGA 1XD8A 3Q1KA 4E6PA 1KP3A 2WWIA 2NVOA 4ARVA 4RLSA 4CKXA 1PN3A 4E2ZA 2PGJA 1VLQA 1FFXA 1L7VC 4FJ0A 5DULA 1T1JA 2FOXA 4B6QA 2XWJI 1TO6A 3B1XA 2Y1GA 1JG3A 4IWYA 3G2IA 3S68A 4B7XA 3ZCVA 3QELA 5FWNA 1D07A 1ONPA 1W75A 4WD3A 1NQTA 4XD2A 3DWGA 1PDWA 4HXGA 2MR5A 5ALVA 5CFOA 4BXOB 3HJUA 1CNEA 3I3SR 3IQFA 3H13A 1DWOA 3Q8WA 4FTWA 5K3AA 4DG9A 2JKVA 3ESBA 2C7QA 1ZD4A 5I47A 5HFAA 5TMEA 4DCNA 5ALYA 1DIOB 1SBTA 2C97A 3L4JA 1A1SA 1T2NA 3IDSA 3D9QX 3P4UA 4FS8A 3RSFA 1JNYA 4OHXA 2HR1A 2GJ4A 3Q2KA 5BWLA 5JWRA 1SIUA 5AESA 2QMHA 1GQFA 1SZJG 1C81A 3KV3O 4J90A 1BE0A 4DOMA 1FPQA 2VR1A 4AS1A 4JVNA 2DWOA 3AINA 3AVWA 3OF3A 2ZJ4A 2GEVA 1TC2A 3ZY3A 3F3KA 2ZFUA 3CKKA 2JFGA 4BO0A 4F1KA 5IUNC 1LNQA 2HZ7A 1MO6A 5K3FA 1JFRA 2V7QD 3K8OE 4RZSA 4TKUA 5CK5A 3FYTA 4QELA 4BVLA 2EDAA 1H1DA 2AW3A 2FX2A 1TUIA 3W5BA 4GEKA 5ESDA 4I3GA 3AVXA 4TS3A 1ESCA 2O2GA 1GILA 4BJ6A 2JBAA 1H42A 1X74A 2CNLA 3UB3A 3CA8A 3CVYA 4ZQEA 1B8PA 4AN0A 3F6PA 3GJ0A 1CZHA 4UU0A 1F0NA 5KEIA 4XYGA 3I8SA 4FOSA 3PFWO 2QTWB 3BILA 3JR7A 4BNKA 5I4CA 1NLUA 3RVBA 2P9GA 1SEPA 3ZR4B 2ZANA 3A2MA 4G26A 1O5IA 2C5SA 5BQ3A 2J3QA 5AKKA 4QFMA 1AIPA 4E2FA 3ND7A 3JZDA 1DAGA 1NVVQ 3UMGA 9ABPA 1JHVA 3GA0A 1HK7A 3KOUA 3KG2A 2JEOA 1ZFNA 1N5IA 2FMXA 1TX4B 1DC4A 2VBIA 1QC5B 1W0KD 2ZTMA 3DTTA 3MB8A 3PJEA 2QTHA 4H4EA 1TYEB 2FZVA 3E58A 3G02A 1SU7A 4JC0A 4HT3B 5EQJB 2Q1WA 1C8BA 2WD7B 2VRBA 5H83A 1IBMB 4RGBA 4QUGA 3L0DA 2XBMA 1XT6A 5CU7A 2H0QA 3UOWA 5AQ1A 1XPJA 1Y4AE 3G2MA 2HPAA 4IX1A 3IAM1 5C34B 2BGTA 3A4TA 4RIHA 1CRZA 1TE2A 5ITWA 3GJ8A 1PBNA 3NYIA 3MWJA 5EYPB 2FR8C 1UBFA 3KWFA 3ZKAA 2F3SA 4KX5A 3UJ3X 5CFQA 1MZVA 2EWMA 2O8VA 3W9UA 3H87A 3UATA 3JQPA 2E9SA 1Y7TA 5LZ2A 2ZATA 1UKVY 1KDTA 3V1MA 4IICA 1KJYA 1LLFA 1XDGA 2P2YA 2YY6A 3AF4A 3AWDA 3JWGA 5I7UA 2CDCA 3ET4A 1KZ1A 1IDOA 1QHYA 1OLXA 1SMKA 2XWQA 5CDGA 1N77A 1LU9A 5GZ6A 2KPOA 3LY7A 2XVMA 4ZJYA 3ZE2B 4EW6A 4HPXB 5IXJA 3HCBA 5GY7A 4ZEOA 4B6GA 3VTZA 4YMLA 3O8OA 4G0QA 3SPXA 5HZGA 3BF8A 2ODPA 4CKWB 5HIJA 3VZRA 1T4DA 1YIAA 2VLBA 3BMOA 4QQKA 4Q4AA 1KORA 3FCYA 3HR4A 4EUNA 1T0JB 3BJRA 1H69A 2YY5A 4REQB 1C9YA 5ERXA 2GA8A 1NC3A 1IONA 2H9IA 3SSNA 3M4NA 4ASUA 2RKWA 1X1CA 5L3SB 4ZQFA 3LT4A 2UVDA 3IMEA 3ICEA 1GUBA 5F78A 2ZEJA 3RRNA 1UP7A 1BOFA 4AT1A 2HPZA 1TFRA 3GDOA 4GM1A 3PC2A 1LSOA 3H9GA 3LC0A 4Q3AA 5KNDH 1JHYA 4DILA 3IV7A 1ZITA 4OQYA 1XNGA 2H5JA 1CS4C 3AERB 5KOJB 2Q1YA 1KDZA 3STYA 2Q0QA 4D4MA 1M2HA 4YT2A 4HDSA 5LQDA 3R6DA 1T25A 2O8NA 4M54A 3KZKA 3ZC3A 4W9MC 3QOWA 2MIIA 5ETJA 3P2JA 4C0XA 1A96A 4O4IB 4EHIA 3ROZA 4ZZ2A 2JLYA 1CY2A 1N0UA 1JEEA 2GLXA 2CLOB 1UDWA 2JGAA 2QP4A 3DBLA 3SWWA 3NTQA 1KNXA 2R68A 2HF9A 2P0AA 3O6VA 4TKZA 4U6QA 1OPRA 4B4UA 1NBEA 3H97A 4BFTA 3AUYA 4JI1B 1IYZA 1EFVB 4QLOA 2RAFA 1AQNA 1GAWA 5DGXA 4B33A 1QHSA 1QYXA 1YQQA 3AXSA 3KLMX 1BXGA 4B43A 1V8OA 2J1LA 1U11A 1WUYA 2FWBA 3TFQA 4EWLA 2OCKA 2BZGA 3I04A 1UFVA 2EW2A 2FRDC 3I9V1 5KNCH 2G40A 1ISIA 3RK4A 3WAJA 1FSGA 4G8BA 1Y1KE 5G1OA 4DVGA 4EHHA 1E1DA 3ZU3A 4WN3A 4FCTA 4KO8A 1HSZA 1NOIA 5C35A 2WT4A 1ONSA 1JA1A 2OV6A 2VVTA 1JFFA 4MVXA 2XUAA 1EM8A 4LV8B 2Z9CA 2PVPA 5A0FA 5BT9A 1H2YA 3DNMA 1H93A 1TIKA 3S28A 1XXHE 3GGJA 5AXBA 1KGSA 1SCUB 2HDWA 4Z7OB 4DDWA 4P35A 1TGVA 1CXZA 1FFDA 2WJIA 2OWDA 4P8RA 3BXEA 3RROA 1F3OA 4MW1A 3HRHA 1MO3A 3N6VA 5D84A 3PNSA 1TPZA 4HNAA 5DGIA 3IDZA 2WZQA 5HDBB 5JEEA 1VGVA 2WJJA 1NNEA 1OMOA 2E85A 3ZE6A 4CEJA 4DCCA 4LF9B 2PK3A 3CURA 4F4FA 1EBFA 2HYIC 3IR5A 4CHTA 4KYVA 4W5TA 4L0MA 3ZLTA 2OECA 2X23A 4PBRA 3W1EA 3ZVKA 1QHEA 2WKWA 2VUIB 4UDYX 1MAUA 1ONNA 1SELA 3VHXB 1W5EA 2ZP1A 3WLRA 3RF7A 5MHTA 5K0TA 1M2VA 3IKJA 3ZV7A 1W7AA 1R10A 3PGKA 4CM1A 4KR2A 3K35A 4H17A 4NU6A 2HRBA 3KCNA 4CKEB 5E0KB 4UD6A 5M29A 4UXIA 1FDOA 5FBKA 1T3SA 4R1PA 2A9VA 3QKTA 3O1HB 2EXXA 3UAVA 3ZEAA 3UT6A 3A2KA 1NVVR 2FW0A 3MERA 1FJ2A 2CBGA 5DLYA 1DTWB 4GBED 3LY8A 4P4TA 4KYUA 1E9FA 4TRJA 4B85A 1RRFA 1DT5A 4HC4A 3RSCA 4CM8A 1RM0A 4MULA 2Y92A 4DWOA 1CE8A 1MOZA 2O3QA 1Y3CE 2GFIA 4OBWA 4YAIA 3C3WA 2F6RA 2IXBA 3MD9A 1P61B 3QLVA 4HDRA 4Z9YA 3ER9A 1MGPA 1P7ZA 3DV0A 4J7XA 1Z2OX 4UZEA 3TKAA 1UFRA 1OH8A 3ESAA 3P27A 4NEGA 2XTNA 4Q9KA 1J22A 1T2AA 3ORRA 4WXRA 5J2TF 3PA6A 1ZWLA 5CJJA 3S7TA 3FPFA 1DJMA 3TPCA 1KOGA 1W8DA 5LB2A 5HKAA 1KYTA 3OLCX 1VJRA 1JJVA 2HU2A 2RHLA 2I1WA 3GFGA 5EFOA 3HI6A 3PPXA 3Q9NA 2R6R1 3HU2A 3T7SA 4BEJA 5AVUA 5JC1A 4BNHA 2Z8YA 2OYCA 4EY3A 5AOBA 3S1AB 1RWVA 3N5CA 1JPUA 3AOEA 4Q7EA 1F0PA 4WJZA 5K6TA 5G02A 4U5QA 1EP1B 4MKZA 4F2HA 2ZJAA 1EGQA 3NCHA 3ENVA 2PRZA 2Q3BA 3F7OA 4JOBA 4TSKA 5L45A 1YB6A 1LI5A 4OEHA 2EU8A 3OQJA 4QDXA 4OUDB 4IUBS 1ZPDA 5K0SA 5FPKA 1QE3A 2HDHA 4TYPA 4B1FA 2XUHA 3GYBA 1AQJA 4AY6A 4P0PB 1CEQA 3N70A 4ZVQA 1U65A 