4C3HG

Structure of 14-subunit rna polymerase i at 3.27 a resolution, crystal form c2-93
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
309
structure length
259
Chain Sequence
NENRETARFIKKHKKQVTNPIDEKNGTSNCIVRVPIALYVSLAPMYLENPLQGVMKQHLNPLVMKYNNKVGGVVLGYEGLKILDADPLDTSEKLIKITPDTPFGFTWCHVNLYVWQPQVGDVLEGYIFIQSASHIGLLIHDAFNASIKKNNIPVDWTFVHNDVELGHWVDSNGEPIDGKLRFTVRNVHTTGRVVSVDGTLISYNSSRSQAESLPIVSNKKIVFDDEVSIENKESHKELDLPEVKEDNGSEIVYEENTSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-DIRECTED RNA POLYMERASE I SUBUNIT RPA190
publication title Crystal Structure of the 14-Subunit RNA Polymerase I
pubmed doi rcsb
molecule tags Transcription
total genus 37
structure length 259
sequence length 309
ec nomenclature
pdb deposition date 2013-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF03876 SHS2_Rpb7-N SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397
G PF17875 RPA43_OB RPA43 OB domain in RNA Pol I
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.1060 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4c3hG02
4C3HG 4C3JG 4C3IG
chains in the Genus database with same CATH superfamily
2VQFL 2O5JC 1LO5D 1C8CA 3U9OA 3QG1A 2PMZE 4CHTB 3AMUA 4DV5Q 1KXLA 5BN5A 2XWBB 1K83H 1ILQA 1I4QA 2QW7A 2ZXOA 5M5WB 4IUQA 1EOTA 2F3WA 1Q81C 4LF5L 1QOHA 3D4RA 4CJ0B 3CD6A 1PTOD 4PMWA 4G7HC 1SYEA 2JQOA 2I46A 1EY7A 1WYDA 1GUWA 1YEZA 4LFAQ 2PPBC 1B8AA 3KLSA 4X3TA 4OX9Q 3HKZG 4OELB 2B29A 3CC2A 2Z6BA 1JE5A 2V4DA 3LGJA 1PVOA 2WIIB 1GHJA 4UDUC 2L55A 1TWCH 1RD9D 1D1KA 5I2YA 3G6EA 2LXJA 4ZYSA 1DCZA 1KD1C 1TVXA 5LMUL 4IZ8A 1GHKA 3VR3A 4GLAC 1TWFB 3SHLA 3S1MB 4XYOA 3K0YA 2EXZA 3Q8DA 3KBGA 2Q8TA 1KC8C 3H15A 1HFNA 1STNA 1WCMH 4C2MH 1L1OC 1B9MA 3F2UA 4TVAB 1HZ9A 2HD3A 1ESRA 2F4IA 1Y1WH 1B4OA 2A69D 3BVGA 4CDEC 3D4DA 1WTXA 3A7LA 4UPAA 5CYUA 4OL7A 2OQ0A 5C3EG 2NVTH 2N49A 4GN3B 3QIAA 4WJWA 4OHJA 1GKHA 4C1NI 2DJGC 4DA2A 4QF4A 3GTQH 2VXWA 3H94A 4AYBB 1FJGL 3FVQA 3W2DA 2R7ZH 1I50B 4RGNA 2RVLA 3PMFA 5A2QL 1PFSA 1XNQL 3SK5A 1EYGA 2Q8RE 5K36G 4HEDA 4LFBL 1S3OA 1HQRD 1HCZA 2WINB 2H5XA 2WB1E 2IPKD 4QUCA 5T1IA 3J81i 1DM0B 3AU7A 3NXWA 2OTJA 2CW0C 5EPKA 3LX0A 4ALPA 3H0GG 3DMUA 2K1BA 2E75C 4NMZA 4Z9CB 3G48A 5I6WA 1YJNA 2Y0SB 1PFMA 5ELCA 1QCBD 1I4PA 2B2YA 4DK0A 1Z6HA 2N78A 3VYSA 4R1JA 5C5MA 1BBWA 1IKLA 2WACA 1AE3A 3I91A 4DR4L 4A3FH 3CAMA 3HOWG 3OWFA 2EXDA 3WOFA 2VQEL 2B39A 1JJ2A 5IOCA 2F0UA 1GVPA 1IBML 5CC4A 4A3BH 1A6XA 4HSVA 2F0GA 2VB3X 1QZHA 1LTID 1JJGA 1LLRD 3D4WA 2F4VL 4GKJL 1MBYA 2IX3A 1SDFA 1WVLA 2PW5A 4FP5D 1HNXL 1D7QA 1QUQB 3QR8A 3K7AB 4BBRG 4DR5L 5EJWA 2KCNA 1VQ6A 3BYTB 3C2PA 1AN8A 2CH4A 2PQAB 2MFIA 1ICWA 3J80E 3OPOA 4RHRA 1BCPD 5KNCA 2ZXPA 2MNAA 2OXPA 4LK1C 2WKDA 1Y1VG 3P1HA 3PO2H 5E3FA 2ZTEA 2R93H 3MEFA 1U4PA 2NVYB 3JAME 2QILA 5C4XB 1PZKD 4K5WA 2ZTCA 5M5XH 2WKCA 5M3MB 2CKZB 1TR5A 2PCFB 4G4KA 4DUZQ 2B2TC 5IWAL 5IYCH 4JI7L 1EWHA 3PO3B 3WOEA 4A3JB 2X69A 3S2DH 5DLQE 3BJUA 3W1BA 5J39A 1W6KA 2FFKB 1GUNA 1HTPA 1YHBA 4DR1L 2JJQA 2K28A 3IRBA 5BR8Q 2UUAQ 1DZ1A 1SYFA 2E76C 2EE1A 5IYDH 1C9OA 3UDGA 2J4XA 2XIWA 4I65A 3S1QH 4Q0FA 4FF4A 1LV9A 1CTMA 2HHHQ 2D62A 4WFN3 4ID6A 3VYUA 4JI0L 3TBIB 1HNWL 1BXTA 3E9HA 2YTYA 4X65Q 3I4MB 1FYCA 5IGCA 4ILWA 1OXTA 1C4QA 2F1MA 4JG2A 4DV1Q 4JW0A 3FEWX 1J5EQ 4X66L 1XMOQ 1I4HA 2VW9A 3Q24A 1EIHA 2K5QA 4QCLA 2E2JB 2PQAA 3RLFA 4EVOA 2R7ZG 4LF6Q 1S5BD 1HA5A 3DM3A 1B3AA 4S3SA 1N32L 1EIGA 2A19A 4DK3C 2F0WA 3VR5A 5FKAC 1G2TA 5D14A 4CGYB 3BDOA 3SDZA 1TY2A 1PH7A 2R3ZA 3PUXA 4RGTA 1JCKB 1SJHD 1TWAB 3NEMA 3CRKC 1L0YB 4F7XA 1JWMD 2PNRC 1N36Q 5CBEE 1STYA 3A8JE 3EJIA 3VA5A 2XRQD 4A3KB 4A3EG 1EQQA 3EROA 3A74A 1A3TA 4DAMA 1W6JA 4IALA 3D6WA 5JEAG 3J80L 1G91A 2ZTDA 4A3LG 3J7AV 4DV6L 1TS5A 4TQUS 1XPUA 2BCOA 3EIVA 1KIXA 1Q12A 4DR3L 1K28A 2NZ1D 5C44B 1HZAA 2ATWA 4JI1Q 2F0HA 4JVZA 1VQNA 2JA8H 3A8KE 3HS0C 3B6YA 3I8ZA 3JAML 3BVMA 3SEBA 2CW0D 1B9NA 3E0EA 3U4VA 1HR0Q 5CV7A 2UU9Q 4C3IB 5C3WA 4J15A 3P7JA 5C4ZA 1BCPF 1FGUA 2A1AA 1YHQA 4KKSA 1U0LA 1TKWB 3STBC 4P74A 3U9SA 1K0SA 1SFOB 5C3XA 4YY3L 2F0TA 3CW2C 1I6VC 3KUPA 3PV0A 4TKOB 4MTNA 3TZUA 3MEHA 2A68D 4EGVA 3DEOA 2BDOA 2NYZD 2IHFA 4JBWA 3E3XA 3EA6A 2O5IC 3EN2A 3UE0A 3RLOA 2RBMA 1HA6A 4BXXG 2VUMH 2UUCL 2YTVA 5DEHA 4C3JB 4B3RQ 1SNMA 2EPBA 4B3SL 2L11A 5C0XH 4FDBA 5GQOA 3HKSA 3S1NB 3M4YA 2AQ1B 1KRSA 3URYA 4AYBE 1FNVA 3ITPA 1U5KA 1EEID 1JJCB 4GZYC 1I94Q 1XMQL 1KNAA 2MP1A 4F87A 1ESFA 2B2UA 2H4OA 3K6OA 4IURA 3R8BA 4EX5A 2VB2X 3OW2A 3I7FA 3J7ZC 1S40A 3GTJB 5I9PA 2JP1A 2L1BA 3VR2A 3K7UC 1PH2A 1G291 3HG9A 3NPPA 2GVBA 4X62Q 1LTAD 4BY1B 2A6EC 2ICEC 1KAWA 1H9KA 2JA9A 5C5LA 3OMCA 2CWAA 1CA5A 1L2FA 1EL0A 2CWPA 1HNZL 3ERQA 1MD2D 1UAPA 1BDOA 4HJ5A 3PCOB 2K03A 5AFWA 1LTBD 3R93A 3SK8A 1ILPA 2RSOA 1I6HB 3QWNA 3TQYA 1AFPA 2R7DA 2QKIC 3KLRA 3TZDA 1YNJD 2ALYB 5KNDA 2EVBA 1WD1A 1EEFD 1EIFA 1QWYA 4K5VA 2YU9H 1L0XB 3MFGA 3FRPB 1K8GA 3S15H 3GQBA 4MIUA 3T1YQ 1CI3M 3AEVA 1J6QA 4H0LC 3KDFB 1CSPA 4YHHL 1FD7D 4L5SA 4DV2Q 4K6LA 1PH4A 1M90C 5JJKA 2KOLA 4IUUA 1FR3A 4KN7C 1PV4A 1E1OA 3J81j 1AE2A 3PIPA 2A8VA 1BBXC 3PQIA 1VQLA 3SVMA 1ZYRC 4AYBG 4DNIA 1RL2A 4ZUIA 5KYLA 1HQMC 3AYHB 4JC0A 4DK1A 1UE5A 4J6HA 5LMNL 2KUMA 1WOCA 1NR4A 1JWUD 3IFTA 1E7ZA 4LF4Q 2FMCA 3UDIA 4B9WA 3J80c 1S5FD 3MXPA 1MGSA 4IPGA 4M1UB 4V0BA 4RHSA 4JI6L 4NXMQ 2BE5C 1NTGA 1LACA 3OTOL 4GKKL 4I7AA 4FYDA 5C6AA 4K8JA 3RZOB 2K14A 3GTOH 1ET6A 1TWAH 4Y7NB 4DV4Q 2XN9C 2Y0SG 5ELFA 1XPRA 3JAMc 4IUNA 3HOUB 5C3EH 3U58A 2CQOA 4LMQD 2B63B 4ZKCB 1VQJA 2NB0A 3I2ZA 4BY7B 2SNMA 1F9RA 4QY7A 5CV6A 3H6MA 5CV4A 5IGGA 4B3TQ 1UEBA 4TRDA 3KLWA 3L7ZC 4K0KL 1PH8A 5DNFA 2VY3A 4KK7A 1MKHA 2MGSA 1WTQA 1L0WA 3PIP3 2K32A 1WFQA 2EYLA 2EYMA 3RN2A 3J7A5 5K36H 1IBKQ 1D6EC 4OO1I 2DNCA 2K05A 3G7LA 3NUCA 1GJXA 2SOBA 1V1PB 3WDNA 1EOVA 1PFBA 2F0DA 2OQKA 1BR9A 5G3LD 2XNAC 1N8RC 5C4JH 4XDXA 3HOXB 4DAPA 4MN3A 3H0GH 4DR2L 5M5YH 2SDFA 5CORA 2M9VA 5JVG3 2ES2A 5C0XJ 1KRTA 4L5TA 1DD2A 4GNXB 5TSSA 3RZDH 1K3RA 2NVXH 2UXBL 1VS0A 1UE7A 1EY0A 3PIO3 1FNUA 4KKTA 2VUMG 3KK7A 4I7ZC 3VYRA 5LHY1 2AMCB 5JAVA 3HOYB 2SEBD 4YIJA 2K01A 1ZEQX 3K5OA 4IFDI 1TWGH 2ICIA 3S16H 4LF7Q 4GN4B 3HOZB 1IYJB 5C4XG 3CCQA 4IOAA 3GO5A 5EKLA 5CGKA 3K81C 5M3MG 1TWHH 1F9QA 2EJMA 1JT8A 1SE8A 4TSSA 3ER0A 2FJ2A 2DNEA 3BZKA 5E1FA 1V8QA 5AJ3Q 4JOIC 5CV9A 3PO3G 3Q6SA 4BBRH 4DV0L 4A3JG 2IX1A 3MWYW 4DAVA 3BYYB 1WTVA 3CCJA 3LNNA 4KN4C 1RIPA 4HIOA 3CCEA 3H09A 3PSIA 3VR6A 3AB9A 4YCWA 5IGFA 5KIXA 1VQ8A 4UHVA 1Y1VH 3NSWA 4PMCA 2UXDL 1SRUA 1PH6A 2N8NA 4OO1G 1J8IA 2AQ3B 5ELBA 4EQPA 2PI2E 5F2DA 4YWMA 3ONAB 2KCCA 2R7FA 5BN4A 4DV7L 4BY1H 3DHQA 4DV3L 4NP5A 1STEA 3H91A 1IBLL 3A0JA 3KF6B 4DFAA 1CQVA 3GD7A 3I3CA 3I4MG 1Q1BA 2LKVA 1VQMA 3IKJA 3MFYA 2BA1A 5IYBG 2Q2UA 4UP8A 1V1PA 2A6ED 2WV6D 4IFDG 1PRTC 2MQHA 3K0XA 4J8QA 3H3VH 1JB7A 1A2TA 1SR3A 5IT9E 3V05A 4GNXA 1I3QH 1O7YA 3MTSA 5KNBA 4P73A 4QGUA 2NZOA 3S17B 5CV5A 1VQ9A 1J9OA 3FPUB 4DN4M 3R3OA 3G4SA 2F0IA 3L0OA 1OXVA 4LFCL 4ME5A 2C35B 4RH6A 3E6ZX 1BCPB 1ENFA 4KHPQ 2JE6I 2EYFA 4Y52H 1PLFA 4UP9A 4XTCS 2O2LD 4A3KG 1XX8A 3NTHA 4IOCA 2XGTA 1ENCA 3TSSA 5ISRA 5KRUA 1RF2D 1AP0A 3T53B 4C56C 2EY1A 2VNUD 1CSQA 1HFGA 1D5XC 3NELA 2NWGA 3CMEA 1K8AC 1CKMA 5C44G 2UUBQ 3S14B 4OXPA 1IZ6A 4F8MA 2I5HA 2CCZA 2F0VA 1BUVT 5E7NA 2BE5D 1EWCA 3OIPA 2F0LA 4AQYL 2RCFA 4LUVA 3U4ZA 4FO2A 3V96A 3MAQA 5G3LF 4QMGA 4HCSA 1SYCA 4C3IG 1XTDA 3KF6A 1HUMA 3NK9A 2JA7B 1YI2A 2E5LL 3HEJA 1PTOH 1STBA 4K5XA 4A3EH 3D0FA 5IODA 3OWEB 1X55A 1YVCA 5JEAH 1KAAA 3UDFA 4KY5A 3H3VI 2A74C 4A3LH 2EYJA 3FP9A 4BS9A 3HOXH 2N55A 4WJ3M 1PH9A 2ZM6Q 4ZKBB 4LUOA 1CZGA 4X64Q 1CKOA 2IX0A 5FO9B 4LF8L 3VYTA 1R9TB 3S2HB 3DEPA 1T9HA 4JYAL 2UXCL 2SNSA 1EQRA 4HN7A 4RCNA 2ZJRA 3Q22A 3R2TA 3DWQA 2EY2A 4IJHA 4O2DA 4R8NA 1LTGD 3OSOA 1AEXA 2EOTA 3HOVB 2D2CC 4KD3A 5E4XA 1O80A 4C1NK 3EFXD 1K8OA 1CHQD 4KHVA 1CHPD 1V1OA 1YNND 3RUZA 1NY4A 3I4LA 3KLSX 4P2CB 3Q0AA 2D5DA 2GN5A 1KHIA 1M4VA 2PYKA 1ZXTA 4DUYQ 1GUSA 1EY9A 1TXYA 3NWTA 3F2BA 3TRZA 1L1OB 4BY1G 5IT9L 1U4LA 3I72A 5EGTA 1EIYB 4A3IB 3IL8A 3S1RB 4LF9Q 1IHZA 1E2ZA 1GUTA 2NVQB 