4C3HG

Structure of 14-subunit rna polymerase i at 3.27 a resolution, crystal form c2-93
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
309
structure length
259
Chain Sequence
NENRETARFIKKHKKQVTNPIDEKNGTSNCIVRVPIALYVSLAPMYLENPLQGVMKQHLNPLVMKYNNKVGGVVLGYEGLKILDADPLDTSEKLIKITPDTPFGFTWCHVNLYVWQPQVGDVLEGYIFIQSASHIGLLIHDAFNASIKKNNIPVDWTFVHNDVELGHWVDSNGEPIDGKLRFTVRNVHTTGRVVSVDGTLISYNSSRSQAESLPIVSNKKIVFDDEVSIENKESHKELDLPEVKEDNGSEIVYEENTSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the 14-Subunit RNA Polymerase I
pubmed doi rcsb
molecule tags Transcription
molecule keywords DNA-DIRECTED RNA POLYMERASE I SUBUNIT RPA190
total genus 37
structure length 259
sequence length 309
ec nomenclature
pdb deposition date 2013-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF03876 SHS2_Rpb7-N SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397
G PF17875 RPA43_OB RPA43 OB domain in RNA Pol I
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.1060 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4c3hG02
4C3HG 4C3IG 4C3JG
chains in the Genus database with same CATH superfamily
1RF2D 3K0XA 1STBA 4IN3A 1GKHA 2VY3A 4G7ZC 3MEFA 3PO2H 4LF7L 2PZUA 2PW7A 2KEEA 2DY8A 3S1RH 5M3MH 5HGTA 3EVQA 5A2QE 2WB1E 4ZYSA 1V1PA 2Q2HA 2WACA 1WTXA 5GROA 3GTQH 2B2WA 4NKLA 5CBAE 4DV4Q 4NPSA 3I91A 1NAPA 1XJVA 3KJOA 4IUVA 4X64L 1F9RA 1OXXK 3MWYW 1YNXA 2ZT9C 1E1OA 1SYEA 3W5OA 4DV6Q 2PYKA 3NBIA 5C0XI 1NY4A 4IQZA 2VUMB 5EAYA 2HQLA 1IZ6A 2I0QA 4LF4Q 4A3EB 3TBIB 1QE6A 4IJHA 1VQAA 1GUOA 3J80E 1VQ7A 3KYHC 2O2LD 4B3RL 3J80i 1DOMA 1S72A 4A3MG 1RTNA 2SOBA 4KY7A 1NE3A 1YHQA 2OT2A 1UE5A 3CC4A 3PO2B 2ZM6Q 4TRDA 1QOHA 1X3FA 1Y8OB 3OIQA 4JYAQ 1SNPA 1QB5D 2NB0A 1SJED 4GN5A 1I50H 4HIOA 4QGUA 2KHJA 1BCPF 3IRBA 1BOSA 1XNQQ 2HIVA 3RUZA 1HR0W 4KD4A 3BS1A 2OTJA 3HKZE 3PIOA 2UXDL 2EJMA 4RG1A 4MZ9A 1JB7A 3DMUA 1CTMA 4KHVA 3DEOA 2F4IA 3I90A 2SEBD 4C2MH 2OTLA 2F0SA 3HFZB 4LUOA 2NUCA 5COYA 4HTHA 1C7YA 