4C3HG

Structure of 14-subunit rna polymerase i at 3.27 a resolution, crystal form c2-93
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
309
structure length
259
Chain Sequence
b'NENRETARFIKKHKKQVTNPIDEKNGTSNCIVRVPIALYVSLAPMYLENPLQGVMKQHLNPLVMKYNNKVGGVVLGYEGLKILDADPLDTSEKLIKITPDTPFGFTWCHVNLYVWQPQVGDVLEGYIFIQSASHIGLLIHDAFNASIKKNNIPVDWTFVHNDVELGHWVDSNGEPIDGKLRFTVRNVHTTGRVVSVDGTLISYNSSRSQAESLPIVSNKKIVFDDEVSIENKESHKELDLPEVKEDNGSEIVYEENTSE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-DIRECTED RNA POLYMERASE I SUBUNIT RPA190
publication title Crystal Structure of the 14-Subunit RNA Polymerase I
pubmed doi rcsb
molecule tags Transcription
total genus 37
structure length 259
sequence length 309
ec nomenclature
pdb deposition date 2013-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF03876 SHS2_Rpb7-N SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397
G PF17875 RPA43_OB RPA43 OB domain in RNA Pol I
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.1060 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4c3hG02
4C3IG 4C3JG 4C3HG
chains in the Genus database with same CATH superfamily
1MIUA 3NK9A 1VQOA 1IKLA 3S1RB 3W2DA 1GJXA 3P20A 2K33A 1KC8C 4K8IA 1GUSA 2PW5A 4ILWA 4PZ8A 3J7YW 2VUMB 1ZYRD 2CWAA 4DV0L 4BBRH 1EY9A 3PUZA 4Q0FA 4LF6L 4EQNA 4IOAA 1W6KA 2SNMA 1I94Q 5EQ0A 3EA6A 2RDFA 5M5XH 4K6LA 4IJLA 2KCTA 3E3XA 1O78A 2JQOA 4O0AA 1D1IA 1N32Q 1C9OA 1LV9A 3HOWG 1LTTD 4AQYQ 3HOVG 4DV5L 1C8CA 2R7DA 2UXCL 1H9MA 1VQJA 4YCWA 4C3HG 1WCMH 1UUPA 1WD0A 5K36G 2HDLA 1KAWA 1HRJA 1A62A 4FF2A 4UP7A 1YJWA 2VXWA 3SEBA 4GKKL 3D6WA 3J81c 3KJOA 5J3BA 4LUZA 4R1JA 3NWSA 1EWIA 3A8IE 2X6LA 3K0YA 3UE0A 1KXLA 2EYOA 3K5OA 3I4NH 1Z6HA 2L0CA 1V1QA 4A3FG 1L1OB 2V4DA 4C3IB 1IL2A 3RN5A 3CPWA 1PDQA 2LKVA 1BQQT 5C3EB 2A5HA 4LUVA 2R92H 2NVYB 1Y1VH 3K6OA 3QO2A 3B6YA 2K5VA 3K5LA 1GKHA 1NR2A 4WJ3M 1T5XD 2F0KA 3HKSA 2QW7A 2EPBA 4A3BG 5C0XG 1EYGA 1WTRA 2NVQH 1XYIA 1WVLA 5E7NA 2PPBC 2RKSA 4IUUA 4X6AH 5KIXA 4BY7H 5A35A 2ATWA 1X56A 4BXXG 3U58A 4YWKA 4HR7B 1AH9A 3O13A 4K5WA 3ERQA 2UUAL 1TR5A 1N33L 4DUZL 4JI7Q 5IGFA 2PQAB 4KKUA 4CHTB 3J81L 2MGSA 1I6VC 2R93H 2UUCL 2YTYA 3CXCA 1SXTA 3MXPA 2JA7B 4G7HC 3FMCA 1TWGB 4OL7A 5GROA 2DUDA 2XSCA 2G5DA 1FJGL 1BUVT 5CR3A 3NPPA 4JG2A 4TQUS 2JEAI 3HOZB 5ELBA 5KYLA 1DOMA 3TMEA 1E1TA 3NELA 5C4XH 3H0GB 4R4TA 1CT1D 5LMUQ 3H6MA 3HKZB 1Z47A 1SNCA 5LMNL 3I70A 1BCPB 1GHJA 1WTXA 1FR3A 4A3EB 3S1RH 2F0MA 2Z0SA 3KDFA 3GTJB 4KHPQ 2VUMH 1OXXK 2CCZA 1EYCA 5IGEA 3SK8A 1BR9A 1HTLD 2EJFC 5GAHC 1CKMA 2RDGA 2NTTA 4DV7L 4JYAQ 2AQ1B 3CMAA 1SLJA 1YHBA 2FFKB 5L37A 3G4SA 2HUGA 3KLRA 3HZXA 5E4WC 4KTAA 5EKIA 4FXGC 1Q46A 1BDOA 1NJIC 3BJUA 2A69C 3QWNA 1AZQA 4OWWB 5CV7A 3R3OA 4QL5A 1WTWA 2VY3A 3MAQA 3EROA 4OWXB 3SK5A 2JXMB 4YCVA 3UDIA 2C5CA 1D5MC 1J8IA 3UDGA 3S1QB 1EEID 2F0WA 1VQLA 4RG1A 5EAYA 3DLLA 1JB7A 1HQMC 4C1NI 2KBNA 2GVBA 3M4OB 2XWBB 2VQEQ 2IPKD 1VS0A 1D6EC 4DV3Q 4DR5Q 2F4VL 2A68D 3MXGA 2F4IA 4GS3A 1HXYD 1YVCA 1ZKOA 2PNRC 4C3IH 1EWHA 5JJZA 3HOYB 3CRLC 5C3EH 3GTMB 1WYDA 3MFYA 1PYSB 1PZID 2F0PA 1BKBA 1TWAB 1U9RA 1IBKL 2Z4HA 2JA6B 1X3FA 1TS5A 1W2BA 1E0BA 1EIYB 1MD2D 3C46A 4QMGA 4K5XA 3TREA 3D3RA 2E2IB 3N6RA 1STNA 4RKBA 2LXJA 3NTKA 1QCBD 4DF7A 1EWCA 1HNXQ 2OXPA 3PO3G 5KNDA 3NE5B 2ZM6L 1U4MA 3LX0A 1LTID 1JT8A 1JJGA 1L1OA 4X65L 2NZHA 1NUCA 3PIPA 5IIFA 5CYUA 4NW2A 4A3JB 3JAME 3OSOA 4HCEA 2JA7H 1HNWQ 1TWGH 3P7JA 4O1NA 3T4AC 1X32A 2WIIB 1KHIA 1HA5A 1XNRL 2HIXA 2I46A 1DM0B 1B4OA 1FGUA 4DV1L 2E75C 3HOZH 5M5WB 1EUJA 2LS01 4JBJA 3F1ZA 4A4IA 2RCFA 1SRUA 3H3VC 2CWPA 5JEAG 2I07B 3A0JA 2KCCA 1AE3A 3H0GH 3H15A 1PRTB 1X65A 4A3KG 2ZJPA 3H09A 2G9HD 3BYTB 4IUNA 2PQAA 3IFTA 1N34L 3QR8A 2FINB 1SJHD 4A3EH 1G2SA 1I4GA 3J7ZC 4U68A 4LFCL 4CKCA 3GTJH 1ESFA 3S17B 4LF9Q 3HEJA 4RA8A 1CA6A 5FO7B 4JV5Q 1ET9A 5CBAE 3F2DA 1HZCA 3F2CA 1A15A 2IX1A 2NN6G 5IY0A 3L7ZC 4PQXA 2K4KA 3Q24A 1EFID 4QY7A 1KQSA 4L5QA 1KL9A 2F0EA 4EVOA 4LFAL 4DAYB 4A3IB 1LTSD 5C3XA 1TXYA 1N32L 1K28A 4OXPA 1B8AA 3M7GA 1L0WA 5IP7H 1VMPA 5M3MB 3ULPA 2SNSA 4JOIC 2L55A 1A3UA 3I8ZA 1K73C 3S1QH 5CV8A 2B2YC 1ASYA 4WRDA 3M4OH 2A74C 1KDAA 3PUXA 2RBMA 2BA1A 4PZ6A 2BH2A 3WWVA 3ND8A 1Y8NB 4ZCKA 4MIUA 3HOYH 1STHA 3D4DA 5CBEE 2VQFQ 1KAAA 3GTMH 5C44G 2XGTA 1VQ8A 1EYDA 2EYHA 2EIFA 3VR3A 5LL6X 2Z6KC 4DV5Q 1PFSA 2UXCQ 1TWAH 4IJHA 1RODA 5C6AA 2XRSD 3W1BA 2JA6H 3Q0AA 1GVPA 2E2IH 4RFBA 1VQMA 1Y1WB 4R4OA 3TS2A 3ITPA 4N8FA 2WACA 1JB3A 3FPPA 1UEAB 2P5ZX 5AFWA 4GKKQ 1YJ9A 1NAPA 3J80E 4A3GB 2BCOA 5DM73 4DUYL 1SE8A 3I73A 1IL8A 2TSSA 1GUOA 5LHY1 5IP9G 5ELFA 1GO3E 1ZYRC 3M4QA 3PCOB 2OQ0A 4HCSA 1IKMA 5C4HA 5C4JB 4A3JH 4YHHL 3G6EA 2EQSA 3RZDB 1PH1A 3NENA 2LMCB 3HOXB 2O2LD 1KTKA 1XWEA 1D2BA 3GV6A 4ZYSA 2K6AA 4MHEA 4HMIA 2JE6I 2JSOA 4CGYB 2QEJC 5FLXc 4J15A 5M5WH 4IALA 2F03A 1D7QA 2QA4A 4ULLA 4JBWA 3OIQA 1EQTA 4FYDA 3SE0A 2EDGA 1H9KA 5HURA 3A8JE 1BCPD 5DNFA 4XYOA 2X69A 3S17H 5ELEA 1TWHB 3BU2A 1O7YA 1Q3LA 2OQKA 3HS0C 2UUCQ 5FLMH 2F0FA 1PH5A 2Z9HA 4PG3A 2WB1G 3BYYB 1NBWA 3OHXC 4P2CB 2EE1A 1L2FA 3JAMc 2MFIA 2OTLA 4DV6Q 3D0FA 1CKNB 4C3JG 2B2VA 4DU9A 1RIPA 4ZUJA 5LMNW 3EBEA 2HHHQ 4RGOS 3AMUA 1HJPA 4JYAL 2K5WA 4HEDA 4BY1G 4ZLTF 5FLXL 1B9NA 4A93B 2K03A 5ISRA 3T53B 4A3IH 1U4PA 2F0DA 2C9OA 1EY6A 3DEPA 4DAVA 4DKAC 5IT9c 5LMNQ 1OO9B 2F0OA 1S5BD 2AHOB 2LSSA 3SK6A 5M3MH 1P16A 3PSIA 3CCSA 4XTCS 1XNQL 5KRUA 1TVXA 2EYJA 4KJOA 4RMFA 4B3SQ 1LABA 2I5MX 1D5ZC 2R7ZG 2NUCA 4DV7Q 1G6ZA 2JP1A 1NTGA 2VW9A 1QWYA 1N36L 2HCCA 2EYLA 1H9SB 2VQEL 1N8RC 3JAML 3VR6A 4OO1I 1Q7YC 2NVTB 3A54A 5EKLA 1Y14B 3PO2H 4DV4L 2AWOA 2ZXRA 1DXMA 2ZT9C 1KRTA 5M3FG 3FKIG 4RGTA 1Y1WH 4JPBW 5E1FA 1R9TB 4YIJA 1SE2A 2CH4A 1VQBA 2KOLA 5LL6S 2WAQB 3CCUA 4O2DA 5IT9L 4A3GH 4LMQD 3FPUB 2ZJRA 2WB1E 4JC0A 4X62Q 3I90A 4BA2I 5C4JH 1HNXL 4F8MA 3RZDH 3HOUB 3GTOB 1Z7TA 3GTGH 3HOXH 3MVVA 2L11A 1RCVD 3I3CA 4FP5D 4ZRZA 3P75A 2B8GA 3EVQA 2GVAA 3L3OC 1HNWL 1IBKQ 1MSHA 1T9HA 2N3SA 1STYA 1I6HB 3SR1A 4KKTA 1ESRA 4LNQA 3SXHA 4JW0A 2YYZA 1YI2A 1B7YB 4OWTB 4UP9A 1DONA 1W3SA 1LM0A 4DR4Q 3AB9A 2IJ0A 3E0EA 3ER0A 1NMFA 4XIGS 1FL0A 1YHQA 1TS4A 2JA5G 2NZOA 5CC4A 1PZKD 1MJCA 2KENA 3D8GA 4GLVB 1HNZQ 4KHVA 4LJZC 1IBML 1TWHH 4GOPB 1KDCA 2HD3A 2F52A 2KVMA 3G7LA 1XX8A 2A68C 2O4XA 5AJ3L 1XNRQ 1J6QA 1QG7A 5FKAC 3K59A 4JV5L 1LTBD 4A3CH 5EPJA 1B3QA 4TRDA 1F2YA 1V1PA 1WD1A 5IYBH 1JWUD 3ND9A 5I4DA 1VQPA 2H4OA 2WAQE 1JORA 2E76C 3GV3A 4A93H 2B63G 4QUFA 3CC4A 3RLNA 2XIWA 2XN9C 4K14A 1PTOH 2MPMA 4A3MG 3GTKB 3ULLA 4DPGA 1HCZA 1S3OA 3A7AB 4LFCQ 2F0HA 5BN4A 3L9AX 5DAUA 3RR5A 2B3GA 1CKNA 1TWFB 3PMFA 1LYLA 5E3FA 4B3RQ 2A6HD 2IL8A 2F0UA 1WTPA 4P72A 2F1MA 3NTIA 4S3SA 2NVTH 1K8GA 4F88A 3S1MB 4LFAQ 4L8JA 4XT1B 2VQFL 2IX3A 1C48A 1QZHA 4Y52H 1DCZA 1K3BC 1I3QB 1RDPD 4JI2Q 4DR7L 5FO9B 1R9TH 1K83B 2B8FA 2DNCA 4KY6A 3HOWB 3HOVB 2B29A 4NKLA 1MSGA 2CVRA 3A5UA 2F0TA 5IODA 1CSQA 1SYFA 4HIDA 1Q8IA 4MTNA 3UDXA 4C3HB 1UE6A 4OO1H 1H9SA 2KQ3A 3WOEA 3HOUH 1Q12A 3GTOH 2DN8A 1OXTA 1WOCA 4FF1A 1Q90A 3S1NH 3STBD 4NXML 1M8AA 1EIGA 3PUWA 2BDOA 3KFUA 2XRQD 1IBLQ 4RCNA 3NP8A 4RCOA 1TWCB 3VYUA 5C0XI 1DOKA 1HUNA 4WFN3 1KABA 1SMYD 3Q8DA 5GQOA 2A1AA 1HHVA 1JC7A 1I6HH 2PYKA 3NHHA 4CDFC 2D0OA 3LWUA 1PH7A 4KV6A 4A3FB 5C5LA 4FF3A 2RF4A 1STEA 3GTQB 1EY4A 2NWGA 2VB3X 3D31A 4CKEA 2FMCA 5IGDA 1PH6A 1KDBA 4DK0A 1A3VA 5I9PA 4DUYQ 3CCLA 3OIPA 2E2HB 1A0IA 1OXUA 1P8LA 2GN5A 5IYDH 3NBHB 1VQGA 1XMOL 4YHHQ 1PV4A 3ULJA 4A3BB 3VYTA 3QOLA 3FVQA 2HT1A 1ENCA 2M9VA 4RAUC 4NXNQ 3C1EA 1PTOF 4OHJA 1M1KC 1CSPA 1VQNA 2WKDA 4FXKC 3EQLC 4BBSH 2IX0A 2K50A 2M00A 1EQVA 1G291 3UE1A 1TS2A 4DV6L 2VZAA 2HQLA 5A2QE 1HUMA 2ZTEA 3IFDA 4ZAIA 4PMWA 1BVSA 2HHHL 3CCQA 4GOPA 3U9SA 1VQAA 3GTKH 1PTOD 2KHJA 1KLGD 3U4VA 3T1HL 4QJFA 2LXKA 3PV0A 3R93A 3BDCA 2QILA 1PLFA 1SNQA 4LFBQ 4HSVA 3FDTA 1IZ6A 2GA4B 3HRZC 2E5LQ 1GUNA 1TWFH 4J1MA 1SSOA 4FO2A 2XVSA 4NPSA 3PF4A 1HPCA 4GNXB 3I4MG 2UXBQ 2B2WC 1KNAA 4LF7L 3SDZA 2PO4A 3PUYA 4B3SL 4CJ1B 3URYA 2X6GA 1OTCA 1SYBA 4UHVA 1CQVA 1WTQA 1JWSD 3S1MH 3BZDB 1QVGA 4DV2L 4NB3A 3G71A 2Y0SG 2EYMA 3AYHB 