1V43A 5LMNW 2R92B 1OXUA 4BXXH 3J81E 4DR6Q 1SNQA 4B08A 1D1IA 2B2WC 3CRLC 1YBYA 2RDHA 1VQ4A 1CUKA 2J0TD 1DJRD 2TSSA 4HIDA 3A55A 2DY7A 4JI2Q 5ELOA 2EDGA 3FKIB 3TN2A 4JI5Q 4APVA 3E0JA 4JI3Q 3BVZA 1LT5D 1X65A 1XNRQ 1IW7C 4R4OA 3CF5A 4QQBX 5M5WH 1FGBD 3A5ZB 1ZKOA 5HGQA 2F0MA 4A93B 4DF7A 1YZ6A 1OXSC 1DOMA 4JI8L 1XWEA 1IL2A 2K5DA 1EYAA 4IUTA 3M3YB 5FO8B 2B2VC 2OTLA 3SGIA 4CJ2C 2KECA 3OYYA 4O42A 1Y8NB 2ASBA 1NR2A 1N33Q 3D6CA 1M1KC 3OHXC 4J1MA 2JK8A 5IP7G 1B50A 1SN8A 4X3KA 4PG3A 4GOPC 4FVMA 1F2LA 4JK1C 1PRTD 4R4TA 4DV5L 3D3RA 2ZJPA 4NB3A 3EVQA 3KBXA 1TWFH 1S5CD 3S1MH 2HIXA 4K6DA 4GN5A 4B3MQ 1E22A 1Q46A 1GUGA 4L8JA 2OCEA 4BBSB 2A6HC 1JC7A 4ZQ3A 5IGDA 4LFAL 4PMBA 1KABA 5H1SE 1SROA 1VQOA 3GV3A 4OX9L 1K9MC 1AW7A 2ZXRA 3HOUG 2A5HA 1O7ZA 1NAPA 2N88A 3HKZB 2B63G 1WTOA 4KKUA 3SK4A 4C3HB 3N6RA 4BY7G 2OWOA 1SMYC 2KENA 2G9HD 2MO0A 3C1EA 3TEHB 4FXDA 1L1OA 2LXKA 1LTLA 4RAUC 1N34Q 2XSCA 1I50H 3ULLA 1SJED 3VR4A 2F0KA 1SBBB 2VS1A 1B7YB 3T1HQ 1LABA 3G6JB 1K8MA 3HGBA 3AFPA 4K8IA 4A75A 5BN3A 4RGOS 5M9OA 2YTXA 4P75A 1KLUD 3HOXG 5IGEA 5GAGC 5IIFA 4A3MB 1IL8A 1JOQA 5ELEA 4CDCC 4DR7Q 3UE1A 3FDTA 1QVCA 2D0OA 3PF4A 1NCVA 1STAA 1VQBA 4DGZA 3HOYG 3OIQA 5EKIA 4JI4Q 1SNCA 4NKLA 2OF1A 3NP8A 2F3VA 3H3VC 5KEEA 2PMZB 2L12A 3I90A 5D65A 1KL9A 1LYLA 4PZ8A 2RHSB 4NXNQ 2KEDA 2I5MX 1SEBD 3CQZB 3MA2B 3J81L 2IL8A 4MHEA 4A3GB 3M4QA 1FVIA 3GTKB 1SYGA 1AZPA 4QIWB 3CKIB 5EAYA 4KY6A 1X32A 3K7AH 5IT9c 2WFWA 1HH2P 1I5FA 1JQYD 4JV5Q 3CCUA 1HTLD 4A4IA 1O7LA 3KFUA 2F0SA 3TDQA 3GTLB 1RKNA 3DWPA 3C46A 3K57A 2L9HA 1EY5A 3HOWB 2HQLA 5FLMG 1UNSA 2AUJD 3MZ5A 1B1ZA 2BH8A 2CFMA 2NVYH 1PH3A 1EZ6A 5C4XH 1EU3A 2VQFQ 4ODGA 4XT3B 3CCMA 5M3MH 3GTMB 1I4XA 3M4OB 1X56A 5GADC 3PO3H 3R2IA 4LF5Q 1PXUA 4A3JH 2L4NA 4WORA 1UEAB 1KTKA 3W5OA 1LTTD 3A7AB 5M3FB 2NBFA 1Q7YC 1QZGA 2HDMA 2XTIA 1ICFB 4L5RC 4CBVA 4KMUC 2R6GA 1Q90A 2Y0SE 1Y69U 2B2TA 2PW7A 4CKEA 2ENBA 1QILA 3BDCA 1EY4A 3X3NA 1WJJA 1PTOC 3BS1A 2JA6B 3KJPA 5JJIA 2WB1B 1HUNA 4OO1H 1EY8A 2CQAA 1PRTF 3I4OA 5LMUQ 3E5SA 4DUZL 1JB3A 1Z7TA 1K83B 2QF7A 1H9JA 3DUZA 4EQNA 1Z9FA 1CA6A 3TREA 2F0EA 2V1CC 2F3IA 4NW2A 3I4MH 1VQCA 5IYBH 3QO2A 2N3SA 1R4PB 2F0FA 5I9OA 2KVMA 4IFDH 5BR8L 4GLXA 2UUAL 3MC0B 2E2JH 2C5CA 4HR7B 1Q82C 1BBUA 1TQOA 4DK6C 2B3GA 4NPSA 3UI2A 1TWCB 1KDBA 3W3AA 1P16A 1VMPA 1K3BC 1FJGQ 4BBSH 4H7BA 3C3LA 4KY7A 1LUZA 1XNQQ 3D31A 4GOPA 2HHHL 2NN6I 1EQTA 4MNOA 5GAEC 4ULLA 5J22A 5EBCA 1TT2A 3D8GA 4IQZA 5A35A 4LFBQ 1WCMB 4G7OC 4X6AH 1CK1A 3PIOA 1ONLA 1QG7A 1Y1WB 4X65L 1BOSA 2LSSA 2A6HD 2F52A 1AH9A 4FXGC 4DV1L 2JEAI 3I55A 2NVTB 1J5EL 1XMOL 3MXNB 3FPPA 4Q5VA 2K33A 1WTHA 2MO1A 3NHHA 2JA7G 4FF3A 4IUVA 4YWLA 1KLGD 3PGZA 5IY0A 3CCRA 4A3KH 4LF6L 1SMYD 3GTQB 3F8TA 4ZAIA 2R7ZB 4DR4Q 2D0PA 3J81c 4OIJA 2RA4A 2I0QA 1PYSB 2VQEQ 1ET9A 1U9RA 4DAYB 1A3UA 1NMFA 2C9OA 1IBMQ 2B2YC 1HHVA 1KDAA 3NTKA 5C44H 4JBKA 5HGTA 2NZHA 2F4VQ 1VQ7A 4GKJQ 1JE4A 3CCVA 1EFID 3SR1A 4POFA 3NBHB 2JA5B 2E2DC 1HNXQ 1WD0A 4RGMA 2Q2TA 1D2BA 2CVRA 3MHBA 4DR5Q 4IUPA 2XVSA 5HURA 1N36L 3A54A 4C3IH 2KHSA 3GTGB 2QDBA 4BWGB 3HOVG 3NWSA 1LT3D 3EBEA 1X3FA 1EFWA 4DU9A 4A3FB 1SFOH 4MTKA 1MI2A 1X3QA 3L3OC 2NN6G 1CT1D 3DLLA 1DGSA 2J7ZA 4A3BB 3OMGA 3OW7A 1F9PA 4JI1L 1VQFA 4CDDC 5DAUA 1E0BA 1PH1A 3STBD 5FJ8G 4A3IG 5A2QE 4OWXB 4CKCA 4XQNA 1PHJA 2R92G 1QVFA 2BA0A 2WAQB 2RCNA 4K2LA 1HR0L 5IWAQ 4JI7Q 3T16A 2GA4B 1A63A 2UU9L 4C3JH 4G7ZC 1SXTA 4M8AA 4KTAA 3CC4A 3BZCA 3U50C 3S1NH 4MZ9A 4DR1Q 3FKIG 5JPNC 1IYUA 3PO2B 3VA7A 4HJAA 1Q8IA 2R93B 1RTNA 5FOBB 1MJCA 2KHJA 3MXNA 2B8FA 4WRDA 2Q2HA 5NUCA 1Q86C 4HMIA 1ASZA 1OO9B 3PUWA 3GTJH 4A93G 5IP9G 5FK9C 4PNYA 4CKBA 1EYDA 2DUDA 5M5XB 1W3SA 3TP8A 2RHQB 4JBJA 2BDNA 4R4CA 4KV6A 1VQDA 4IFDJ 1X3PA 4KI0A 1SMXA 3T51B 1TS3A 4DAYA 4KD4A 5C4HA 1YJWA 1STGA 1V9PA 1VQGA 4B3RL 3EQLC 1JR0D 4JI0Q 1HNWQ 1XYIA 2RKSA 5CMDA 1YIJA 3NBHA 1I6HH 3M9BA 1BKBA 5J1ZA 2KCMA 4R4QA 1I94L 4X66Q 4UP7A 1QE6A 1II3A 4JBMA 2OT2A 3K5LA 1BF4A 1C0AA 1D8LA 2E74C 1JOOA 1B2TA 4BBSG 3ZYYX 2LY7A 2EQSA 5IGBA 3GTPB 3S1QB 2MPMA 1S72A 1VMCA 4X62L 1A15A 2Z4IA 4QIWE 1RJTA 3VDYA 1N32Q 5I4DA 1EUJA 2QGQA 1YJ9A 4IJLA 1GUOA 4C3HG 1EQVA 1RODA 2M2LA 5CR3A 1CFMA 1S5ED 5EPJA 4G57A 4GLVB 3X3MA 4RMFA 4YCVA 3K5MA 2OEOA 2Q8IB 2LS01 1PH5A 2Z6KC 5IP7H 4HIMA 1NMGA 3KF8B 1CZWA 4A3DB 4KHZA 1CKNA 5EQ0A 3UDXA 2AKWB 4P72A 1X9NA 3F1ZA 3I73A 1ZYRD 3T4AC 3T1YL 4QJFA 1FL0A 5LL6S 3RZOH 1MIUA 4OWWB 1MHWC 3J80i 1TU2B 3RLNA 4OGQC 4DV2L 4DV6Q 4Y7NH 3QOLA 4XIGS 3RMHA 4A3MG 1G8ZD 3TMEA 3AFQA 1UE6A 4QL5A 3QOJA 4GS3A 5FLXE 1U4RA 4DR3Q 3I4NB 3HOUH 2JYOA 1C48A 3HZXA 4N8X1 2B63H 1ASYA 1X54A 1GO3E 3K80C 1IYVA 4BY7H 1DOLA 2EY5A 3BZDB 4X3UA 1KQSA 3JAMi 1Q8KA 5COYA 4LF4L 2DGYA 1CQFA 1MJEA 3WWVA 1PYWD 1C7YA 2K5WA 1W2BA 2HQEA 4DKAC 2K6AA 2K4KA 3ZJYC 4NXML 1AZQA 1U4MA 1A3VA 4A3GG 2BOSA 1BNZA 1XTCD 2AHOB 2JA5H 4YY3Q 4DV4L 4HAEA 5CV8A 4HJ9A 4RKLA 4A3CH 1X6OA 5GAHC 1SNOA 2JA8B 4HMJA 3GTGH 2R61A 2HUGA 2IHEA 4O1NA 1R4QB 4PZ6A 4B3TL 4FF1A 1A2UA 3HOYH 1PRTB 1Y14B 4C3JG 2UUCQ 3DWAA 4L5QA 2A68C 4H02A 1UWVA 2RDFA 1PYBA 1SNDA 5JOBA 1VQ5A 3HOZH 5IE8A 3A5UA 4B3SQ 4U673 1JOKA 5EBDA 1IBKL 1GXDC 4RWSC 1SLJA 2KHIA 4QB4A 4BA1I 3IAYA 1XMQQ 3KF8A 5T1GA 1SSOA 2CHBD 4R8IA 2EJFC 1XXGA 3F2CA 1WTPA 5M3FG 2RF4A 2KBNA 2G9DA 2IY5B 4HTHA 5HY6A 4HIKA 4EQOA 2Z0SA 2VUMB 1VQPA 2B2UC 2PNHA 3NQIA 4N8FA 4OWTB 4OONA 4JOIA 1HNZQ 3ND8A 4LF7L 1IKMA 1CM9A 3P75A 3W1GA 2JA6G 1E2VA 3MXGA 5FLMH 3PF5A 2WB1G 4A76A 2K7VA 4KJOA 5DM63 5I2XA 4JPBW 5AJ3L 4HCEA 3FHWA 1Z47A 3KOJA 1Y8PB 1YITA 3CCLA 2HT1A 2DY8A 2PQEA 1PTOF 1TS2A 2JSOA 3RD4A 3BDLA 4RFBA 3GDEA 4DNTB 3GP7A 2CH4W 3LWEA 2O4XA 3HP3A 4YHHQ 1PA6A 3BU2A 3NENA 1PZJD 1YNJC 3RR5A 1E3PA 3CU7A 1DONA 4ZRZA 2E2HB 3ERSX 3FMCA 5FLXL 1LTSD 3QJYA 3GTPH 5LMNQ 1X3EA 1VQKA 5GROA 3K5NA 3S17H 3KJOA 2PZWA 3T56B 4XXEA 5FO7B 4ZLTF 3NTIA 1QB5D 4JI6Q 1WCMG 2YU9B 4PQXA 1JORA 1OXXK 3OTOQ 3S15B 4GKKQ 1Y1WG 1IXRA 5CBAE 4PZ7A 4AH6A 2EYOA 1N9WA 4XQQA 1QUQA 2AUKA 2ID0A 2WAQE 4POGA 1KDCA 1NJIC 1RHPA 4A3DH 4QUFA 2K5VA 2MJ8A 1QJOA 4DPGA 5JVH3 4WJ4A 4IN3A 1TY0A 5JEAJ 1K73C 3NBIA 4DXFA 1LM0A 1EYCA 4ZUJA 2WP8J 4CDFC 4K0KQ 1VF5C 2Z6KA 3S14H 5ELDA 2I5LX 5JPMC 2EIFA 2ZT9C 4PV1C 3I4NH 1HR0W 4YWKA 2VZAA 3ULPA 2JA5G 2L15A 3IFDA 2Z1CA 4K14A 2XWJB 4KHPL 3GTOB 1G6PA 2A73B 2PZTA 2MUYA 3AQQA 3SK6A 2Z8LA 1WTWA 4A3CG 2F0OA 4DR2Q 1GOZA 5C3EB 1NE3A 1Q3LA 2QEJC 1NUCA 2X6LA 2YYZA 2UXBQ 2IT1A 2JA7H 1SYBA 4XYQA 4LUZA 4A3FG 3K59A 5LL6X 1MSGA 3BG3A 4XT1B 3M7GA 1UUPA 4L6TB 3HOZG 2UUBL 4A3BG 4H44C 4FF2A 2E2IB 2NUCA 1K0RA 2KQ3A 3I56A 1R9TH 4IPDA 3S2HH 1GM5A 1B53A 4CJ1B 4RCOA 2WAQG 2F0PA 5JJZA 2G5DA 5C4JB 2B8GA 3H0GB 3I70A 5M5YB 4DV0Q 1EY6A 2K75A 3A56A 3RZDB 2NVXB 1VCIA 2F0NA 1HZBA 3HOVH 1P8LA 1O7IA 3T13A 3NE5B 3PO2G 1F2MA 1SE3A 2IW3A 4GOPB 2F0JA 2R93G 5EPLA 2QEXA 3K8AA 1TWGB 3S16B 1VF7A 2NN6H 1DYQA 2F03A 3TS2A 2UXDQ 4N9PA 1EU4A 5K5PA 1SE4A 2ZM6L 3MXUA 4X64L 1TWHB 3NQTA 2K04A 2X6GA 3TP7A 4L63B 4OEMB 1ML0D 5FJ8H 4A3IH 4DV7Q 5IYCG 4DV3Q 5J3BA 3S1RH 4N9TA 3DM1A 1X3GA 2EY6A 4BBRB 4HJ8A 1IBLQ 2BH2A 2NVQH 2R92H 2KJXA 1XPOA 2HCIA 3V2TA 4ME3A 1YNXA 2L0CA 1RTOA 2K5HA 5L37A 2E8GA 2FINB 1D5MC 1SNPA 1VQIA 3ND9A 3CPWA 1RDPD 2KEEA 5FLXc 3CCSA 1PDQA 1T5XD 3FKIH 3KYHC 1A0IA 1Y1VB 2M00A 4ZK9B 3Q23A 4R4IA 3P20A 5IYDG 1F2YA 2KA7A 4IPCA 4DUYL 2B2WA 1HRJA 1I4GA 4A93H 5IP9H 4FNFA 4ZCKA 3C1FA 2PI2A 4K2KA 1A8VA 4LF9L 3M3YH 2QDLA 1SYDA 5E4WC 4HSPA 2NTSA 4DR6L 1EWIA 4LFCQ 1IW7D 2FMMA 4KJNA 4B9XA 1G2SA 5I6YA 3RNUA 1RCVD 4GNXC 2E2HH 1V1QA 1FNWA 3N52A 1HZCA 4OIKA 4JCVE 3S24A 4R9WA 4RKBA 1JMCA 1S5DD 4A3DG 4JI2L 1G51A 4JI5L 1QNKA 3CPFA 1S4ZA 2B2VA 4FXKC 4JI3L 2QA4A 2MHVA 4DNRB 1XNRL 1E24A 3HFZB 2KCTA 1B44D 2FHTA 2JXMB 1UE1A 1KNEA 3TP6A 1H95A 1I3QB 3PUVA 1DOKA 4DXGA 2H1EA 4H13C 2A69C 3SXHA 1WTRA 2I07B 3K58A 3ULJA 2Q2IA 2YV5A 1H9SB 1NNXA 2DN8A 3I4NG 1LT6D 2K50A 4F88A 4C2MB 1N33L 3L9AX 4C3HH 4AQYQ 1JWSD 3M85A 1HJPA 1LT4D 1M8AA 2PO4A 2LFNA 1SAPA 4EQ5A 1PMRA 4ABNA 2NTTA 1F77A 1Q1EA 1VQHA 5JJLA 3S9WA 3CC7A 1B70B 1TS4A 1YHAA 3PUZA 1PZID 3DXJC 4B3ML 3CHBD 5C0XI 1LTRD 2E5LQ 1QVGA 1EZ8A 4E6IA 5D3DA 5DM73 1Y8OB 1A62A 4IPHA 4YCUA 1MSHA 4A3MH 2JA8G 2AWNA 3O13A 3TP5A 4LW1A 4LF8Q 1HXYD 5KYIA 1DXMA 3RN5A 2LMCB 4U68A 1F9SA 4JYAQ 2Z9HA 2UXCQ 1T5EA 1N34L 4LNQA 1BVSA 1BO0A 1GD7A 4IO9A 2K52A 2RSNA 1STHA 1BQQT 1E1TA 1PFNA 3T1HL 4LJZC 5ELNA 1XJVA 2FXQA 4NDXA 1PTOB 2JEBI 3CQZH 2E2IH 3LWUA 4A3EB 4UAIA 2RQXA 4A3GH 2HCCA 3GTKH 2HDLA 3M4PA 2EYPA 4RG1A 4V190 3E9IA 1G6ZA 3J7AF 4KLKA 2QCPX 3PUYA 2ZJQA 3G71A 2AQ2B 1VQEA 1BCPC 4HJ7A 4P71A 1F2ZA 4DR7L 1O78A 2IJ0A 1D5ZC 1OTCA 1VDZA 4LWCA 2Z4HA 4AIMA 2K5NA 4JI4L 3GTLH 2D9UA 5D3IB 1JICA 3KDFA 3QB3A 1WI5A 1YNNC 1CKNB 3M7NA 1H9SA 2GVAA 3HKZE 1VQAA 3HOWH 1ENAA 5C0XG 3TS0A 4NXNL 2F0QA 3CP0A 3JC66 3A8IE 4LAAA 4RA8A 1I4RA 1NBWA 4XQJA 2RDGA 2IWHA 1QNUA 5EKKA 3GTMH 4BA2I 3F2DA 3HRZC 3M4OH 1H9MA 3GV6A 2EJGC 2AWOA 3L2PA 4JV5L 1B3QA 2HIVA 1E2WA 1HPCA 3SE0A 2L5TA 4UY8C 4JI8Q 5KGUA 2EYHA 5M3FH 2VL6A 2P5ZX 3CXCA 1H9RA 3CMAA 3MVVA 1SE2A 2DJFC 1NSNS 2JN4A 3ICEA 2EZVA 2PZUA 3OOCA 3S2DB 2XRSD 4O0AA 2TMPA 2JA6H 4X3SA 1TIID 3J7YW