1X56A 3M3YB 1E2ZA 3ZYYX 3SE0A 2N3SA 3NENA 5C3EG 3HOWB 2R92G 1SDFA 3I72A 1N32Q 1QNKA 4B08A 1SSOA 2CWAA 2WINB 1NR2A 2IX3A 1ZEQX 4OWTB 3RZOH 4KV6A 4P72A 3S16B 1Q1EA 3SVMA 1N32L 4OO1H 3HOVB 4DPGA 2AMCB 4JVZA 1P16A 2EDGA 4RA8A 3TSSA 1JC7A 4K8JA 5T1IA 4F88A 2K6AA 4DV7Q 5CV8A 1GUNA 5IE8A 3RN5A 2B39A 2A19A 4A93G 1AZQA 2MFIA 3EN2A 2OQ0A 2WAQE 3U9OA 1X3PA 2EZVA 1S4ZA 1FNUA 2YU9H 2K5HA 2WB1B 4EQ5A 1SYDA 2SNMA 1ICFB 3QWNA 1PZJD 2MP1A 3J7A5 2GVBA 1SEBD 1XXGA 5ELNA 3TS2A 4EQOA 2PZTA 1LTGD 4A76A 3S1QH 1VQ9A 3FPUB 4X66L 1RIPA 2A69D 3TZDA 5JJIA 1MKHA 4A3KB 5I2YA 2ZJQA 1ZYRD 2NN6I 1PHJA 5LL6S 1F2ZA 3F1ZA 5CV7A 1XPRA 4JOIA 3NTKA 4C3IH 1X9NA 3BZKA 1PH3A 3STBD 1SROA 3MFYA 5T1GA 1AE3A 3NSWA 2K05A 1TT2A 3I4NG 1PH7A 1E22A 1NSNS 4LF6Q 1XYIA 3OOCA 1G91A 1PTOB 1E2VA 4K6LA 4YY3L 3K59A 1B2TA 2JA5H 1A6XA 3PO3B 3SK4A 1N33Q 1D7QA 1Y8PB 3KLRA 2I46A 4DR2L 1DXMA 3QJYA 4A3FB 2NBFA 3VR2A 2AQ1B 3UDIA 4LF6L 1HCZA 4N8X1 3ULJA 4DXFA 1EWIA 4AYBG 4EQNA 1AEXA 5EGTA 1YNJD 2M9VA 5C4XB 1HR0Q 2VQFL 1VMPA 1KRTA 2ZTCA 3P1HA 1HXYD 4FF4A 4O0AA 2PI2A 2Q8RE 3K7UC 2R6GA 1JWMD 2PI2E 4HSVA 2EY1A 4XIGS 4IALA 1TWHB 5JJZA 3PSIA 3A5UA 2K5VA 1CSPA 2K5WA 1AW7A 1YBYA 1D5ZC 3J80c 1A2TA 2ZJRA 5IGDA 4RKBA 4A3DH 3CRKC 2QA4A 3CW2C 1EOVA 1EEID 3K5NA 5CV4A 1KRSA 3JC66 5IYCH 3T13A 3AMUA 1WTPA 3AFPA 2DUDA 3S2HH 3K57A 2VZAA 4ODGA 3BYYB 2LXKA 4UP8A 5M5XB 2KHSA 2Q2TA 3H0GG 2CW0D 4Y7NB 1HNWQ 2L12A 3BYTB 1B3QA 1BCPB 1LO5D 1NJIC 2XIWA 2CWPA 1JE5A 2F0MA 3S2DH 1JWUD 3OTOQ 5C4JB 5FK9C 3HS0C 3RLFA 1SXTA 3T1YQ 1EFWA 4FP5D 5EBCA 1LT5D 4C3JB 4ZRZA 1RODA 4LK1C 2Z1CA 3R2TA 2K4KA 5HURA 1NMFA 5M5XH 3CCQA 2F0VA 4ZKCB 5L37A 2A68C 2JEBI 1KL9A 3QO2A 4A3BG 4BBSG 1ILPA 4NB3A 5C5LA 5EKLA 1YNJC 1EU3A 1SMYC 4ZUIA 4DV3L 4N9TA 5CV5A 1QNUA 1VCIA 2E74C 3E0EA 1SNDA 2VB3X 3LNNA 3NTHA 1PFNA 1PZID 2B3GA 2Z4IA 4A3FG 3CMEA 4DR4Q 2EIFA 3KJPA 1V1PB 2WIIB 5AJ3L 2HCIA 1VQHA 4A3DB 1RTOA 2JA6G 1TWFH 1PXUA 1Q86C 5FLMH 3PF4A 2PW5A 4J15A 2ICIA 3OW2A 2B2UC 4DV5Q 4DR4L 1B9NA 