1F9PA 2WKCA 5ELDA 1YJNA 4BS9A 1I3QH 2D0PA 2HCIA 1QZGA 2KCNA 1Z9FA 1K83H 2EY6A 3CCRA 1PH2A 2ZXOA 3HOWH 3HOVH 2LFNA 1BCPC 1XNQQ 3I4OA 4ABNA 4XDXA 4DNTB 3QOJA 3ZJYC 5CV9A 4C3HH 5K36H 2EYPA 2RVLA 2K1BA 5C5MA 1DD2A 2KJXA 1N36Q 4EQPA 3BS1A 1SNPA 4X62L 4QGUA 3BDLA 3DMUA 4KHZA 2EY1A 1LACA 1GHKA 1TWCH 4DV4Q 4X3TA 3T1YL 2N88A 4DK3C 4X3UA 2QGQA 1CZWA 1XJVA 2R6GA 3X3NA 4RKLA 4A3FH 5JOBA 4JI0L 2NVYH 4K6DA 1SE3A 3A7LA 4LF4L 3GTQH 3QJYA 1HFGA 3JC66 3A8KE 4V190 3X3MA 3H3VI 5DEHA 2ZTCA 3PIO3 2Q2HA 1DGSA 5ELCA 4UP8A 2PMZE 4R8IA 2E2HH 3EN2A 4HSPA 3VR5A 3OW2A 4A3LH 4DR4L 1SNDA 3E9HA 3J7A5 1MGSA 4A3BH 1HNZL 1PH9A 4AYBG 3PO3B 4BXXH 3GTLB 3W3AA 1EU4A 2Y0SE 3U9OA 4JCVE 2NBFA 3JAMi 5CV4A 3CCJA 1JWMD 2IT1A 4FXDA 4I7ZC 3CKIB 4GLXA 3ZYYX 2VS1A 3NBHA 4LAAA 1WJJA 3F8TA 3PGZA 1E2ZA 2NN6I 4ME3A 3LGJA 1IBMQ 3I2ZA 3OPOA 4K2LA 3I72A 1X3QA 1B1ZA 5FJ8G 1EQRA 4A3KB 3TEHB 2JA8G 5M5YB 1RKNA 3AU7A 1I4HA 5D14A 3ICEA 2H5XA 3E9IA 3K8AA 5AJ3Q 1S5FD 1SBBB 1YIJA 5KEEA 5D3IB 5JVH3 3OOCA 3V2TA 2D2CC 4J8QA 4B3RL 1XTCD 2WP8J 2R7FA 1AFPA 1JE5A 3DEOA 2B2VC 4HIOA 3T51B 1WTHA 1PRTC 3A74A 3M9BA 3WDNA 5IYCG 1WTVA 1W6JA 3U4ZA 5I2XA 4JI8L 4GNXA 4F87A 1CFMA 4OIJA 4RGNA 2IHFA 4ZUIA 4JI2L 3QG1A 1QILA 4QCLA 4F7XA 4DN4M 2Q2IA 1PXUA 2JJQA 4AYBE 4HJ5A 4A75A 4P71A 3KJPA 1AE2A 1ENAA 1M90C 4H7BA 3QB3A 1TU2B 4KY5A 1WI5A 4DA2A 3M4PA 4HN7A 3VA7A 1F77A 2EJGC 5IWAQ 1PHJA 3VYRA 2CH4W 3W5OA 2CW0D 3NEMA 1RJTA 4DNRB 1IBLL 4DR7Q 3CCEA 5KNCA 1HH2P 3A56A 5C44B 1DOLA 1B53A 1Y8PB 4KMUC 1MJEA 4Y7NB 4I65A 1F2LA 5A2QL 1I4RA 4ZQ3A 4UY8C 1VMCA 1TS3A 3J7AF 4IOCA 4H13C 3CF5A 1F9SA 3BVZA 1B3AA 3PO2G 4C2MB 2RQXA 4X64L 1ET6A 3KLSA 2F0GA 2FHTA 2MUYA 3T16A 1VQ7A 2A6HC 4HTHA 1YHAA 4NXMQ 4Q5VA 4QIWE 3PO3H 3I7FA 4FVMA 3GTLH 3J80i 2F0LA 2QCPX 4JI3L 2BH8A 4OELB 1XPUA 3PF5A 4GZYC 2JEBI 1JMCA 4L5TA 1LTLA 1YNXA 2XWJB 1VQEA 4NXNL 1PVOA 4TVAB 4J6HA 1BCPF 3PIP3 3CU7A 3MA2B 1Q82C 5TSSA 5EBCA 2LY7A 1E22A 3TZDA 2J4XA 1V1PB 1V9PA 4QF4A 2K5QA 4K0KL 1EY0A 2MO0A 5FOBB 4V0BA 2QF7A 1B9MA 1XMOQ 1JOQA 2KHSA 4LUOA 2K7VA 2MJ8A 2N8NA 4A3KH 5M5YH 1QNUA 3MFGA 1CA5A 1VQIA 1BBWA 3STBC 3KBXA 4P73A 4LFBL 1LTRD 4A3DG 1E2WA 5HY6A 2JN4A 2E5LL 1STBA 2F3VA 4X3SA 2CKZB 1BBXC 4YWMA 4DAMA 2UXBL 2NVXB 4IFDI 1MI2A 1SMYC 4U673 1NMGA 3TP5A 1K9MC 1E1OA 2WB1B 2YTXA 2NN6H 4IN3A 3KLSX 1G51A 2M2LA 2PCFB 3UDFA 1STGA 5CV5A 4JBKA 1F2ZA 1SFOB 4C3JB 3IKJA 3KF6B 2MP1A 4HJ9A 3T1HQ 3GO5A 3MEFA 3M3YB 1R4QB 1JQYD 2HQEA 1LTGD 3FEWX 5D3DA 4BY1B 4IFDG 3P1HA 3K57A 1O7LA 1XPOA 1I4XA 3DM3A 2Z4IA 1L0YB 4LF7Q 1SNMA 4G4KA 1X9NA 4B9WA 4L63B 1HZBA 1UEBA 4K5VA 1AZPA 4L6TB 3BZKA 4KLKA 2DGYA 2K04A 1PH4A 4KN7C 2UXDL 4RGMA 2A73B 1AW7A 2K28A 3RN2A 1PMRA 4DV2Q 2R7ZB 4AIMA 5BN3A 4JK1C 2OT2A 3FP9A 3CHBD 3K7AB 4DR3L 4FNFA 5C44H 3J81E 5EKKA 3RD4A 1PTOC 1WFQA 3EIVA 4I7AA 4JVZA 4Y7NH 4YY3L 4POFA 4IQZA 1KIXA 4BBRG 1CHPD 4R4CA 3UI2A 1A6XA 2NZ1D 2EXDA 1I50B 4JI4L 4IPHA 5M3FB 4XT3B 4DR6L 1EY5A 4X3KA 3FKIB 2Z1CA 4C2MH 1S5ED 4B3TQ 2RA4A 2BE5D 1CTMA 2O5IC 1N9WA 4KY7A 3K81C 4H44C 1II3A 3RMHA 4EX5A 5C4ZA 1I5FA 2PNHA 3OYYA 4IUPA 1TT2A 5IE8A 5IP9H 4XXEA 1VQKA 3T1YQ 1PRTF 1TY2A 1JOOA 4C56C 1B2TA 1WCMG 2OCEA 1JE4A 2DNEA 4JI0Q 2PQEA 2QKIC 2EVBA 1X3PA 3CQZB 2HIVA 3SK4A 4X66Q 1PYWD 1S5DD 5BR8Q 1D5XC 4LF4Q 1U0LA 3VYSA 3K0XA 2L9HA 1JJCB 2K75A 1HR0L 1UNSA 4QUCA 3I4NG 1PRTD 2KEDA 4G57A 5C3WA 3I56A 2QDLA 2AQ2B 3TSSA 3E0JA 2A6ED 1Y69U 5T1GA 3J80c 5CORA 2R92G 4ODGA 2JA5B 1Y1VG 4DXFA 1L0XB 1SN8A 4DR2Q 1CM9A 2K01A 1C7YA 2NVXH 1Q86C 5DLQE 5IYDG 1V1OA 5I2YA 2DY7A 3G6JB 4DR1Q 2E2JB 1FNVA 4TSSA 4BY7G 3CCMA 1X55A 3HFZB 5JJLA 1SFOH 3V05A 4C3JH 2AQ3B 4IPDA 2F3WA 2I5HA 1EY8A 4KJNA 3M3YH 4N8X1 2R93G 2HDMA 4BY1H 4IUTA 2F0VA 3TBIB 5I6YA 4IUVA 3FHWA 2B63B 5C0XJ 4BBSG 4IO9A 1PFBA 3AFPA 2KECA 3OTOQ 3C2PA 4A3MB 4B3ML 1B70B 3F2BA 1PH3A 3TP6A 3MXNB 4HJ8A 3J80L 3MZ5A 4MTKA 5C4XG 1TKWB 3NXWA 3VR2A 2R7ZH 3KF6A 2RDHA 2VNUD 3DXJC 4APVA 4LF8Q 1NY4A 3CD6A 1VQ9A 4YWLA 4JBMA 1BF4A 3CW2C 5IWAL 2VUMG 3CCVA 4PV1C 1K8OA 4JI8Q 1QJOA 2PI2E 1I50H 4MN3A 4LW1A 5M3FH 3BZCA 1H9RA 5EPKA 1VF5C 3FKIH 4GN4B 3R8BA 5K5PA 4WORA 2L5TA 1EY7A 2UU9L 3CRKC 1YITA 2QEXA 1ENFA 1Q1BA 2B2UA 4BWGB 5GAEC 3GTPB 2WINB 5J22A 4DNIA 3LWEA 4JI5L 2R3ZA 4TKOB 1EYAA 1XPRA 3DWAA 3DUZA 2K14A 4HIKA 3OMCA 3BVGA 3CQZH 3BG3A 5IGBA 2J7ZA 4RWSC 4AH6A 4HJ7A 1A63A 2AUJD 4CJ0B 2KUMA 3KF8B 4XQJA 5GAGC 2IWHA 5F2DA 2AKWB 2FMMA 4X64Q 1Q81C 1WTOA 4C3IG 3VA5A 1I4PA 2F0QA 1V8QA 3KLWA 5C3EG 3S16B 1PYBA 2Q8RE 4CDCC 4ZKBB 2ICEC 3IRBA 1SYCA 2SEBD 2JA5H 3PIOA 1IYVA 1Q1EA 2BOSA 4KN4C 4GKJL 1GD7A 4JI3Q 2FXQA 1B44D 4HAEA 1GM5A 1L1OC 4A3LG 2CW0C 2E2JH 5HGTA 3NQIA 4DXGA 4DFAA 1ICWA 4KK7A 1ILPA 1IXRA 4JI1Q 5NUCA 1GUWA 1BBUA 2PZUA 3GP7A 1DYQA 1YNJD 5EBDA 5KYIA 1CQFA 3NQTA 5ELNA 4QB4A 4K0KQ 1SEBD 1D1KA 4B9XA 2YV5A 2JA7G 2PI2A 2B63H 2B2TA 4BA1I 3T56B 2NTSA 1EQQA 4PMBA 4A3MH 1LT5D 1TQOA 1J5EQ 3J81j 2L1BA 1VDZA 3HOZG 4RHSA 5ELOA 4QQBX 5I6WA 3R2IA 1C4QA 2WFWA 3E6ZX 1CHQD 1SYDA 2PMZB 3H0GG 1HZ9A 5IGGA 5BN5A 2YU9B 3HKZG 2ZTDA 4K2KA 3I4MB 1RTOA 1F2MA 3AQQA 4OIKA 3S15B 1BXTA 1SR3A 1I4QA 1SROA 3TRZA 4A3EG 1A8VA 4WJWA 4CKBA 1A2UA 3NUCA 3ERSX 4CJ2C 3H91A 5JEAJ 4JI6L 2EY5A 2R61A 1UWVA 2ID0A 1YBYA 4M1UB 1JICA 2Y0SB 2F3IA 5KGUA 3MXNA 4NMZA 1LUZA 1SMXA 2JYOA 2VB2X 3GTPH 2Z8LA 1TY0A 4GNXC 1PFNA 1STAA 1MBYA 3KOJA 4MNOA 4B3TL 3PQIA 3CPFA 4R4QA 1RD9D 3RNUA 1FNUA 2UXDQ 4LK1C 5CV6A 1CZGA 1FNWA 4R8NA 2UUBL 2CQAA 2CHBD 3GD7A 1NCVA 2E74C 4P74A 5IP7G 4DR3Q 3SGIA 4LF5L 3NTHA 4ZK9B 1JJ2A 1QUQB 1AN8A 2NB0A 2OTJA 1PFMA 5T1IA 3DM1A 1JR0D 2G9DA 4YY3Q 4OONA 4UAIA 1K0RA 3BDOA 2OEOA 4JI4Q 1ZEQX 1QOHA 1BNZA 3NBIA 1SDFA 4X66L 5H1SE 5BR8L 4L5SA 4RH6A 4DR6Q 3FRPB 1JCKB 5JPNC 1YNND 3TP7A 3HOYG 3RLFA 2E8GA 3S16H 3KUPA 1ILQA 3CAMA 4UPAA 1X3EA 5FLXE 2ASBA 1A2TA 2AWNA 3CP0A 1J9OA 1FGBD 2NYZD 2AUKA 2RCNA 5C0XH 3HKZE 1QVFA 2JA6G 2A8VA 3K58A 4XQNA 4OGQC 1EIFA 3A5ZB 3ONAB 2BDNA 1HR0W 4EGVA 5JVG3 1RL2A 5EJWA 4DR2L 3KF8A 4AYBB 5IGCA 2K05A 4EQ5A 2J0TD 1MKHA 2ZXPA 1LO5D 3S2DB 4KD4A 1HR0Q 1D8LA 4DR1L 5FO8B 2L12A 1LTAD 4A3JG 1G8ZD 2K32A 1GOZA 1A3TA 1VQ5A 2CQOA 2BE5C 1CUKA 3D6CA 3SHLA 5E4XA 1H9JA 3R2TA 2RSNA 5EGTA 1BO0A 2MO1A 4IPGA 3OTOL 1ZXTA 2K5DA 5CMDA 2SDFA 2Z6BA 2JA8B 3TQYA 1E7ZA 2YU9H 1BOSA 1OXSC 5IT9E 3I4MH 3EFXD 3S15H 2OF1A 4OX9L 2ES2A 1EL0A 4LWCA 4A76A 2AMCB 4Z9CB 1SJED 5HGQA 1SAPA 4QIWB 3F2UA 1IHZA 1EFWA 2B2WA 4G7ZC 5FLMG 4GN5A 3VDYA 1XMQQ 2H1EA 4LF8L 3A55A 1SNOA 1VQFA 3CC2A 3S14B 3I55A 3V96A 4PNYA 4FDBA 2EZVA 2A6EC 3DHQA 1G6PA 4B3MQ 2OWOA 3TZUA 5JJIA 1RHPA 1PZJD 1XTDA 2JA9A 1FD7D 4HMJA 4XQQA 4DGZA 1MHWC 1I94L 4A3IG 4WJ4A 3WOFA 3MXUA 4ALPA 3S2HB 2XTIA 1HA6A 3MEHA 5M3MG 2D5DA 5EPLA 1R4PB 1PH8A 1IW7C 4AQYL 5J1ZA 2ALYB 4KI0A 3HG9A 2ENBA 3H94A 1EOVA 4ME5A 3RZOB 1HZAA 1UE1A 3OWEB 3M85A 4DV0Q 1F9RA 4DK6C 1IYJB 3TP8A 4LF6Q 4M8AA 5G3LF 4IFDJ 2UU9Q 3I4LA 1CKOA 1JOKA 1AP0A 4PZ7A 1FYCA 3S24A 2EYFA 1C0AA 1CI3M 3L2PA 4JI5Q 1E2VA 1K8AC 1HQRD 2WV6D 4OEMB 3PO2B 1HFNA 1QUQA 1NSNS 3T13A 1Y1WG 5G3LD 1S5CD 1XXGA 1VQHA 3H3VH 4A3GG 2KA7A 2JK8A 1X54A 5M9OA 1CK1A 1NR4A 1K3RA 3S2DH 3QIAA 1SYGA 2RHQB 1YZ6A 2PZTA 4XYQA 4N9PA 2I5LX 1DZ1A 2SOBA 2XNAC 4ZKCB 3HOXG 1SE4A 4JI1L 3W1GA 3GTGB 2KHIA 4FF4A 1HTPA 5JEAH 2F0SA 4JI7L 1TIID 3Q22A 4GKJQ 1K0SA 2RHSB 1NNXA 1LT3D 3TDQA 1VQ4A 1EEFD 5FJ8H 2JA8H 1G91A 1J5EL 2KCMA 3TS0A 4GLAC 1QVCA 5GADC 2EOTA 1O80A 3HP3A 2F0NA 2A69D 4A3DB 1G2TA 3AFQA 1PA6A 1IYUA 2MHVA 2F0IA 3KK7A 3IAYA 3CMEA 3MC0B 2EY2A 2UUAQ 1N33Q 1ML0D 4DUZQ 1EZ6A 5LMUL 3KYHC 1VCIA 2YTVA 1S4ZA 3RUZA 1RTNA 1UAPA 3S14H 5KNBA 4IURA 2Q2TA 3M7NA 3PUVA 1GXDC 4A3CG 2DY8A 5IYCH 4KHPL 2V1CC 1LT6D 2K5HA 3IL8A 5IYBG 1EOTA 4YCUA 1FJGQ 2N78A 1DJRD 3BVMA 4H0LC 4A93G 3OW7A 4NDXA 3N52A 3K80C 2PZWA 1VQ6A 1QNKA 2TMPA 5I9OA 3S2HH 1QB5D 3Q6SA 1LLRD 3MTSA 1EIHA 1PTOB 2N49A 1B50A 4JOIA 1YNJC 2B2YA 2Q8TA 4JI6Q 2K5NA 1LT4D 1U4RA 4C1NK 1U4LA 3RZOH 3D4RA 4DAPA 5J39A 3MWYW 2D9UA 2K52A 3GQBA 1VF7A 1ASZA 3C1FA 3DWQA 1V43A 2C35B 3J81i 5JPMC 3S9WA 3K7UC 4BBRB 2B39A 1UE7A 4DAYA 4HJAA 1H95A 3EJIA 5JAVA 2Z6KA 1RF2D 2F0JA 4O42A 4DV3L 4DR5L 4UDUC 3E5SA 2UUBQ 5M5XB 2PW7A 1ICFB 2N55A 2DJFC 2B2UC 4ID6A 1Y8OB 2L4NA 2QDBA 4R4IA 4RHRA 1T5EA 1E3PA 2BA0A 4LF5Q 3L0OA 2WAQG 1YEZA 4PMCA 1ONLA 1GUTA 2RSOA 4R9WA 3GDEA 3RLOA 1WCMB 2L15A 4OO1G 2D62A 1KNEA 1AEXA 4CDDC 4IUQA 3HOUG 3CC7A 3M4YA 5IOCA 2FJ2A 2F4VQ 3U50C 1KLUD 2VL6A 4B08A 1EU3A 3NWTA 3AEVA 2IY5B 3S1NB 3J7AV 2CFMA 3I4NB 3MHBA 4NP5A 3NSWA 4L5RC 2ZJQA 1E24A 1O7IA 2IHEA 5CGKA 2R92B 1S72A 1GUGA 4DK1A 4P75A 5COYA 1Y1VB 1KD1C 1M4VA 5DM63 4A3DH 1FVIA 4G7OC 3HGBA 2EXZA 3DWPA 4CDEC 2ZM6Q 5FK9C 2Q2UA 3G48A 2E2DC 1F9QA 1K8MA 2NVQB 4X65Q 3D4WA 1IW7D 1U5KA 1EZ8A 3I91A 2A19A 1VQCA 3LNNA 4BY7B 1YNNC 1S40A 4KKSA 1QE6A 2I0QA 2KEEA 2Q8IB 1X3GA 1OXVA 1XMQL 5JJKA 1X6OA 2EJMA 3K5MA 4LF9L 2R93B 4CBVA 1SYEA 2DJGC 4IPCA 4GOPC 2B2TC 4DV1Q 1NE3A 4IFDH 4E6IA 4BBSB 3KDFB 4GN3B 3SVMA 4MZ9A 3TN2A 1VQDA 4IZ8A 2IW3A 3K5NA 4OX9Q 2O5JC 1Q8KA 2MQHA 4N9TA 1N34Q 1O7ZA 4H02A 4K8JA 2ICIA 3KBGA 3OWFA 4KD3A 3OMGA 5C4XB 1KRSA 5D65A 3K7AH 3C3LA 2MNAA 1UE5A 3VR4A 3Q23A 4HIMA 4EQOA 4POGA