chains in the Genus database with same CATH topology
2O5JC 1LO5D 1C8CA 3U9OA 3QG1A 3AMUA 4CHTB 5BN5A 2XWBB 5M5WB 1ILQA 1I4QA 2ZXOA 4IUQA 1EOTA 2F3WA 1QOHA 3D4RA 4CJ0B 1PTOD 4PMWA 4G7HC 1SYEA 2I46A 1EY7A 1GUWA 2PPBC 3KLSA 4X3TA 2V4DA 2WIIB 1GHJA 4UDUC 2L55A 1RD9D 1D1KA 5I2YA 4ZYSA 1DCZA 1TVXA 4IZ8A 1GHKA 3VR3A 1TWFB 3SHLA 3S1MB 4XYOA 3K0YA 2EXZA 3KBGA 2Q8TA 1HFNA 1STNA 1B9MA 3F2UA 1ESRA 2F4IA 1B4OA 2A69D 3BVGA 3D4DA 1WTXA 3A7LA 5CYUA 4OL7A 3QIAA 4WJWA 4OHJA 4C1NI 4DA2A 4QF4A 2VXWA 3H94A 4AYBB 3FVQA 3W2DA 1I50B 4RGNA 2RVLA 3PMFA 5A2QL 3SK5A 2Q8RE 5K36G 4HEDA 1HQRD 1HCZA 2WINB 2IPKD 4QUCA 5T1IA 1DM0B 3AU7A 3NXWA 2CW0C 5EPKA 3LX0A 3DMUA 2K1BA 2E75C 4NMZA 4Z9CB 5I6WA 2Y0SB 1PFMA 5ELCA 1QCBD 1I4PA 2B2YA 4DK0A 1Z6HA 3VYSA 5C5MA 1IKLA 2WACA 3I91A 3OWFA 3WOFA 2B39A 5IOCA 2F0UA 5CC4A 1A6XA 4HSVA 2F0GA 2VB3X 1LTID 1LLRD 3D4WA 1MBYA 2IX3A 1SDFA 1WVLA 2PW5A 4FP5D 3K7AB 5EJWA 2KCNA 3BYTB 3C2PA 1AN8A 1ICWA 3J80E 3OPOA 4RHRA 1BCPD 5KNCA 2ZXPA 2OXPA 4LK1C 2WKDA 3P1HA 5E3FA 1U4PA 2NVYB 3JAME 2QILA 5C4XB 1PZKD 4K5WA 2WKCA 5M3MB 1TR5A 2PCFB 4G4KA 2B2TC 1EWHA 3PO3B 3WOEA 4A3JB 2X69A 5J39A 1W6KA 2FFKB 1GUNA 1HTPA 2K28A 1DZ1A 1SYFA 2E76C 2EE1A 2J4XA 2XIWA 4I65A 4Q0FA 4FF4A 1LV9A 1CTMA 2D62A 4WFN3 4ID6A 3VYUA 3TBIB 1BXTA 3I4MB 1FYCA 5IGCA 4ILWA 1OXTA 1C4QA 2F1MA 3FEWX 1I4HA 3Q24A 1EIHA 2K5QA 4QCLA 2E2JB 3RLFA 4EVOA 1S5BD 1HA5A 1B3AA 4S3SA 1EIGA 2F0WA 3VR5A 5FKAC 1G2TA 5D14A 4CGYB 3BDOA 3SDZA 1TY2A 2R3ZA 3PUXA 4RGTA 1JCKB 1SJHD 1TWAB 3CRKC 1L0YB 4F7XA 1JWMD 2PNRC 5CBEE 1STYA 3A8JE 3EJIA 3VA5A 2XRQD 4A3KB 3EROA 1A3TA 1W6JA 4IALA 3D6WA 5JEAG 3J80L 1G91A 3J7AV 1TS5A 4TQUS 2BCOA 1Q12A 2NZ1D 5C44B 2F0HA 3A8KE 3HS0C 3I8ZA 3JAML 3BVMA 3SEBA 2CW0D 1B9NA 5CV7A 4C3IB 5C3WA 3P7JA 5C4ZA 1BCPF 4KKSA 1TKWB 3U9SA 1SFOB 5C3XA 2F0TA 1I6VC 3KUPA 3PV0A 4TKOB 3TZUA 4EGVA 3MEHA 2A68D 3DEOA 2BDOA 2NYZD 4JBWA 3EA6A 2O5IC 2RBMA 1HA6A 5DEHA 4C3JB 1SNMA 2EPBA 2L11A 5C0XH 3S1NB 3M4YA 2AQ1B 3URYA 1FNVA 3ITPA 1EEID 4GZYC 4F87A 1KNAA 2MP1A 1ESFA 2B2UA 2H4OA 3K6OA 4IURA 3R8BA 2VB2X 3GTJB 5I9PA 2JP1A 2L1BA 3VR2A 1G291 3HG9A 3NPPA 1LTAD 4BY1B 2A6EC 2ICEC 1H9KA 5C5LA 3OMCA 1CA5A 1EL0A 3ERQA 1MD2D 1UAPA 1BDOA 2K03A 5AFWA 1LTBD 3R93A 3SK8A 1ILPA 2RSOA 1I6HB 3QWNA 1AFPA 2QKIC 3KLRA 3TZDA 1YNJD 5KNDA 2EVBA 1WD1A 1EEFD 1QWYA 4K5VA 1L0XB 3MFGA 3FRPB 3GQBA 4MIUA 1CI3M 4H0LC 1FD7D 4K6LA 2KOLA 4IUUA 1FR3A 4KN7C 1BBXC 3SVMA 1ZYRC 4ZUIA 5KYLA 1HQMC 4DK1A 4J6HA 2KUMA 1NR4A 1JWUD 3IFTA 2FMCA 4B9WA 1S5FD 3MXPA 1MGSA 4M1UB 4V0BA 4RHSA 2BE5C 1LACA 4FYDA 5C6AA 4K8JA 3RZOB 1ET6A 4Y7NB 2XN9C 5ELFA 4IUNA 3HOUB 4LMQD 2B63B 4ZKCB 2NB0A 4BY7B 2SNMA 1F9RA 5CV6A 3H6MA 5CV4A 5IGGA 4TRDA 3L7ZC 5DNFA 4KK7A 2MGSA 1WTQA 3PIP3 2K32A 2EYLA 2EYMA 5K36H 1D6EC 4OO1I 2DNCA 2K05A 3G7LA 3NUCA 1GJXA 2SOBA 1V1PB 3WDNA 2F0DA 1PFBA 5G3LD 1BR9A 2XNAC 4XDXA 3HOXB 4DAPA 4MN3A 2SDFA 5CORA 2M9VA 5JVG3 5C0XJ 1DD2A 5TSSA 3PIO3 1EY0A 1FNUA 4KKTA 3KK7A 4I7ZC 3VYRA 5LHY1 3HOYB 5JAVA 2SEBD 4YIJA 2K01A 1ZEQX 3K5OA 4IFDI 2ICIA 3HOZB 3GO5A 5EKLA 5CGKA 1F9QA 2EJMA 4TSSA 2FJ2A 2DNEA 5E1FA 1V8QA 5CV9A 3Q6SA 2IX1A 3MWYW 4DAVA 3BYYB 1WTVA 3LNNA 4KN4C 3H09A 3VR6A 3AB9A 5IGFA 5KIXA 3NSWA 4PMCA 4OO1G 1J8IA 2AQ3B 5ELBA 4EQPA 5F2DA 2KCCA 3ONAB 5BN4A 3DHQA 4NP5A 1STEA 3H91A 4DFAA 1CQVA 3GD7A 3I3CA 1Q1BA 2LKVA 3IKJA 3MFYA 2BA1A 1V1PA 2A6ED 2WV6D 4IFDG 1PRTC 4J8QA 1A2TA 5IT9E 3V05A 1O7YA 3MTSA 5KNBA 3S17B 5CV5A 1J9OA 3FPUB 4DN4M 3R3OA 2F0IA 1OXVA 4ME5A 4RH6A 3E6ZX 1BCPB 1ENFA 2JE6I 2EYFA 1PLFA 4XTCS 2O2LD 1XX8A 3NTHA 1ENCA 3TSSA 5ISRA 5KRUA 1RF2D 1AP0A 3T53B 4C56C 2EY1A 2VNUD 1HFGA 1D5XC 2NWGA 3S14B 4F8MA 2F0VA 1BUVT 2BE5D 1EWCA 3OIPA 2F0LA 4FO2A 3V96A 3MAQA 5G3LF 4QMGA 4HCSA 1SYCA 4C3IG 1HUMA 3NK9A 2JA7B 3HEJA 1PTOH 1STBA 4K5XA 5IODA 3OWEB 5JEAH 1KAAA 4KY5A 2A74C 2EYJA 4BS9A 2N55A 4ZKBB 1CZGA 5FO9B 2IX0A 3VYTA 1R9TB 3S2HB 3DEPA 2SNSA 4HN7A 4RCNA 3Q22A 3R2TA 3DWQA 2EY2A 4R8NA 1LTGD 3OSOA 1AEXA 2EOTA 3HOVB 2D2CC 4KD3A 5E4XA 1O80A 4C1NK 3EFXD 1K8OA 1CHQD 4KHVA 1CHPD 1V1OA 1YNND 3RUZA 3I4LA 3KLSX 4P2CB 3Q0AA 2D5DA 1M4VA 2PYKA 1ZXTA 1GUSA 1EY9A 3NWTA 5IT9L 1U4LA 3I72A 5EGTA 4A3IB 3IL8A 3S1RB 1IHZA 1E2ZA 1GUTA 2NVQB 1V43A 2R92B 1OXUA 3J81E 1SNQA 4B08A 1D1IA 2B2WC 3CRLC 2RDHA 2J0TD 1DJRD 2TSSA 3A55A 2DY7A 2EDGA 3FKIB 3TN2A 3E0JA 3BVZA 1LT5D 1IW7C 1FGBD 1ZKOA 2F0MA 4A93B 4DF7A 1OXSC 1DOMA 1XWEA 2K5DA 1EYAA 4IUTA 3M3YB 5FO8B 2B2VC 4CJ2C 2KECA 4O42A 1Y8NB 1NR2A 3D6CA 3OHXC 4J1MA 1B50A 4X3KA 4FVMA 1F2LA 4JK1C 1PRTD 3D3RA 3EVQA 3KBXA 1S5CD 4K6DA 1GUGA 4L8JA 4BBSB 2A6HC 1JC7A 4ZQ3A 5IGDA 4PMBA 1KABA 3GV3A 1AW7A 2ZXRA 2A5HA 1O7ZA 1NAPA 2N88A 3HKZB 1WTOA 4KKUA 3SK4A 4C3HB 3N6RA 1SMYC 2G9HD 3C1EA 4FXDA 4RAUC 2XSCA 1SJED 3VR4A 2F0KA 1SBBB 1LABA 3G6JB 1K8MA 3HGBA 4K8IA 5BN3A 4RGOS 5M9OA 1KLUD 5IGEA 5IIFA 4A3MB 1IL8A 1JOQA 5ELEA 3FDTA 1NCVA 1STAA 4DGZA 3OIQA 5EKIA 1SNCA 4NKLA 2OF1A 3NP8A 2F3VA 3H3VC 5KEEA 2PMZB 2L12A 3I90A 5D65A 2KEDA 1SEBD 3CQZB 3MA2B 3J81L 2IL8A 4MHEA 4A3GB 3GTKB 1SYGA 1AZPA 4QIWB 3CKIB 4KY6A 1X32A 1JQYD 1HTLD 1O7LA 2F0SA 3TDQA 3GTLB 1RKNA 3DWPA 3C46A 3K57A 2L9HA 1EY5A 3HOWB 1UNSA 2AUJD 3MZ5A 1B1ZA 1EZ6A 1EU3A 4ODGA 4XT3B 3GTMB 1I4XA 3M4OB 3R2IA 1PXUA 2L4NA 4WORA 1UEAB 1KTKA 1LTTD 3A7AB 5M3FB 2NBFA 2HDMA 4CBVA 4KMUC 2R6GA 1Q90A 1Y69U 2B2TA 2PW7A 4CKEA 2ENBA 1QILA 3BDCA 1EY4A 3X3NA 1PTOC 3BS1A 2JA6B 2WB1B 1HUNA 4OO1H 1EY8A 2CQAA 1PRTF 3E5SA 1JB3A 1Z7TA 1K83B 2QF7A 1H9JA 3DUZA 4EQNA 1CA6A 2F0EA 4NW2A 3QO2A 1R4PB 2F0FA 5I9OA 2KVMA 4IFDH 3MC0B 2C5CA 4HR7B 1TQOA 3UI2A 1TWCB 1KDBA 3W3AA 1VMPA 4H7BA 3C3LA 4KY7A 3D31A 2NN6I 1EQTA 4ULLA 5J22A 5EBCA 1TT2A 3D8GA 4IQZA 5A35A 1WCMB 4G7OC 1CK1A 1ONLA 1QG7A 1Y1WB 1BOSA 2A6HD 4FXGC 2JEAI 2NVTB 3FPPA 4Q5VA 2K33A 3NHHA 4FF3A 4IUVA 1KLGD 3GTQB 1SMYD 4ZAIA 2R7ZB 4OIJA 2RA4A 1ET9A 1U9RA 1A3UA 2C9OA 2B2YC 1HHVA 1KDAA 3NTKA 5HGTA 1JE4A 1EFID 3SR1A 2JA5B 2E2DC 1WD0A 4RGMA 1D2BA 2CVRA 3MHBA 4IUPA 2XVSA 5HURA 3A54A 2KHSA 3GTGB 2QDBA 4BWGB 3NWSA 1LT3D 4DU9A 4A3FB 1MI2A 1X3QA 3L3OC 2NN6G 1CT1D 2J7ZA 4A3BB 3OMGA 3OW7A 1F9PA 5DAUA 1E0BA 5A2QE 4CKCA 4XQNA 2BA0A 2WAQB 4K2LA 3T16A 2GA4B 4G7ZC 1SXTA 4M8AA 4KTAA 5JPNC 1IYUA 3PO2B 3VA7A 1Q8IA 2R93B 1RTNA 5FOBB 3MXNA 2B8FA 4WRDA 5NUCA 4HMIA 1OO9B 3PUWA 5FK9C 4PNYA 4CKBA 1EYDA 5M5XB 3TP8A 2BDNA 4KV6A 4IFDJ 1X3PA 4KI0A 3T51B 1TS3A 4DAYA 4KD4A 5C4HA 1STGA 3EQLC 1JR0D 1XYIA 2RKSA 5CMDA 3NBHA 5J1ZA 1QE6A 1II3A 2OT2A 3K5LA 1BF4A 2E74C 1JOOA 1B2TA 3ZYYX 2LY7A 5IGBA 3GTPB 3S1QB 2MPMA 1VMCA 1A15A 2Z4IA 1RJTA 5I4DA 1GUOA 4C3HG 1EQVA 1RODA 2M2LA 5CR3A 1CFMA 1S5ED 5EPJA 4G57A 3X3MA 3K5MA 2OEOA 2Q8IB 2LS01 1CZWA 4A3DB 4KHZA 5EQ0A 3I73A 1ZYRD 3T4AC 5LL6S 1TU2B 4OGQC 3QOLA 4XIGS 3RMHA 1G8ZD 3TMEA 3QOJA 3I4NB 5FLXE 1U4RA 2JYOA 1C48A 3HZXA 1IYVA 1DOLA 2EY5A 3BZDB 4X3UA 5COYA 1CQFA 1PYWD 2K5WA 2HQEA 2K6AA 1AZQA 1U4MA 1A3VA 2BOSA 1BNZA 1XTCD 4HAEA 5CV8A 4RKLA 1SNOA 2JA8B 4HMJA 2R61A 2HUGA 4O1NA 1R4QB 4FF1A 1A2UA 1PRTB 4C3JG 3DWAA 2A68C 2RDFA 1SNDA 5JOBA 4U673 