2VDNB 3EEYA 1ZSVA 1MX1A 3TTYA 1ONOA 1YA8A 1OR8A 2CUTA 3EMBA 3L6OO 2IIQA 4WH0A 5T6BA 4ZDKA 4MA4A 1OC4A 5AI8A 3SZGA 3TECE 3W2GA 3LC1O 2HMYB 3P26A 5F73A 5EIEA 4J0KA 2L42A 1E8MA 1WLSA 3ENNA 4IJ6A 5GGXA 5CFRA 5EJEA 2XYHA 1JP7A 3ZKWB 1HDEA 4BNYA 1N1DA 4I81A 1LX7A 4Q19A 4UHKA 2J9YB 4YUYA 4CIBA 5DT9A 1Z3CA 2OB2A 3RANA 4LRXA 4YGYA 3RC7A 1XRSB 5IZCC 1E2GA 4LOKA 1VJTA 3OEHD 5CW1A 4OSPA 4A16A 1R6XA 2QG9A 4BZWA 3I6YA 3D3KA 1MQ9A 1IU9A 3AKYA 4WFKA 1V2HE 4F6RB 1RRMA 3CH5A 2VWQA 1LJUA 2YINC 1L7AA 3LGSA 4C0LA 3RVMA 4C6TB 3A1EA 4YHHB 2CXOA 2B69A 3W05A 2PD4A 3D2CA 5KOHA 2AB0A 2R1UA 2Q27A 4ZAXA 2WOOA 3T35A 4B9EA 4TZ0A 3DJYA 5LIRA 4KWIA 2AKYA 5AM2A 4KPEC 5A3JA 5H9WA 3GEHA 2VUTA 4NYIQ 5F9MA 4DTIA 5L4NA 3OZWA 1MF7A 4J6FA 5U4XA 5CPFA 4BNFA 4DC1A 3NIFB 4JUBA 1KERA 3BZUA 3G59A 3STXA 3OCXA 4I1OA 5BQOA 1RKXA 3KE9A 5EUCA 4PG8A 2GNPA 4CV3A 1L7BA 1C41A 1ZJ6A 2QG6A 2QD5A 4BTLA 4DR5B 4BB6A 3SCZA 3D6HA 3USES 1NNLA 4O4JA 1WZUA 4P2GA 4YR7A 1M5RA 1M72A 2IS1A 5DW3A 3SS9X 3FF1A 3L0YA 4FEEA 1ZD8A 4QGAA 4AC9A 1J0AA 1Z0KA 3LUJA 4BZQA 4DC0A 2DH5A 4N3BA 2GN6A 4KHPB 3OG9A 1ID1A 3GJ5A 3A8TA 1NP3A 4WINA 2OQ2A 2AI1A 5BV2P 4DSTA 5T4FA 3W3AD 5H0IA 5DX0A 1QYVA 4OD0A 4IMIB 2F67A 1J33A 1VBMA 1P5FA 4JXJA 5FI3A 3B6EA 2JIOA 2G88A 1M1YE 1E2FA 3OZGA 5AKHA 2QA5A 3PQ5A 2PZJA 5JATA 3GLHE 3C5CA 1X77A 3WB9A 4BNZA 1GQQA 4ZYUA 1RLJA 3O4GA 1YB2A 2WYUA 1IOZA 2WFZA 3R09A 1ZDMA 4R0NA 3PPIA 5IH3A 3ZDFA 4BO5A 3OU6A 4RQBA 3UUWA 1OXBB 3UXEA 2JGFA 3GUYA 3GY0A 4YJHA 1JIVA 5BN3B 1P91A 1VMDA 3KHKA 1I30A 1MW9X 1XHLA 2VIIA 4QOJA 3WLTA 3QI7A 5IJZA 4JI4B 1CQWA 1NXPA 1ADFA 1TYBE 2J31A 4NNPA 3QVVA 3AP2A 2UZAA 1LLUA 1VL5A 4I4NA 5CK4A 2XQVA 2C0PA 4CMGA 5A4MS 5L3QA 2QD1A 3OE4A 4UW9A 1DAMA 4M1OA 1H8HD 3DVAB 2IDZA 5M5BA 2DPHA 2VXOA 1MFPA 4ZCIA 1QHGA 1YUBA 2J9GA 5I9NA 5JASA 2W6IA 4MW7A 2Z5VA 1W30A 2VHYA 3GGPA 1K6EA 5LOVB 2QJTA 4ARSA 2RGDA 3NDPA 2JJ1D 1WPGA 4KQ1A 3EZNA 4L4SA 5AJWA 1CTQA 1TT5A 2NXJA 3E2MA 3IX7A 5DBOA 4P6VF 4YUAA 3IT0A 5K45A 2DLCX 3H5VA 4PPYA 4GMDA 2WMDA 4R4JA 2PUWA 2Z4TA 4LYHA 2O5CA 2YFQA 3UEOA 2PNJA 4BAZA 3EHDA 3BBLA 4AZ3A 5GIPE 1DKOA 4M60A 1E2HA 3I5UA 2E4UA 3C3XA 3M6VA 2YS6A 4J2OA 5DHAA 1E61A 1BX3A 4HQNA 2JDIA 1U2RA 1HTBA 3ID6C 2WTXA 1B41A 2AI3A 1W5AA 5B5SA 2OFOA 3SX4A 1AQYA 1EWQA 1DKPA 2Q46A 4DLZA 2F2TA 4N6NA 4YJ2B 3QEBZ 3JWEA 1OFUA 4JQYA 4KEAA 5A9TA 3HKCA 4ER5A 1ZA1A 4I6JA 1OZAA 4A9AA 3TLCA 2HX1A 3LUCA 1I1QB 5LQUA 3KJIA 4EW3A 1RW4A 2II6A 3NHZA 3C15C 2I54A 5HRCA 5DB4A 4O29A 3AB3A 3V80A 5IM4A 2F8LA 4RK5A 2WJ4A 5C5EA 2X15A 3KP1A 3SYMA 1XEXA 2NYRA 3FSEA 5DYWA 2YZ2A 4GYWA 5FAXA 3NVMB 3F2VA 5CCDA 2BBSA 1H4QA 2X7XA 3LU1A 5JS6A 4C0HA 4HR7A 2YIMA 5BN5B 3JQ8B 4JQZA 4J2HA 1QH9A 2N46A 3FNHA 4H6WA 4KQKA 4G67A 1YRBA 2R25B 2VPPA 4L3VA 4QXPA 3RYCB 2IZ0A 2YJ4A 3B89A 2JIDA 2Z2IA 1LTQA 2WUGA 3I92A 1K5HA 3PLRA 4MI9A 3MG9A 4Q66C 4W8OA 4XCXA 1O9GA 3JWPA 5CLJA 1VMIA 2M32A 4OMUA 4KRFA 3WFIA 4DWJA 3A37A 3HKBA 1ND5A 1ZJ5A 3L5OA 5H4GA 1A2OA 1NVKA 3TR0A 4P83A 3AHDA 3BWDD 1KC3A 3DHVA 3L07A 2VLIA 3DPIA 4HPJB 4X7BA 5DN9A 4CG0A 4ZJUA 4P33A 1DRWA 1RYBA 1QH0A 2R47A 5CA1A 4DZTA 5A03A 1IIRA 5KTNA 1M1YA 1IIBA 5EE0A 4JJFA 3VU9B 2FUG1 1M7GA 3GLHA 2XB2A 1I2ZA 5A0TA 6ADHA 1F06A 1MENA 2GXQA 2NSJA 4NYIR 4OGKA 4S1PA 3GQVA 5HOEA 5B1HA 2OT3B 3QUTA 1I9CA 4EGSA 5DGTA 5CAEB 2ONCA 4ZOQI 1YFKA 2MSEB 2WWFA 3AETB 2C7PA 2MSDB 1Z4NA 4IVRA 3PQ3A 3THYA 2YRFA 6Q21A 3GAFA 1PIWA 4P5EA 3EJ6A 3C3EA 3OQPA 1NFRA 1H65A 2ADOA 3MJSA 4B4KA 3DFFA 4JJ6A 1W581 4NCNA 2K5UA 1NWHA 5D87A 5K20A 1V3UA 1CU1A 4V0OA 4NWIA 3W5DA 1LLQA 2ZKLA 1KMCA 4M0UA 2BEWB 1JS1X 4IDBA 4YHBA 1H4TA 4ZWNA 3OQOA 2IPNA 4ISCA 1Z63A 1KJZA 4ZVKA 1C7ZA 2MSWA 1WU8A 2AG1A 3MW8A 3VYTB 1XQYA 1EA5A 3JPWA 3A6EA 3EDCA 2I7DA 4EPVA 6ABPA 1V1RA 4NI5A 1GTG1 2FW7A 5G0UA 4BGIA 1EFPA 5A1TA 2QUJA 4HQOA 3MRVA 3CZMA 2BUAA 1XZKA 4PHFA 3CW9A 1P7VA 4MW2A 2AJDA 3DCNA 2DBYA 1VP9A 1KAHA 5DLEA 3TNFA 3DAOA 4ZFNA 2C83A 2X8AA 2XSZD 1JHZA 4X20A 4OI1A 2Z2ZA 2WD8A 3HACA 2ZZKA 1MO4A 2JLCA 2X86A 3H83A 3KDSE 1TI7A 1DLJA 3O8CA 1TKCA 2EF0A 2ZIXB 4GWKA 4QE3A 5IJWA 1JR6A 5KWSA 3TRFA 3V1UA 5CGZA 3IXQA 4PPNA 4ID3A 3VSEA 4KMOA 1CYDA 2P4EA 2VHQA 3G5LA 4HDAA 1VHLA 4ZCPA 1GPJA 3EK2A 3F5FA 2A35A 3LKDA 5ARBA 1T9BA 3FHLA 1XELA 5L3RA 4RF3A 3UJ6A 4HAYA 2ATCA 4DV4B 1B26A 4J03A 1VL0A 3WJ7A 1E2PA 3NMUF 4I4TA 4CKZA 1E1QA 3JSXA 4BP8A 3FI9A 5I7OA 3ZCPA 2ORIA 1DWPA 4J0HA 2C4TA 3RI3A 3I9KA 2Q2OA 1S2IA 2FEKA 1ESEA 2IK8A 3HWRA 3T3HA 3ZQ6A 2J09A 1SQGA 1XU7A 3GZNB 1G9SA 4MLCA 4H0CA 1Q3KA 2XUKA 1JFTA 1LS1A 5IVHA 3IE1A 4YDRA 1H0SA 4GF5A 3FSGD 3INNA 1FFWA 1I9GA 1ENYA 2FSGA 3O8QB 4F91B 1EJ0A 1FRVA 3CEMA 3HADA 3ZGNA 1WA5A 2R9VA 3CVWA 3UJ7A 1TL7C 