chains in the Genus database with same CATH topology
3NK9A 1IKLA 3S1RB 3W2DA 1GJXA 3P20A 2K33A 2VUMB 4K8IA 1GUSA 2PW5A 4ILWA 3J7YW 1ZYRD 1EY9A 3PUZA 4Q0FA 4EQNA 1W6KA 2SNMA 5EQ0A 3EA6A 2RDFA 4K6LA 1O78A 1D1IA 1LV9A 1LTTD 1C8CA 1H9MA 4C3HG 1WD0A 1UUPA 5K36G 2HDLA 1HRJA 4FF2A 2VXWA 3SEBA 3D6WA 3NWSA 3A8IE 2X6LA 3K0YA 2EYOA 3K5OA 1Z6HA 2L0CA 2V4DA 4C3IB 1PDQA 2LKVA 1BQQT 5C3EB 2A5HA 2NVYB 3K6OA 3QO2A 3K5LA 1NR2A 1T5XD 2F0KA 2EPBA 5C0XG 1WTRA 1XYIA 1WVLA 2PPBC 2RKSA 4IUUA 5KIXA 5A35A 4HR7B 3O13A 4K5WA 3ERQA 1TR5A 5IGFA 4KKUA 4CHTB 3J81L 2MGSA 1I6VC 1SXTA 3MXPA 2JA7B 4G7HC 3FMCA 1TWGB 4OL7A 2XSCA 1BUVT 5CR3A 3NPPA 4TQUS 2JEAI 3HOZB 5ELBA 5KYLA 1DOMA 3TMEA 3H0GB 1CT1D 3H6MA 3HKZB 1Z47A 1SNCA 3I70A 1BCPB 1GHJA 1WTXA 1FR3A 4A3EB 2F0MA 3GTJB 1OXXK 1EYCA 5IGEA 3SK8A 1BR9A 1HTLD 2EJFC 2RDGA 2NTTA 2AQ1B 2FFKB 2HUGA 3KLRA 3HZXA 5E4WC 4KTAA 5EKIA 4FXGC 1BDOA 2A69C 3QWNA 1AZQA 5CV7A 3R3OA 1WTWA 3MAQA 3EROA 3SK5A 2JXMB 2C5CA 1D5MC 1J8IA 3S1QB 1EEID 2F0WA 1HQMC 4C1NI 3M4OB 2XWBB 2IPKD 1D6EC 2A68D 3MXGA 2F4IA 1HXYD 1ZKOA 2PNRC 1EWHA 5JJZA 3HOYB 3CRLC 3GTMB 3MFYA 1PZID 2F0PA 1TWAB 1U9RA 2Z4HA 2JA6B 1TS5A 1E0BA 3C46A 1MD2D 2E2IB 4QMGA 4K5XA 3D3RA 3N6RA 1STNA 4RKBA 3NTKA 1QCBD 4DF7A 1EWCA 2OXPA 5KNDA 3NE5B 1U4MA 3LX0A 1LTID 1NUCA 5IIFA 5CYUA 4NW2A 4A3JB 3JAME 3OSOA 4HCEA 3P7JA 4O1NA 3T4AC 1X32A 2WIIB 1HA5A 2I46A 1DM0B 1B4OA 2E75C 5M5WB 2LS01 3H3VC 5JEAG 2I07B 2KCCA 1PRTB 3H09A 2G9HD 3BYTB 4IUNA 3IFTA 2FINB 1SJHD 1G2SA 1I4GA 4U68A 4CKCA 1ESFA 3S17B 3HEJA 4RA8A 1CA6A 5FO7B 1ET9A 5CBAE 1A15A 2IX1A 2NN6G 3L7ZC 4PQXA 3Q24A 1EFID 2F0EA 4EVOA 4A3IB 1LTSD 5C3XA 3M7GA 1VMPA 5M3MB 2SNSA 2L55A 1A3UA 3I8ZA 5CV8A 2B2YC 4WRDA 2A74C 1KDAA 3PUXA 2RBMA 2BA1A 3ND8A 1Y8NB 4MIUA 1STHA 3D4DA 5CBEE 1KAAA 1EYDA 2EYHA 3VR3A 5LL6X 1RODA 5C6AA 2XRSD 3Q0AA 4RFBA 1Y1WB 3ITPA 2WACA 1JB3A 3FPPA 1UEAB 5AFWA 1NAPA 3J80E 4A3GB 2BCOA 5DM73 3I73A 1IL8A 2TSSA 1GUOA 5LHY1 5ELFA 1ZYRC 4HCSA 1IKMA 5C4HA 5C4JB 3RZDB 2LMCB 3HOXB 2O2LD 1KTKA 1XWEA 1D2BA 3GV6A 4ZYSA 2K6AA 4MHEA 4HMIA 2JE6I 2JSOA 4CGYB 2QEJC 4IALA 2F03A 4ULLA 4JBWA 3OIQA 1EQTA 4FYDA 3SE0A 2EDGA 1H9KA 5HURA 3A8JE 1BCPD 5DNFA 4XYOA 2X69A 5ELEA 1TWHB 1O7YA 1Q3LA 3HS0C 2F0FA 3BYYB 3OHXC 4P2CB 2EE1A 4C3JG 2B2VA 4DU9A 4ZUJA 4RGOS 3AMUA 2K5WA 4HEDA 4ZLTF 5FLXL 1B9NA 4A93B 2K03A 5ISRA 3T53B 1U4PA 2F0DA 2C9OA 1EY6A 3DEPA 4DAVA 1OO9B 2F0OA 1S5BD 3SK6A 4XTCS 5KRUA 1TVXA 2EYJA 4KJOA 1LABA 1D5ZC 2NUCA 1G6ZA 2JP1A 1QWYA 2HCCA 2EYLA 1H9SB 3JAML 3VR6A 4OO1I 2NVTB 3A54A 5EKLA 2AWOA 2ZXRA 1DXMA 2ZT9C 4RGTA 5E1FA 1R9TB 4YIJA 1SE2A 2KOLA 5LL6S 2WAQB 5IT9L 4LMQD 3FPUB 3I90A 4BA2I 4F8MA 3HOUB 3GTOB 1Z7TA 3MVVA 2L11A 1RCVD 3I3CA 4FP5D 4ZRZA 3P75A 2B8GA 3EVQA 3L3OC 1MSHA 1STYA 1I6HB 3SR1A 4KKTA 1ESRA 3SXHA 2YYZA 1DONA 3AB9A 2IJ0A 4XIGS 1TS4A 5CC4A 1PZKD 3D8GA 4KHVA 4LJZC 1KDCA 2KVMA 3G7LA 1XX8A 2A68C 2O4XA 1QG7A 5FKAC 3K59A 1LTBD 5EPJA 4TRDA 1F2YA 1V1PA 1WD1A 1JWUD 3ND9A 5I4DA 2H4OA 1JORA 2E76C 3GV3A 4QUFA 2XIWA 2XN9C 4K14A 1PTOH 2MPMA 3GTKB 1HCZA 3A7AB 2F0HA 5BN4A 3L9AX 5DAUA 1TWFB 3PMFA 5E3FA 2A6HD 2IL8A 2F0UA 1WTPA 2F1MA 3NTIA 4S3SA 4F88A 3S1MB 4L8JA 4XT1B 2IX3A 1C48A 1DCZA 1I3QB 1RDPD 5FO9B 1K83B 2B8FA 2DNCA 4KY6A 3HOWB 3HOVB 4NKLA 1MSGA 2CVRA 2F0TA 5IODA 1SYFA 1Q8IA 4C3HB 4OO1H 1H9SA 2KQ3A 3WOEA 1Q12A 2DN8A 1OXTA 4FF1A 1Q90A 1M8AA 1EIGA 3PUWA 2BDOA 2XRQD 4RCNA 3NP8A 4RCOA 1TWCB 3VYUA 5C0XI 1DOKA 1HUNA 4WFN3 1KABA 1SMYD 1HHVA 1JC7A 2PYKA 3NHHA 3LWUA 4KV6A 4A3FB 5C5LA 4FF3A 1STEA 3GTQB 1EY4A 2NWGA 2VB3X 3D31A 4CKEA 2FMCA 5IGDA 1KDBA 4DK0A 1A3VA 5I9PA 3OIPA 2E2HB 1OXUA 4A3BB 3VYTA 3QOLA 3FVQA 1ENCA 2M9VA 4RAUC 3C1EA 1PTOF 4OHJA 2WKDA 4FXKC 3EQLC 2IX0A 2M00A 1EQVA 1G291 1TS2A 5A2QE 1HUMA 3IFDA 4ZAIA 4PMWA 3U9SA 1PTOD 1KLGD 3PV0A 3R93A 3BDCA 2QILA 1PLFA 1SNQA 4HSVA 3FDTA 2GA4B 3HRZC 1GUNA 4J1MA 1SSOA 4FO2A 2XVSA 1HPCA 2B2WC 1KNAA 3SDZA 2PO4A 3PUYA 4CJ1B 3URYA 2X6GA 1SYBA 1CQVA 1WTQA 1JWSD 3BZDB 2EYMA 1F9PA 2WKCA 5ELDA 4BS9A 2HCIA 2KCNA 2EY6A 2ZXOA 2LFNA 1BCPC 4ABNA 4XDXA 4DNTB 3QOJA 5CV9A 5K36H 2EYPA 2RVLA 2K1BA 5C5MA 1DD2A 2KJXA 4EQPA 3BS1A 1SNPA 3BDLA 3DMUA 4KHZA 2EY1A 1LACA 1GHKA 4X3TA 2N88A 4X3UA 1CZWA 2R6GA 3X3NA 4RKLA 5JOBA 4K6DA 1SE3A 3A7LA 3QJYA 1HFGA 3A8KE 4V190 3X3MA 5DEHA 3PIO3 5ELCA 4R8IA 3VR5A 4HSPA 1SNDA 1MGSA 3PO3B 3GTLB 3W3AA 1EU4A 3U9OA 2NBFA 5CV4A 1JWMD 2IT1A 4FXDA 4I7ZC 3CKIB 3ZYYX 3NBHA 4LAAA 1E2ZA 2NN6I 3OPOA 4K2LA 3I72A 1X3QA 1B1ZA 4A3KB 5M5YB 1RKNA 3AU7A 1I4HA 5D14A 1S5FD 1SBBB 5KEEA 5D3IB 5JVH3 3OOCA 3V2TA 2D2CC 4J8QA 1XTCD 2WP8J 1AFPA 3DEOA 2B2VC 3T51B 1PRTC 3WDNA 1WTVA 1W6JA 5I2XA 4F87A 1CFMA 4OIJA 4RGNA 4ZUIA 3QG1A 1QILA 4QCLA 4F7XA 4DN4M 1PXUA 1ENAA 4H7BA 3QB3A 1TU2B 4KY5A 4DA2A 4HN7A 3VA7A 1F77A 2EJGC 3VYRA 2CW0D 1RJTA 4DNRB 5KNCA 3A56A 5C44B 1DOLA 1B53A 1Y8PB 4KMUC 4Y7NB 4I65A 1F2LA 5A2QL 1I4RA 4ZQ3A 1VMCA 1TS3A 3J7AF 4H13C 1F9SA 3BVZA 1B3AA 4C2MB 2RQXA 1ET6A 3KLSA 2F0GA 2FHTA 2MUYA 3T16A 2A6HC 4HTHA 4Q5VA 4FVMA 2F0LA 2QCPX 4GZYC 2JEBI 2XWJB 4J6HA 1BCPF 3PIP3 3CU7A 3MA2B 5TSSA 5EBCA 2LY7A 3TZDA 2J4XA 1V1PB 4QF4A 2K5QA 1EY0A 5FOBB 4V0BA 2QF7A 1B9MA 1JOQA 2KHSA 2K7VA 2MJ8A 1QNUA 3MFGA 1CA5A 3KBXA 1LTRD 1E2WA 1STBA 2F3VA 4X3SA 1BBXC 2NVXB 4IFDI 1MI2A 1SMYC 4U673 3TP5A 2WB1B 2NN6H 4IN3A 3KLSX 2PCFB 2M2LA 1STGA 5CV5A 1F2ZA 1SFOB 4C3JB 3IKJA 2MP1A 3GO5A 3M3YB 1R4QB 1JQYD 2HQEA 1LTGD 3FEWX 5D3DA 4BY1B 4IFDG 3P1HA 3K57A 1O7LA 1I4XA 2Z4IA 1L0YB 1SNMA 4G4KA 4B9WA 4L63B 1AZPA 4K5VA 4L6TB 2K04A 4KN7C 4RGMA 2A73B 1AW7A 2K28A 1PMRA 2R7ZB 5BN3A 4JK1C 2OT2A 3K7AB 3CHBD 4FNFA 3J81E 5EKKA 3RD4A 1PTOC 4IQZA 1CHPD 3UI2A 1A6XA 2NZ1D 1I50B 5M3FB 4XT3B 1EY5A 4X3KA 3FKIB 2Z1CA 1S5ED 2RA4A 2BE5D 1CTMA 2O5IC 4KY7A 4H44C 1II3A 3RMHA 5C4ZA 4IUPA 1TT2A 4XXEA 1PRTF 1TY2A 1JOOA 4C56C 1B2TA 1JE4A 2DNEA 2PQEA 2QKIC 2EVBA 1X3PA 3CQZB 3SK4A 1PYWD 1S5DD 1D5XC 3VYSA 2L9HA 1UNSA 4QUCA 1PRTD 2KEDA 4G57A 5C3WA 2AQ2B 3TSSA 3E0JA 2A6ED 1Y69U 5T1GA 5CORA 4ODGA 2JA5B 4DXFA 1L0XB 1CM9A 2K01A 1V1OA 5I2YA 2DY7A 3G6JB 2E2JB 1FNVA 4TSSA 3V05A 2AQ3B 2F3WA 1EY8A 4KJNA 2HDMA 4IUTA 2F0VA 3TBIB 5I6YA 4IUVA 2B63B 5C0XJ 1PFBA 2KECA 3C2PA 4A3MB 3TP6A 3J80L 3MZ5A 1TKWB 3NXWA 3VR2A 2RDHA 2VNUD 3DXJC 1BF4A 4PV1C 1K8OA 1QJOA 4MN3A 1H9RA 5EPKA 1VF5C 3R8BA 5K5PA 4WORA 2L5TA 1EY7A 3CRKC 1ENFA 1Q1BA 2B2UA 4BWGB 3GTPB 2WINB 5J22A 3LWEA 2R3ZA 4TKOB 1EYAA 3DWAA 3DUZA 3OMCA 3BVGA 3BG3A 5IGBA 2J7ZA 4RWSC 2AUJD 4CJ0B 2KUMA 4XQJA 2IWHA 5F2DA 2FMMA 1WTOA 4C3IG 3VA5A 1I4PA 2F0QA 1V8QA 3S16B 2Q8RE 4ZKBB 2ICEC 1SYCA 2SEBD 1IYVA 1Q1EA 2BOSA 4KN4C 1B44D 4HAEA 2CW0C 5HGTA 3NQIA 4DXGA 4DFAA 1ICWA 4KK7A 1ILPA 5NUCA 1GUWA 2PZUA 3GP7A 1DYQA 1YNJD 5EBDA 5KYIA 1CQFA 3NQTA 4QB4A 1SEBD 1D1KA 4B9XA 2B2TA 4BA1I 3T56B 2NTSA 4PMBA 1LT5D 1TQOA 2L1BA 1VDZA 4RHSA 5I6WA 3R2IA 1C4QA 3E6ZX 1CHQD 1SYDA 2PMZB 5IGGA 5BN5A 2YU9B 4K2KA 3I4MB 3S15B 1RTOA 1F2MA 4OIKA 1BXTA 1I4QA 4WJWA 4CKBA 1A2UA 3NUCA 4CJ2C 3H91A 5JEAJ 2EY5A 2R61A 2ID0A 4M1UB 1JICA 2Y0SB 5KGUA 3MXNA 4NMZA 