1JOKA 5EBDA 1GXDC 4RWSC 4QB4A 4BA1I 3IAYA 3KF8A 5T1GA 1SSOA 2CHBD 4R8IA 2EJFC 1XXGA 1WTPA 2G9DA 4HTHA 4EQOA 2VUMB 2B2UC 3NQIA 3ND8A 1IKMA 1CM9A 3P75A 1E2VA 3MXGA 2K7VA 4KJOA 5DM63 5I2XA 4HCEA 1Z47A 1Y8PB 2DY8A 2PQEA 1PTOF 1TS2A 2JSOA 3RD4A 3BDLA 4RFBA 4DNTB 3GP7A 3LWEA 2O4XA 3HP3A 1PZJD 1YNJC 3CU7A 1DONA 4ZRZA 2E2HB 3FMCA 5FLXL 1LTSD 3QJYA 3K5NA 2PZWA 3T56B 4XXEA 5FO7B 4ZLTF 3NTIA 1QB5D 2YU9B 4PQXA 1JORA 1OXXK 3S15B 5CBAE 2EYOA 4XQQA 2AUKA 2ID0A 1KDCA 1RHPA 4QUFA 2MJ8A 1QJOA 5JVH3 4IN3A 1TY0A 5JEAJ 3NBIA 4DXFA 1EYCA 4ZUJA 2WP8J 1VF5C 5ELDA 5JPMC 2ZT9C 4PV1C 3IFDA 2Z1CA 4K14A 2XWJB 3GTOB 2A73B 2PZTA 2MUYA 3SK6A 2Z8LA 1WTWA 2F0OA 1GOZA 5C3EB 1Q3LA 2QEJC 1NUCA 2X6LA 2YYZA 2IT1A 1SYBA 4XYQA 3K59A 5LL6X 1MSGA 3BG3A 4XT1B 3M7GA 1UUPA 4L6TB 4H44C 4FF2A 2E2IB 2NUCA 2KQ3A 1B53A 4CJ1B 4RCOA 2F0PA 5JJZA 5C4JB 2B8GA 3H0GB 3I70A 5M5YB 1EY6A 3A56A 3RZDB 2NVXB 1VCIA 2F0NA 3T13A 3NE5B 1F2MA 1SE3A 2IW3A 2F0JA 5EPLA 1TWGB 3S16B 1VF7A 2NN6H 1DYQA 2F03A 4N9PA 1EU4A 5K5PA 1SE4A 3MXUA 1TWHB 3NQTA 2K04A 2X6GA 3TP7A 4L63B 1ML0D 4N9TA 3DM1A 2EY6A 4BBRB 2KJXA 2HCIA 3V2TA 2L0CA 1RTOA 2FINB 1D5MC 1SNPA 3ND9A 1RDPD 2KEEA 1PDQA 1T5XD 1Y1VB 2M00A 4ZK9B 3Q23A 3P20A 1F2YA 2KA7A 2B2WA 1HRJA 1I4GA 4FNFA 3C1FA 4K2KA 1SYDA 5E4WC 4HSPA 2NTSA 1IW7D 2FMMA 4KJNA 4B9XA 1G2SA 5I6YA 1RCVD 1FNWA 3N52A 4OIKA 4R9WA 4RKBA 1S5DD 1QNKA 4FXKC 1S4ZA 2B2VA 2MHVA 4DNRB 1B44D 2FHTA 2JXMB 1KNEA 3TP6A 1I3QB 3PUVA 1DOKA 4DXGA 2H1EA 4H13C 2A69C 3SXHA 1WTRA 2I07B 3K58A 1H9SB 2DN8A 1LT6D 4F88A 4C2MB 3L9AX 1JWSD 3M85A 1LT4D 1M8AA 2PO4A 2LFNA 1SAPA 1PMRA 4ABNA 2NTTA 1F77A 1Q1EA 3S9WA 1TS4A 3PUZA 1PZID 3DXJC 3CHBD 5C0XI 1LTRD 1EZ8A 4E6IA 5D3DA 5DM73 1Y8OB 1MSHA 2AWNA 3O13A 3TP5A 1HXYD 5KYIA 1DXMA 2LMCB 4U68A 1F9SA 1T5EA 1BO0A 2RSNA 1STHA 1BQQT 1PFNA 4LJZC 4NDXA 1PTOB 2JEBI 3LWUA 4A3EB 4UAIA 2RQXA 2HCCA 2HDLA 2EYPA 4V190 1G6ZA 3J7AF 2QCPX 3PUYA 2AQ2B 1BCPC 1F2ZA 1O78A 2IJ0A 1D5ZC 1VDZA 2Z4HA 2D9UA 5D3IB 1JICA 3QB3A 1YNNC 3M7NA 1H9SA 1ENAA 5C0XG 2F0QA 3A8IE 4LAAA 4RA8A 1I4RA 4XQJA 2RDGA 2IWHA 1QNUA 5EKKA 4BA2I 3HRZC 1H9MA 3GV6A 2EJGC 2AWOA 1E2WA 1HPCA 3SE0A 2L5TA 5KGUA 2EYHA 1H9RA 3MVVA 1SE2A 1NSNS 2EZVA 2PZUA 3OOCA 3S2DB 2XRSD 2TMPA 4X3SA 1TIID 3J7YW
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4C3H G;  4C3J G;  4C3I G; 
#chains in the Genus database with same CATH topology
 2VQF L;  2O5J C;  1LO5 D;  1C8C A;  3U9O A;  3QG1 A;  2PMZ E;  4CHT B;  3AMU A;  4DV5 Q;  1KXL A;  5BN5 A;  2XWB B;  1K83 H;  1ILQ A;  1I4Q A;  2QW7 A;  2ZXO A;  5M5W B;  4IUQ A;  1EOT A;  2F3W A;  1Q81 C;  4LF5 L;  1QOH A;  3D4R A;  4CJ0 B;  3CD6 A;  1PTO D;  4PMW A;  4G7H C;  1SYE A;  2JQO A;  2I46 A;  1EY7 A;  1WYD A;  1GUW A;  1YEZ A;  4LFA Q;  2PPB C;  1B8A A;  3KLS A;  4X3T A;  4OX9 Q;  3HKZ G;  4OEL B;  2B29 A;  3CC2 A;  2Z6B A;  1JE5 A;  2V4D A;  3LGJ A;  1PVO A;  2WII B;  1GHJ A;  4UDU C;  2L55 A;  1TWC H;  1RD9 D;  1D1K A;  5I2Y A;  3G6E A;  2LXJ A;  4ZYS A;  1DCZ A;  1KD1 C;  1TVX A;  5LMU L;  4IZ8 A;  1GHK A;  3VR3 A;  4GLA C;  1TWF B;  3SHL A;  3S1M B;  4XYO A;  3K0Y A;  2EXZ A;  3Q8D A;  3KBG A;  2Q8T A;  1KC8 C;  3H15 A;  1HFN A;  1STN A;  1WCM H;  4C2M H;  1L1O C;  1B9M A;  3F2U A;  4TVA B;  1HZ9 A;  2HD3 A;  1ESR A;  2F4I A;  1Y1W H;  1B4O A;  2A69 D;  3BVG A;  4CDE C;  3D4D A;  1WTX A;  3A7L A;  4UPA A;  5CYU A;  4OL7 A;  2OQ0 A;  5C3E G;  2NVT H;  2N49 A;  4GN3 B;  3QIA A;  4WJW A;  4OHJ A;  1GKH A;  4C1N I;  2DJG C;  4DA2 A;  4QF4 A;  3GTQ H;  2VXW A;  3H94 A;  4AYB B;  1FJG L;  3FVQ A;  3W2D A;  2R7Z H;  1I50 B;  4RGN A;  2RVL A;  3PMF A;  5A2Q L;  1PFS A;  1XNQ L;  3SK5 A;  1EYG A;  2Q8R E;  5K36 G;  4HED A;  4LFB L;  1S3O A;  1HQR D;  1HCZ A;  2WIN B;  2H5X A;  2WB1 E;  2IPK D;  4QUC A;  5T1I A;  3J81 i;  1DM0 B;  3AU7 A;  3NXW A;  2OTJ A;  2CW0 C;  5EPK A;  3LX0 A;  4ALP A;  3H0G G;  3DMU A;  2K1B A;  2E75 C;  4NMZ A;  4Z9C B;  3G48 A;  5I6W A;  1YJN A;  2Y0S B;  1PFM A;  5ELC A;  1QCB D;  1I4P A;  2B2Y A;  4DK0 A;  1Z6H A;  2N78 A;  3VYS A;  4R1J A;  5C5M A;  1BBW A;  1IKL A;  2WAC A;  1AE3 A;  3I91 A;  4DR4 L;  4A3F H;  3CAM A;  3HOW G;  3OWF A;  2EXD A;  3WOF A;  2VQE L;  2B39 A;  1JJ2 A;  5IOC A;  2F0U A;  1GVP A;  1IBM L;  5CC4 A;  4A3B H;  1A6X A;  4HSV A;  2F0G A;  2VB3 X;  1QZH A;  1LTI D;  1JJG A;  1LLR D;  3D4W A;  2F4V L;  4GKJ L;  1MBY A;  2IX3 A;  1SDF A;  1WVL A;  2PW5 A;  4FP5 D;  1HNX L;  1D7Q A;  1QUQ B;  3QR8 A;  3K7A B;  4BBR G;  4DR5 L;  5EJW A;  2KCN A;  1VQ6 A;  3BYT B;  3C2P A;  1AN8 A;  2CH4 A;  2PQA B;  2MFI A;  1ICW A;  3J80 E;  3OPO A;  4RHR A;  1BCP D;  5KNC A;  2ZXP A;  2MNA A;  2OXP A;  4LK1 C;  2WKD A;  1Y1V G;  3P1H A;  3PO2 H;  5E3F A;  2ZTE A;  2R93 H;  3MEF A;  1U4P A;  2NVY B;  3JAM E;  2QIL A;  5C4X B;  1PZK D;  4K5W A;  2ZTC A;  5M5X H;  2WKC A;  5M3M B;  2CKZ B;  1TR5 A;  2PCF B;  4G4K A;  4DUZ Q;  2B2T C;  5IWA L;  5IYC H;  4JI7 L;  1EWH A;  3PO3 B;  3WOE A;  4A3J B;  2X69 A;  3S2D H;  5DLQ E;  3BJU A;  3W1B A;  5J39 A;  1W6K A;  2FFK B;  1GUN A;  1HTP A;  1YHB A;  4DR1 L;  2JJQ A;  2K28 A;  3IRB A;  5BR8 Q;  2UUA Q;  1DZ1 A;  1SYF A;  2E76 C;  2EE1 A;  5IYD H;  1C9O A;  3UDG A;  2J4X A;  2XIW A;  4I65 A;  3S1Q H;  4Q0F A;  4FF4 A;  1LV9 A;  1CTM A;  2HHH Q;  2D62 A;  4WFN 3;  4ID6 A;  3VYU A;  4JI0 L;  3TBI B;  1HNW L;  1BXT A;  3E9H A;  2YTY A;  4X65 Q;  3I4M B;  1FYC A;  5IGC A;  4ILW A;  1OXT A;  1C4Q A;  2F1M A;  4JG2 A;  4DV1 Q;  4JW0 A;  3FEW X;  1J5E Q;  4X66 L;  1XMO Q;  1I4H A;  2VW9 A;  3Q24 A;  1EIH A;  2K5Q A;  4QCL A;  2E2J B;  2PQA A;  3RLF A;  4EVO A;  2R7Z G;  4LF6 Q;  1S5B D;  1HA5 A;  3DM3 A;  1B3A A;  4S3S A;  1N32 L;  1EIG A;  2A19 A;  4DK3 C;  2F0W A;  3VR5 A;  5FKA C;  1G2T A;  5D14 A;  4CGY B;  3BDO A;  3SDZ A;  1TY2 A;  1PH7 A;  2R3Z A;  3PUX A;  4RGT A;  1JCK B;  1SJH D;  1TWA B;  3NEM A;  3CRK C;  1L0Y B;  4F7X A;  1JWM D;  2PNR C;  1N36 Q;  5CBE E;  1STY A;  3A8J E;  3EJI A;  3VA5 A;  2XRQ D;  4A3K B;  4A3E G;  1EQQ A;  3ERO A;  3A74 A;  1A3T A;  4DAM A;  1W6J A;  4IAL A;  3D6W A;  5JEA G;  3J80 L;  1G91 A;  2ZTD A;  4A3L G;  3J7A V;  4DV6 L;  1TS5 A;  4TQU S;  1XPU A;  2BCO A;  3EIV A;  1KIX A;  1Q12 A;  4DR3 L;  1K28 A;  2NZ1 D;  5C44 B;  1HZA A;  2ATW A;  4JI1 Q;  2F0H A;  4JVZ A;  1VQN A;  2JA8 H;  3A8K E;  3HS0 C;  3B6Y A;  3I8Z A;  3JAM L;  3BVM A;  3SEB A;  2CW0 D;  1B9N A;  3E0E A;  3U4V A;  1HR0 Q;  5CV7 A;  2UU9 Q;  4C3I B;  5C3W A;  4J15 A;  3P7J A;  5C4Z A;  1BCP F;  1FGU A;  2A1A A;  1YHQ A;  4KKS A;  1U0L A;  1TKW B;  3STB C;  4P74 A;  3U9S A;  1K0S A;  1SFO B;  5C3X A;  4YY3 L;  2F0T A;  3CW2 C;  1I6V C;  3KUP A;  3PV0 A;  4TKO B;  4MTN A;  3TZU A;  3MEH A;  2A68 D;  4EGV A;  3DEO A;  2BDO A;  2NYZ D;  2IHF A;  4JBW A;  3E3X A;  3EA6 A;  2O5I C;  3EN2 A;  3UE0 A;  3RLO A;  2RBM A;  1HA6 A;  4BXX G;  2VUM H;  2UUC L;  2YTV A;  5DEH A;  4C3J B;  4B3R Q;  1SNM A;  2EPB A;  4B3S L;  2L11 A;  5C0X H;  4FDB A;  5GQO A;  3HKS A;  3S1N B;  3M4Y A;  2AQ1 B;  1KRS A;  3URY A;  4AYB E;  1FNV A;  3ITP A;  1U5K A;  1EEI D;  1JJC B;  4GZY C;  1I94 Q;  1XMQ L;  1KNA A;  2MP1 A;  4F87 A;  1ESF A;  2B2U A;  2H4O A;  3K6O A;  4IUR A;  3R8B A;  4EX5 A;  2VB2 X;  3OW2 A;  3I7F A;  3J7Z C;  1S40 A;  3GTJ B;  5I9P A;  2JP1 A;  2L1B A;  3VR2 A;  3K7U C;  1PH2 A;  1G29 1;  3HG9 A;  3NPP A;  2GVB A;  4X62 Q;  1LTA D;  4BY1 B;  2A6E C;  2ICE C;  1KAW A;  1H9K A;  2JA9 A;  5C5L A;  3OMC A;  2CWA A;  1CA5 A;  1L2F A;  1EL0 A;  2CWP A;  1HNZ L;  3ERQ A;  1MD2 D;  1UAP A;  1BDO A;  4HJ5 A;  3PCO B;  2K03 A;  5AFW A;  1LTB D;  3R93 A;  3SK8 A;  1ILP A;  2RSO A;  1I6H B;  3QWN A;  3TQY A;  1AFP A;  2R7D A;  2QKI C;  3KLR A;  3TZD A;  1YNJ D;  2ALY B;  5KND A;  2EVB A;  1WD1 A;  1EEF D;  1EIF A;  1QWY A;  4K5V A;  2YU9 H;  1L0X B;  3MFG A;  3FRP B;  1K8G A;  3S15 H;  3GQB A;  4MIU A;  3T1Y Q;  1CI3 M;  3AEV A;  1J6Q A;  4H0L C;  3KDF B;  1CSP A;  