2FHPA 3D6VA 1ZI6A 1FU8A 1KSJA 2VPQA 4N5NA 3IQEA 4DIKA 4YXWD 4GM0A 2CV0A 4Z86A 5EVCA 2FK8A 2ZVQX 3MBKA 4TN1A 4GP6A 1ZM9A 3NX4A 4FIDA 2WTUA 3M6XA 3T3EA 4Y1RB 3E4CA 5EWJB 3MGCA 5KOYA 3O90A 2JH8A 3HVIA 2RHGB 2ZUVA 4UUAA 1Y33E 5I7AA 1J49A 5JISA 5KU7A 3GT7A 5ALFA 5LM3A 5CB6A 3IFSA 4YUWA 3BTVA 4YRRA 4L8WB 2DAPA 4ROTA 2Y1KA 5KSYA 4CJXA 3I6IA 4REOA 2R4UA 1F3LA 1VA4A 3I72A 1WETA 4PLZA 4M1QA 3QXGA 3WG9A 3FFAA 3F5MA 4E1AA 2BE9A 2IPOA 1UAAA 3A25A 2IYRA 2D13A 4JLKA 1T0HB 4EKDA 5C51B 2EJBA 2XE7A 4B46A 3CE6A 2NWQA 2NQ2C 3OLQA 4J1SA 2PWZA 1E8NA 1K4KA 3OPQA 4NARA 1S2NA 3HBJA 4UMFA 3U3RA 3UAGA 1HZZC 3MCAA 2XQFA 4QBKA 2ZIAA 5E1BA 2FX5A 2HU5A 2J3DA 2ZJZA 5AI0A 4B73A 4ZICA 1E2BA 4TUYB 2OB1A 2RMKA 1NW4A 3DAYA 3EYWA 2A2ZA 2I8CA 2DP4E 4CTMA 1C0PA 3H65A 3ZU2A 4B2IA 5A9SB 4NRDA 2AOTA 1T8YA 2VRCD 2Q5QA 3H6HA 2CE7A 4DADA 3DONA 4WNCA 2GYWA 4H4CA 4JODA 1GDHA 4OQ4A 4UNNA 5CCEA 2JFVA 3TEJA 4BCBA 5AVVA 4M55A 3H1BA 5KZMB 1PR1A 1RAFA 1EG7A 1RJGA 3BDIA 4W6QA 4EB8A 5AO9A 1NU6A 3LWDA 9ATCA 2H4XA 3KQHA 4RKYA 1K3FA 4IDEA 1K7CA 3ZGXA 3JQFC 2IIPA 3D2LA 1ZH6A 5ALTA 3U0BA 2I1VB 2J67A 1MJNA 2NGRA 2YVUA 3EDOA 4LNHA 4NCXA 2EWVA 4G81A 2J08A 2QLJA 2VF5X 2D1FA 3LYUA 4U6SA 3MUNA 2ERYA 4IV5A 1XF1A 2ROQA 3R40A 2G25A 4MV7A 4BNNA 5C5IA 1EVEA 3KS9A 1GNQA 1IL0A 2GK4A 4Y9UA 4Z1MD 4DUPA 3IAS1 4Q1VA 2G70A 3NO4A 1JDNA 5ICGA 1SVWA 2BTQB 3IH5A 4PLTA 4IEEA 4E6EA 3ZW9A 1P1BA 1U94A 1BVRA 2V0CA 4HXEB 3P9PA 3F8TA 3GEGA 2C96A 1QAQA 3L8EA 1NLMA 3FPLA 2Q3DA 4WBNB 1W6RA 5EXTA 1JBKA 2AQ8A 1BD4A 1XEFA 3GARA 4KUGA 4R8KA 4QIHA 4EK9A 2ANBA 2G5PA 1UBEA 1U8CB 1VKZA 3P2OA 2VZ0A 4QGHA 3H0KA 3EQ2A 1E7WA 3L8FA 1NJSA 3HG7A 2W2OA 3PDJA 1KGDA 1SVOA 4LE1A 4KO2S 5JS1A 4D9IA 4FLMA 5D5PA 2IEIA 5AKIA 3U3OA 1PNTA 2VTBB 1I2DA 4TL6A 1QPZA 1CRPA 1NM5A 4NKRA 1PNVA 2FAXA 2HA2A 2A14A 3QEMB 3O4VA 3DKVA 1W76A 4HB4A 4G84A 4M1EA 4YRAA 3NGMA 5JO9A 1EZZA 4IS2A 1J9GA 2X14A 1SOVA 4IDNA 3QVGA 5KJCA 1S1CA 1KIMA 5NLLA 2H29A 2GFQA 2J4CA 4CE6A 1K4YA 4QBHA 3H75A 3QKRA 4E5PA 3R0IA 2QVLA 5C7IO 3OIDA 3KB2A 1M76A 5BSFA 5ITZB 1SXJE 1UOEA 3EIUA 1UWCA 1GL9B 2DG2A 4C03A 4BUJA 3QPDA 4UOEA 4O3MA 1RI2A 4Y2QA 5COAA 4CI0B 4RETA 3OZIA 3ROMA 3BH6A 3RBXA 1ADCA 2DPXA 3ZHQA 4RPCA 3HBNA 2YUIA 3D6NB 1ZGBA 3H9EO 2ZYIA 3FCEA 3ZHOA 3HNRA 1OI4A 2YCBA 3RADC 1GVHA 1Z9BA 4BQSA 3VR0A 4BO8A 1QJCA 1TLFA 4GAEA 4HFMA 4GKVA 4HVCA 4DABA 3CU5A 4K8RB 2OZPA 1QP4A 1AGXA 1FFXB 2V9CA 4LDNA 5EL0A 1O87A 3TAHA 4HYEA 2X0NA 3FUTA 1VB5A 4IWXA 1L7PA 4GRAA 3M9LA 4LHEA 2ECOA 3AUJB 3Q15C 1P2SA 5A7GA 3RIMA 1MQ8B 1DKQA 2EDCA 1VJCA 1L7EA 2EZUA 3BSSA 1THZA 4IUYA 4RQUA 3EQ9A 1ANKA 3HDTA 3NV7A 4OGLA 4YR9A 4L8VA 1RWMA 4CMIA 1W0JA 2YIJA 2V5AA 5KC8A 4KP7A 4V1CI 1EUQA 2ZJFA 1DOHA 2QVZX 1IC6A 2GYVA 3QZUA 5IFKA 5T7BA 1FMFA 3OICA 1B76A 3FB4A 3UK7A 4C3UA 4IVQA 5B53A 5IHXA 2CFCA 1RHRA 5G0WA 5FUVA 4D4JA 5DP1A 3ZX4A 4OHYA 1A9TA 2PXCA 3N6RA 4L57A 1PEKE 3GZ4A 4X92A 1KE1A 5K3FB 1D5WA 5AVOA 1PR9A 2UVQA 3NYQA 4TKUB 3AHEA 5DASA 1M74A 3FUUA 1OB2A 1XZMA 4FW9A 4EF5A 4G0UA 1A4RA 1OIXA 4E5YA 1LJLA 1ZS9A 4DLPA 1BWPA 2JBAB 3LP8A 1WHTB 4CNBA 1UPTA 1R0CA 2ZYRA 4C4SA 5BVGA 2X4GA 3I0MA 1KEPA 3FXAA 3CZ5A 3PE6A 4DM3A 2MYTA 4U8HA 3BX1A 4DMFA 5FYQA 3VZBA 1QCDA 1BQEA 1ZGCA 4H0NA 3RK1A 1U0EA 3IHWA 4IIGA 2C1XA 4ZODA 1LDEA 1ZZEA 3G17A 1PD1A 3KB8A 721PA 2ZUWA 1CP2A 1IWBB 1QANA 2JGLA 3AH8A 3BMQB 4RM3A 1NUSA 3N2LA 3VYRB 2FSUA 4MB6A 3PWZA 4MSUA 3VC2A 1PUIA 3GLIE 3HB4X 2DPMA 1GR1A 1ZO8A 5CT9A 2P1DA 3O2NA 1KQPA 1WXQA 4UBMA 4G37A 3KZCA 4GD3Q 4B4WA 3HXKA 3L6DA 2XB6A 4PYJA 4ZMBA 3I1YA 1SCDA 4DJTA 3FY4A 1VLHA 2I1QA 2IEGA 3DEJA 3WICA 3B3GA 4AULA 1QIEA 4BS9A 3IAM6 5K6AA 1CNMA 3B60A 4JK3A 1HL7A 3VVCA 4RTPA 3FMOB 2ODBA 4MS1A 2X9GA 2P2ZA 2XT0A 3A3OA 3DVSX 3B52X 1Q16A 3P52A 4D9FA 3SDBA 4QAQA 1QRSA 1TO1E 3IB6A 4TKVB 3T9FA 1BE1A 1GNPA 4BC0A 1RHJA 5SYNA 1SXJA 1ISRA 3STVA 3OKAA 3OEWA 4G0VA 2Q2WA 3CNNA 2W58A 1IAQA 3W6ZA 4R16A 4B44A 3ZIUA 3G13A 4JSYA 4QT0A 1PNQA 3E18A 1BWQA 1MX5A 5AI9A 3QGMA 4E08A 1WKBA 1OLXB 2FJUA 3AVPA 1JR3E 1NDQA 1U2GA 2ZRKA 3NHYA 4DRXB 3DD1A 3BXGA 5JADA 2Z0MA 5KHAA 3EASA 3E7PA 1T4MA 4UDOA 2PSDA 3DE4X 1WL8A 1YVDA 2YC4C 3MOGA 3O8OB 4G5OA 4IJ5A 3DT8A 3B9PA 2PG3A 1VHWA 3LDHA 4NYMQ 2ACEA 3L7YA 4WERA 5DHSA 2PL3A 1FUUA 3U3DA 5KWJA 2AZTA 3K0FA 4IRMA 3BMOB 4B4VA 1WDWB 2X22A 3DMGA 4Q4AB 1XFAA 3IOBA 4YNBA 3GVCA 3EH1A 2XLBA 2F1OA 3TBFA 3PRHA 4JJAA 4CIVA 1YZQA 1XXLA 4N3AA 3OCYA 1FFCA 4UREA 4II3A 1KJIA 4CIYA 1EHIA 1FXUA 1RWPA 3NM6B 4US2R 4CG3A 5SV2A 2FPOA 3IBSA 2JIZA 3OIYA 1CR1A 1QVVA 2IXEA 1L4BA 1TA9A 2W93A 4ZZ0A 3SK0A 4E4RA 5ADVA 1MOSA 2MWMA 4IS3A 4QD3A 5C53B 3HK2A 4IIFA 2PX2A 4RS3A 3LQ1A 3K6KA 5E6SB 5EG5A 4BC1A 4H31A 1XTIA 