2JYOA 2VB2X 2Z8LA 1TY0A 1PFNA 1STAA 1MBYA 1RD9D 1FNUA 4LK1C 5CV6A 1CZGA 1FNWA 4R8NA 2CQAA 2CHBD 3GD7A 1NCVA 2E74C 3NTHA 4ZK9B 1AN8A 2NB0A 1PFMA 5T1IA 3DM1A 1JR0D 2G9DA 4UAIA 3BDOA 2OEOA 1ZEQX 1QOHA 1BNZA 3NBIA 1SDFA 4RH6A 3FRPB 1JCKB 5JPNC 1YNND 3TP7A 3RLFA 3KUPA 1ILQA 5FLXE 1A2TA 2AWNA 1J9OA 1FGBD 2NYZD 2AUKA 5C0XH 3K58A 4XQNA 4OGQC 3ONAB 2BDNA 4EGVA 5JVG3 5EJWA 3KF8A 4AYBB 5IGCA 2K05A 2J0TD 2ZXPA 1LO5D 3S2DB 4KD4A 5FO8B 2L12A 1LTAD 1G8ZD 2K32A 1GOZA 1A3TA 2BE5C 3SHLA 3D6CA 5E4XA 1H9JA 3R2TA 2RSNA 5EGTA 1BO0A 1ZXTA 2K5DA 5CMDA 2SDFA 2JA8B 1BOSA 1OXSC 5IT9E 3EFXD 2OF1A 1EL0A 4Z9CB 1SJED 1SAPA 4QIWB 3F2UA 1IHZA 2B2WA 4G7ZC 2H1EA 3A55A 1SNOA 3S14B 3V96A 4PNYA 2EZVA 2A6EC 3DHQA 3TZUA 1RHPA 1PZJD 1FD7D 4HMJA 4XQQA 4DGZA 3WOFA 3MXUA 3S2HB 1HA6A 3MEHA 2D5DA 5EPLA 1R4PB 1IW7C 5J1ZA 4KI0A 3HG9A 2ENBA 3H94A 4ME5A 3RZOB 3OWEB 3M85A 1F9RA 3TP8A 4IFDJ 5G3LF 4M8AA 3I4LA 1JOKA 1AP0A 1FYCA 2EYFA 1CI3M 1E2VA 1HQRD 2WV6D 1HFNA 3PO2B 1NSNS 3T13A 5G3LD 1S5CD 1XXGA 2KA7A 5M9OA 1CK1A 1NR4A 3QIAA 1SYGA 2PZTA 4XYQA 4N9PA 1DZ1A 2SOBA 2XNAC 4ZKCB 1SE4A 3GTGB 4FF4A 1HTPA 5JEAH 2F0SA 1TIID 3Q22A 1LT3D 3TDQA 1EEFD 1G91A 2EOTA 1O80A 3HP3A 2F0NA 2A69D 4A3DB 1G2TA 1IYUA 2MHVA 2F0IA 3KK7A 3IAYA 3MC0B 2EY2A 1ML0D 1EZ6A 1VCIA 3RUZA 1S4ZA 1RTNA 1UAPA 5KNBA 4IURA 3M7NA 3PUVA 1GXDC 2DY8A 1LT6D 3IL8A 1EOTA 1DJRD 3BVMA 4H0LC 3OW7A 4NDXA 3N52A 2PZWA 1QNKA 2TMPA 5I9OA 1QB5D 3Q6SA 1LLRD 3MTSA 1EIHA 1PTOB 1B50A 1YNJC 2B2YA 2Q8TA 1LT4D 1U4RA 4C1NK 1U4LA 3D4RA 4DAPA 5J39A 3MWYW 2D9UA 3GQBA 1VF7A 3C1FA 3DWQA 1V43A 5JPMC 3S9WA 4BBRB 2B39A 4DAYA 3EJIA 5JAVA 1RF2D 2F0JA 4O42A 4UDUC 3E5SA 5M5XB 2PW7A 2N55A 2B2UC 4ID6A 1Y8OB 2L4NA 2QDBA 4RHRA 1T5EA 2BA0A 4PMCA 1ONLA 1GUTA 2RSOA 4R9WA 1WCMB 4OO1G 2D62A 1KNEA 1AEXA 4IUQA 3M4YA 5IOCA 2FJ2A 1KLUD 4B08A 1EU3A 3NWTA 3S1NB 3J7AV 3I4NB 3MHBA 4NP5A 3NSWA 5CGKA 2R92B 1GUGA 4DK1A 5COYA 1Y1VB 1M4VA 5DM63 4G7OC 3HGBA 2EXZA 3DWPA 5FK9C 2E2DC 1F9QA 1K8MA 2NVQB 3D4WA 1IW7D 1EZ8A 3I91A 3LNNA 4BY7B 1YNNC 4KKSA 1QE6A 2KEEA 2Q8IB 1OXVA 2EJMA 3K5MA 2R93B 4CBVA 1SYEA 2B2TC 4IFDH 4E6IA 4BBSB 3SVMA 3TN2A 4IZ8A 2IW3A 3K5NA 2O5JC 4N9TA 1O7ZA 4K8JA 2ICIA 3KBGA 3OWFA 4KD3A 3OMGA 5C4XB 5D65A 3C3LA 3Q23A 3VR4A 4EQOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4C3I G;  4C3J G;  4C3H G; 
#chains in the Genus database with same CATH topology
 1MIU A;  3NK9 A;  1VQO A;  1IKL A;  3S1R B;  3W2D A;  1GJX A;  3P20 A;  2K33 A;  1KC8 C;  4K8I A;  1GUS A;  2PW5 A;  4ILW A;  4PZ8 A;  3J7Y W;  2VUM B;  1ZYR D;  2CWA A;  4DV0 L;  4BBR H;  1EY9 A;  3PUZ A;  4Q0F A;  4LF6 L;  4EQN A;  4IOA A;  1W6K A;  2SNM A;  1I94 Q;  5EQ0 A;  3EA6 A;  2RDF A;  5M5X H;  4K6L A;  4IJL A;  2KCT A;  3E3X A;  1O78 A;  2JQO A;  4O0A A;  1D1I A;  1N32 Q;  1C9O A;  1LV9 A;  3HOW G;  1LTT D;  4AQY Q;  3HOV G;  4DV5 L;  1C8C A;  2R7D A;  2UXC L;  1H9M A;  1VQJ A;  4YCW A;  4C3H G;  1WCM H;  1UUP A;  1WD0 A;  5K36 G;  2HDL A;  1KAW A;  1HRJ A;  1A62 A;  4FF2 A;  4UP7 A;  1YJW A;  2VXW A;  3SEB A;  4GKK L;  3D6W A;  3J81 c;  3KJO A;  5J3B A;  4LUZ A;  4R1J A;  3NWS A;  1EWI A;  3A8I E;  2X6L A;  3K0Y A;  3UE0 A;  1KXL A;  2EYO A;  3K5O A;  3I4N H;  1Z6H A;  2L0C A;  1V1Q A;  4A3F G;  1L1O B;  2V4D A;  4C3I B;  1IL2 A;  3RN5 A;  3CPW A;  1PDQ A;  2LKV A;  1BQQ T;  5C3E B;  2A5H A;  4LUV A;  2R92 H;  2NVY B;  1Y1V H;  3K6O A;  3QO2 A;  3B6Y A;  2K5V A;  3K5L A;  1GKH A;  1NR2 A;  4WJ3 M;  1T5X D;  2F0K A;  3HKS A;  2QW7 A;  2EPB A;  4A3B G;  5C0X G;  1EYG A;  1WTR A;  2NVQ H;  1XYI A;  1WVL A;  5E7N A;  2PPB C;  2RKS A;  4IUU A;  4X6A H;  5KIX A;  4BY7 H;  5A35 A;  2ATW A;  1X56 A;  4BXX G;  3U58 A;  4YWK A;  4HR7 B;  1AH9 A;  3O13 A;  4K5W A;  3ERQ A;  2UUA L;  1TR5 A;  1N33 L;  4DUZ L;  4JI7 Q;  5IGF A;  2PQA B;  4KKU A;  4CHT B;  3J81 L;  2MGS A;  1I6V C;  2R93 H;  2UUC L;  2YTY A;  3CXC A;  1SXT A;  3MXP A;  2JA7 B;  4G7H C;  3FMC A;  1TWG B;  4OL7 A;  5GRO A;  2DUD A;  2XSC A;  2G5D A;  1FJG L;  1BUV T;  5CR3 A;  3NPP A;  4JG2 A;  4TQU S;  2JEA I;  3HOZ B;  5ELB A;  5KYL A;  1DOM A;  3TME A;  1E1T A;  3NEL A;  5C4X H;  3H0G B;  4R4T A;  1CT1 D;  5LMU Q;  3H6M A;  3HKZ B;  1Z47 A;  1SNC A;  5LMN L;  3I70 A;  1BCP B;  1GHJ A;  1WTX A;  1FR3 A;  4A3E B;  3S1R H;  2F0M A;  2Z0S A;  3KDF A;  3GTJ B;  4KHP Q;  2VUM H;  1OXX K;  2CCZ A;  1EYC A;  5IGE A;  3SK8 A;  1BR9 A;  1HTL D;  2EJF C;  5GAH C;  1CKM A;  2RDG A;  2NTT A;  4DV7 L;  4JYA Q;  2AQ1 B;  3CMA A;  1SLJ A;  1YHB A;  2FFK B;  5L37 A;  3G4S A;  2HUG A;  3KLR A;  3HZX A;  5E4W C;  4KTA A;  5EKI A;  4FXG C;  1Q46 A;  1BDO A;  1NJI C;  3BJU A;  2A69 C;  3QWN A;  1AZQ A;  4OWW B;  5CV7 A;  3R3O A;  4QL5 A;  1WTW A;  2VY3 A;  3MAQ A;  3ERO A;  4OWX B;  3SK5 A;  2JXM B;  4YCV A;  3UDI A;  2C5C A;  1D5M C;  1J8I A;  3UDG A;  3S1Q B;  1EEI D;  2F0W A;  1VQL A;  4RG1 A;  5EAY A;  3DLL A;  1JB7 A;  1HQM C;  4C1N I;  2KBN A;  2GVB A;  3M4O B;  2XWB B;  2VQE Q;  2IPK D;  1VS0 A;  1D6E C;  4DV3 Q;  4DR5 Q;  2F4V L;  2A68 D;  3MXG A;  2F4I A;  4GS3 A;  1HXY D;  1YVC A;  1ZKO A;  2PNR C;  4C3I H;  1EWH A;  5JJZ A;  3HOY B;  3CRL C;  5C3E H;  3GTM B;  1WYD A;  3MFY A;  1PYS B;  1PZI D;  2F0P A;  1BKB A;  1TWA B;  1U9R A;  1IBK L;  2Z4H A;  2JA6 B;  1X3F A;  1TS5 A;  1W2B A;  1E0B A;  1EIY B;  1MD2 D;  3C46 A;  4QMG A;  4K5X A;  3TRE A;  3D3R A;  2E2I B;  3N6R A;  1STN A;  4RKB A;  2LXJ A;  3NTK A;  1QCB D;  4DF7 A;  1EWC A;  1HNX Q;  2OXP A;  3PO3 G;  5KND A;  3NE5 B;  2ZM6 L;  1U4M A;  3LX0 A;  1LTI D;  1JT8 A;  1JJG A;  1L1O A;  4X65 L;  2NZH A;  1NUC A;  3PIP A;  5IIF A;  5CYU A;  4NW2 A;  4A3J B;  3JAM E;  3OSO A;  4HCE A;  2JA7 H;  1HNW Q;  1TWG H;  3P7J A;  4O1N A;  3T4A C;  1X32 A;  2WII B;  1KHI A;  1HA5 A;  1XNR L;  2HIX A;  2I46 A;  1DM0 B;  1B4O A;  1FGU A;  4DV1 L;  2E75 C;  3HOZ H;  5M5W B;  1EUJ A;  2LS0 1;  4JBJ A;  3F1Z A;  4A4I A;  2RCF A;  1SRU A;  3H3V C;  2CWP A;  5JEA G;  2I07 B;  3A0J A;  2KCC A;  1AE3 A;  3H0G H;  3H15 A;  1PRT B;  1X65 A;  4A3K G;  2ZJP A;  3H09 A;  2G9H D;  3BYT B;  4IUN A;  2PQA A;  3IFT A;  1N34 L;  3QR8 A;  2FIN B;  1SJH D;  4A3E H;  1G2S A;  1I4G A;  3J7Z C;  4U68 A;  4LFC L;  4CKC A;  3GTJ H;  1ESF A;  3S17 B;  4LF9 Q;  3HEJ A;  4RA8 A;  1CA6 A;  5FO7 B;  4JV5 Q;  1ET9 A;  5CBA E;  3F2D A;  1HZC A;  3F2C A;  1A15 A;  2IX1 A;  2NN6 G;  5IY0 A;  3L7Z C;  4PQX A;  2K4K A;  3Q24 A;  1EFI D;  4QY7 A;  1KQS A;  4L5Q A;  1KL9 A;  2F0E A;  4EVO A;  4LFA L;  4DAY B;  4A3I B;  1LTS D;  5C3X A;  1TXY A;  1N32 L;  1K28 A;  4OXP A;  1B8A A;  3M7G A;  1L0W A;  5IP7 H;  1VMP A;  5M3M B;  3ULP A;  2SNS A;  4JOI C;  2L55 A;  1A3U A;  3I8Z A;  1K73 C;  3S1Q H;  5CV8 A;  2B2Y C;  1ASY A;  4WRD A;  3M4O H;  2A74 C;  1KDA A;  3PUX A;  2RBM A;  2BA1 A;  4PZ6 A;  2BH2 A;  3WWV A;  3ND8 A;  1Y8N B;  4ZCK A;  4MIU A;  3HOY H;  1STH A;  3D4D A;  5CBE E;  2VQF Q;  1KAA A;  3GTM H;  5C44 G;  2XGT A;  1VQ8 A;  1EYD A;  2EYH A;  2EIF A;  3VR3 A;  5LL6 X;  2Z6K C;  4DV5 Q;  1PFS A;  2UXC Q;  1TWA H;  4IJH A;  1ROD A;  5C6A A;  2XRS D;  3W1B A;  2JA6 H;  3Q0A A;  1GVP A;  2E2I H;  4RFB A;  1VQM A;  1Y1W B;  4R4O A;  3TS2 A;  3ITP A;  4N8F A;  2WAC A;  1JB3 A;  3FPP A;  1UEA B;  2P5Z X;  5AFW A;  4GKK Q;  1YJ9 A;  1NAP A;  3J80 E;  4A3G B;  2BCO A;  5DM7 3;  4DUY L;  1SE8 A;  3I73 A;  1IL8 A;  2TSS A;  1GUO A;  5LHY 1;  5IP9 G;  5ELF A;  1GO3 E;  1ZYR C;  3M4Q A;  3PCO B;  2OQ0 A;  4HCS A;  1IKM A;  5C4H A;  5C4J B;  4A3J H;  4YHH L;  3G6E A;  2EQS A;  3RZD B;  1PH1 A;  3NEN A;  2LMC B;  3HOX B;  2O2L D;  1KTK A;  1XWE A;  1D2B A;  3GV6 A;  4ZYS A;  2K6A A;  4MHE A;  4HMI A;  2JE6 I;  2JSO A;  4CGY B;  2QEJ C;  5FLX c;  4J15 A;  5M5W H;  4IAL A;  2F03 A;  1D7Q A;  2QA4 A;  4ULL A;  4JBW A;  3OIQ A;  1EQT A;  4FYD A;  3SE0 A;  2EDG A;  1H9K A;  5HUR A;  3A8J E;  1BCP D;  5DNF A;  4XYO A;  2X69 A;  3S17 H;  5ELE A;  1TWH B;  3BU2 A;  1O7Y A;  