4YHH L;  1FD7 D;  4L5S A;  4DV2 Q;  4K6L A;  1PH4 A;  1M90 C;  5JJK A;  2KOL A;  4IUU A;  1FR3 A;  4KN7 C;  1PV4 A;  1E1O A;  3J81 j;  1AE2 A;  3PIP A;  2A8V A;  1BBX C;  3PQI A;  1VQL A;  3SVM A;  1ZYR C;  4AYB G;  4DNI A;  1RL2 A;  4ZUI A;  5KYL A;  1HQM C;  3AYH B;  4JC0 A;  4DK1 A;  1UE5 A;  4J6H A;  5LMN L;  2KUM A;  1WOC A;  1NR4 A;  1JWU D;  3IFT A;  1E7Z A;  4LF4 Q;  2FMC A;  3UDI A;  4B9W A;  3J80 c;  1S5F D;  3MXP A;  1MGS A;  4IPG A;  4M1U B;  4V0B A;  4RHS A;  4JI6 L;  4NXM Q;  2BE5 C;  1NTG A;  1LAC A;  3OTO L;  4GKK L;  4I7A A;  4FYD A;  5C6A A;  4K8J A;  3RZO B;  2K14 A;  3GTO H;  1ET6 A;  1TWA H;  4Y7N B;  4DV4 Q;  2XN9 C;  2Y0S G;  5ELF A;  1XPR A;  3JAM c;  4IUN A;  3HOU B;  5C3E H;  3U58 A;  2CQO A;  4LMQ D;  2B63 B;  4ZKC B;  1VQJ A;  2NB0 A;  3I2Z A;  4BY7 B;  2SNM A;  1F9R A;  4QY7 A;  5CV6 A;  3H6M A;  5CV4 A;  5IGG A;  4B3T Q;  1UEB A;  4TRD A;  3KLW A;  3L7Z C;  4K0K L;  1PH8 A;  5DNF A;  2VY3 A;  4KK7 A;  1MKH A;  2MGS A;  1WTQ A;  1L0W A;  3PIP 3;  2K32 A;  1WFQ A;  2EYL A;  2EYM A;  3RN2 A;  3J7A 5;  5K36 H;  1IBK Q;  1D6E C;  4OO1 I;  2DNC A;  2K05 A;  3G7L A;  3NUC A;  1GJX A;  2SOB A;  1V1P B;  3WDN A;  1EOV A;  1PFB A;  2F0D A;  2OQK A;  1BR9 A;  5G3L D;  2XNA C;  1N8R C;  5C4J H;  4XDX A;  3HOX B;  4DAP A;  4MN3 A;  3H0G H;  4DR2 L;  5M5Y H;  2SDF A;  5COR A;  2M9V A;  5JVG 3;  2ES2 A;  5C0X J;  1KRT A;  4L5T A;  1DD2 A;  4GNX B;  5TSS A;  3RZD H;  1K3R A;  2NVX H;  2UXB L;  1VS0 A;  1UE7 A;  1EY0 A;  3PIO 3;  1FNU A;  4KKT A;  2VUM G;  3KK7 A;  4I7Z C;  3VYR A;  5LHY 1;  2AMC B;  5JAV A;  3HOY B;  2SEB D;  4YIJ A;  2K01 A;  1ZEQ X;  3K5O A;  4IFD I;  1TWG H;  2ICI A;  3S16 H;  4LF7 Q;  4GN4 B;  3HOZ B;  1IYJ B;  5C4X G;  3CCQ A;  4IOA A;  3GO5 A;  5EKL A;  5CGK A;  3K81 C;  5M3M G;  1TWH H;  1F9Q A;  2EJM A;  1JT8 A;  1SE8 A;  4TSS A;  3ER0 A;  2FJ2 A;  2DNE A;  3BZK A;  5E1F A;  1V8Q A;  5AJ3 Q;  4JOI C;  5CV9 A;  3PO3 G;  3Q6S A;  4BBR H;  4DV0 L;  4A3J G;  2IX1 A;  3MWY W;  4DAV A;  3BYY B;  1WTV A;  3CCJ A;  3LNN A;  4KN4 C;  1RIP A;  4HIO A;  3CCE A;  3H09 A;  3PSI A;  3VR6 A;  3AB9 A;  4YCW A;  5IGF A;  5KIX A;  1VQ8 A;  4UHV A;  1Y1V H;  3NSW A;  4PMC A;  2UXD L;  1SRU A;  1PH6 A;  2N8N A;  4OO1 G;  1J8I A;  2AQ3 B;  5ELB A;  4EQP A;  2PI2 E;  5F2D A;  4YWM A;  3ONA B;  2KCC A;  2R7F A;  5BN4 A;  4DV7 L;  4BY1 H;  3DHQ A;  4DV3 L;  4NP5 A;  1STE A;  3H91 A;  1IBL L;  3A0J A;  3KF6 B;  4DFA A;  1CQV A;  3GD7 A;  3I3C A;  3I4M G;  1Q1B A;  2LKV A;  1VQM A;  3IKJ A;  3MFY A;  2BA1 A;  5IYB G;  2Q2U A;  4UP8 A;  1V1P A;  2A6E D;  2WV6 D;  4IFD G;  1PRT C;  2MQH A;  3K0X A;  4J8Q A;  3H3V H;  1JB7 A;  1A2T A;  1SR3 A;  5IT9 E;  3V05 A;  4GNX A;  1I3Q H;  1O7Y A;  3MTS A;  5KNB A;  4P73 A;  4QGU A;  2NZO A;  3S17 B;  5CV5 A;  1VQ9 A;  1J9O A;  3FPU B;  4DN4 M;  3R3O A;  3G4S A;  2F0I A;  3L0O A;  1OXV A;  4LFC L;  4ME5 A;  2C35 B;  4RH6 A;  3E6Z X;  1BCP B;  1ENF A;  4KHP Q;  2JE6 I;  2EYF A;  4Y52 H;  1PLF A;  4UP9 A;  4XTC S;  2O2L D;  4A3K G;  1XX8 A;  3NTH A;  4IOC A;  2XGT A;  1ENC A;  3TSS A;  5ISR A;  5KRU A;  1RF2 D;  1AP0 A;  3T53 B;  4C56 C;  2EY1 A;  2VNU D;  1CSQ A;  1HFG A;  1D5X C;  3NEL A;  2NWG A;  3CME A;  1K8A C;  1CKM A;  5C44 G;  2UUB Q;  3S14 B;  4OXP A;  1IZ6 A;  4F8M A;  2I5H A;  2CCZ A;  2F0V A;  1BUV T;  5E7N A;  2BE5 D;  1EWC A;  3OIP A;  2F0L A;  4AQY L;  2RCF A;  4LUV A;  3U4Z A;  4FO2 A;  3V96 A;  3MAQ A;  5G3L F;  4QMG A;  4HCS A;  1SYC A;  4C3I G;  1XTD A;  3KF6 A;  1HUM A;  3NK9 A;  2JA7 B;  1YI2 A;  2E5L L;  3HEJ A;  1PTO H;  1STB A;  4K5X A;  4A3E H;  3D0F A;  5IOD A;  3OWE B;  1X55 A;  1YVC A;  5JEA H;  1KAA A;  3UDF A;  4KY5 A;  3H3V I;  2A74 C;  4A3L H;  2EYJ A;  3FP9 A;  4BS9 A;  3HOX H;  2N55 A;  4WJ3 M;  1PH9 A;  2ZM6 Q;  4ZKB B;  4LUO A;  1CZG A;  4X64 Q;  1CKO A;  2IX0 A;  5FO9 B;  4LF8 L;  3VYT A;  1R9T B;  3S2H B;  3DEP A;  1T9H A;  4JYA L;  2UXC L;  2SNS A;  1EQR A;  4HN7 A;  4RCN A;  2ZJR A;  3Q22 A;  3R2T A;  3DWQ A;  2EY2 A;  4IJH A;  4O2D A;  4R8N A;  1LTG D;  3OSO A;  1AEX A;  2EOT A;  3HOV B;  2D2C C;  4KD3 A;  5E4X A;  1O80 A;  4C1N K;  3EFX D;  1K8O A;  1CHQ D;  4KHV A;  1CHP D;  1V1O A;  1YNN D;  3RUZ A;  1NY4 A;  3I4L A;  3KLS X;  4P2C B;  3Q0A A;  2D5D A;  2GN5 A;  1KHI A;  1M4V A;  2PYK A;  1ZXT A;  4DUY Q;  1GUS A;  1EY9 A;  1TXY A;  3NWT A;  3F2B A;  3TRZ A;  1L1O B;  4BY1 G;  5IT9 L;  1U4L A;  3I72 A;  5EGT A;  1EIY B;  4A3I B;  3IL8 A;  3S1R B;  4LF9 Q;  1IHZ A;  1E2Z A;  1GUT A;  2NVQ B;  1V43 A;  5LMN W;  2R92 B;  1OXU A;  4BXX H;  3J81 E;  4DR6 Q;  1SNQ A;  4B08 A;  1D1I A;  2B2W C;  3CRL C;  1YBY A;  2RDH A;  1VQ4 A;  1CUK A;  2J0T D;  1DJR D;  2TSS A;  4HID A;  3A55 A;  2DY7 A;  4JI2 Q;  5ELO A;  2EDG A;  3FKI B;  3TN2 A;  4JI5 Q;  4APV A;  3E0J A;  4JI3 Q;  3BVZ A;  1LT5 D;  1X65 A;  1XNR Q;  1IW7 C;  4R4O A;  3CF5 A;  4QQB X;  5M5W H;  1FGB D;  3A5Z B;  1ZKO A;  5HGQ A;  2F0M A;  4A93 B;  4DF7 A;  1YZ6 A;  1OXS C;  1DOM A;  4JI8 L;  1XWE A;  1IL2 A;  2K5D A;  1EYA A;  4IUT A;  3M3Y B;  5FO8 B;  2B2V C;  2OTL A;  3SGI A;  4CJ2 C;  2KEC A;  3OYY A;  4O42 A;  1Y8N B;  2ASB A;  1NR2 A;  1N33 Q;  3D6C A;  1M1K C;  3OHX C;  4J1M A;  2JK8 A;  5IP7 G;  1B50 A;  1SN8 A;  4X3K A;  4PG3 A;  4GOP C;  4FVM A;  1F2L A;  4JK1 C;  1PRT D;  4R4T A;  4DV5 L;  3D3R A;  2ZJP A;  4NB3 A;  3EVQ A;  3KBX A;  1TWF H;  1S5C D;  3S1M H;  2HIX A;  4K6D A;  4GN5 A;  4B3M Q;  1E22 A;  1Q46 A;  1GUG A;  4L8J A;  2OCE A;  4BBS B;  2A6H C;  1JC7 A;  4ZQ3 A;  5IGD A;  4LFA L;  4PMB A;  1KAB A;  5H1S E;  1SRO A;  1VQO A;  3GV3 A;  4OX9 L;  1K9M C;  1AW7 A;  2ZXR A;  3HOU G;  2A5H A;  1O7Z A;  1NAP A;  2N88 A;  3HKZ B;  2B63 G;  1WTO A;  4KKU A;  3SK4 A;  4C3H B;  3N6R A;  4BY7 G;  2OWO A;  1SMY C;  2KEN A;  2G9H D;  2MO0 A;  3C1E A;  3TEH B;  4FXD A;  1L1O A;  2LXK A;  1LTL A;  4RAU C;  1N34 Q;  2XSC A;  1I50 H;  3ULL A;  1SJE D;  3VR4 A;  2F0K A;  1SBB B;  2VS1 A;  1B7Y B;  3T1H Q;  1LAB A;  3G6J B;  1K8M A;  3HGB A;  3AFP A;  4K8I A;  4A75 A;  5BN3 A;  4RGO S;  5M9O A;  2YTX A;  4P75 A;  1KLU D;  3HOX G;  5IGE A;  5GAG C;  5IIF A;  4A3M B;  1IL8 A;  1JOQ A;  5ELE A;  4CDC C;  4DR7 Q;  3UE1 A;  3FDT A;  1QVC A;  2D0O A;  3PF4 A;  1NCV A;  1STA A;  1VQB A;  4DGZ A;  3HOY G;  3OIQ A;  5EKI A;  4JI4 Q;  1SNC A;  4NKL A;  2OF1 A;  3NP8 A;  2F3V A;  3H3V C;  5KEE A;  2PMZ B;  2L12 A;  3I90 A;  5D65 A;  1KL9 A;  1LYL A;  4PZ8 A;  2RHS B;  4NXN Q;  2KED A;  2I5M X;  1SEB D;  3CQZ B;  3MA2 B;  3J81 L;  2IL8 A;  4MHE A;  4A3G B;  3M4Q A;  1FVI A;  3GTK B;  1SYG A;  1AZP A;  4QIW B;  3CKI B;  5EAY A;  4KY6 A;  1X32 A;  3K7A H;  5IT9 c;  2WFW A;  1HH2 P;  1I5F A;  1JQY D;  4JV5 Q;  3CCU A;  1HTL D;  4A4I A;  1O7L A;  3KFU A;  2F0S A;  3TDQ A;  3GTL B;  1RKN A;  3DWP A;  3C46 A;  3K57 A;  2L9H A;  1EY5 A;  3HOW B;  2HQL A;  5FLM G;  1UNS A;  2AUJ D;  3MZ5 A;  1B1Z A;  2BH8 A;  2CFM A;  2NVY H;  1PH3 A;  1EZ6 A;  5C4X H;  1EU3 A;  2VQF Q;  4ODG A;  4XT3 B;  3CCM A;  5M3M H;  3GTM B;  1I4X A;  3M4O B;  1X56 A;  5GAD C;  3PO3 H;  3R2I A;  4LF5 Q;  1PXU A;  4A3J H;  2L4N A;  4WOR A;  1UEA B;  1KTK A;  3W5O A;  1LTT D;  3A7A B;  5M3F B;  2NBF A;  1Q7Y C;  1QZG A;  2HDM A;  2XTI A;  1ICF B;  4L5R C;  4CBV A;  4KMU C;  2R6G A;  1Q90 A;  2Y0S E;  1Y69 U;  2B2T A;  2PW7 A;  4CKE A;  2ENB A;  1QIL A;  3BDC A;  1EY4 A;  3X3N A;  1WJJ A;  1PTO C;  3BS1 A;  2JA6 B;  3KJP A;  5JJI A;  2WB1 B;  1HUN A;  4OO1 H;  1EY8 A;  2CQA A;  1PRT F;  3I4O A;  5LMU Q;  3E5S A;  4DUZ L;  1JB3 A;  1Z7T A;  1K83 B;  2QF7 A;  1H9J A;  3DUZ A;  4EQN A;  1Z9F A;  1CA6 A;  3TRE A;  2F0E A;  2V1C C;  2F3I A;  4NW2 A;  3I4M H;  1VQC A;  5IYB H;  3QO2 A;  2N3S A;  1R4P B;  2F0F A;  5I9O A;  2KVM A;  4IFD H;  5BR8 L;  4GLX A;  2UUA L;  3MC0 B;  2E2J H;  2C5C A;  4HR7 B;  1Q82 C;  1BBU A;  1TQO A;  4DK6 C;  2B3G A;  