1R0WA 3BFVA 3K94A 4CMEC 5IEJA 4MYHA 4Q7LA 2OVFA 2ZUDA 4ZAYA 1IHDA 2VEDA 4IR7A 3RUAA 2YDYA 1PD0A 4AJ4A 3K5WA 1XHFA 3FHJA 3NXKA 4DWWA 3BK1A 4LF7B 3PS9A 1JG7A 4LDZA 4A1FA 3PRYA 3P97A 1LNZA 2ZAOA 2A3RA 4MPPA 4B5KA 5BR4A 5DNWA 4ARIA 1I2AA 1R0KA 1UQTA 1U0FA 4NU5A 4RY9A 4KVZA 1EU1A 1PUXA 3ZVRA 3KUKA 1PJ4A 1WOYA 5EI5A 1AQIA 2QMOA 1BXGB 4IKEA 4WN9A 3GLGB 1B6GA 5AM1A 3G7UA 3C6BA 1MPTA 5B1YA 1TM2A 2HK6A 4HEHA 3RASA 1Y0BA 4EEXA 5IBPA 2BHLA 5CITA 3NHMA 5LMZA 4A27A 2GDZA 4I1VA 2HSDA 3VMMA 1YJCA 2FSIA 3HP1A 1YC5A 3PCXA 3I09A 2D54A 2DGDA 4AP6A 2PKQO 1JFFB 1MP0A 1X9IA 5FIUA 4CL2A 3GLIA 3AI3A 2P90A 3WQBA 1UJ5A 5CCBA 4QXMA 1K8QA 1N2HA 2QXTA 3GUVA 4PNPA 1Z62A 1P4JA 1U7DA 4LXHA 1TAHA 2GWHA 4IZ6A 1YB5A 2G4CA 1USVA 2TMKA 2GHRA 1VIYA 2I4MA 2O23A 4GI2A 4L0QA 1AUOA 2ZCUA 3WGTA 1AO0A 2DQKA 3AFNA 2GPYA 5LQCA 1YAJA 4HNAB 2HBRA 4LXIA 3VR6H 2XW6A 1VXRA 1TCUA 3D6MA 3HJNA 2XRYA 1MN6A 2CJWA 3KR0A 5CTAA 3W78A 3QJ5A 4BVGA 3OX4A 4CEJB 2JLVA 1QFYA 4YAKA 1YZ3A 4HWGA 1V16B 1Y34E 3LC7O 3F90A 4J76A 4TS9A 4EG0A 1OZGA 2LZ0A 9LDTA 5EJAA 1N8NA 2O2HA 4D96A 3NW9A 3LLVA 4S04A 3ZV6A 4PZYA 5LA6F 4UM9D 3GAAA 2VK2A 4DQ0A 1M2VB 1YDFA 2J4DA 3KK0A 1U2SA 3KTDA 1IHUA 1DXHA 4K6HA 2RGNA 4MWCA 1ZMOA 1W46A 3QJGA 3BULA 4PCAA 2REQA 3VR5A 1JR3A 2J5BA 3T1OA 3WX0A 2A1IA 2DMRA 3X3HA 4G3XA 2KLBA 3DHNA 1QRRA 3FPKA 4G4GA 3B7PA 4I55F 4XWTA 5FHRA 5J40A 1MAAA 2AT1A 4OIMA 2JI7A 2FN7A 3RRYA 1L8OA 1P7CA 3H8WA 3FZQA 3MELA 5FF9A 1UANA 3QA9A 3CXUA 5ALDA 4RPGA 4ZAFA 4ZC8A 2CCJA 2BDEA 3DWIA 2NNWB 2P68A 2IYAA 1CUYA 3S7ZA 1PK8A 1YFZA 3GJXC 2ZM5A 3FFTA 4E51A 4D98A 3FAZA 2XADA 2P78A 4MEJA 1V5GA 1ULSA 2IXDA 1R6AA 3REOA 5FH9A 5WRFA 5LMNB 1W87A 3L6BA 3THOA 5HIAA 4BMOB 1RYZA 5L9AA 4PWZA 5B3JC 4LC0A 4F7DA 4PNEA 5JTUA 4NY1A 2X1MA 3H1EA 1DWQA 1O89A 1GDDA 1TD1A 4JP3A 3TQTA 5INTA 2CXQA 4A6XA 4QHSA 1SRRA 3H04A 4ALNA 4AJEA 5DLDA 4PYLA 1ENPA 3A1CA 1XMVA 3H1GA 3R5SA 3UW1A 4EH1A 3M5CA 4KQCA 3IRVA 2YXNA 3L1HA 4EKNB 2IXFA 4F4HA 3F6YA 2Q6OA 4AUEA 5AVSA 5B6PA 3LH5A 1UIRA 1JR4A 3LKBA 1B8VA 2IYLD 2QRGA 3C7CB 4KTVE 5DI3A 4D42A 4E22A 3IODA 2EFDB 4F2WA 4OA8A 2PLWA 4X61A 3TTTA 1ZLXA 1KIFA 3T5DA 4EARA 3IL2A 5JRDS 5ALIA 1ODSA 2JCYA 1P9WA 2WJ3A 3PT5A 2UZ1A 4HWSA 421PA 1XZNA 3KTAA 4NAUA 1TZJA 1CRLA 1NE7A 2C7GA 3OJEA 5G3YA 3VPSA 1T8PA 3RUIA 4BNTA 4RTJA 4OSEA 1V9LA 4EP1A 4ENRA 2O6LA 3HA2A 3ZDRA 3HXOA 1UBKS 3BERA 1RC8A 1T4CA 1W6UA 1D1SA 1IY2A 3VDMA 2UUPA 3SP1A 2Q8NA 3B3QA 4JC4A 4ZT7A 1JQ3A 2FPMA 3TLGB 3G79A 2GF0A 4HYYA 3ZW8A 4BP9A 1ZW6A 3ESYA 3T3NA 3VNQA 4QPNA 1WPQA 4Q34A 4B45A 3B70A 5FI5A 2FPIA 2YYSA 2OBLA 3ZS8A 2EQAA 1ZC3A 2BGUA 5JS2A 2YYAA 1GUYA 4QFDA 1R50A 2HBYA 2VDKB 5EJ9A 2QZSA 4TV8B 2V5VA 5FPSA 4E15A 1ZM4A 2FQXA 5K03A 1P2GA 3V8BA 2AWOA 2QN7A 2PX0A 3SDZA 3SQOA 2AXQA 3OZSA 5JJCA 1FP4A 2ZUCA 1RRGA 3ROXA 1K6MA 1NZDA 3BHNA 2NPFA 3DF9A 1XTUA 3OJFA 4FYMA 3KJQA 4HB0A 4NJEB 1IY9A 5IH7A 3NHWA 5SYMA 3SEFA 5I7WA 4OA5A 3L2OB 4EEZA 2O2YA 3IDOA 4RTKA 3PR1A 5HF5A 1DCFA 4Z0TA 5KMGB 3FWZA 3GJQA 4IGKA 3RPEA 1I80A 3TCKA 3PD0A 3GFQA 2GPAA 5CVUA 1W9MA 5CM8B 2GLUA 4EABA 4EGAA 4KFUA 3KTOA 1FYEA 1TCVA 3GIWA 3V1KA 1PW7A 4ZKEA 3X1YA 4EUHA 2OMEA 1H6DA 2FETA 1DCTA 4JB8A 1SR8A 3TDKA 4QBIA 4PC7A 4O4JB 3RKUA 3B1WA 5CT6A 3K30A 2D2XA 2JAXA 2WUFA 3H18A 5AW5A 3ETCA 1J8MF 1NTOA 2YMPA 3DDHA 1JHQA 3K0CC 3QBTA 3SEAA 5JCXA 4NOJA 3GH1A 3GCGA 1X8XA 3BS4A 4QRDA 3T3IA 1S2DA 4BLRA 2FPXA 5HBGA 1V4NA 3DAPA 3T6KA 1W2GA 4OY3A 3W2IA 2P7IA 4FUQA 4NIMA 1WMBA 3BGDA 3WYEA 4K6OA 1P2UA 4C2UA 4H3SA 3ROQA 2FCAA 3ED1A 4KYIB 4PQYA 4G85A 3BOSA 5AI6A 2ONJA 3SD7A 2GWRA 3L8HA 4Q01A 1EXVA 1G7SA 3SI7A 2RARA 4JCOA 3RS8A 1N2IA 5EJGA 4MI1A 2IZZA 4P38A 5F9FA 2NTEA 4J9VA 1T9DA 3N2EA 4FHCA 4RACA 5JSQA 4YJHB 4G8DA 3ESRA 2OV3A 3ZNPA 3V3TA 1L4LA 1NF2A 4AO6A 2RGRA 4K05A 2ZJ7A 2ZAIA 3VC7A 5G41A 3VJMA 2JLUA 2IODA 4G65A 3I6BA 4HOYA 2WU8A 3WGIA 2JATA 1M10A 4ON9A 5LN1A 3K0KA 1WTCA 3QHPA 3IAEA 1AKMA 3SIPA 5L3QB 1V39A 3I05A 5F1KA 1PNRA 4RWEA 3K4QA 5KVVA 4AYWA 3KKEA 4C4RA 1OBVA 2ABWA 4BQIA 1U7XA 2J4FA 3WYCA 5BXYA 5JBIA 4DKXA 3AHGA 1ZXLA 4HZUB 4DQLA 4NU8X 2VRWA 3SR3A 4G89A 1OHHA 3AV3A 3ZE8A 3WFZA 2ILTA 3N0TA 2ZRGA 1EHCA 5C1BA 1AK1A 2QRKA 5G1PA 4PWYA 3WGHA 4G6ZA 4JOCA 4HP8A 1X7DA 5K8CA 4AXBA 4OF4A 4V24A 1GG5A 2R8BA 1PO7A 3AP3A 3K3PA 1WMDA 3FX2A 3THRA 3PENA 3AHFA 5SY9A 5KYWB 1E2NA 1LI4A 1TA4A 2WM8A 1JH8A 2PPLA 4XFKA 3IQIX 3PNMA 1ODIA 2XE4A 1NBIA 4O4HA 1KBQA 1X2EA 3RLIA 4BCDA 1IUKA 1GVNB 2D1RA 4XW2A 4MB2A 4F45A 4RK0A 2RHOA 2O2ZA 4GG1A 4HX5A 1LX6A 1JHDA 5IJXA 4OHVA 1N5JA 3NUQA 4WZAB 5HMMA 4EI8A 2NOAA 4V2IA 2DKNA 1GADO 1NOKA 1W59A 4FCCA 5AJVB 1L5OA 4M21A 4UHJA 5ED0A 4EYGA 3AJ8A 2G9UA 2WIFA 3VGJA 3GJZA 5CHYA 