1Q3L A;  2OQK A;  3HS0 C;  2UUC Q;  5FLM H;  2F0F A;  1PH5 A;  2Z9H A;  4PG3 A;  2WB1 G;  3BYY B;  1NBW A;  3OHX C;  4P2C B;  2EE1 A;  1L2F A;  3JAM c;  2MFI A;  2OTL A;  4DV6 Q;  3D0F A;  1CKN B;  4C3J G;  2B2V A;  4DU9 A;  1RIP A;  4ZUJ A;  5LMN W;  3EBE A;  2HHH Q;  4RGO S;  3AMU A;  1HJP A;  4JYA L;  2K5W A;  4HED A;  4BY1 G;  4ZLT F;  5FLX L;  1B9N A;  4A93 B;  2K03 A;  5ISR A;  3T53 B;  4A3I H;  1U4P A;  2F0D A;  2C9O A;  1EY6 A;  3DEP A;  4DAV A;  4DKA C;  5IT9 c;  5LMN Q;  1OO9 B;  2F0O A;  1S5B D;  2AHO B;  2LSS A;  3SK6 A;  5M3M H;  1P16 A;  3PSI A;  3CCS A;  4XTC S;  1XNQ L;  5KRU A;  1TVX A;  2EYJ A;  4KJO A;  4RMF A;  4B3S Q;  1LAB A;  2I5M X;  1D5Z C;  2R7Z G;  2NUC A;  4DV7 Q;  1G6Z A;  2JP1 A;  1NTG A;  2VW9 A;  1QWY A;  1N36 L;  2HCC A;  2EYL A;  1H9S B;  2VQE L;  1N8R C;  3JAM L;  3VR6 A;  4OO1 I;  1Q7Y C;  2NVT B;  3A54 A;  5EKL A;  1Y14 B;  3PO2 H;  4DV4 L;  2AWO A;  2ZXR A;  1DXM A;  2ZT9 C;  1KRT A;  5M3F G;  3FKI G;  4RGT A;  1Y1W H;  4JPB W;  5E1F A;  1R9T B;  4YIJ A;  1SE2 A;  2CH4 A;  1VQB A;  2KOL A;  5LL6 S;  2WAQ B;  3CCU A;  4O2D A;  5IT9 L;  4A3G H;  4LMQ D;  3FPU B;  2ZJR A;  2WB1 E;  4JC0 A;  4X62 Q;  3I90 A;  4BA2 I;  5C4J H;  1HNX L;  4F8M A;  3RZD H;  3HOU B;  3GTO B;  1Z7T A;  3GTG H;  3HOX H;  3MVV A;  2L11 A;  1RCV D;  3I3C A;  4FP5 D;  4ZRZ A;  3P75 A;  2B8G A;  3EVQ A;  2GVA A;  3L3O C;  1HNW L;  1IBK Q;  1MSH A;  1T9H A;  2N3S A;  1STY A;  1I6H B;  3SR1 A;  4KKT A;  1ESR A;  4LNQ A;  3SXH A;  4JW0 A;  2YYZ A;  1YI2 A;  1B7Y B;  4OWT B;  4UP9 A;  1DON A;  1W3S A;  1LM0 A;  4DR4 Q;  3AB9 A;  2IJ0 A;  3E0E A;  3ER0 A;  1NMF A;  4XIG S;  1FL0 A;  1YHQ A;  1TS4 A;  2JA5 G;  2NZO A;  5CC4 A;  1PZK D;  1MJC A;  2KEN A;  3D8G A;  4GLV B;  1HNZ Q;  4KHV A;  4LJZ C;  1IBM L;  1TWH H;  4GOP B;  1KDC A;  2HD3 A;  2F52 A;  2KVM A;  3G7L A;  1XX8 A;  2A68 C;  2O4X A;  5AJ3 L;  1XNR Q;  1J6Q A;  1QG7 A;  5FKA C;  3K59 A;  4JV5 L;  1LTB D;  4A3C H;  5EPJ A;  1B3Q A;  4TRD A;  1F2Y A;  1V1P A;  1WD1 A;  5IYB H;  1JWU D;  3ND9 A;  5I4D A;  1VQP A;  2H4O A;  2WAQ E;  1JOR A;  2E76 C;  3GV3 A;  4A93 H;  2B63 G;  4QUF A;  3CC4 A;  3RLN A;  2XIW A;  2XN9 C;  4K14 A;  1PTO H;  2MPM A;  4A3M G;  3GTK B;  3ULL A;  4DPG A;  1HCZ A;  1S3O A;  3A7A B;  4LFC Q;  2F0H A;  5BN4 A;  3L9A X;  5DAU A;  3RR5 A;  2B3G A;  1CKN A;  1TWF B;  3PMF A;  1LYL A;  5E3F A;  4B3R Q;  2A6H D;  2IL8 A;  2F0U A;  1WTP A;  4P72 A;  2F1M A;  3NTI A;  4S3S A;  2NVT H;  1K8G A;  4F88 A;  3S1M B;  4LFA Q;  4L8J A;  4XT1 B;  2VQF L;  2IX3 A;  1C48 A;  1QZH A;  4Y52 H;  1DCZ A;  1K3B C;  1I3Q B;  1RDP D;  4JI2 Q;  4DR7 L;  5FO9 B;  1R9T H;  1K83 B;  2B8F A;  2DNC A;  4KY6 A;  3HOW B;  3HOV B;  2B29 A;  4NKL A;  1MSG A;  2CVR A;  3A5U A;  2F0T A;  5IOD A;  1CSQ A;  1SYF A;  4HID A;  1Q8I A;  4MTN A;  3UDX A;  4C3H B;  1UE6 A;  4OO1 H;  1H9S A;  2KQ3 A;  3WOE A;  3HOU H;  1Q12 A;  3GTO H;  2DN8 A;  1OXT A;  1WOC A;  4FF1 A;  1Q90 A;  3S1N H;  3STB D;  4NXM L;  1M8A A;  1EIG A;  3PUW A;  2BDO A;  3KFU A;  2XRQ D;  1IBL Q;  4RCN A;  3NP8 A;  4RCO A;  1TWC B;  3VYU A;  5C0X I;  1DOK A;  1HUN A;  4WFN 3;  1KAB A;  1SMY D;  3Q8D A;  5GQO A;  2A1A A;  1HHV A;  1JC7 A;  1I6H H;  2PYK A;  3NHH A;  4CDF C;  2D0O A;  3LWU A;  1PH7 A;  4KV6 A;  4A3F B;  5C5L A;  4FF3 A;  2RF4 A;  1STE A;  3GTQ B;  1EY4 A;  2NWG A;  2VB3 X;  3D31 A;  4CKE A;  2FMC A;  5IGD A;  1PH6 A;  1KDB A;  4DK0 A;  1A3V A;  5I9P A;  4DUY Q;  3CCL A;  3OIP A;  2E2H B;  1A0I A;  1OXU A;  1P8L A;  2GN5 A;  5IYD H;  3NBH B;  1VQG A;  1XMO L;  4YHH Q;  1PV4 A;  3ULJ A;  4A3B B;  3VYT A;  3QOL A;  3FVQ A;  2HT1 A;  1ENC A;  2M9V A;  4RAU C;  4NXN Q;  3C1E A;  1PTO F;  4OHJ A;  1M1K C;  1CSP A;  1VQN A;  2WKD A;  4FXK C;  3EQL C;  4BBS H;  2IX0 A;  2K50 A;  2M00 A;  1EQV A;  1G29 1;  3UE1 A;  1TS2 A;  4DV6 L;  2VZA A;  2HQL A;  5A2Q E;  1HUM A;  2ZTE A;  3IFD A;  4ZAI A;  4PMW A;  1BVS A;  2HHH L;  3CCQ A;  4GOP A;  3U9S A;  1VQA A;  3GTK H;  1PTO D;  2KHJ A;  1KLG D;  3U4V A;  3T1H L;  4QJF A;  2LXK A;  3PV0 A;  3R93 A;  3BDC A;  2QIL A;  1PLF A;  1SNQ A;  4LFB Q;  4HSV A;  3FDT A;  1IZ6 A;  2GA4 B;  3HRZ C;  2E5L Q;  1GUN A;  1TWF H;  4J1M A;  1SSO A;  4FO2 A;  2XVS A;  4NPS A;  3PF4 A;  1HPC A;  4GNX B;  3I4M G;  2UXB Q;  2B2W C;  1KNA A;  4LF7 L;  3SDZ A;  2PO4 A;  3PUY A;  4B3S L;  4CJ1 B;  3URY A;  2X6G A;  1OTC A;  1SYB A;  4UHV A;  1CQV A;  1WTQ A;  1JWS D;  3S1M H;  3BZD B;  1QVG A;  4DV2 L;  4NB3 A;  3G71 A;  2Y0S G;  2EYM A;  3AYH B;  1F9P A;  2WKC A;  5ELD A;  1YJN A;  4BS9 A;  1I3Q H;  2D0P A;  2HCI A;  1QZG A;  2KCN A;  1Z9F A;  1K83 H;  2EY6 A;  3CCR A;  1PH2 A;  2ZXO A;  3HOW H;  3HOV H;  2LFN A;  1BCP C;  1XNQ Q;  3I4O A;  4ABN A;  4XDX A;  4DNT B;  3QOJ A;  3ZJY C;  5CV9 A;  4C3H H;  5K36 H;  2EYP A;  2RVL A;  2K1B A;  5C5M A;  1DD2 A;  2KJX A;  1N36 Q;  4EQP A;  3BS1 A;  1SNP A;  4X62 L;  4QGU A;  3BDL A;  3DMU A;  4KHZ A;  2EY1 A;  1LAC A;  1GHK A;  1TWC H;  4DV4 Q;  4X3T A;  3T1Y L;  2N88 A;  4DK3 C;  4X3U A;  2QGQ A;  1CZW A;  1XJV A;  2R6G A;  3X3N A;  4RKL A;  4A3F H;  5JOB A;  4JI0 L;  2NVY H;  4K6D A;  1SE3 A;  3A7L A;  4LF4 L;  3GTQ H;  3QJY A;  1HFG A;  3JC6 6;  3A8K E;  4V19 0;  3X3M A;  3H3V I;  5DEH A;  2ZTC A;  3PIO 3;  2Q2H A;  1DGS A;  5ELC A;  4UP8 A;  2PMZ E;  4R8I A;  2E2H H;  3EN2 A;  4HSP A;  3VR5 A;  3OW2 A;  4A3L H;  4DR4 L;  1SND A;  3E9H A;  3J7A 5;  1MGS A;  4A3B H;  1HNZ L;  1PH9 A;  4AYB G;  3PO3 B;  4BXX H;  3GTL B;  3W3A A;  1EU4 A;  2Y0S E;  3U9O A;  4JCV E;  2NBF A;  3JAM i;  5CV4 A;  3CCJ A;  1JWM D;  2IT1 A;  4FXD A;  4I7Z C;  3CKI B;  4GLX A;  3ZYY X;  2VS1 A;  3NBH A;  4LAA A;  1WJJ A;  3F8T A;  3PGZ A;  1E2Z A;  2NN6 I;  4ME3 A;  3LGJ A;  1IBM Q;  3I2Z A;  3OPO A;  4K2L A;  3I72 A;  1X3Q A;  1B1Z A;  5FJ8 G;  1EQR A;  4A3K B;  3TEH B;  2JA8 G;  5M5Y B;  1RKN A;  3AU7 A;  1I4H A;  5D14 A;  3ICE A;  2H5X A;  3E9I A;  3K8A A;  5AJ3 Q;  1S5F D;  1SBB B;  1YIJ A;  5KEE A;  5D3I B;  5JVH 3;  3OOC A;  3V2T A;  2D2C C;  4J8Q A;  4B3R L;  1XTC D;  2WP8 J;  2R7F A;  1AFP A;  1JE5 A;  3DEO A;  2B2V C;  4HIO A;  3T51 B;  1WTH A;  1PRT C;  3A74 A;  3M9B A;  3WDN A;  5IYC G;  1WTV A;  1W6J A;  3U4Z A;  5I2X A;  4JI8 L;  4GNX A;  4F87 A;  1CFM A;  4OIJ A;  4RGN A;  2IHF A;  4ZUI A;  4JI2 L;  3QG1 A;  1QIL A;  4QCL A;  4F7X A;  4DN4 M;  2Q2I A;  1PXU A;  2JJQ A;  4AYB E;  4HJ5 A;  4A75 A;  4P71 A;  3KJP A;  1AE2 A;  1ENA A;  1M90 C;  4H7B A;  3QB3 A;  1TU2 B;  4KY5 A;  1WI5 A;  4DA2 A;  3M4P A;  4HN7 A;  3VA7 A;  1F77 A;  2EJG C;  5IWA Q;  1PHJ A;  3VYR A;  2CH4 W;  3W5O A;  2CW0 D;  3NEM A;  1RJT A;  4DNR B;  1IBL L;  4DR7 Q;  3CCE A;  5KNC A;  1HH2 P;  3A56 A;  5C44 B;  1DOL A;  1B53 A;  1Y8P B;  4KMU C;  1MJE A;  4Y7N B;  4I65 A;  1F2L A;  5A2Q L;  1I4R A;  4ZQ3 A;  4UY8 C;  1VMC A;  1TS3 A;  3J7A F;  4IOC A;  4H13 C;  3CF5 A;  1F9S A;  3BVZ A;  1B3A A;  3PO2 G;  4C2M B;  2RQX A;  4X64 L;  1ET6 A;  3KLS A;  2F0G A;  2FHT A;  2MUY A;  3T16 A;  1VQ7 A;  2A6H C;  4HTH A;  1YHA A;  4NXM Q;  4Q5V A;  4QIW E;  3PO3 H;  3I7F A;  4FVM A;  3GTL H;  3J80 i;  2F0L A;  2QCP X;  4JI3 L;  2BH8 A;  4OEL B;  1XPU A;  3PF5 A;  4GZY C;  2JEB I;  1JMC A;  4L5T A;  1LTL A;  1YNX A;  2XWJ B;  1VQE A;  4NXN L;  1PVO A;  4TVA B;  4J6H A;  1BCP F;  3PIP 3;  3CU7 A;  3MA2 B;  1Q82 C;  5TSS A;  5EBC A;  2LY7 A;  1E22 A;  3TZD A;  2J4X A;  1V1P B;  1V9P A;  4QF4 A;  2K5Q A;  4K0K L;  1EY0 A;  2MO0 A;  5FOB B;  4V0B A;  2QF7 A;  1B9M A;  1XMO Q;  1JOQ A;  2KHS A;  4LUO A;  2K7V A;  2MJ8 A;  2N8N A;  4A3K H;  5M5Y H;  1QNU A;  3MFG A;  1CA5 A;  1VQI A;  1BBW A;  3STB C;  3KBX A;  4P73 A;  4LFB L;  1LTR D;  4A3D G;  1E2W A;  5HY6 A;  2JN4 A;  2E5L L;  1STB A;  2F3V A;  4X3S A;  2CKZ B;  1BBX C;  4YWM A;  4DAM A;  2UXB L;  2NVX B;  4IFD I;  1MI2 A;  1SMY C;  4U67 3;  1NMG A;  3TP5 A;  