4NPS A;  3UI2 A;  1TWC B;  1KDB A;  3W3A A;  1P16 A;  1VMP A;  1K3B C;  1FJG Q;  4BBS H;  4H7B A;  3C3L A;  4KY7 A;  1LUZ A;  1XNQ Q;  3D31 A;  4GOP A;  2HHH L;  2NN6 I;  1EQT A;  4MNO A;  5GAE C;  4ULL A;  5J22 A;  5EBC A;  1TT2 A;  3D8G A;  4IQZ A;  5A35 A;  4LFB Q;  1WCM B;  4G7O C;  4X6A H;  1CK1 A;  3PIO A;  1ONL A;  1QG7 A;  1Y1W B;  4X65 L;  1BOS A;  2LSS A;  2A6H D;  2F52 A;  1AH9 A;  4FXG C;  4DV1 L;  2JEA I;  3I55 A;  2NVT B;  1J5E L;  1XMO L;  3MXN B;  3FPP A;  4Q5V A;  2K33 A;  1WTH A;  2MO1 A;  3NHH A;  2JA7 G;  4FF3 A;  4IUV A;  4YWL A;  1KLG D;  3PGZ A;  5IY0 A;  3CCR A;  4A3K H;  4LF6 L;  1SMY D;  3GTQ B;  3F8T A;  4ZAI A;  2R7Z B;  4DR4 Q;  2D0P A;  3J81 c;  4OIJ A;  2RA4 A;  2I0Q A;  1PYS B;  2VQE Q;  1ET9 A;  1U9R A;  4DAY B;  1A3U A;  1NMF A;  2C9O A;  1IBM Q;  2B2Y C;  1HHV A;  1KDA A;  3NTK A;  5C44 H;  4JBK A;  5HGT A;  2NZH A;  2F4V Q;  1VQ7 A;  4GKJ Q;  1JE4 A;  3CCV A;  1EFI D;  3SR1 A;  4POF A;  3NBH B;  2JA5 B;  2E2D C;  1HNX Q;  1WD0 A;  4RGM A;  2Q2T A;  1D2B A;  2CVR A;  3MHB A;  4DR5 Q;  4IUP A;  2XVS A;  5HUR A;  1N36 L;  3A54 A;  4C3I H;  2KHS A;  3GTG B;  2QDB A;  4BWG B;  3HOV G;  3NWS A;  1LT3 D;  3EBE A;  1X3F A;  1EFW A;  4DU9 A;  4A3F B;  1SFO H;  4MTK A;  1MI2 A;  1X3Q A;  3L3O C;  2NN6 G;  1CT1 D;  3DLL A;  1DGS A;  2J7Z A;  4A3B B;  3OMG A;  3OW7 A;  1F9P A;  4JI1 L;  1VQF A;  4CDD C;  5DAU A;  1E0B A;  1PH1 A;  3STB D;  5FJ8 G;  4A3I G;  5A2Q E;  4OWX B;  4CKC A;  4XQN A;  1PHJ A;  2R92 G;  1QVF A;  2BA0 A;  2WAQ B;  2RCN A;  4K2L A;  1HR0 L;  5IWA Q;  4JI7 Q;  3T16 A;  2GA4 B;  1A63 A;  2UU9 L;  4C3J H;  4G7Z C;  1SXT A;  4M8A A;  4KTA A;  3CC4 A;  3BZC A;  3U50 C;  3S1N H;  4MZ9 A;  4DR1 Q;  3FKI G;  5JPN C;  1IYU A;  3PO2 B;  3VA7 A;  4HJA A;  1Q8I A;  2R93 B;  1RTN A;  5FOB B;  1MJC A;  2KHJ A;  3MXN A;  2B8F A;  4WRD A;  2Q2H A;  5NUC A;  1Q86 C;  4HMI A;  1ASZ A;  1OO9 B;  3PUW A;  3GTJ H;  4A93 G;  5IP9 G;  5FK9 C;  4PNY A;  4CKB A;  1EYD A;  2DUD A;  5M5X B;  1W3S A;  3TP8 A;  2RHQ B;  4JBJ A;  2BDN A;  4R4C A;  4KV6 A;  1VQD A;  4IFD J;  1X3P A;  4KI0 A;  1SMX A;  3T51 B;  1TS3 A;  4DAY A;  4KD4 A;  5C4H A;  1YJW A;  1STG A;  1V9P A;  1VQG A;  4B3R L;  3EQL C;  1JR0 D;  4JI0 Q;  1HNW Q;  1XYI A;  2RKS A;  5CMD A;  1YIJ A;  3NBH A;  1I6H H;  3M9B A;  1BKB A;  5J1Z A;  2KCM A;  4R4Q A;  1I94 L;  4X66 Q;  4UP7 A;  1QE6 A;  1II3 A;  4JBM A;  2OT2 A;  3K5L A;  1BF4 A;  1C0A A;  1D8L A;  2E74 C;  1JOO A;  1B2T A;  4BBS G;  3ZYY X;  2LY7 A;  2EQS A;  5IGB A;  3GTP B;  3S1Q B;  2MPM A;  1S72 A;  1VMC A;  4X62 L;  1A15 A;  2Z4I A;  4QIW E;  1RJT A;  3VDY A;  1N32 Q;  5I4D A;  1EUJ A;  2QGQ A;  1YJ9 A;  4IJL A;  1GUO A;  4C3H G;  1EQV A;  1ROD A;  2M2L A;  5CR3 A;  1CFM A;  1S5E D;  5EPJ A;  4G57 A;  4GLV B;  3X3M A;  4RMF A;  4YCV A;  3K5M A;  2OEO A;  2Q8I B;  2LS0 1;  1PH5 A;  2Z6K C;  5IP7 H;  4HIM A;  1NMG A;  3KF8 B;  1CZW A;  4A3D B;  4KHZ A;  1CKN A;  5EQ0 A;  3UDX A;  2AKW B;  4P72 A;  1X9N A;  3F1Z A;  3I73 A;  1ZYR D;  3T4A C;  3T1Y L;  4QJF A;  1FL0 A;  5LL6 S;  3RZO H;  1MIU A;  4OWW B;  1MHW C;  3J80 i;  1TU2 B;  3RLN A;  4OGQ C;  4DV2 L;  4DV6 Q;  4Y7N H;  3QOL A;  4XIG S;  3RMH A;  4A3M G;  1G8Z D;  3TME A;  3AFQ A;  1UE6 A;  4QL5 A;  3QOJ A;  4GS3 A;  5FLX E;  1U4R A;  4DR3 Q;  3I4N B;  3HOU H;  2JYO A;  1C48 A;  3HZX A;  4N8X 1;  2B63 H;  1ASY A;  1X54 A;  1GO3 E;  3K80 C;  1IYV A;  4BY7 H;  1DOL A;  2EY5 A;  3BZD B;  4X3U A;  1KQS A;  3JAM i;  1Q8K A;  5COY A;  4LF4 L;  2DGY A;  1CQF A;  1MJE A;  3WWV A;  1PYW D;  1C7Y A;  2K5W A;  1W2B A;  2HQE A;  4DKA C;  2K6A A;  2K4K A;  3ZJY C;  4NXM L;  1AZQ A;  1U4M A;  1A3V A;  4A3G G;  2BOS A;  1BNZ A;  1XTC D;  2AHO B;  2JA5 H;  4YY3 Q;  4DV4 L;  4HAE A;  5CV8 A;  4HJ9 A;  4RKL A;  4A3C H;  1X6O A;  5GAH C;  1SNO A;  2JA8 B;  4HMJ A;  3GTG H;  2R61 A;  2HUG A;  2IHE A;  4O1N A;  1R4Q B;  4PZ6 A;  4B3T L;  4FF1 A;  1A2U A;  3HOY H;  1PRT B;  1Y14 B;  4C3J G;  2UUC Q;  3DWA A;  4L5Q A;  2A68 C;  4H02 A;  1UWV A;  2RDF A;  1PYB A;  1SND A;  5JOB A;  1VQ5 A;  3HOZ H;  5IE8 A;  3A5U A;  4B3S Q;  4U67 3;  1JOK A;  5EBD A;  1IBK L;  1GXD C;  4RWS C;  1SLJ A;  2KHI A;  4QB4 A;  4BA1 I;  3IAY A;  1XMQ Q;  3KF8 A;  5T1G A;  1SSO A;  2CHB D;  4R8I A;  2EJF C;  1XXG A;  3F2C A;  1WTP A;  5M3F G;  2RF4 A;  2KBN A;  2G9D A;  2IY5 B;  4HTH A;  5HY6 A;  4HIK A;  4EQO A;  2Z0S A;  2VUM B;  1VQP A;  2B2U C;  2PNH A;  3NQI A;  4N8F A;  4OWT B;  4OON A;  4JOI A;  1HNZ Q;  3ND8 A;  4LF7 L;  1IKM A;  1CM9 A;  3P75 A;  3W1G A;  2JA6 G;  1E2V A;  3MXG A;  5FLM H;  3PF5 A;  2WB1 G;  4A76 A;  2K7V A;  4KJO A;  5DM6 3;  5I2X A;  4JPB W;  5AJ3 L;  4HCE A;  3FHW A;  1Z47 A;  3KOJ A;  1Y8P B;  1YIT A;  3CCL A;  2HT1 A;  2DY8 A;  2PQE A;  1PTO F;  1TS2 A;  2JSO A;  3RD4 A;  3BDL A;  4RFB A;  3GDE A;  4DNT B;  3GP7 A;  2CH4 W;  3LWE A;  2O4X A;  3HP3 A;  4YHH Q;  1PA6 A;  3BU2 A;  3NEN A;  1PZJ D;  1YNJ C;  3RR5 A;  1E3P A;  3CU7 A;  1DON A;  4ZRZ A;  2E2H B;  3ERS X;  3FMC A;  5FLX L;  1LTS D;  3QJY A;  3GTP H;  5LMN Q;  1X3E A;  1VQK A;  5GRO A;  3K5N A;  3S17 H;  3KJO A;  2PZW A;  3T56 B;  4XXE A;  5FO7 B;  4ZLT F;  3NTI A;  1QB5 D;  4JI6 Q;  1WCM G;  2YU9 B;  4PQX A;  1JOR A;  1OXX K;  3OTO Q;  3S15 B;  4GKK Q;  1Y1W G;  1IXR A;  5CBA E;  4PZ7 A;  4AH6 A;  2EYO A;  1N9W A;  4XQQ A;  1QUQ A;  2AUK A;  2ID0 A;  2WAQ E;  4POG A;  1KDC A;  1NJI C;  1RHP A;  4A3D H;  4QUF A;  2K5V A;  2MJ8 A;  1QJO A;  4DPG A;  5JVH 3;  4WJ4 A;  4IN3 A;  1TY0 A;  5JEA J;  1K73 C;  3NBI A;  4DXF A;  1LM0 A;  1EYC A;  4ZUJ A;  2WP8 J;  4CDF C;  4K0K Q;  1VF5 C;  2Z6K A;  3S14 H;  5ELD A;  2I5L X;  5JPM C;  2EIF A;  2ZT9 C;  4PV1 C;  3I4N H;  1HR0 W;  4YWK A;  2VZA A;  3ULP A;  2JA5 G;  2L15 A;  3IFD A;  2Z1C A;  4K14 A;  2XWJ B;  4KHP L;  3GTO B;  1G6P A;  2A73 B;  2PZT A;  2MUY A;  3AQQ A;  3SK6 A;  2Z8L A;  1WTW A;  4A3C G;  2F0O A;  4DR2 Q;  1GOZ A;  5C3E B;  1NE3 A;  1Q3L A;  2QEJ C;  1NUC A;  2X6L A;  2YYZ A;  2UXB Q;  2IT1 A;  2JA7 H;  1SYB A;  4XYQ A;  4LUZ A;  4A3F G;  3K59 A;  5LL6 X;  1MSG A;  3BG3 A;  4XT1 B;  3M7G A;  1UUP A;  4L6T B;  3HOZ G;  2UUB L;  4A3B G;  4H44 C;  4FF2 A;  2E2I B;  2NUC A;  1K0R A;  2KQ3 A;  3I56 A;  1R9T H;  4IPD A;  3S2H H;  1GM5 A;  1B53 A;  4CJ1 B;  4RCO A;  2WAQ G;  2F0P A;  5JJZ A;  2G5D A;  5C4J B;  2B8G A;  3H0G B;  3I70 A;  5M5Y B;  4DV0 Q;  1EY6 A;  2K75 A;  3A56 A;  3RZD B;  2NVX B;  1VCI A;  2F0N A;  1HZB A;  3HOV H;  1P8L A;  1O7I A;  3T13 A;  3NE5 B;  3PO2 G;  1F2M A;  1SE3 A;  2IW3 A;  4GOP B;  2F0J A;  2R93 G;  5EPL A;  2QEX A;  3K8A A;  1TWG B;  3S16 B;  1VF7 A;  2NN6 H;  1DYQ A;  2F03 A;  3TS2 A;  2UXD Q;  4N9P A;  1EU4 A;  5K5P A;  1SE4 A;  2ZM6 L;  3MXU A;  4X64 L;  1TWH B;  3NQT A;  2K04 A;  2X6G A;  3TP7 A;  4L63 B;  4OEM B;  1ML0 D;  5FJ8 H;  4A3I H;  4DV7 Q;  5IYC G;  4DV3 Q;  5J3B A;  3S1R H;  4N9T A;  3DM1 A;  1X3G A;  2EY6 A;  4BBR B;  4HJ8 A;  1IBL Q;  2BH2 A;  2NVQ H;  2R92 H;  2KJX A;  1XPO A;  2HCI A;  3V2T A;  4ME3 A;  1YNX A;  2L0C A;  1RTO A;  2K5H A;  5L37 A;  2E8G A;  2FIN B;  1D5M C;  1SNP A;  1VQI A;  3ND9 A;  3CPW A;  1RDP D;  2KEE A;  5FLX c;  3CCS A;  1PDQ A;  1T5X D;  3FKI H;  3KYH C;  1A0I A;  1Y1V B;  2M00 A;  4ZK9 B;  3Q23 A;  4R4I A;  3P20 A;  5IYD G;  1F2Y A;  2KA7 A;  4IPC A;  4DUY L;  2B2W A;  1HRJ A;  1I4G A;  4A93 H;  5IP9 H;  4FNF A;  4ZCK A;  3C1F A;  2PI2 A;  4K2K A;  1A8V A;  4LF9 L;  3M3Y H;  2QDL A;  1SYD A;  5E4W C;  4HSP A;  2NTS A;  4DR6 L;  1EWI A;  4LFC Q;  1IW7 D;  2FMM A;  4KJN A;  4B9X A;  1G2S A;  5I6Y A;  3RNU A;  1RCV D;  4GNX C;  2E2H H;  1V1Q A;  1FNW A;  3N52 A;  1HZC A;  4OIK A;  4JCV E;  3S24 A;  4R9W A;  4RKB A;  1JMC A;  1S5D D;  4A3D G;  4JI2 L;  1G51 A;  4JI5 L;  1QNK A;  3CPF A;  1S4Z A;  2B2V A;  4FXK C;  4JI3 L;  2QA4 A;  2MHV A;  4DNR B;  1XNR L;  1E24 A;  3HFZ B;  