3FTNA 4FMDB 5DTEA 4E32A 2BFEA 1LNSA 2GBLA 3PFBA 4L2IA 5GONF 1NJFA 1HE5A 4IDPA 5E1OA 2V45A 2BV3A 3PGMA 1G8YA 5CR9A 2NNLD 4RNCA 1XEXB 2VSFA 2X19A 1JFVA 4QNMA 1Q91A 2JAWA 2G9QA 4PXAA 4HWPA 1J8FA 3U4AA 1QUEA 2QRNA 1Q12A 3V4VB 1RJWA 2YIDA 4FK8A 4AP5A 2PX8A 3FLMA 1K06A 1QFSA 3K9WA 4X5OA 3I45A 4KLAA 3FPGA 3CSSA 3V2IA 5TGZA 1U1FA 1YASA 1VHDA 2D62A 3NLLA 5DYIA 5ERGB 2EJCA 4A6EA 2VDVE 1TZMA 2H54A 4MQLA 4B82A 4H16A 4RA6A 2IZ1A 2WSMA 3TI9A 4DSAA 4PEVA 5JC8A 3SSOA 2P3OA 2X0IA 2BHNA 2AOVA 3HKBB 1IEWA 3N0VA 3SKXA 3UWSA 3KB1A 4FGUA 1URPA 5C2JB 3UANA 5IS2A 3Q8KA 3AKDA 3E4DA 1CETA 5H68A 5EZYA 2FKAA 4Q37A 1F6DA 3I5MA 1NF3A 3PPVA 2AOWA 4RVHA 4AUMA 4I50F 1LDBA 1VLVA 2FUG6 3MINB 4M99A 4RF5A 3PQDA 3PD1A 4OFXA 3HDGA 4LIPD 5K09A 2O54A 1UCFA 3N2ZB 3TQQA 1T34A 3IRUA 5GQSA 4D9NA 1SG6A 2XF8A 3V8RA 4CQJA 4G0WA 2AJ8A 3QWFA 1YGPA 3MTAA 4D8YA 4Q4HA 4W9RA 5CB0A 3BK2A 1UPAA 4G5GA 1CB0A 3HRKA 5BWNA 2PJRA 4KFSA 5J58A 1KYQA 4DZRA 2IQ5A 2PKCA 3LO8A 3CT6A 4URFA 4W8GA 3U7HB 1CUXA 3THYB 2F1IA 2BOVA 3CEAA 1CUGA 2DCMA 3JWJA 2C3PA 3W6UA 1Z0UA 2BSAA 3R8XA 4YRSA 1R27A 3BUSA 4JBXA 4O1HA 4ZEXA 1GZ7A 4PHTA 3C6KA 3H3FA 2GF2A 1L5HA 2YW9A 2QPOA 1OF1A 3BJMA 3WLMA 1XEWX 3CF2A 4O0LA 4X1IA 5EAIA 4U0JA 3FNRA 1JEQA 4EO9A 1XQVA 3K9FC 2PPVA 3W3ZB 1IEVA 3NKVA 3TN7A 1PGNA 4FMCF 4MQUA 4CL0A 1U6IA 1Y5NA 3SX2A 3BIOA 3AT1A 3GDGA 3IULA 3NTXA 3MM4A 4R5HA 2HUNA 3TOXA 5C32A 1TQHA 1DHRA 3X2FA 1BVUA 3Q5EA 4EDFA 1L1RA 4N8EA 2QDXA 1SUDA 4ABTA 5JTTA 2PA0A 4QYIA 3PXBA 4X20B 2Z08A 1FLVA 1YU9A 2NO9A 3QQPA 1RC0A 2J6CA 3A1WA 2PFKA 3L5KA 4P54A 4YRDA 4MAMA 2H5IA 1LSUA 3N2KB 5JLAA 4UAGA 4N40A 2BHRA 3MMZA 4DR3B 2Z6VA 1AXGA 4JLOA 3BE4A 3NAZA 4BLTA 5CB8A 3IQWA 3PHGA 1HURA 4ROSA 2NVUB 3I04M 3GVXA 3NNNA 2EKPA 2FK7A 3K72B 1B93A 3STUA 4ER6A 1HUQA 3VKFA 2JEZA 1TQ6A 5B4VA 1UWVA 3JAWA 3ADDA 1W4LA 4I4TB 2BR3A 1MFZA 1UEJA 4O2AB 4PRZA 1LLDA 4BEBA 1X9HA 3TGWA 3U7QA 3LOPA 1JKMA 1DRUA 1H1LA 1SN7A 3H9BA 3LE8A 4M9CA 4V0ME 5CVJA 3ZI0A 1T9GR 4TT3D 3G82C 4YFYA 2OA0A 1WHSA 5LJLA 1VG9B 2XE8A 2QUHA 3D8RA 4HK4A 4JH0A 2YHIA 2GSWA 4MP6A 1V71A 1P77A 1TPYA 2IZOA 4IDGA 4I9UA 2ISSD 2HZBA 1LPMA 5SY4A 1U1IA 3IUPA 5KTTA 1GWNA 3AGPA 4YX9A 3TE7A 3L7BA 4MVWA 1DCKA 2C82A 4QLBA 1NVWQ 2H2GA 3DE6X 3ECAA 5FLXA 1A7KA 3M70A 1JIQA 2ZYDA 1TM3E 3NTOA 4YRTA 4BMPB 621PA 1Y6QA 5K0ZA 1EESA 3QOFA 3WGLA 1KI7A 5J43A 5IAKA 2R7NA 4QXAA 2G07A 4H6VA 1FMCA 2P5TB 2Q9AA 2VXCA 2EFGA 2VT6A 4NSNA 2V7QA 3VYWA 2C2MA 4AZVA 1QDUA 3FWYA 3COYA 1XPRA 4DN6A 1XVUA 4W5WA 3BICA 2FSHA 2QTVA 3BFPA 1G8PA 1ECGA 1NW3A 2QW1A 1U90A 3MWYW 4MYCA 2A0WA 5F3RA 1OOEA 3H86A 5F1OA 3AI2A 5IWCA 1VPEA 3UC5A 3RH0A 3W90A 2BI8A 2IWRA 4RZXA 1V6CA 4QU0A 2JIPA 2C99A 3OT4A 3TRHA 1H0HA 1XZFA 4BO1A 5LC1A 1DVRA 5T4BA 2RK4A 5T6MA 4FKBA 3VI4B 2IXAA 1EUCA 1RQ2A 4QICA 3ABQB 2XCOA 1XMJA 3AVUA 3ADKA 3A9RA 1BDJA 3PEYA 1QF6A 1M73E 2FUEA 1QHHA 2VUHB 3BB4A 3IDQA 4ANFA 1N2JA 4M9RA 5DRTA 3JVEA 4R7ZA 3C24A 4UBNA 5B3AA 4P0TA 4N1AA 3NXSA 1M6YA 3TXXA 1TM7E 2EHJA 2HHCA 1ZINA 4EB6A 4WXMA 2ATEA 4PTLA 1GNRA 2NXEA 4LKRA 1NQVA 2WDPA 3AU9A 4QSMA 3BD8A 2DFTA 3OKCA 4TTVA 3C8MA 5EZ5A 3L0BA 2HCBA 4YRPA 3TNDA 1JILA 3B53X 3MBOA 4HWKA 1G6Q1 1IATA 1DB3A 1I2BA 3AKCA 2F3PA 4L72A 2RDMA 3H1PA 4DA8A 2Z8YM 4XKJA 1G8KA 4DJJA 3ND9A 4ZRMA 1XAGA 4QU5A 2M6SA 5ANRB 3RVPA 3SOZA 3LOUA 4A23A 4EF4A 1QHIA 2PR2A 5CLFA 3ELBA 2XB8A 2YWDA 1ISJA 2GRAA 4HEA1 3TL6A 1L5QA 4TYNA 4DA4A 1A1VA 1L5FA 4DPLA 2PUHA 3BH0A 5AJYA 1NGSA 1PFVA 3QF4A 3G0IA 3KVVA 4YO8A 2VWHA 3OM8A 5JNVA 3ANXA 3IAS6 1YJQA 4LVNA 2QN6A 1F51E 5I9TA 2CHQA 4ZOBA 4X64B 1TD9A 2VK4A 1VCMA 4OV6B 2JGMA 4PN3A 3C14C 3FSJX 1KO1A 4AIRA 2ZI3A 2CEKA 4KQHA 3K4HA 3ORHA 1N0WA 1D2AA 1X94A 3HUFA 4FKMA 3CG4A 4URHA 4BO4A 1EWKA 1TZ2A 4AS2A 2X9VA 3HFRA 1T43A 3HKEB 5JNRA 2ZBUA 4OHUA 4PIMA 3TQFA 3FR8A 5A1JA 1XDSA 1CNFA 3CLTC 1SNYA 3D1LA 5A3SA 1RVV1 2EYQA 5F5XA 4V0MA 1Y8ZA 2OC4A 1UBTS 1ZXBA 3UMRA 1X1QA 2XD4A 1XZLA 4JIGA 2JL1A 1QPGA 1TLLA 4R1SA 4IDFA 2VHEA 1A4IA 3UUFA 5CFPA 1NAHA 3A3NA 2F8TA 5CNKA 3CUTA 1KFEB 3RIXA 2YJNA 1A72A 4JR2A 1DWUA 3HJGA 1E3MA 5HPYB 1VXOA 3EJWA 2C2ZA 2VQDA 3F6SA 3FTFA 3SQMA 4BO3A 2OO5A 1TT7A 3E27A 3MRXA 2I6QA 2RHCA 4JS0A 1NQAO 3OD1A 4PTZA 4S12A 3RS4A 3FDJA 3BBPA 1J99A 3Q87B 1SHZA 4PS0A 4Y2PA 3U13A 3CKLA 4DSNA 3VUFA 1KVSA 3ZH9B 1EA7A 3WK8A 2EC5A 2SCUA 3QVGB 4NFLA 2YZKA 5CNJA 3E81A 4DAEA 4ZTBA 5FA5A 3E5NA 4BB5A 1DEHA 2OCPA 2IHUA 2AG6A 4LF6B 3K5IA 1KK3A 1VI2A 1W25A 4EVIA 2BGIA 1JX6A 2R6DA 3A0RB 3M1IA 1M34E 2V7XA 2Q7XA 3NS7A 5EN4A 1CDZA 1MIOA 1GFWA 4FT2A 4L9WA 5AK6A 5HJ7A 1R5BA 4KFTA 3COJA 1XVAA 1MTOA 4XJXA 3RYTC 4DM4A 2GUGA 4JSTA 4YRCA 4B3JA 1QDEA 4NBTA 1IB0A 4N5LA 4QYWA 3Q41A 4BO2A 1Q21A 