1K9M C;  1E1O A;  2WB1 B;  2YTX A;  2NN6 H;  4IN3 A;  3KLS X;  1G51 A;  2M2L A;  2PCF B;  3UDF A;  1STG A;  5CV5 A;  4JBK A;  1F2Z A;  1SFO B;  4C3J B;  3IKJ A;  3KF6 B;  2MP1 A;  4HJ9 A;  3T1H Q;  3GO5 A;  3MEF A;  3M3Y B;  1R4Q B;  1JQY D;  2HQE A;  1LTG D;  3FEW X;  5D3D A;  4BY1 B;  4IFD G;  3P1H A;  3K57 A;  1O7L A;  1XPO A;  1I4X A;  3DM3 A;  2Z4I A;  1L0Y B;  4LF7 Q;  1SNM A;  4G4K A;  1X9N A;  4B9W A;  4L63 B;  1HZB A;  1UEB A;  4K5V A;  1AZP A;  4L6T B;  3BZK A;  4KLK A;  2DGY A;  2K04 A;  1PH4 A;  4KN7 C;  2UXD L;  4RGM A;  2A73 B;  1AW7 A;  2K28 A;  3RN2 A;  1PMR A;  4DV2 Q;  2R7Z B;  4AIM A;  5BN3 A;  4JK1 C;  2OT2 A;  3FP9 A;  3CHB D;  3K7A B;  4DR3 L;  4FNF A;  5C44 H;  3J81 E;  5EKK A;  3RD4 A;  1PTO C;  1WFQ A;  3EIV A;  4I7A A;  4JVZ A;  4Y7N H;  4YY3 L;  4POF A;  4IQZ A;  1KIX A;  4BBR G;  1CHP D;  4R4C A;  3UI2 A;  1A6X A;  2NZ1 D;  2EXD A;  1I50 B;  4JI4 L;  4IPH A;  5M3F B;  4XT3 B;  4DR6 L;  1EY5 A;  4X3K A;  3FKI B;  2Z1C A;  4C2M H;  1S5E D;  4B3T Q;  2RA4 A;  2BE5 D;  1CTM A;  2O5I C;  1N9W A;  4KY7 A;  3K81 C;  4H44 C;  1II3 A;  3RMH A;  4EX5 A;  5C4Z A;  1I5F A;  2PNH A;  3OYY A;  4IUP A;  1TT2 A;  5IE8 A;  5IP9 H;  4XXE A;  1VQK A;  3T1Y Q;  1PRT F;  1TY2 A;  1JOO A;  4C56 C;  1B2T A;  1WCM G;  2OCE A;  1JE4 A;  2DNE A;  4JI0 Q;  2PQE A;  2QKI C;  2EVB A;  1X3P A;  3CQZ B;  2HIV A;  3SK4 A;  4X66 Q;  1PYW D;  1S5D D;  5BR8 Q;  1D5X C;  4LF4 Q;  1U0L A;  3VYS A;  3K0X A;  2L9H A;  1JJC B;  2K75 A;  1HR0 L;  1UNS A;  4QUC A;  3I4N G;  1PRT D;  2KED A;  4G57 A;  5C3W A;  3I56 A;  2QDL A;  2AQ2 B;  3TSS A;  3E0J A;  2A6E D;  1Y69 U;  5T1G A;  3J80 c;  5COR A;  2R92 G;  4ODG A;  2JA5 B;  1Y1V G;  4DXF A;  1L0X B;  1SN8 A;  4DR2 Q;  1CM9 A;  2K01 A;  1C7Y A;  2NVX H;  1Q86 C;  5DLQ E;  5IYD G;  1V1O A;  5I2Y A;  2DY7 A;  3G6J B;  4DR1 Q;  2E2J B;  1FNV A;  4TSS A;  4BY7 G;  3CCM A;  1X55 A;  3HFZ B;  5JJL A;  1SFO H;  3V05 A;  4C3J H;  2AQ3 B;  4IPD A;  2F3W A;  2I5H A;  1EY8 A;  4KJN A;  3M3Y H;  4N8X 1;  2R93 G;  2HDM A;  4BY1 H;  4IUT A;  2F0V A;  3TBI B;  5I6Y A;  4IUV A;  3FHW A;  2B63 B;  5C0X J;  4BBS G;  4IO9 A;  1PFB A;  3AFP A;  2KEC A;  3OTO Q;  3C2P A;  4A3M B;  4B3M L;  1B70 B;  3F2B A;  1PH3 A;  3TP6 A;  3MXN B;  4HJ8 A;  3J80 L;  3MZ5 A;  4MTK A;  5C4X G;  1TKW B;  3NXW A;  3VR2 A;  2R7Z H;  3KF6 A;  2RDH A;  2VNU D;  3DXJ C;  4APV A;  4LF8 Q;  1NY4 A;  3CD6 A;  1VQ9 A;  4YWL A;  4JBM A;  1BF4 A;  3CW2 C;  5IWA L;  2VUM G;  3CCV A;  4PV1 C;  1K8O A;  4JI8 Q;  1QJO A;  2PI2 E;  1I50 H;  4MN3 A;  4LW1 A;  5M3F H;  3BZC A;  1H9R A;  5EPK A;  1VF5 C;  3FKI H;  4GN4 B;  3R8B A;  5K5P A;  4WOR A;  2L5T A;  1EY7 A;  2UU9 L;  3CRK C;  1YIT A;  2QEX A;  1ENF A;  1Q1B A;  2B2U A;  4BWG B;  5GAE C;  3GTP B;  2WIN B;  5J22 A;  4DNI A;  3LWE A;  4JI5 L;  2R3Z A;  4TKO B;  1EYA A;  1XPR A;  3DWA A;  3DUZ A;  2K14 A;  4HIK A;  3OMC A;  3BVG A;  3CQZ H;  3BG3 A;  5IGB A;  2J7Z A;  4RWS C;  4AH6 A;  4HJ7 A;  1A63 A;  2AUJ D;  4CJ0 B;  2KUM A;  3KF8 B;  4XQJ A;  5GAG C;  2IWH A;  5F2D A;  2AKW B;  2FMM A;  4X64 Q;  1Q81 C;  1WTO A;  4C3I G;  3VA5 A;  1I4P A;  2F0Q A;  1V8Q A;  3KLW A;  5C3E G;  3S16 B;  1PYB A;  2Q8R E;  4CDC C;  4ZKB B;  2ICE C;  3IRB A;  1SYC A;  2SEB D;  2JA5 H;  3PIO A;  1IYV A;  1Q1E A;  2BOS A;  4KN4 C;  4GKJ L;  1GD7 A;  4JI3 Q;  2FXQ A;  1B44 D;  4HAE A;  1GM5 A;  1L1O C;  4A3L G;  2CW0 C;  2E2J H;  5HGT A;  3NQI A;  4DXG A;  4DFA A;  1ICW A;  4KK7 A;  1ILP A;  1IXR A;  4JI1 Q;  5NUC A;  1GUW A;  1BBU A;  2PZU A;  3GP7 A;  1DYQ A;  1YNJ D;  5EBD A;  5KYI A;  1CQF A;  3NQT A;  5ELN A;  4QB4 A;  4K0K Q;  1SEB D;  1D1K A;  4B9X A;  2YV5 A;  2JA7 G;  2PI2 A;  2B63 H;  2B2T A;  4BA1 I;  3T56 B;  2NTS A;  1EQQ A;  4PMB A;  4A3M H;  1LT5 D;  1TQO A;  1J5E Q;  3J81 j;  2L1B A;  1VDZ A;  3HOZ G;  4RHS A;  5ELO A;  4QQB X;  5I6W A;  3R2I A;  1C4Q A;  2WFW A;  3E6Z X;  1CHQ D;  1SYD A;  2PMZ B;  3H0G G;  1HZ9 A;  5IGG A;  5BN5 A;  2YU9 B;  3HKZ G;  2ZTD A;  4K2K A;  3I4M B;  1RTO A;  1F2M A;  3AQQ A;  4OIK A;  3S15 B;  1BXT A;  1SR3 A;  1I4Q A;  1SRO A;  3TRZ A;  4A3E G;  1A8V A;  4WJW A;  4CKB A;  1A2U A;  3NUC A;  3ERS X;  4CJ2 C;  3H91 A;  5JEA J;  4JI6 L;  2EY5 A;  2R61 A;  1UWV A;  2ID0 A;  1YBY A;  4M1U B;  1JIC A;  2Y0S B;  2F3I A;  5KGU A;  3MXN A;  4NMZ A;  1LUZ A;  1SMX A;  2JYO A;  2VB2 X;  3GTP H;  2Z8L A;  1TY0 A;  4GNX C;  1PFN A;  1STA A;  1MBY A;  3KOJ A;  4MNO A;  4B3T L;  3PQI A;  3CPF A;  4R4Q A;  1RD9 D;  3RNU A;  1FNU A;  2UXD Q;  4LK1 C;  5CV6 A;  1CZG A;  1FNW A;  4R8N A;  2UUB L;  2CQA A;  2CHB D;  3GD7 A;  1NCV A;  2E74 C;  4P74 A;  5IP7 G;  4DR3 Q;  3SGI A;  4LF5 L;  3NTH A;  4ZK9 B;  1JJ2 A;  1QUQ B;  1AN8 A;  2NB0 A;  2OTJ A;  1PFM A;  5T1I A;  3DM1 A;  1JR0 D;  2G9D A;  4YY3 Q;  4OON A;  4UAI A;  1K0R A;  3BDO A;  2OEO A;  4JI4 Q;  1ZEQ X;  1QOH A;  1BNZ A;  3NBI A;  1SDF A;  4X66 L;  5H1S E;  5BR8 L;  4L5S A;  4RH6 A;  4DR6 Q;  3FRP B;  1JCK B;  5JPN C;  1YNN D;  3TP7 A;  3HOY G;  3RLF A;  2E8G A;  3S16 H;  3KUP A;  1ILQ A;  3CAM A;  4UPA A;  1X3E A;  5FLX E;  2ASB A;  1A2T A;  2AWN A;  3CP0 A;  1J9O A;  1FGB D;  2NYZ D;  2AUK A;  2RCN A;  5C0X H;  3HKZ E;  1QVF A;  2JA6 G;  2A8V A;  3K58 A;  4XQN A;  4OGQ C;  1EIF A;  3A5Z B;  3ONA B;  2BDN A;  1HR0 W;  4EGV A;  5JVG 3;  1RL2 A;  5EJW A;  4DR2 L;  3KF8 A;  4AYB B;  5IGC A;  2K05 A;  4EQ5 A;  2J0T D;  1MKH A;  2ZXP A;  1LO5 D;  3S2D B;  4KD4 A;  1HR0 Q;  1D8L A;  4DR1 L;  5FO8 B;  2L12 A;  1LTA D;  4A3J G;  1G8Z D;  2K32 A;  1GOZ A;  1A3T A;  1VQ5 A;  2CQO A;  2BE5 C;  1CUK A;  3D6C A;  3SHL A;  5E4X A;  1H9J A;  3R2T A;  2RSN A;  5EGT A;  1BO0 A;  2MO1 A;  4IPG A;  3OTO L;  1ZXT A;  2K5D A;  5CMD A;  2SDF A;  2Z6B A;  2JA8 B;  3TQY A;  1E7Z A;  2YU9 H;  1BOS A;  1OXS C;  5IT9 E;  3I4M H;  3EFX D;  3S15 H;  2OF1 A;  4OX9 L;  2ES2 A;  1EL0 A;  4LWC A;  4A76 A;  2AMC B;  4Z9C B;  1SJE D;  5HGQ A;  1SAP A;  4QIW B;  3F2U A;  1IHZ A;  1EFW A;  2B2W A;  4G7Z C;  5FLM G;  4GN5 A;  3VDY A;  1XMQ Q;  2H1E A;  4LF8 L;  3A55 A;  1SNO A;  1VQF A;  3CC2 A;  3S14 B;  3I55 A;  3V96 A;  4PNY A;  4FDB A;  2EZV A;  2A6E C;  3DHQ A;  1G6P A;  4B3M Q;  2OWO A;  3TZU A;  5JJI A;  1RHP A;  1PZJ D;  1XTD A;  2JA9 A;  1FD7 D;  4HMJ A;  4XQQ A;  4DGZ A;  1MHW C;  1I94 L;  4A3I G;  4WJ4 A;  3WOF A;  3MXU A;  4ALP A;  3S2H B;  2XTI A;  1HA6 A;  3MEH A;  5M3M G;  2D5D A;  5EPL A;  1R4P B;  1PH8 A;  1IW7 C;  4AQY L;  5J1Z A;  2ALY B;  4KI0 A;  3HG9 A;  2ENB A;  3H94 A;  1EOV A;  4ME5 A;  3RZO B;  1HZA A;  1UE1 A;  3OWE B;  3M85 A;  4DV0 Q;  1F9R A;  4DK6 C;  1IYJ B;  3TP8 A;  4LF6 Q;  4M8A A;  5G3L F;  4IFD J;  2UU9 Q;  3I4L A;  1CKO A;  1JOK A;  1AP0 A;  4PZ7 A;  1FYC A;  3S24 A;  2EYF A;  1C0A A;  1CI3 M;  3L2P A;  4JI5 Q;  1E2V A;  1K8A C;  1HQR D;  2WV6 D;  4OEM B;  3PO2 B;  1HFN A;  1QUQ A;  1NSN S;  3T13 A;  1Y1W G;  5G3L D;  1S5C D;  1XXG A;  1VQH A;  3H3V H;  4A3G G;  2KA7 A;  2JK8 A;  1X54 A;  5M9O A;  1CK1 A;  1NR4 A;  1K3R A;  3S2D H;  3QIA A;  1SYG A;  2RHQ B;  1YZ6 A;  2PZT A;  4XYQ A;  4N9P A;  2I5L X;  1DZ1 A;  2SOB A;  2XNA C;  4ZKC B;  3HOX G;  1SE4 A;  4JI1 L;  3W1G A;  3GTG B;  2KHI A;  4FF4 A;  1HTP A;  5JEA H;  2F0S A;  4JI7 L;  1TII D;  3Q22 A;  4GKJ Q;  1K0S A;  2RHS B;  1NNX A;  1LT3 D;  3TDQ A;  1VQ4 A;  1EEF D;  5FJ8 H;  2JA8 H;  1G91 A;  1J5E L;  2KCM A;  3TS0 A;  4GLA C;  1QVC A;  5GAD C;  2EOT A;  1O80 A;  3HP3 A;  2F0N A;  2A69 D;  4A3D B;  1G2T A;  3AFQ A;  1PA6 A;  1IYU A;  2MHV A;  2F0I A;  3KK7 A;  3IAY A;  3CME A;  3MC0 B;  2EY2 A;  2UUA Q;  1N33 Q;  1ML0 D;  4DUZ Q;  1EZ6 A;  5LMU L;  3KYH C;  1VCI A;  2YTV A;  1S4Z A;  3RUZ A;  1RTN A;  1UAP A;  3S14 H;  5KNB A;  4IUR A;  2Q2T A;  3M7N A;  3PUV A;  1GXD C;  4A3C G;  2DY8 A;  5IYC H;  4KHP L;  2V1C C;  1LT6 D;  2K5H A;  3IL8 A;  5IYB G;  1EOT A;  4YCU A;  1FJG Q;  