2KCT A;  1B44 D;  2FHT A;  2JXM B;  1UE1 A;  1KNE A;  3TP6 A;  1H95 A;  1I3Q B;  3PUV A;  1DOK A;  4DXG A;  2H1E A;  4H13 C;  2A69 C;  3SXH A;  1WTR A;  2I07 B;  3K58 A;  3ULJ A;  2Q2I A;  2YV5 A;  1H9S B;  1NNX A;  2DN8 A;  3I4N G;  1LT6 D;  2K50 A;  4F88 A;  4C2M B;  1N33 L;  3L9A X;  4C3H H;  4AQY Q;  1JWS D;  3M85 A;  1HJP A;  1LT4 D;  1M8A A;  2PO4 A;  2LFN A;  1SAP A;  4EQ5 A;  1PMR A;  4ABN A;  2NTT A;  1F77 A;  1Q1E A;  1VQH A;  5JJL A;  3S9W A;  3CC7 A;  1B70 B;  1TS4 A;  1YHA A;  3PUZ A;  1PZI D;  3DXJ C;  4B3M L;  3CHB D;  5C0X I;  1LTR D;  2E5L Q;  1QVG A;  1EZ8 A;  4E6I A;  5D3D A;  5DM7 3;  1Y8O B;  1A62 A;  4IPH A;  4YCU A;  1MSH A;  4A3M H;  2JA8 G;  2AWN A;  3O13 A;  3TP5 A;  4LW1 A;  4LF8 Q;  1HXY D;  5KYI A;  1DXM A;  3RN5 A;  2LMC B;  4U68 A;  1F9S A;  4JYA Q;  2Z9H A;  2UXC Q;  1T5E A;  1N34 L;  4LNQ A;  1BVS A;  1BO0 A;  1GD7 A;  4IO9 A;  2K52 A;  2RSN A;  1STH A;  1BQQ T;  1E1T A;  1PFN A;  3T1H L;  4LJZ C;  5ELN A;  1XJV A;  2FXQ A;  4NDX A;  1PTO B;  2JEB I;  3CQZ H;  2E2I H;  3LWU A;  4A3E B;  4UAI A;  2RQX A;  4A3G H;  2HCC A;  3GTK H;  2HDL A;  3M4P A;  2EYP A;  4RG1 A;  4V19 0;  3E9I A;  1G6Z A;  3J7A F;  4KLK A;  2QCP X;  3PUY A;  2ZJQ A;  3G71 A;  2AQ2 B;  1VQE A;  1BCP C;  4HJ7 A;  4P71 A;  1F2Z A;  4DR7 L;  1O78 A;  2IJ0 A;  1D5Z C;  1OTC A;  1VDZ A;  4LWC A;  2Z4H A;  4AIM A;  2K5N A;  4JI4 L;  3GTL H;  2D9U A;  5D3I B;  1JIC A;  3KDF A;  3QB3 A;  1WI5 A;  1YNN C;  1CKN B;  3M7N A;  1H9S A;  2GVA A;  3HKZ E;  1VQA A;  3HOW H;  1ENA A;  5C0X G;  3TS0 A;  4NXN L;  2F0Q A;  3CP0 A;  3JC6 6;  3A8I E;  4LAA A;  4RA8 A;  1I4R A;  1NBW A;  4XQJ A;  2RDG A;  2IWH A;  1QNU A;  5EKK A;  3GTM H;  4BA2 I;  3F2D A;  3HRZ C;  3M4O H;  1H9M A;  3GV6 A;  2EJG C;  2AWO A;  3L2P A;  4JV5 L;  1B3Q A;  2HIV A;  1E2W A;  1HPC A;  3SE0 A;  2L5T A;  4UY8 C;  4JI8 Q;  5KGU A;  2EYH A;  5M3F H;  2VL6 A;  2P5Z X;  3CXC A;  1H9R A;  3CMA A;  3MVV A;  1SE2 A;  2DJF C;  1NSN S;  2JN4 A;  3ICE A;  2EZV A;  2PZU A;  3OOC A;  3S2D B;  2XRS D;  4O0A A;  2TMP A;  2JA6 H;  4X3S A;  1TII D;  3J7Y W; 
#chains in the Genus database with same CATH homology
 2O5J C;  1LO5 D;  1C8C A;  3U9O A;  3QG1 A;  3AMU A;  4CHT B;  5BN5 A;  2XWB B;  5M5W B;  1ILQ A;  1I4Q A;  2ZXO A;  4IUQ A;  1EOT A;  2F3W A;  1QOH A;  3D4R A;  4CJ0 B;  1PTO D;  4PMW A;  4G7H C;  1SYE A;  2I46 A;  1EY7 A;  1GUW A;  2PPB C;  3KLS A;  4X3T A;  2V4D A;  2WII B;  1GHJ A;  4UDU C;  2L55 A;  1RD9 D;  1D1K A;  5I2Y A;  4ZYS A;  1DCZ A;  1TVX A;  4IZ8 A;  1GHK A;  3VR3 A;  1TWF B;  3SHL A;  3S1M B;  4XYO A;  3K0Y A;  2EXZ A;  3KBG A;  2Q8T A;  1HFN A;  1STN A;  1B9M A;  3F2U A;  1ESR A;  2F4I A;  1B4O A;  2A69 D;  3BVG A;  3D4D A;  1WTX A;  3A7L A;  5CYU A;  4OL7 A;  3QIA A;  4WJW A;  4OHJ A;  4C1N I;  4DA2 A;  4QF4 A;  2VXW A;  3H94 A;  4AYB B;  3FVQ A;  3W2D A;  1I50 B;  4RGN A;  2RVL A;  3PMF A;  5A2Q L;  3SK5 A;  2Q8R E;  5K36 G;  4HED A;  1HQR D;  1HCZ A;  2WIN B;  2IPK D;  4QUC A;  5T1I A;  1DM0 B;  3AU7 A;  3NXW A;  2CW0 C;  5EPK A;  3LX0 A;  3DMU A;  2K1B A;  2E75 C;  4NMZ A;  4Z9C B;  5I6W A;  2Y0S B;  1PFM A;  5ELC A;  1QCB D;  1I4P A;  2B2Y A;  4DK0 A;  1Z6H A;  3VYS A;  5C5M A;  1IKL A;  2WAC A;  3I91 A;  3OWF A;  3WOF A;  2B39 A;  5IOC A;  2F0U A;  5CC4 A;  1A6X A;  4HSV A;  2F0G A;  2VB3 X;  1LTI D;  1LLR D;  3D4W A;  1MBY A;  2IX3 A;  1SDF A;  1WVL A;  2PW5 A;  4FP5 D;  3K7A B;  5EJW A;  2KCN A;  3BYT B;  3C2P A;  1AN8 A;  1ICW A;  3J80 E;  3OPO A;  4RHR A;  1BCP D;  5KNC A;  2ZXP A;  2OXP A;  4LK1 C;  2WKD A;  3P1H A;  5E3F A;  1U4P A;  2NVY B;  3JAM E;  2QIL A;  5C4X B;  1PZK D;  4K5W A;  2WKC A;  5M3M B;  1TR5 A;  2PCF B;  4G4K A;  2B2T C;  1EWH A;  3PO3 B;  3WOE A;  4A3J B;  2X69 A;  5J39 A;  1W6K A;  2FFK B;  1GUN A;  1HTP A;  2K28 A;  1DZ1 A;  1SYF A;  2E76 C;  2EE1 A;  2J4X A;  2XIW A;  4I65 A;  4Q0F A;  4FF4 A;  1LV9 A;  1CTM A;  2D62 A;  4WFN 3;  4ID6 A;  3VYU A;  3TBI B;  1BXT A;  3I4M B;  1FYC A;  5IGC A;  4ILW A;  1OXT A;  1C4Q A;  2F1M A;  3FEW X;  1I4H A;  3Q24 A;  1EIH A;  2K5Q A;  4QCL A;  2E2J B;  3RLF A;  4EVO A;  1S5B D;  1HA5 A;  1B3A A;  4S3S A;  1EIG A;  2F0W A;  3VR5 A;  5FKA C;  1G2T A;  5D14 A;  4CGY B;  3BDO A;  3SDZ A;  1TY2 A;  2R3Z A;  3PUX A;  4RGT A;  1JCK B;  1SJH D;  1TWA B;  3CRK C;  1L0Y B;  4F7X A;  1JWM D;  2PNR C;  5CBE E;  1STY A;  3A8J E;  3EJI A;  3VA5 A;  2XRQ D;  4A3K B;  3ERO A;  1A3T A;  1W6J A;  4IAL A;  3D6W A;  5JEA G;  3J80 L;  1G91 A;  3J7A V;  1TS5 A;  4TQU S;  2BCO A;  1Q12 A;  2NZ1 D;  5C44 B;  2F0H A;  3A8K E;  3HS0 C;  3I8Z A;  3JAM L;  3BVM A;  3SEB A;  2CW0 D;  1B9N A;  5CV7 A;  4C3I B;  5C3W A;  3P7J A;  5C4Z A;  1BCP F;  4KKS A;  1TKW B;  3U9S A;  1SFO B;  5C3X A;  2F0T A;  1I6V C;  3KUP A;  3PV0 A;  4TKO B;  3TZU A;  4EGV A;  3MEH A;  2A68 D;  3DEO A;  2BDO A;  2NYZ D;  4JBW A;  3EA6 A;  2O5I C;  2RBM A;  1HA6 A;  5DEH A;  4C3J B;  1SNM A;  2EPB A;  2L11 A;  5C0X H;  3S1N B;  3M4Y A;  2AQ1 B;  3URY A;  1FNV A;  3ITP A;  1EEI D;  4GZY C;  4F87 A;  1KNA A;  2MP1 A;  1ESF A;  2B2U A;  2H4O A;  3K6O A;  4IUR A;  3R8B A;  2VB2 X;  3GTJ B;  5I9P A;  2JP1 A;  2L1B A;  3VR2 A;  1G29 1;  3HG9 A;  3NPP A;  1LTA D;  4BY1 B;  2A6E C;  2ICE C;  1H9K A;  5C5L A;  3OMC A;  1CA5 A;  1EL0 A;  3ERQ A;  1MD2 D;  1UAP A;  1BDO A;  2K03 A;  5AFW A;  1LTB D;  3R93 A;  3SK8 A;  1ILP A;  2RSO A;  1I6H B;  3QWN A;  1AFP A;  2QKI C;  3KLR A;  3TZD A;  1YNJ D;  5KND A;  2EVB A;  1WD1 A;  1EEF D;  1QWY A;  4K5V A;  1L0X B;  3MFG A;  3FRP B;  3GQB A;  4MIU A;  1CI3 M;  4H0L C;  1FD7 D;  4K6L A;  2KOL A;  4IUU A;  1FR3 A;  4KN7 C;  1BBX C;  3SVM A;  1ZYR C;  4ZUI A;  5KYL A;  1HQM C;  4DK1 A;  4J6H A;  2KUM A;  1NR4 A;  1JWU D;  3IFT A;  2FMC A;  4B9W A;  1S5F D;  3MXP A;  1MGS A;  4M1U B;  4V0B A;  4RHS A;  2BE5 C;  1LAC A;  4FYD A;  5C6A A;  4K8J A;  3RZO B;  1ET6 A;  4Y7N B;  2XN9 C;  5ELF A;  4IUN A;  3HOU B;  4LMQ D;  2B63 B;  4ZKC B;  2NB0 A;  4BY7 B;  2SNM A;  1F9R A;  5CV6 A;  3H6M A;  5CV4 A;  5IGG A;  4TRD A;  3L7Z C;  5DNF A;  4KK7 A;  2MGS A;  1WTQ A;  3PIP 3;  2K32 A;  2EYL A;  2EYM A;  5K36 H;  1D6E C;  4OO1 I;  2DNC A;  2K05 A;  3G7L A;  3NUC A;  1GJX A;  2SOB A;  1V1P B;  3WDN A;  2F0D A;  1PFB A;  5G3L D;  1BR9 A;  2XNA C;  4XDX A;  3HOX B;  4DAP A;  4MN3 A;  2SDF A;  5COR A;  2M9V A;  5JVG 3;  5C0X J;  1DD2 A;  5TSS A;  3PIO 3;  1EY0 A;  1FNU A;  4KKT A;  3KK7 A;  4I7Z C;  3VYR A;  5LHY 1;  3HOY B;  5JAV A;  2SEB D;  4YIJ A;  2K01 A;  1ZEQ X;  3K5O A;  4IFD I;  2ICI A;  3HOZ B;  3GO5 A;  5EKL A;  5CGK A;  1F9Q A;  2EJM A;  4TSS A;  2FJ2 A;  2DNE A;  5E1F A;  1V8Q A;  5CV9 A;  3Q6S A;  2IX1 A;  3MWY W;  4DAV A;  3BYY B;  1WTV A;  3LNN A;  4KN4 C;  3H09 A;  3VR6 A;  3AB9 A;  5IGF A;  5KIX A;  3NSW A;  4PMC A;  4OO1 G;  1J8I A;  2AQ3 B;  5ELB A;  4EQP A;  5F2D A;  2KCC A;  3ONA B;  5BN4 A;  3DHQ A;  4NP5 A;  1STE A;  3H91 A;  4DFA A;  1CQV A;  3GD7 A;  3I3C A;  1Q1B A;  2LKV A;  3IKJ A;  3MFY A;  2BA1 A;  1V1P A;  2A6E D;  2WV6 D;  4IFD G;  1PRT C;  4J8Q A;  1A2T A;  5IT9 E;  3V05 A;  1O7Y A;  3MTS A;  5KNB A;  3S17 B;  5CV5 A;  1J9O A;  3FPU B;  4DN4 M;  3R3O A;  2F0I A;  1OXV A;  4ME5 A;  4RH6 A;  3E6Z X;  1BCP B;  1ENF A;  2JE6 I;  2EYF A;  1PLF A;  4XTC S;  2O2L D;  1XX8 A;  3NTH A;  1ENC A;  3TSS A;  5ISR A;  5KRU A;  1RF2 D;  1AP0 A;  3T53 B;  4C56 C;  2EY1 A;  2VNU D;  1HFG A;  1D5X C;  2NWG A;  3S14 B;  4F8M A;  2F0V A;  1BUV T;  2BE5 D;  1EWC A;  3OIP A;  2F0L A;  4FO2 A;  3V96 A;  3MAQ A;  5G3L F;  4QMG A;  4HCS A;  1SYC A;  4C3I G;  1HUM A;  3NK9 A;  2JA7 B;  3HEJ A;  1PTO H;  1STB A;  4K5X A;  5IOD A;  3OWE B;  5JEA H;  1KAA A;  4KY5 A;  2A74 C;  2EYJ A;  4BS9 A;  2N55 A;  4ZKB B;  1CZG A;  5FO9 B;  2IX0 A;  3VYT A;  1R9T B;  3S2H B;  3DEP A;  2SNS A;  4HN7 A;  4RCN A;  3Q22 A;  3R2T A;  3DWQ A;  2EY2 A;  