3OOJA 2HRDA 1SZPA 1KS9A 2PBLA 3AEYA 1XL0A 4G5RA 5LNK1 1N32B 1E18A 1GCGA 1BX1A 5CXUA 4HH4A 3EW7A 1O94D 4N3NA 1GPLA 1AB6A 1ECLA 4IO0A 5JDCC 3JRWA 4JJIA 1E60A 1HTTA 1SZCA 4LWOA 5E9QA 1KDYA 3RV4A 4A2WA 2XBLA 1FU7A 1GKLA 1RTKA 4BYMA 4E7PA 3F74A 2VJNA 2HJGA 1D6MA 1Z33A 1GU1A 3C3PA 4KDCA 3A1VA 4AVYA 3VSDA 4UXHA 5DCLA 1UM9B 1O4WA 1XA0A 5HUQA 5KO2A 4K88A 1KDRA 3HA5A 1JW9B 2JJYA 2X1VA 1ORVA 3CRVA 3V4PB 2WUEA 4CMIB 5JJIA 4A92A 4U3JA 1W5SA 4XGQA 4K86A 3TIGA 2H1VA 2ZUSA 3GUCA 2GXSA 1HNZB 3CVVA 1Z6YA 5CYGA 2QRVA 3T7TA 1JDBC 3C41J 3N07A 5FA6A 3PT9A 3GDHA 4RYLA 5CLHA 2FWAA 2WWYA 2EKLA 2VDUE 1C4WA 1VTKA 4C7XA 4BLPA 3DTVB 5EPOA 2ZXUA 1P31A 1DV2A 2ZI4A 3KAKA 1X7XA 2OAP1 1QWOA 4LK3A 4WX2B 3MTIA 2PRSA 3QU4A 4JLBA 4RVNA 4XR4A 1YONA 1OLSA 3CRQA 2PKXA 1BCRA 1L9XA 1LI7A 3B6MA 1P2DA 4N6GA 1GRVA 3LCMA 2F17A 2H5LA 2J9FA 4JB2A 2G7ZA 5BVGB 4B3RB 3SBEA 1SVMA 4INAA 1H6AA 3IMCA 4JLPA 4L0DA 4EUFA 1ABBA 2GPWA 3PF8A 4UOQA 5JMTA 2JAUA 4DSUA 1E9AA 3RAFC 3TMKA 2B5WA 5T8KA 2RC5A 4MRSA 1R88A 1X9GA 4R31A 3R5HA 1U1EA 1GCAA 4R40A 1L4HA 2NV2B 3OBBA 2I62A 3QNUA 4RVUA 1NP6A 4QULA 4RS4A 2HPHA 2A5JA 1EP9A 4H7HA 4Q3OA 2FRXA 3TKYA 2HXSA 3GRFA 4QRIA 2XQJA 1STOA 3IIEA 4MXDA 4DHWA 4D5GA 4KMMA 4R54A 1MH9A 3JD3A 5IYZF 2P9HA 1QCYA 4I5IA 4PLWA 5C8VA 4FFWA 4WT7A 4X45A 4ESVA 5DHFA 6LDHA 1VSQA 4GSYA 4WZBB 5DM60 2BI4A 1QDLB 1YI0A 1NMYA 1JEAA 1Z34A 3D7RA 4I8XA 4J8PA 2HB6A 4HGRA 2GI4A 4MWDA 5ICFA 3DE3X 4RY0A 2OAEA 3ZE1B 1HYHA 2WTMA 3LBAA 3K05A 2O2IA 2UYHA 1SXIA 3HBLA 4NEQA 4OU4A 1HTWA 2JK1A 5KSPA 2HCFA 5F33A 3VOBA 1JU4A 2ZVDA 1SXJB 1JLSA 1J1ZA 1XAJA 2D0DA 5G1NA 3TG8A 1M34A 4NDAA 3QM1A 1IQ0A 5JD3A 4Z9XA 3GG9A 3U31A 1LPAB 2JD2A 2RAVA 5D3ZA 3F6BX 4OUKX 3WSTA 4DMCA 3RVJA 5J4VA 2D8AA 1YZTA 4ENQA 3A11A 1T6XA 5ENZA 4ZEMA 2NN3C 4W7HA 2BFMA 1LPSA 2WIDA 1L3BA 2BFCA 2G04A 3ESXA 2HJSA 1PDVA 5LOVF 4IV8A 4DBLE 3AJDA 4R0MA 3B6ZA 3S0JA 2CVQA 4UQPA 2B7BA 4WKOA 3NM4A 2GAOA 3K0FB 1NUQA 1TZBA 2IYNA 3EY4A 5DZSA 3UT5A 3DE5X 4LX0A 1XD9A 3WZMA 5KYKA 3OEHA 5EXXA 2TMDA 3QTBA 4O4LF 4S1WA 2OTCA 2IPMA 3IOMA 3T0IA 5HRUA 4IRXA 3ZQKA 1JF8A 1VKHA 2WFLA 3K6JA 3QHQA 4BGVA 1D2HA 1H3NA 3F6EX 2VF7A 5H3HA 2YV2A 5TV2A 4NJMA 2XITA 4A3SA 4MLPA 4XM1A 3LQFA 3FBWA 3BWVA 1KEZA 1NG1A 3JQ9A 3KV1A 1L5NA 1KO4A 4AKGA 1X87A 2Q1XA 2GR9A 3CSDA 4XX0B 5A3QA 2EFCB 2QLFA 3R0JA 1G4UR 3B8HA 2ZSDA 2VP9A 4G9GA 1I3NA 1P1JA 2QTTA 1LK0A 2C88A 2YY7A 4LRSB 5JQWA 4R2JA 1NN3A 5D86A 1UIMA 1T5HX 1BGXT 2PN1A 4C4YA 1GZHB 3K5PA 2CKMA 4GQIA 1MW8X 2GF9A 1WBDA 2O1WA 4ATNA 3M49A 4NENA 3F97A 4FFVA 5BW8A 4BLOA 1N7IA 5CP8A 4QM7A 2F3UA 3JVIA 1MXFA 3IHTA 1SFRA 1KK1A 1ZX1A 2IU3A 5H02A 3G7NA 4B0PA 2FDCA 1VC2A 2UZ0A 4UTXA 4BBAA 4MV8A 3GLGE 4G0MA 4KAJA 3RYHA 3ENKA 4GX0A 2AEJA 4WXEA 1ABFA 2RGEA 3BFKA 3BORA 3JQRA 4JOQA 3W3AA 4J1QA 4JNKA 5K3DA 4DV3B 3RS0A 4P4GA 1WB5A 3RCBA 2PIAA 1WNFA 1XN4A 2P79A 4Q48A 3BTOA 5EMKA 4ND8B 3GLIB 3DEKA 5ARCA 2PMEA 4HB3A 5C31A 1KF0A 2HSGA 3IVGA 3RHTA 5KVAA 1QO9A 1V7ZA 3UCXA 5KTOA 4Q7MB 1P7WA 3EXG1 3VKWA 3UJNA 2OV1A 3PIIA 1QF7A 3DFZA 1V9SA 3SJBA 5K3OA 3R3ZA 2HSJA 4EG7A 1SKBA 4DGQA 1QRAA 2KMLA 5CJPA 1CEYA 4MTCA 2CJWB 1Y3AA 1ZRMA 2ONYA 2L2QA 3H8JA 4RE6A 4RVCA 4F9GA 1SU4A 1XMSA 2C5FA 2NUAA 3ZDXB 3DDCA 4N76A 1SBHA 5FT9A 4MGKR 4RF4A 4C9BA 2DLNA 4OCZA 3RVLA 4UTPA 4ZI3A 2D2VA 2JAQA 1PCXA 2VCEA 3QXJA 4ZZ3A 4DV6B 3HXLA 2ZRQA 3LPAA 5J4LA 3HXPA 1WW2A 1ZUNA 3L0ZA 1G8HA 3OH8A 5EY5B 4PX3A 5J4HA 4OQNA 3H5NA 5F9HA 1ZK2A 3BSWA 2JJ1A 3I4CA 1YT5A 4MGEA 3U7EB 1ADGA 4DMGA 3MLEA 4ZI7F 2BGNA 2AG0A 1N3BA 2Z56A 3KCQA 2FB9A 3N28A 4CF3A 4A5OA 4I6GA 1G42A 2JI9A 1Z5UA 1ZUIA 2BKVA 2D7JA 2HQ1A 5HM8A 3V1YA 4AF7A 1FSZA 2QYHA 3B20A 1SXQA 1Z5OA 1KR2A 2JF0A 1MJHA 2YQZA 3LC2O 4JWKA 4KQIA 1W52X 3ROGA 4HRAA 1GT91 1NQ5A 2Y66A 4US1R 4IIEA 5DCUA 2D0OB 5C81A 4WNAB 4O02B 3ANLA 1K8YB 1J6UA 2D5AA 3T9CA 3AR3A 3AM1A 3EXHA 2GXUA 4QEDA 5EHNA 4E5NA 2QR3A 2VP3A 1PG5A 1RPAA 1E1RA 1E77A 2ZI5A 3CUKA 1M6NA 4EHBA 1XKTA 3OPMA 5DYYA 3EPKA 3L06A 1GQSA 1UJ4A 3GCWA 1T5OA 3PNKA 4X3OA 2XCQA 2J7PD 4UNPA 5FOTA 5KYXA 4LFBB 3WC4A 1FDSA 1P39A 4CT4B 5FUQA 4X65B 3RSQA 4TTTS 5DNYB 5AQEA 2YJ5A 2QL6A 5KVQA 5JECA 3G88A 4RLHA 5LB4A 4CODB 3K9NA 1E3WB 1Z15A 3OQ1A 1PBTA 1AUVA 2NTYC 4ML3A 5FOSA 2C58A 3QBJA 3GOQA 3LXXA 2IUSA 3IP9A 3ROTA 1GZ3A 4BATA 1EFTA 4JI7B 1OWPA 4L5IA 5DI3B 2PNFA 4MV0A 1XRRA 3IPRA 4DG5A 5C1PA 3F3MA 4PS1A 4EMTA 5J47A 3WGNA 2BM9A 4MR8A 2XXBA 1NX9A 2O1SA 1E7QA 3C3DA 2IUYA 3OLZA 2TSYB 5D8DA 3TZLA 4YRNA 3B48A 3KTAB 3FZEA 1HKHA 3Q7EA 4F06A 1N5KA 3GLGA 4L3WA 2R1VA 1CQZA 4MQ4A 2E0IA 4XRRA 1XCMA 3OF2A 4H77A 4QX6A 2RIRA 3ZYCA 3HKDB 4XQGA 3DBIA 3E61A 4JB3A 1MJFA 2XX3A 3L6EA 3CB4A 1WMEA 1T4CB 2JAOA 2ZI9A 