2N78 A;  1DJR D;  3BVM A;  4H0L C;  4A93 G;  3OW7 A;  4NDX A;  3N52 A;  3K80 C;  2PZW A;  1VQ6 A;  1QNK A;  2TMP A;  5I9O A;  3S2H H;  1QB5 D;  3Q6S A;  1LLR D;  3MTS A;  1EIH A;  1PTO B;  2N49 A;  1B50 A;  4JOI A;  1YNJ C;  2B2Y A;  2Q8T A;  4JI6 Q;  2K5N A;  1LT4 D;  1U4R A;  4C1N K;  1U4L A;  3RZO H;  3D4R A;  4DAP A;  5J39 A;  3MWY W;  2D9U A;  2K52 A;  3GQB A;  1VF7 A;  1ASZ A;  3C1F A;  3DWQ A;  1V43 A;  2C35 B;  3J81 i;  5JPM C;  3S9W A;  3K7U C;  4BBR B;  2B39 A;  1UE7 A;  4DAY A;  4HJA A;  1H95 A;  3EJI A;  5JAV A;  2Z6K A;  1RF2 D;  2F0J A;  4O42 A;  4DV3 L;  4DR5 L;  4UDU C;  3E5S A;  2UUB Q;  5M5X B;  2PW7 A;  1ICF B;  2N55 A;  2DJF C;  2B2U C;  4ID6 A;  1Y8O B;  2L4N A;  2QDB A;  4R4I A;  4RHR A;  1T5E A;  1E3P A;  2BA0 A;  4LF5 Q;  3L0O A;  2WAQ G;  1YEZ A;  4PMC A;  1ONL A;  1GUT A;  2RSO A;  4R9W A;  3GDE A;  3RLO A;  1WCM B;  2L15 A;  4OO1 G;  2D62 A;  1KNE A;  1AEX A;  4CDD C;  4IUQ A;  3HOU G;  3CC7 A;  3M4Y A;  5IOC A;  2FJ2 A;  2F4V Q;  3U50 C;  1KLU D;  2VL6 A;  4B08 A;  1EU3 A;  3NWT A;  3AEV A;  2IY5 B;  3S1N B;  3J7A V;  2CFM A;  3I4N B;  3MHB A;  4NP5 A;  3NSW A;  4L5R C;  2ZJQ A;  1E24 A;  1O7I A;  2IHE A;  5CGK A;  2R92 B;  1S72 A;  1GUG A;  4DK1 A;  4P75 A;  5COY A;  1Y1V B;  1KD1 C;  1M4V A;  5DM6 3;  4A3D H;  1FVI A;  4G7O C;  3HGB A;  2EXZ A;  3DWP A;  4CDE C;  2ZM6 Q;  5FK9 C;  2Q2U A;  3G48 A;  2E2D C;  1F9Q A;  1K8M A;  2NVQ B;  4X65 Q;  3D4W A;  1IW7 D;  1U5K A;  1EZ8 A;  3I91 A;  2A19 A;  1VQC A;  3LNN A;  4BY7 B;  1YNN C;  1S40 A;  4KKS A;  1QE6 A;  2I0Q A;  2KEE A;  2Q8I B;  1X3G A;  1OXV A;  1XMQ L;  5JJK A;  1X6O A;  2EJM A;  3K5M A;  4LF9 L;  2R93 B;  4CBV A;  1SYE A;  2DJG C;  4IPC A;  4GOP C;  2B2T C;  4DV1 Q;  1NE3 A;  4IFD H;  4E6I A;  4BBS B;  3KDF B;  4GN3 B;  3SVM A;  4MZ9 A;  3TN2 A;  1VQD A;  4IZ8 A;  2IW3 A;  3K5N A;  4OX9 Q;  2O5J C;  1Q8K A;  2MQH A;  4N9T A;  1N34 Q;  1O7Z A;  4H02 A;  4K8J A;  2ICI A;  3KBG A;  3OWF A;  4KD3 A;  3OMG A;  5C4X B;  1KRS A;  5D65 A;  3K7A H;  3C3L A;  2MNA A;  1UE5 A;  3VR4 A;  3Q23 A;  4HIM A;  4EQO A;  4POG A; 
#chains in the Genus database with same CATH homology
 3NK9 A;  1IKL A;  3S1R B;  3W2D A;  1GJX A;  3P20 A;  2K33 A;  2VUM B;  4K8I A;  1GUS A;  2PW5 A;  4ILW A;  3J7Y W;  1ZYR D;  1EY9 A;  3PUZ A;  4Q0F A;  4EQN A;  1W6K A;  2SNM A;  5EQ0 A;  3EA6 A;  2RDF A;  4K6L A;  1O78 A;  1D1I A;  1LV9 A;  1LTT D;  1C8C A;  1H9M A;  4C3H G;  1WD0 A;  1UUP A;  5K36 G;  2HDL A;  1HRJ A;  4FF2 A;  2VXW A;  3SEB A;  3D6W A;  3NWS A;  3A8I E;  2X6L A;  3K0Y A;  2EYO A;  3K5O A;  1Z6H A;  2L0C A;  2V4D A;  4C3I B;  1PDQ A;  2LKV A;  1BQQ T;  5C3E B;  2A5H A;  2NVY B;  3K6O A;  3QO2 A;  3K5L A;  1NR2 A;  1T5X D;  2F0K A;  2EPB A;  5C0X G;  1WTR A;  1XYI A;  1WVL A;  2PPB C;  2RKS A;  4IUU A;  5KIX A;  5A35 A;  4HR7 B;  3O13 A;  4K5W A;  3ERQ A;  1TR5 A;  5IGF A;  4KKU A;  4CHT B;  3J81 L;  2MGS A;  1I6V C;  1SXT A;  3MXP A;  2JA7 B;  4G7H C;  3FMC A;  1TWG B;  4OL7 A;  2XSC A;  1BUV T;  5CR3 A;  3NPP A;  4TQU S;  2JEA I;  3HOZ B;  5ELB A;  5KYL A;  1DOM A;  3TME A;  3H0G B;  1CT1 D;  3H6M A;  3HKZ B;  1Z47 A;  1SNC A;  3I70 A;  1BCP B;  1GHJ A;  1WTX A;  1FR3 A;  4A3E B;  2F0M A;  3GTJ B;  1OXX K;  1EYC A;  5IGE A;  3SK8 A;  1BR9 A;  1HTL D;  2EJF C;  2RDG A;  2NTT A;  2AQ1 B;  2FFK B;  2HUG A;  3KLR A;  3HZX A;  5E4W C;  4KTA A;  5EKI A;  4FXG C;  1BDO A;  2A69 C;  3QWN A;  1AZQ A;  5CV7 A;  3R3O A;  1WTW A;  3MAQ A;  3ERO A;  3SK5 A;  2JXM B;  2C5C A;  1D5M C;  1J8I A;  3S1Q B;  1EEI D;  2F0W A;  1HQM C;  4C1N I;  3M4O B;  2XWB B;  2IPK D;  1D6E C;  2A68 D;  3MXG A;  2F4I A;  1HXY D;  1ZKO A;  2PNR C;  1EWH A;  5JJZ A;  3HOY B;  3CRL C;  3GTM B;  3MFY A;  1PZI D;  2F0P A;  1TWA B;  1U9R A;  2Z4H A;  2JA6 B;  1TS5 A;  1E0B A;  3C46 A;  1MD2 D;  2E2I B;  4QMG A;  4K5X A;  3D3R A;  3N6R A;  1STN A;  4RKB A;  3NTK A;  1QCB D;  4DF7 A;  1EWC A;  2OXP A;  5KND A;  3NE5 B;  1U4M A;  3LX0 A;  1LTI D;  1NUC A;  5IIF A;  5CYU A;  4NW2 A;  4A3J B;  3JAM E;  3OSO A;  4HCE A;  3P7J A;  4O1N A;  3T4A C;  1X32 A;  2WII B;  1HA5 A;  2I46 A;  1DM0 B;  1B4O A;  2E75 C;  5M5W B;  2LS0 1;  3H3V C;  5JEA G;  2I07 B;  2KCC A;  1PRT B;  3H09 A;  2G9H D;  3BYT B;  4IUN A;  3IFT A;  2FIN B;  1SJH D;  1G2S A;  1I4G A;  4U68 A;  4CKC A;  1ESF A;  3S17 B;  3HEJ A;  4RA8 A;  1CA6 A;  5FO7 B;  1ET9 A;  5CBA E;  1A15 A;  2IX1 A;  2NN6 G;  3L7Z C;  4PQX A;  3Q24 A;  1EFI D;  2F0E A;  4EVO A;  4A3I B;  1LTS D;  5C3X A;  3M7G A;  1VMP A;  5M3M B;  2SNS A;  2L55 A;  1A3U A;  3I8Z A;  5CV8 A;  2B2Y C;  4WRD A;  2A74 C;  1KDA A;  3PUX A;  2RBM A;  2BA1 A;  3ND8 A;  1Y8N B;  4MIU A;  1STH A;  3D4D A;  5CBE E;  1KAA A;  1EYD A;  2EYH A;  3VR3 A;  5LL6 X;  1ROD A;  5C6A A;  2XRS D;  3Q0A A;  4RFB A;  1Y1W B;  3ITP A;  2WAC A;  1JB3 A;  3FPP A;  1UEA B;  5AFW A;  1NAP A;  3J80 E;  4A3G B;  2BCO A;  5DM7 3;  3I73 A;  1IL8 A;  2TSS A;  1GUO A;  5LHY 1;  5ELF A;  1ZYR C;  4HCS A;  1IKM A;  5C4H A;  5C4J B;  3RZD B;  2LMC B;  3HOX B;  2O2L D;  1KTK A;  1XWE A;  1D2B A;  3GV6 A;  4ZYS A;  2K6A A;  4MHE A;  4HMI A;  2JE6 I;  2JSO A;  4CGY B;  2QEJ C;  4IAL A;  2F03 A;  4ULL A;  4JBW A;  3OIQ A;  1EQT A;  4FYD A;  3SE0 A;  2EDG A;  1H9K A;  5HUR A;  3A8J E;  1BCP D;  5DNF A;  4XYO A;  2X69 A;  5ELE A;  1TWH B;  1O7Y A;  1Q3L A;  3HS0 C;  2F0F A;  3BYY B;  3OHX C;  4P2C B;  2EE1 A;  4C3J G;  2B2V A;  4DU9 A;  4ZUJ A;  4RGO S;  3AMU A;  2K5W A;  4HED A;  4ZLT F;  5FLX L;  1B9N A;  4A93 B;  2K03 A;  5ISR A;  3T53 B;  1U4P A;  2F0D A;  2C9O A;  1EY6 A;  3DEP A;  4DAV A;  1OO9 B;  2F0O A;  1S5B D;  3SK6 A;  4XTC S;  5KRU A;  1TVX A;  2EYJ A;  4KJO A;  1LAB A;  1D5Z C;  2NUC A;  1G6Z A;  2JP1 A;  1QWY A;  2HCC A;  2EYL A;  1H9S B;  3JAM L;  3VR6 A;  4OO1 I;  2NVT B;  3A54 A;  5EKL A;  2AWO A;  2ZXR A;  1DXM A;  2ZT9 C;  4RGT A;  5E1F A;  1R9T B;  4YIJ A;  1SE2 A;  2KOL A;  5LL6 S;  2WAQ B;  5IT9 L;  4LMQ D;  3FPU B;  3I90 A;  4BA2 I;  4F8M A;  3HOU B;  3GTO B;  1Z7T A;  3MVV A;  2L11 A;  1RCV D;  3I3C A;  4FP5 D;  4ZRZ A;  3P75 A;  2B8G A;  3EVQ A;  3L3O C;  1MSH A;  1STY A;  1I6H B;  3SR1 A;  4KKT A;  1ESR A;  3SXH A;  2YYZ A;  1DON A;  3AB9 A;  2IJ0 A;  4XIG S;  1TS4 A;  5CC4 A;  1PZK D;  3D8G A;  4KHV A;  4LJZ C;  1KDC A;  2KVM A;  3G7L A;  1XX8 A;  2A68 C;  2O4X A;  1QG7 A;  5FKA C;  3K59 A;  1LTB D;  5EPJ A;  4TRD A;  1F2Y A;  1V1P A;  1WD1 A;  1JWU D;  3ND9 A;  5I4D A;  2H4O A;  1JOR A;  2E76 C;  3GV3 A;  4QUF A;  2XIW A;  2XN9 C;  4K14 A;  1PTO H;  2MPM A;  3GTK B;  1HCZ A;  3A7A B;  2F0H A;  5BN4 A;  3L9A X;  5DAU A;  1TWF B;  3PMF A;  5E3F A;  2A6H D;  2IL8 A;  2F0U A;  1WTP A;  2F1M A;  3NTI A;  4S3S A;  4F88 A;  3S1M B;  4L8J A;  4XT1 B;  2IX3 A;  1C48 A;  1DCZ A;  1I3Q B;  1RDP D;  5FO9 B;  1K83 B;  2B8F A;  2DNC A;  4KY6 A;  3HOW B;  3HOV B;  4NKL A;  1MSG A;  2CVR A;  2F0T A;  5IOD A;  1SYF A;  1Q8I A;  4C3H B;  4OO1 H;  1H9S A;  2KQ3 A;  3WOE A;  1Q12 A;  2DN8 A;  1OXT A;  4FF1 A;  1Q90 A;  1M8A A;  1EIG A;  3PUW A;  2BDO A;  2XRQ D;  4RCN A;  3NP8 A;  4RCO A;  1TWC B;  3VYU A;  5C0X I;  1DOK A;  1HUN A;  4WFN 3;  1KAB A;  1SMY D;  1HHV A;  1JC7 A;  2PYK A;  3NHH A;  3LWU A;  4KV6 A;  4A3F B;  5C5L A;  4FF3 A;  1STE A;  3GTQ B;  1EY4 A;  2NWG A;  2VB3 X;  3D31 A;  4CKE A;  2FMC A;  5IGD A;  1KDB A;  4DK0 A;  1A3V A;  5I9P A;  3OIP A;  2E2H B;  1OXU A;  4A3B B;  3VYT A;  3QOL A;  3FVQ A;  1ENC A;  2M9V A;  4RAU C;  3C1E A;  1PTO F;  4OHJ A;  2WKD A;  4FXK C;  3EQL C;  2IX0 A;  2M00 A;  1EQV A;  1G29 1;  1TS2 A;  5A2Q E;  1HUM A;  3IFD A;  4ZAI A;  4PMW A;  3U9S A;  1PTO D;  1KLG D;  3PV0 A;  3R93 A;  3BDC A;  2QIL A;  1PLF A;  1SNQ A;  4HSV A;  3FDT A;  2GA4 B;  3HRZ C;  1GUN A;  4J1M A;  1SSO A;  4FO2 A;  2XVS A;  1HPC A;  2B2W C;  1KNA A;  3SDZ A;  2PO4 A;  3PUY A;  4CJ1 B;  3URY A;  2X6G