4R8N A;  1LTG D;  3OSO A;  1AEX A;  2EOT A;  3HOV B;  2D2C C;  4KD3 A;  5E4X A;  1O80 A;  4C1N K;  3EFX D;  1K8O A;  1CHQ D;  4KHV A;  1CHP D;  1V1O A;  1YNN D;  3RUZ A;  3I4L A;  3KLS X;  4P2C B;  3Q0A A;  2D5D A;  1M4V A;  2PYK A;  1ZXT A;  1GUS A;  1EY9 A;  3NWT A;  5IT9 L;  1U4L A;  3I72 A;  5EGT A;  4A3I B;  3IL8 A;  3S1R B;  1IHZ A;  1E2Z A;  1GUT A;  2NVQ B;  1V43 A;  2R92 B;  1OXU A;  3J81 E;  1SNQ A;  4B08 A;  1D1I A;  2B2W C;  3CRL C;  2RDH A;  2J0T D;  1DJR D;  2TSS A;  3A55 A;  2DY7 A;  2EDG A;  3FKI B;  3TN2 A;  3E0J A;  3BVZ A;  1LT5 D;  1IW7 C;  1FGB D;  1ZKO A;  2F0M A;  4A93 B;  4DF7 A;  1OXS C;  1DOM A;  1XWE A;  2K5D A;  1EYA A;  4IUT A;  3M3Y B;  5FO8 B;  2B2V C;  4CJ2 C;  2KEC A;  4O42 A;  1Y8N B;  1NR2 A;  3D6C A;  3OHX C;  4J1M A;  1B50 A;  4X3K A;  4FVM A;  1F2L A;  4JK1 C;  1PRT D;  3D3R A;  3EVQ A;  3KBX A;  1S5C D;  4K6D A;  1GUG A;  4L8J A;  4BBS B;  2A6H C;  1JC7 A;  4ZQ3 A;  5IGD A;  4PMB A;  1KAB A;  3GV3 A;  1AW7 A;  2ZXR A;  2A5H A;  1O7Z A;  1NAP A;  2N88 A;  3HKZ B;  1WTO A;  4KKU A;  3SK4 A;  4C3H B;  3N6R A;  1SMY C;  2G9H D;  3C1E A;  4FXD A;  4RAU C;  2XSC A;  1SJE D;  3VR4 A;  2F0K A;  1SBB B;  1LAB A;  3G6J B;  1K8M A;  3HGB A;  4K8I A;  5BN3 A;  4RGO S;  5M9O A;  1KLU D;  5IGE A;  5IIF A;  4A3M B;  1IL8 A;  1JOQ A;  5ELE A;  3FDT A;  1NCV A;  1STA A;  4DGZ A;  3OIQ A;  5EKI A;  1SNC A;  4NKL A;  2OF1 A;  3NP8 A;  2F3V A;  3H3V C;  5KEE A;  2PMZ B;  2L12 A;  3I90 A;  5D65 A;  2KED A;  1SEB D;  3CQZ B;  3MA2 B;  3J81 L;  2IL8 A;  4MHE A;  4A3G B;  3GTK B;  1SYG A;  1AZP A;  4QIW B;  3CKI B;  4KY6 A;  1X32 A;  1JQY D;  1HTL D;  1O7L A;  2F0S A;  3TDQ A;  3GTL B;  1RKN A;  3DWP A;  3C46 A;  3K57 A;  2L9H A;  1EY5 A;  3HOW B;  1UNS A;  2AUJ D;  3MZ5 A;  1B1Z A;  1EZ6 A;  1EU3 A;  4ODG A;  4XT3 B;  3GTM B;  1I4X A;  3M4O B;  3R2I A;  1PXU A;  2L4N A;  4WOR A;  1UEA B;  1KTK A;  1LTT D;  3A7A B;  5M3F B;  2NBF A;  2HDM A;  4CBV A;  4KMU C;  2R6G A;  1Q90 A;  1Y69 U;  2B2T A;  2PW7 A;  4CKE A;  2ENB A;  1QIL A;  3BDC A;  1EY4 A;  3X3N A;  1PTO C;  3BS1 A;  2JA6 B;  2WB1 B;  1HUN A;  4OO1 H;  1EY8 A;  2CQA A;  1PRT F;  3E5S A;  1JB3 A;  1Z7T A;  1K83 B;  2QF7 A;  1H9J A;  3DUZ A;  4EQN A;  1CA6 A;  2F0E A;  4NW2 A;  3QO2 A;  1R4P B;  2F0F A;  5I9O A;  2KVM A;  4IFD H;  3MC0 B;  2C5C A;  4HR7 B;  1TQO A;  3UI2 A;  1TWC B;  1KDB A;  3W3A A;  1VMP A;  4H7B A;  3C3L A;  4KY7 A;  3D31 A;  2NN6 I;  1EQT A;  4ULL A;  5J22 A;  5EBC A;  1TT2 A;  3D8G A;  4IQZ A;  5A35 A;  1WCM B;  4G7O C;  1CK1 A;  1ONL A;  1QG7 A;  1Y1W B;  1BOS A;  2A6H D;  4FXG C;  2JEA I;  2NVT B;  3FPP A;  4Q5V A;  2K33 A;  3NHH A;  4FF3 A;  4IUV A;  1KLG D;  3GTQ B;  1SMY D;  4ZAI A;  2R7Z B;  4OIJ A;  2RA4 A;  1ET9 A;  1U9R A;  1A3U A;  2C9O A;  2B2Y C;  1HHV A;  1KDA A;  3NTK A;  5HGT A;  1JE4 A;  1EFI D;  3SR1 A;  2JA5 B;  2E2D C;  1WD0 A;  4RGM A;  1D2B A;  2CVR A;  3MHB A;  4IUP A;  2XVS A;  5HUR A;  3A54 A;  2KHS A;  3GTG B;  2QDB A;  4BWG B;  3NWS A;  1LT3 D;  4DU9 A;  4A3F B;  1MI2 A;  1X3Q A;  3L3O C;  2NN6 G;  1CT1 D;  2J7Z A;  4A3B B;  3OMG A;  3OW7 A;  1F9P A;  5DAU A;  1E0B A;  5A2Q E;  4CKC A;  4XQN A;  2BA0 A;  2WAQ B;  4K2L A;  3T16 A;  2GA4 B;  4G7Z C;  1SXT A;  4M8A A;  4KTA A;  5JPN C;  1IYU A;  3PO2 B;  3VA7 A;  1Q8I A;  2R93 B;  1RTN A;  5FOB B;  3MXN A;  2B8F A;  4WRD A;  5NUC A;  4HMI A;  1OO9 B;  3PUW A;  5FK9 C;  4PNY A;  4CKB A;  1EYD A;  5M5X B;  3TP8 A;  2BDN A;  4KV6 A;  4IFD J;  1X3P A;  4KI0 A;  3T51 B;  1TS3 A;  4DAY A;  4KD4 A;  5C4H A;  1STG A;  3EQL C;  1JR0 D;  1XYI A;  2RKS A;  5CMD A;  3NBH A;  5J1Z A;  1QE6 A;  1II3 A;  2OT2 A;  3K5L A;  1BF4 A;  2E74 C;  1JOO A;  1B2T A;  3ZYY X;  2LY7 A;  5IGB A;  3GTP B;  3S1Q B;  2MPM A;  1VMC A;  1A15 A;  2Z4I A;  1RJT A;  5I4D A;  1GUO A;  4C3H G;  1EQV A;  1ROD A;  2M2L A;  5CR3 A;  1CFM A;  1S5E D;  5EPJ A;  4G57 A;  3X3M A;  3K5M A;  2OEO A;  2Q8I B;  2LS0 1;  1CZW A;  4A3D B;  4KHZ A;  5EQ0 A;  3I73 A;  1ZYR D;  3T4A C;  5LL6 S;  1TU2 B;  4OGQ C;  3QOL A;  4XIG S;  3RMH A;  1G8Z D;  3TME A;  3QOJ A;  3I4N B;  5FLX E;  1U4R A;  2JYO A;  1C48 A;  3HZX A;  1IYV A;  1DOL A;  2EY5 A;  3BZD B;  4X3U A;  5COY A;  1CQF A;  1PYW D;  2K5W A;  2HQE A;  2K6A A;  1AZQ A;  1U4M A;  1A3V A;  2BOS A;  1BNZ A;  1XTC D;  4HAE A;  5CV8 A;  4RKL A;  1SNO A;  2JA8 B;  4HMJ A;  2R61 A;  2HUG A;  4O1N A;  1R4Q B;  4FF1 A;  1A2U A;  1PRT B;  4C3J G;  3DWA A;  2A68 C;  2RDF A;  1SND A;  5JOB A;  4U67 3;  1JOK A;  5EBD A;  1GXD C;  4RWS C;  4QB4 A;  4BA1 I;  3IAY A;  3KF8 A;  5T1G A;  1SSO A;  2CHB D;  4R8I A;  2EJF C;  1XXG A;  1WTP A;  2G9D A;  4HTH A;  4EQO A;  2VUM B;  2B2U C;  3NQI A;  3ND8 A;  1IKM A;  1CM9 A;  3P75 A;  1E2V A;  3MXG A;  2K7V A;  4KJO A;  5DM6 3;  5I2X A;  4HCE A;  1Z47 A;  1Y8P B;  2DY8 A;  2PQE A;  1PTO F;  1TS2 A;  2JSO A;  3RD4 A;  3BDL A;  4RFB A;  4DNT B;  3GP7 A;  3LWE A;  2O4X A;  3HP3 A;  1PZJ D;  1YNJ C;  3CU7 A;  1DON A;  4ZRZ A;  2E2H B;  3FMC A;  5FLX L;  1LTS D;  3QJY A;  3K5N A;  2PZW A;  3T56 B;  4XXE A;  5FO7 B;  4ZLT F;  3NTI A;  1QB5 D;  2YU9 B;  4PQX A;  1JOR A;  1OXX K;  3S15 B;  5CBA E;  2EYO A;  4XQQ A;  2AUK A;  2ID0 A;  1KDC A;  1RHP A;  4QUF A;  2MJ8 A;  1QJO A;  5JVH 3;  4IN3 A;  1TY0 A;  5JEA J;  3NBI A;  4DXF A;  1EYC A;  4ZUJ A;  2WP8 J;  1VF5 C;  5ELD A;  5JPM C;  2ZT9 C;  4PV1 C;  3IFD A;  2Z1C A;  4K14 A;  2XWJ B;  3GTO B;  2A73 B;  2PZT A;  2MUY A;  3SK6 A;  2Z8L A;  1WTW A;  2F0O A;  1GOZ A;  5C3E B;  1Q3L A;  2QEJ C;  1NUC A;  2X6L A;  2YYZ A;  2IT1 A;  1SYB A;  4XYQ A;  3K59 A;  5LL6 X;  1MSG A;  3BG3 A;  4XT1 B;  3M7G A;  1UUP A;  4L6T B;  4H44 C;  4FF2 A;  2E2I B;  2NUC A;  2KQ3 A;  1B53 A;  4CJ1 B;  4RCO A;  2F0P A;  5JJZ A;  5C4J B;  2B8G A;  3H0G B;  3I70 A;  5M5Y B;  1EY6 A;  3A56 A;  3RZD B;  2NVX B;  1VCI A;  2F0N A;  3T13 A;  3NE5 B;  1F2M A;  1SE3 A;  2IW3 A;  2F0J A;  5EPL A;  1TWG B;  3S16 B;  1VF7 A;  2NN6 H;  1DYQ A;  2F03 A;  4N9P A;  1EU4 A;  5K5P A;  1SE4 A;  3MXU A;  1TWH B;  3NQT A;  2K04 A;  2X6G A;  3TP7 A;  4L63 B;  1ML0 D;  4N9T A;  3DM1 A;  2EY6 A;  4BBR B;  2KJX A;  2HCI A;  3V2T A;  2L0C A;  1RTO A;  2FIN B;  1D5M C;  1SNP A;  3ND9 A;  1RDP D;  2KEE A;  1PDQ A;  1T5X D;  1Y1V B;  2M00 A;  4ZK9 B;  3Q23 A;  3P20 A;  1F2Y A;  2KA7 A;  2B2W A;  1HRJ A;  1I4G A;  4FNF A;  3C1F A;  4K2K A;  1SYD A;  5E4W C;  4HSP A;  2NTS A;  1IW7 D;  2FMM A;  4KJN A;  4B9X A;  1G2S A;  5I6Y A;  1RCV D;  1FNW A;  3N52 A;  4OIK A;  4R9W A;  4RKB A;  1S5D D;  1QNK A;  4FXK C;  1S4Z A;  2B2V A;  2MHV A;  4DNR B;  1B44 D;  2FHT A;  2JXM B;  1KNE A;  3TP6 A;  1I3Q B;  3PUV A;  1DOK A;  4DXG A;  2H1E A;  4H13 C;  2A69 C;  3SXH A;  1WTR A;  2I07 B;  3K58 A;  1H9S B;  2DN8 A;  1LT6 D;  4F88 A;  4C2M B;  3L9A X;  1JWS D;  3M85 A;  1LT4 D;  1M8A A;  2PO4 A;  2LFN A;  1SAP A;  1PMR A;  4ABN A;  2NTT A;  1F77 A;  1Q1E A;  3S9W A;  1TS4 A;  3PUZ A;  1PZI D;  3DXJ C;  3CHB D;  5C0X I;  1LTR D;  1EZ8 A;  4E6I A;  5D3D A;  5DM7 3;  1Y8O B;  1MSH A;  2AWN A;  3O13 A;  3TP5 A;  1HXY D;  5KYI A;  1DXM A;  2LMC B;  4U68 A;  1F9S A;  1T5E A;  1BO0 A;  2RSN A;  1STH A;  1BQQ T;  1PFN A;  4LJZ C;  4NDX A;  1PTO B;  2JEB I;  3LWU A;  4A3E B;  4UAI A;  2RQX A;  2HCC A;  2HDL A;  2EYP A;  4V19 0;  1G6Z A;  3J7A F;  2QCP X;  3PUY A;  2AQ2 B;  1BCP C;  1F2Z A;  1O78 A;  2IJ0 A;  1D5Z C;  1VDZ A;  2Z4H A;  2D9U A;  5D3I B;  1JIC A;  3QB3 A;  1YNN C;  3M7N A;  1H9S A;  1ENA A;  5C0X G;  2F0Q A;  3A8I E;  4LAA A;  4RA8 A;  1I4R A;  4XQJ A;  2RDG A;  2IWH A;  1QNU A;  5EKK A;  4BA2 I;  3HRZ C;  1H9M A;  3GV6 A;  2EJG C;  2AWO A;  1E2W A;  1HPC A;  3SE0 A;  2L5T A;  5KGU A;  2EYH A;  1H9R A;  3MVV A;  1SE2 A;  1NSN S;  2EZV A;  2PZU A;  3OOC A;  3S2D B;  2XRS D;  2TMP A;  4X3S A;  1TII D;  3J7Y W; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...