4UM8B 5BNTA 3V8QA 2O8CA 1GL6A 4OJMX 5DOVA 4B81A 1OH6A 5D6NA 5JQGF 4WA7A 5DWDA 5LQJA 1P44A 5PNTA 2K7FA 1MT3A 1JDZA 1KYYA 4PSCA 2LV8A 1GYPA 1RWXA 2Y1XA 2C31A 4HVTA 2J5RA 4FHDA 4NC9A 3ZJVA 3LCJA 2A5FA 1RWBA 4AG5A 3LBYA 3CJRA 4C7MA 4OJNA 3ICWA 5BURA 1F4VA 2D5IA 1CS0A 1A95A 2Q2QA 2Z2XA 1CR6A 1Y9JA 2A94A 5LQMA 2IEBA 5GP1A 4ZREA 3VNRA 2ZAGA 2FZWA 3VNAA 4BFYA 4CLXA 5EUMA 2UYGA 2Q1TA 4N18A 1KXJA 4OM8A 2DQ4A 2VJYA 1GEEA 1OFHA 3FR7A 3LQRA 1PU2A 2WSYB 3P5BA 3VM6A 3WNDA 4M8KA 5CG1A 2NAPA 3F5QA 2VOJA 1K3UB 3L8ZA 2ECFA 2HBZA 3PXXA 1UXOA 4FI3F 3ZDZB 1F1BA 2D00A 1JHPA 5JSYA 1J00A 1F38A 5BSUA 1LPPA 4RZHA 4CDRA 2SKCA 1ZGJA 3GAZA 4EA6A 1CY0A 2FZLA 1WEHA 4ZALA 3RQIA 3SICE 4RHTA 5CDUA 2IKSA 3HL0A 5FL3A 3V4LA 5LMCA 4KRYA 5CGQB 4ENUA 1P3JA 2R86A 1LF0A 1NI4A 4GZLA 5B1IA 3D02A 4W7SA 5AKZA 5K51A 5JE8A 3FDIA 3GRCA 5A06A 1Z0DA 4FINA 1XZHA 4MWBA 3V33A 3VSCA 1O2DA 2XSZA 5EIFA 1UJ6A 2G1JA 4BMNA 1EAYA 3LLSA 1SVLA 3M5WA 1RJ9A 3BMNA 3ABIA 1RQGA 3C5HA 1KJNA 4RBNA 1B8UA 4OJYA 2WU1A 4MS4B 3V9PA 4C88A 1ZD2P 3ECSA 1XD2A 1ZVQA 3SFZA 3DBRA 4B8YA 1WSBA 1NVTA 4N0DA 3OU2A 1P8AA 1GGKA 1JQEA 2G72A 4DQVA 2Z9DA 3AF0A 1UOQA 1K6IA 2GEKA 2AN5A 1I7SB 5T3YA 2ZCVA 2O14A 2PZEA 3PUYA 5CXSA 2B36A 2C04A 1RZRD 4CM5A 1ZVKA 2W8ZA 3OD5A 1B0ZA 1NIJA 1U1GA 2O8EA 5LZ4A 4MCHA 1U28A 4EI9A 4XGRA 1GZDA 5CVTA 4KI7A 1T5LA 4PAOA 2WHYA 3R6TA 2A5YB 1P3DA 5G0VA 2H2AA 4ZVRA 3I01M 5DEOA 4B83A 1AA9A 1PEYA 3DCIA 4RKEA 3HB0A 2B8NA 4HN4B 3V46A 5KTKA 2GCOB 2I66A 2XDYA 2YJ3A 3FSGA 3OIFA 3MQ2A 1MX9A 1SM4A 1UBOS 2W43A 4NV3A 1QUFA 4XVHA 3Q85A 3SBXA 3ABZA 4PLYA 4PZ9A 4AI6A 4M53A 1E1CA 3SS8A 4EA9A 1UJ2A 4KQXA 1DBVO 2QDKA 5BN4A 1E32A 3CCCA 3GP8A 5L6MB 4DM7A 3L93A 4N8SA 4GU5A 1PI3A 2LXNA 3PKJA 3O3OB 4JDUA 4ZJZA 4P86A 3T7KA 3JZFA 3TQIA 1S2LA 4IVPA 4W5JA 2F3QA 5LPNA 1UPCA 1VL1A 4GKAA 1FXWA 2IHJA 3OTHA 4XEHA 5FTMA 4AJKA 4EPRA 1KJ8A 2A0KA 2HSWA 2WT8A 1TTTA 3NHLA 4JNCA 4DLKA 5KX5A 2WF5A 1C4XA 3IOEA 3UJPA 4XZ3A 4A6PA 1EUYA 1Q74A 2HHAA 2BJWA 2QI9F 4FSXA 1D03A 2WR8A 4Y1EA 4A2PA 3MAJA 2OKCA 1P9OA 4E0BA 1IJEA 3UMVA 4DR2B 3RIHA 2QY6A 2H92A 1U0LA 3TLEA 1WPXA 1ZJJA 2A59A 2BFEB 4L2IB 1A5SB 4WKNA 4C4TA 2F1JA 1QM5A 3A28A 1DJLA 3QY9A 3L7NA 3P0IA 3GLFB 3DQPA 4OTZA 5AM0A 1Z35A 5JYDA 1GQ2A 3S2SA 3HB7A 4JT9A 3WSVA 3GVIA 5BXQC 5HUHA 2ODQA 4PZLA 3D3NA 3FH0A 2CDBA 4XYBA 3WNCA 4UAUA 5K8IA 2IW3A 3K8ZA 3SY8A 3HU5A 1SPXA 1UBCA 3WO0A 1JMVA 1C1XA 3GEMA 3CFYA 4U7PB 1Y9AA 3HVUA 1GO2A 1MG0A 1MO2A 1R4NA 4HQKA 4RA6B 4JHXA 4BECA 1IBKB 3HVHA 2EFHB 2WPNA 5DJ5A 1F9AA 2PJUA 2EYUA 3GHYA 1NVFA 1DX4A 1Q0HA 3L7LA 1MT0A 1ZIOA 3QOYA 2I33A 2QT0A 1COZA 3N8DA 3AR5A 5FA8A 4MKRA 3E9QA 5H80A 6YASA 3V6MA 4ENWA 2F9FA 2QQ5A 5KNDD 2PH7A 1B42A 3PI7A 3ME5A 1UUFA 5IDYA 4Z1MA 3VMFA 4MV9A 2YXBA 3V7FA 1P1IA 2TECE 2ZJYA 3N5KA 3EE6A 5BSWA 2B98A 3OQHA 4JJGA 1ZOLA 3DTNA 5SZJA 3EGXB 3SN6A 4BDSA 1E98A 2XGOA 3MIIA 1P81A 2Q50A 2R0QC 3ODPA 5D01A 1F20A 4OATA 1KYXA 3WJ2A 1N2BA 4P1ZA 1G59A 4JR1A 4JUCA 4BNVA 2WY2D 3WLLA 3CNQS 2R1TA 1UBJS 3EEFA 2Y68A 3CT4A 2O59A 2VF4X 4AJHA 1A3CA 4EPTA 2CFSA 1P0CA 2OHXA 2PKRA 3BTSA 3IUQA 4NJOA 2FLKA 3DEZA 1MQAA 1N6HA 4MVJM 3VR3D 5JPIA 4HNVA 1QP7A 1NHWA 1JZTA 1Y4SA 2ZI6A 4QGSA 2JGKA 2YHSA 2V5UA 1IUNA 1L5HB 3CG0A 3HBMA 4WLEA 1A82A 4C5BA 5CYOA 5FQNA 4C3OB 1RFLA 4X1IB 2HLNA 3FLEA 4X8LA 3I9OA 5FJJA 2JCBA 3EWSA 4EPWA 3NU1A 2GILA 3A6LA 3F0TA 5IABA 1UBHS 1UDCA 1EKXA 2L18A 3P9IA 1Y6GA 3W8EA 2FW8A 5FUXA 2W6JD 3SAJA 3TVTA 3RRXA 3OLYA 5EJ8A 1E1KA 1V95A 2FSVA 4NNJA 3CRNA 3U9LA 4AJLA 4CL8A 3TW8B 3IMKA 3IUMA 4K3UA 4ZARA 2QSYA 3ONDA 4MGZR 3IMGA 5EHXA 1UC4B 4QYIB 2F4VB 4JSRA 3GJTA 1N78A 1XRLA 2Y1FA 3JWIA 1RLIA 2H1FA 3HJFA 2VYFA 4P4SA 5JAUA 1E5QA 2YVKA 3KFXA 1RPJA 4NESA 1T1RA 5F77A 1JU9A 3RJ5A 4AX4A 1BDIA 3IE0A 2C2XA 4MVJG 5LLTA 5C1DA 1VKNA 3UAXA 1PR5A 1UXIA 4QUHA 4C76A 1LVHA 1XTQA 1JG2A 3W4KA 2CXXA 3KQNA 2B4AA 4FQ7A 1Y48E 3FZYA 4BNUA 2O2CA 1SUPA 2TYSB 1GD1O 3FNFA 3R75A 5LXTA 4GR4A 1ZAYA 3ICCA 3H3XA 3KPWA 4Y8VA 1JJ7A 5CPBA 4H1WA 1PWYE 3JAWB 2ACVA 5BSTA 3R1IA 5FFMA 1FL9A 3D7MA 4CYMA 4KQWA 3VPXA 1A7AA 4K28A 4U6NA 3ZUPA 3OHPA 2CHUA 4RVDA 4IIJA 2VWPA 1H1LB 4LYEA 2PS1A 2RC6A 3VHLB 1EDOA 2EBUA 2WQZA 3DO6A 3DT9A 1IHYA 2IP1A 4KQFA 1GAQA 2ZXFA 3WHPA 2YHIB 2Q9CA 4IMRA 4EYEA 1IM5A 2IU6A 3ZG6A 5JEDA 3E8MA 2HSEA 3BQMB 5ALXA 1JIUA 2C59A 1S9HA 2YRWA 5H4HA 3DXXA 2VCYA 2JHAA 3QFCA 4PYIA 4FDVA 2O2JA 2VN8A 4EY7A 4GPZA 1KTVA 5ILGA 1CIJA 1L8AA 4NR0A 4OP2A 1VIVA 2XNSA 2WJVA 3C7DB 5FKJA 2AR9A 3PNYA 4IEIA 4RF2A 4GOOD 2J3JA 1Q0SA 3DOJA 1TMOA 5DTJA 4FHZA 1T1IA 2J9RA 1ZMTA 1MBZA 1SVUA 1ZI8A 1J90A 2R7MA 2WD9A 3HABA 3WGQA 4D80A 3E5RA 4AZSA 5T67A 1D2CA 1XLWA 3KRTA 1KHTA 3S8EA 1YD7A 2WK1A 