A;  1SYB A;  1CQV A;  1WTQ A;  1JWS D;  3BZD B;  2EYM A;  1F9P A;  2WKC A;  5ELD A;  4BS9 A;  2HCI A;  2KCN A;  2EY6 A;  2ZXO A;  2LFN A;  1BCP C;  4ABN A;  4XDX A;  4DNT B;  3QOJ A;  5CV9 A;  5K36 H;  2EYP A;  2RVL A;  2K1B A;  5C5M A;  1DD2 A;  2KJX A;  4EQP A;  3BS1 A;  1SNP A;  3BDL A;  3DMU A;  4KHZ A;  2EY1 A;  1LAC A;  1GHK A;  4X3T A;  2N88 A;  4X3U A;  1CZW A;  2R6G A;  3X3N A;  4RKL A;  5JOB A;  4K6D A;  1SE3 A;  3A7L A;  3QJY A;  1HFG A;  3A8K E;  4V19 0;  3X3M A;  5DEH A;  3PIO 3;  5ELC A;  4R8I A;  3VR5 A;  4HSP A;  1SND A;  1MGS A;  3PO3 B;  3GTL B;  3W3A A;  1EU4 A;  3U9O A;  2NBF A;  5CV4 A;  1JWM D;  2IT1 A;  4FXD A;  4I7Z C;  3CKI B;  3ZYY X;  3NBH A;  4LAA A;  1E2Z A;  2NN6 I;  3OPO A;  4K2L A;  3I72 A;  1X3Q A;  1B1Z A;  4A3K B;  5M5Y B;  1RKN A;  3AU7 A;  1I4H A;  5D14 A;  1S5F D;  1SBB B;  5KEE A;  5D3I B;  5JVH 3;  3OOC A;  3V2T A;  2D2C C;  4J8Q A;  1XTC D;  2WP8 J;  1AFP A;  3DEO A;  2B2V C;  3T51 B;  1PRT C;  3WDN A;  1WTV A;  1W6J A;  5I2X A;  4F87 A;  1CFM A;  4OIJ A;  4RGN A;  4ZUI A;  3QG1 A;  1QIL A;  4QCL A;  4F7X A;  4DN4 M;  1PXU A;  1ENA A;  4H7B A;  3QB3 A;  1TU2 B;  4KY5 A;  4DA2 A;  4HN7 A;  3VA7 A;  1F77 A;  2EJG C;  3VYR A;  2CW0 D;  1RJT A;  4DNR B;  5KNC A;  3A56 A;  5C44 B;  1DOL A;  1B53 A;  1Y8P B;  4KMU C;  4Y7N B;  4I65 A;  1F2L A;  5A2Q L;  1I4R A;  4ZQ3 A;  1VMC A;  1TS3 A;  3J7A F;  4H13 C;  1F9S A;  3BVZ A;  1B3A A;  4C2M B;  2RQX A;  1ET6 A;  3KLS A;  2F0G A;  2FHT A;  2MUY A;  3T16 A;  2A6H C;  4HTH A;  4Q5V A;  4FVM A;  2F0L A;  2QCP X;  4GZY C;  2JEB I;  2XWJ B;  4J6H A;  1BCP F;  3PIP 3;  3CU7 A;  3MA2 B;  5TSS A;  5EBC A;  2LY7 A;  3TZD A;  2J4X A;  1V1P B;  4QF4 A;  2K5Q A;  1EY0 A;  5FOB B;  4V0B A;  2QF7 A;  1B9M A;  1JOQ A;  2KHS A;  2K7V A;  2MJ8 A;  1QNU A;  3MFG A;  1CA5 A;  3KBX A;  1LTR D;  1E2W A;  1STB A;  2F3V A;  4X3S A;  1BBX C;  2NVX B;  4IFD I;  1MI2 A;  1SMY C;  4U67 3;  3TP5 A;  2WB1 B;  2NN6 H;  4IN3 A;  3KLS X;  2PCF B;  2M2L A;  1STG A;  5CV5 A;  1F2Z A;  1SFO B;  4C3J B;  3IKJ A;  2MP1 A;  3GO5 A;  3M3Y B;  1R4Q B;  1JQY D;  2HQE A;  1LTG D;  3FEW X;  5D3D A;  4BY1 B;  4IFD G;  3P1H A;  3K57 A;  1O7L A;  1I4X A;  2Z4I A;  1L0Y B;  1SNM A;  4G4K A;  4B9W A;  4L63 B;  1AZP A;  4K5V A;  4L6T B;  2K04 A;  4KN7 C;  4RGM A;  2A73 B;  1AW7 A;  2K28 A;  1PMR A;  2R7Z B;  5BN3 A;  4JK1 C;  2OT2 A;  3K7A B;  3CHB D;  4FNF A;  3J81 E;  5EKK A;  3RD4 A;  1PTO C;  4IQZ A;  1CHP D;  3UI2 A;  1A6X A;  2NZ1 D;  1I50 B;  5M3F B;  4XT3 B;  1EY5 A;  4X3K A;  3FKI B;  2Z1C A;  1S5E D;  2RA4 A;  2BE5 D;  1CTM A;  2O5I C;  4KY7 A;  4H44 C;  1II3 A;  3RMH A;  5C4Z A;  4IUP A;  1TT2 A;  4XXE A;  1PRT F;  1TY2 A;  1JOO A;  4C56 C;  1B2T A;  1JE4 A;  2DNE A;  2PQE A;  2QKI C;  2EVB A;  1X3P A;  3CQZ B;  3SK4 A;  1PYW D;  1S5D D;  1D5X C;  3VYS A;  2L9H A;  1UNS A;  4QUC A;  1PRT D;  2KED A;  4G57 A;  5C3W A;  2AQ2 B;  3TSS A;  3E0J A;  2A6E D;  1Y69 U;  5T1G A;  5COR A;  4ODG A;  2JA5 B;  4DXF A;  1L0X B;  1CM9 A;  2K01 A;  1V1O A;  5I2Y A;  2DY7 A;  3G6J B;  2E2J B;  1FNV A;  4TSS A;  3V05 A;  2AQ3 B;  2F3W A;  1EY8 A;  4KJN A;  2HDM A;  4IUT A;  2F0V A;  3TBI B;  5I6Y A;  4IUV A;  2B63 B;  5C0X J;  1PFB A;  2KEC A;  3C2P A;  4A3M B;  3TP6 A;  3J80 L;  3MZ5 A;  1TKW B;  3NXW A;  3VR2 A;  2RDH A;  2VNU D;  3DXJ C;  1BF4 A;  4PV1 C;  1K8O A;  1QJO A;  4MN3 A;  1H9R A;  5EPK A;  1VF5 C;  3R8B A;  5K5P A;  4WOR A;  2L5T A;  1EY7 A;  3CRK C;  1ENF A;  1Q1B A;  2B2U A;  4BWG B;  3GTP B;  2WIN B;  5J22 A;  3LWE A;  2R3Z A;  4TKO B;  1EYA A;  3DWA A;  3DUZ A;  3OMC A;  3BVG A;  3BG3 A;  5IGB A;  2J7Z A;  4RWS C;  2AUJ D;  4CJ0 B;  2KUM A;  4XQJ A;  2IWH A;  5F2D A;  2FMM A;  1WTO A;  4C3I G;  3VA5 A;  1I4P A;  2F0Q A;  1V8Q A;  3S16 B;  2Q8R E;  4ZKB B;  2ICE C;  1SYC A;  2SEB D;  1IYV A;  1Q1E A;  2BOS A;  4KN4 C;  1B44 D;  4HAE A;  2CW0 C;  5HGT A;  3NQI A;  4DXG A;  4DFA A;  1ICW A;  4KK7 A;  1ILP A;  5NUC A;  1GUW A;  2PZU A;  3GP7 A;  1DYQ A;  1YNJ D;  5EBD A;  5KYI A;  1CQF A;  3NQT A;  4QB4 A;  1SEB D;  1D1K A;  4B9X A;  2B2T A;  4BA1 I;  3T56 B;  2NTS A;  4PMB A;  1LT5 D;  1TQO A;  2L1B A;  1VDZ A;  4RHS A;  5I6W A;  3R2I A;  1C4Q A;  3E6Z X;  1CHQ D;  1SYD A;  2PMZ B;  5IGG A;  5BN5 A;  2YU9 B;  4K2K A;  3I4M B;  3S15 B;  1RTO A;  1F2M A;  4OIK A;  1BXT A;  1I4Q A;  4WJW A;  4CKB A;  1A2U A;  3NUC A;  4CJ2 C;  3H91 A;  5JEA J;  2EY5 A;  2R61 A;  2ID0 A;  4M1U B;  1JIC A;  2Y0S B;  5KGU A;  3MXN A;  4NMZ A;  2JYO A;  2VB2 X;  2Z8L A;  1TY0 A;  1PFN A;  1STA A;  1MBY A;  1RD9 D;  1FNU A;  4LK1 C;  5CV6 A;  1CZG A;  1FNW A;  4R8N A;  2CQA A;  2CHB D;  3GD7 A;  1NCV A;  2E74 C;  3NTH A;  4ZK9 B;  1AN8 A;  2NB0 A;  1PFM A;  5T1I A;  3DM1 A;  1JR0 D;  2G9D A;  4UAI A;  3BDO A;  2OEO A;  1ZEQ X;  1QOH A;  1BNZ A;  3NBI A;  1SDF A;  4RH6 A;  3FRP B;  1JCK B;  5JPN C;  1YNN D;  3TP7 A;  3RLF A;  3KUP A;  1ILQ A;  5FLX E;  1A2T A;  2AWN A;  1J9O A;  1FGB D;  2NYZ D;  2AUK A;  5C0X H;  3K58 A;  4XQN A;  4OGQ C;  3ONA B;  2BDN A;  4EGV A;  5JVG 3;  5EJW A;  3KF8 A;  4AYB B;  5IGC A;  2K05 A;  2J0T D;  2ZXP A;  1LO5 D;  3S2D B;  4KD4 A;  5FO8 B;  2L12 A;  1LTA D;  1G8Z D;  2K32 A;  1GOZ A;  1A3T A;  2BE5 C;  3SHL A;  3D6C A;  5E4X A;  1H9J A;  3R2T A;  2RSN A;  5EGT A;  1BO0 A;  1ZXT A;  2K5D A;  5CMD A;  2SDF A;  2JA8 B;  1BOS A;  1OXS C;  5IT9 E;  3EFX D;  2OF1 A;  1EL0 A;  4Z9C B;  1SJE D;  1SAP A;  4QIW B;  3F2U A;  1IHZ A;  2B2W A;  4G7Z C;  2H1E A;  3A55 A;  1SNO A;  3S14 B;  3V96 A;  4PNY A;  2EZV A;  2A6E C;  3DHQ A;  3TZU A;  1RHP A;  1PZJ D;  1FD7 D;  4HMJ A;  4XQQ A;  4DGZ A;  3WOF A;  3MXU A;  3S2H B;  1HA6 A;  3MEH A;  2D5D A;  5EPL A;  1R4P B;  1IW7 C;  5J1Z A;  4KI0 A;  3HG9 A;  2ENB A;  3H94 A;  4ME5 A;  3RZO B;  3OWE B;  3M85 A;  1F9R A;  3TP8 A;  4IFD J;  5G3L F;  4M8A A;  3I4L A;  1JOK A;  1AP0 A;  1FYC A;  2EYF A;  1CI3 M;  1E2V A;  1HQR D;  2WV6 D;  1HFN A;  3PO2 B;  1NSN S;  3T13 A;  5G3L D;  1S5C D;  1XXG A;  2KA7 A;  5M9O A;  1CK1 A;  1NR4 A;  3QIA A;  1SYG A;  2PZT A;  4XYQ A;  4N9P A;  1DZ1 A;  2SOB A;  2XNA C;  4ZKC B;  1SE4 A;  3GTG B;  4FF4 A;  1HTP A;  5JEA H;  2F0S A;  1TII D;  3Q22 A;  1LT3 D;  3TDQ A;  1EEF D;  1G91 A;  2EOT A;  1O80 A;  3HP3 A;  2F0N A;  2A69 D;  4A3D B;  1G2T A;  1IYU A;  2MHV A;  2F0I A;  3KK7 A;  3IAY A;  3MC0 B;  2EY2 A;  1ML0 D;  1EZ6 A;  1VCI A;  3RUZ A;  1S4Z A;  1RTN A;  1UAP A;  5KNB A;  4IUR A;  3M7N A;  3PUV A;  1GXD C;  2DY8 A;  1LT6 D;  3IL8 A;  1EOT A;  1DJR D;  3BVM A;  4H0L C;  3OW7 A;  4NDX A;  3N52 A;  2PZW A;  1QNK A;  2TMP A;  5I9O A;  1QB5 D;  3Q6S A;  1LLR D;  3MTS A;  1EIH A;  1PTO B;  1B50 A;  1YNJ C;  2B2Y A;  2Q8T A;  1LT4 D;  1U4R A;  4C1N K;  1U4L A;  3D4R A;  4DAP A;  5J39 A;  3MWY W;  2D9U A;  3GQB A;  1VF7 A;  3C1F A;  3DWQ A;  1V43 A;  5JPM C;  3S9W A;  4BBR B;  2B39 A;  4DAY A;  3EJI A;  5JAV A;  1RF2 D;  2F0J A;  4O42 A;  4UDU C;  3E5S A;  5M5X B;  2PW7 A;  2N55 A;  2B2U C;  4ID6 A;  1Y8O B;  2L4N A;  2QDB A;  4RHR A;  1T5E A;  2BA0 A;  4PMC A;  1ONL A;  1GUT A;  2RSO A;  4R9W A;  1WCM B;  4OO1 G;  2D62 A;  1KNE A;  1AEX A;  4IUQ A;  3M4Y A;  5IOC A;  2FJ2 A;  1KLU D;  4B08 A;  1EU3 A;  3NWT A;  3S1N B;  3J7A V;  3I4N B;  3MHB A;  4NP5 A;  3NSW A;  5CGK A;  2R92 B;  1GUG A;  4DK1 A;  5COY A;  1Y1V B;  1M4V A;  5DM6 3;  4G7O C;  3HGB A;  2EXZ A;  3DWP A;  5FK9 C;  2E2D C;  1F9Q A;  1K8M A;  2NVQ B;  3D4W A;  1IW7 D;  1EZ8 A;  3I91 A;  3LNN A;  4BY7 B;  1YNN C;  4KKS A;  1QE6 A;  2KEE A;  2Q8I B;  1OXV A;  2EJM A;  3K5M A;  2R93 B;  4CBV A;  1SYE A;  2B2T C;  4IFD H;  4E6I A;  4BBS B;  3SVM A;  3TN2 A;  4IZ8 A;  2IW3 A;  3K5N A;  2O5J C;  4N9T A;  1O7Z A;  4K8J A;  2ICI A;  3KBG A;  3OWF A;  4KD3 A;  3OMG A;  5C4X B;  5D65 A;  3C3L A;  3Q23 A;  3VR4 A;  4EQO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...