2WB2A 1DMSA 1Z2AA 3TAXA 1NRWA 1CWUA 5G4LA 2ZJ0A 5DHTA 3V7NA 2BMAA 5LD2B 2XI4A 3B51X 3RWOA 3W5JA 1WIWA 4A0GA 4V02A 1HX7A 1EK1A 2XWPA 5TPWB 1L3IA 2DEUA 3HDQA 2JZNA 1RRPA 2JVJA 4HGZA 1I3OA 3LPCA 4QXRA 4AG6A 1YJ5A 2CNKA 1LTKA 4XPIA 5K0NA 2DH6A 4RCZA 2E3JA 2RONA 4K26A 5JJLA 1BXRA 5TQ0B 3NOQA 4MMYB 5KC9A 1E6MA 4PCUA 1IZZA 1EGHA 4GRDA 4DBZA 5BNIA 4AB1A 1KJWA 3EPHA 4FBMA 1QHHB 1RCTE 5DHUA 3R74A 1I4EB 4MUIA 4EITA 2HWYA 4OAOA 1O57A 3F4KA 2DYKA 4Y2JA 1WUJS 4P34A 4I1UA 3VYUB 5G4KB 1C7FA 4FFDA 5IAOA 4KSBA 5TMPA 1TEZA 4J1TC 3WMXA 2C57A 1RXUA 4LDJA 5EVJA 4YP6A 1NE2A 4BHTA 5JSHA 4EB6B 1DFHA 2QRPA 3VPFA 4UJ5A 4TXLA 2AOUA 1PV1A 2QD2A 3BCSA 1GKKA 1RYDA 1SUSA 1WUIS 2P41A 4AD8A 3UKOA 1MDBA 1E3DA 1W34A 2OM2A 3O94A 4HEA6 3TOZA 1S8AA 4ZYVA 4K6FA 1U80A 2MMGA 2WAOA 4Z4FA 4ZCRA 1D5CA 2I3ZA 3FNEA 3PF9A 4GWLA 4YIHA 2AE2A 4KQMA 5IK2D 3WNZA 3QF4B 1VBNA 4OKSA 1ORHA 5EKSA 5A02A 4IDOA 4N4AA 1Y89A 3N9IA 3BMCA 3LPNA 2WWTA 1QVAA 3E1GA 2OSBA 2XBUA 2CJXA 4WY2A 1FYWA 3DMTA 3CBQA 5E0OA 3G0HA 1DPGA 1YB1A 4KVGA 2IV2X 4QBGB 3FCCA 4BX3A 2KHZA 1W4ZA 4Z0HO 3PXDA 2FV8A 5TPZA 1ZM3A 1I7QB 5E38A 2XTAA 2X8WA 1B2LA 3R3WA 1DGQA 3PWTA 3GFRA 4LJLA 4YRKA 5E2BA 5IN4A 2V0GA 8MHTA 2B6HA 1NFQA 4IQ8A 3MOIA 5IAAA 1E1MA 1HT0A 1D0SA 2MINA 3SZLA 1JWBB 4HNGA 3FUXA 4ZQGA 5LZ9A 1YFJA 1C9DB 2CNBA 2V74B 3BFJA 3C3KA 4NPAA 1QMPA 5DCYA 2PE5A 4KE6A 1RWKA 4Q02A 3ONNA 1Z36A 3C0KA 4BN5A 4DR4B 2J0VA 1EWVA 4NBRA 4A7PA 2HW8A 4GHWA 2OVBA 1QYWA 4ZZIA 4DB2A 1BE8A 1M0WA 1I3KA 2VSNA 4IGIA 2XVXA 5IBRA 4ILEA 4IQGA 4S0ZA 5GJVC 1EE9A 5I5EA 1GDTA 3GRVA 1Q0RA 1A8HA 1JFLA 1WSWA 2FN4A 2IF2A 3FD8A 1AU9A 2O2DA 2PJZA 2IX3A 3KKKA 4Z9FA 2SCUB 3I2HA 4MO9A 1F48A 3MRSA 4MP8A 1QG0A 2Q6LA 5HA5A 2WVAA 3ZQJA 1RXCA 3LLUA 2I6GA 4MR7B 2LUOA 1ISPA 2DQSA 1B3RA 4C7BA 4NFSA 2NXNA 2QXYA 1M1UA 3N8IA 1FUKA 2Z30A 4WPGA 4TL8A 3WGZA 5HZHA 4WLOA 1V43A 1U7HA 3IAUA 4OXXA 5EEGA 4BWYA 2OXRA 5MDHA 3LECA 3E2PA 2SECE 1KFCB 2BN4A 1KA9H 3UMMA 1XP5A 3KZOA 4Y67A 3A31A 5LNK6 3DQQA 2BHSA 3NBKA 4TTAA 3FSRA 3L7OA 4N8DA 3EQ8A 3MPUA 3NDRA 3A3PA 1Z4JA 3KFVA 3R7LA 4Q03A 4OHCA 4ZVMA 1Q11A 2KB0A 3CBGA 3FVWA 4NV0A 3U80A 4W5NA 2WJZB 1G60A 1H23A 1XHEA 3GFSA 4GWGA 5LIPA 1Q22A 2P5UA 3CNEA 4PO8A 4OQEA 3RBAA 4ZYYA 3F96A 3MJTA 5IKMA 4L27A 2J45A 4IXTA 1RXIA 2H11A 4B2PA 4RPJA 3U7RA 5AVRA 2ERCA 1TU0A 2C2BA 1EEXB 1YA6A 5JFOA 1RT9A 1N6LA 2MSKA 3V97A 3ZWVA 1WVGA 3HM9A 1GGVA 1RKVA 3M9XA 3VR4H 4U3JB 1Q0PA 4WASA 1BN6A 2JLBA 2LWIA 3R0XA 4JVMA 5HILA 3VDRA 3INGA 4C2AA 2ECQA 2YBDA 4P53A 5KKNB 2QRVB 4GMFA 1I6LA 4FHGA 5JBQA 1EGVB 3KALA 1TQDA 4CG1A 1NG9A 1J7KA 2OKGA 4XLTA 2ORWA 5T4HA 5GV7A 3AIIA 1Z2PX 2P5YA 3PC8A 3U3XA 1X3SA 4PR0A 1TVCA 1M8FA 4RWZA 2DBVO 5JNWA 1V0JA 1HYBA 3A4YA 5ENDA 2NZUG 3TOCA 1YR2A 5EMHA 3ZLUA 4N03A 3KEQA 2FI1A 1BCRB 5J5AA 3RREA 3MJVA 2J9FB 2AVNA 4EQ6A 5DXFA 2FLWA 2FGJA 3LW7A 3O95A 5AICA 1NN0A 1DTEA 1Z83A 3KQWA 3OE7A 3UXYA 4NOLA 3VC3A 1YQTA 3AFHA 1Q19A 1QGOA 1UMCA 2UVPA 3EGVA 1I3LA 2AJCA 4RPLA 1ZSNA 5E7JA 1CZOA 4YUVA 3ILXA 2QJOA 3L77A 3KHSA 2BCJQ 2PD3A 1ULBA 1F2UB 4CKCA 1E0AA 1PQWA 1EBBA 1L5RA 2B83A 2BF7A 4M1SA 1HFEL 2NYVA 3ICOA 2B0JA 1PG2A 1E92A 4UZSA 7MHTA 5K0BA 2QROA 3LPLA 3CVXA 4MVJP 3KQLA 1L2TA 4D02A 1WBBA 2H16A 3O9ZA 1IJFA 4ZVUA 1WQ1R 2HRZA 2IYWA 1RAIA 5FTLA 5ADWA 1OWMA 2M6LA 5DBFA 1JLMA 1SJ9A 4ER3A 2D2IA 3IAHA 4EHJA 4CM7A 2DBZA 3OP1A 1B0PA 4A10A 2DZDA 5BSEA 2JC3A 2C3YA 3G8DA 1HDIA 2FPGA 3KPYA 4GI1A 4UHEA 1P0MA 4GUDA 1I7PA 1KZYC 3PXCX 4DDTA 1RLOA 3I9LA 4EW2A 3FOZA 1PJRA 2VNHA 2YV5A 2OV2A 1U2TA 3EHEA 2POCA 4CQLA 4OIFA 2WYWA 2WHXA 1XZDA 4GLBA 4WOKA 4FWTA 1B8NA 4E33A 3KVYA 1SVNA 1X1EA 4D1YA 1YOVB 3P2MA 2J0UA 3G5AA 3OFNA 4OKIA 3ORQA 3UYLA 4Z2AA 1B2RA 3KDPA 1QIJA 1EFHA 4AM8A 5EKUA 3K1JA 2XVYA 3LD9A 2HA0A 3ZZNA 3FMIA 3SHFA 4NS4A 1VI6A 2WIKA 1R8XA 4LDRA 4CKBA 1XIVA 1FEZA 1AQUA 1ZU4A 3OX2A 4AIIA 3SF8A 5ECGC 1L5WA 3DT6A 2W2LD 4U2KA 1R37A 1JIKA 4H08A 3TXYA 2A7XA 1NL3A 3MUFA 4LNUA 2WFLB 3CH4B 4OQXA 2ODTX 2MOKA 2PUBA 2WSBA 1I3CA 4BTEA 1OCEA 2PMFA 3GMTA 2JLAA 3S2YA 4HTFA 5BNWA 1JN0A 4PSUA 1M8KA 2RHWA 3QA3E 3T5PA 4KYTA 2XUOA 1XPOA 4JASB 3O8LA 4MVJH 1USKA 5FPQA 2WNSA 2WWXA 3B85A 1VJGA 2FEOA 3G2JA 1OC2A 1GCUA 1YDMA 4DXAA 4OLFA 2QQ0A 5IW8A 5D1HA 1DO8A 4XM2A 3SHTA 4OHFA 4BAUA 1IAVA 2WJGA 1KETA 3L9XA 2XQKA 3DZKA 4WK0B 3P45A 1ZEJA 5IM4F 2FY8A 1UZAA 2NLOA 2D1SA 1JWLA 1HYEA 3JALB 1BKYA 1GGMA 3PGXA 4Z9AA 1E2KA 1TZCA 1UFQA 1W48A 1Q3TA 4KMRA 4NENB 5KAPA 3DC2A 3JR3A 3F9RA 2XMSA 1CCWA 4LTMA 3R5FA 7REQA 3RSOA 2GM3A 3P71T 2J41A 5FEUA 1ZXXA 2W48A 2PXAA 5JWHA 2X0KA 3ZDDA 4JBGA 3NBZC 4LCJA 4ONEA 1P7YA 3LYHA 4QBFA 3RYHB 4EG3A 1H9AA 1II9A 2R11A 5DNVA 1OT3A 2I99A 4JHLA 3H2JA 3BE6A