3W1GA 4LAAA 4QIWB 3EQLC 2BE5C 1A62A 1PYBA 3NWTA 1KC8C 2OCEA 3OIPA 4JI8Q 5IYDH 3PO2G 4G7OC 3R93A 5LMNW 3TQYA 2CW0C 2FMMA 2K33A 3H6MA 4R9WA 5GQOA 1PLFA 2BDOA 5IGFA 3L2PA 2CH4W 3RZDB 1KNAA 2HUGA 1YJWA 2K04A 2EYOA 1IBKQ 1SE3A 1C9OA 3T1HL 2B63B 1HPCA 5E3FA 2HHHQ 3TP6A 1QZGA 1D1IA 3V05A 3L7ZC 3D4RA 1D6EC 1IBML 2N8NA 4HMJA 2EQSA 1O78A 3BJUA 4IUNA 1HFNA 2N88A 1SNOA 4HEDA 1QG7A 1B9MA 4L5TA 4UPAA 3BG3A 3D8GA 2ZXOA 4QCLA 3I8ZA 2Z6BA 5LL6X 4KY5A 1ASYA 1JMCA 1KIXA 3BVZA 5IT9E 2RCFA 1Q8KA 1VF7A 4FF3A 2JSOA 4LNQA 4H7BA 4GOPC 4X66Q 1K8AC 4C3IB 1H9KA 4YY3Q 1VQPA 1WTWA 1DD2A 2NVQB 4JC0A 1TWCB 1PH5A 2XGTA 4H02A 2QGQA 2NVXH 2Q2IA 5G3LD 2F0IA 4J8QA 4PZ8A 1F77A 4A3MB 4MN3A 2ZTEA 5M3FG 2RHSB 1O80A 2FJ2A 4I7AA 1J9OA 3WOEA 3I4NH 2JQOA 3KBGA 3Q6SA 2JN4A 1TS3A 4QMGA 4OELB 1HA6A 3Q22A 4ALPA 1CSQA 2K01A 4JW0A 4L5SA 4PMWA 2RDGA 1Q81C 4Y52H 4CDCC 4DGZA 1IW7D 2HCCA 2F0FA 3CCSA 1NUCA 2AUJD 4TVAB 4KJNA 1U0LA 2K03A 1HNXL 4UAIA 5JPNC 2IPKD 3MXPA 3RLOA 4HR7B 3WOFA 4LUVA 1TWAB 2RBMA 2E5LL 1PH6A 4A3BH 1Y1VG 3HOVH 2RA4A 1X6OA 4P75A 4HJ9A 3P20A 2EOTA 1UAPA 1YEZA 1GXDC 3QR8A 1ENAA 1BKBA 1HA5A 3CC2A 1SJHD 5I9OA 3GV3A 1AZPA 3K0YA 1STNA 1Y14B 4GKKQ 2L5TA 1MBYA 3A0JA 3HP3A 4HN7A 2EYFA 1TY0A 1G6ZA 4DAVA 3TRZA 3CC7A 4OXPA 5G3LF 1I4QA 5FJ8G 4DR3L 4OO1G 5C0XG 4JI2L 2JJQA 3HRZC 3F8TA 3CXCA 1VQFA 1NMGA 1HJPA 3ND9A 3U9SA 5KIXA 1WFQA 4B3TL 4R8NA 4YHHL 3M85A 1PFBA 5IOCA 4A93H 2Z9HA 2IT1A 4DUZL 4JI8L 3I56A 1HNWL 2I07B 2RKSA 3J81E 3I70A 3IAYA 5JOBA 1I50B 3CU7A 4L5QA 2MUYA 4IFDJ 1SNCA 4MNOA 5ISRA 3U4VA 1LTTD 4PQXA 4A3GG 4P71A 2I5LX 3TN2A 4LMQD 5E7NA 2GVAA 4ZK9B 4NXNQ 2RSOA 1XNQL 2VS1A 3KLSA 4GOPB 2XRSD 4YIJA 5EJWA 3GTKB 4EQPA 2EYMA 3K5LA 3GO5A 2BA1A 4RH6A 1DONA 3NXWA 1I6VC 2Z0SA 1EY6A 3MXNA 4HIDA 3CD6A 3S1MH 2HDLA 3KBXA 5LMNL 1XNRQ 4QUFA 4JI7Q 3PF5A 1YNNC 4O1NA 4DK3C 4C3HB 1FGBD 1DGSA 3V96A 3M4OB 2QEXA 1F9PA 5DLQE 2RF4A 1VQBA 1VF5C 4DR1Q 3UDFA 5LHY1 3MXUA 1E24A 4GKJQ 1LLRD 5JEAH 4OWWB 1XX8A 5M3MB 1AFPA 3S1RB 1FNVA 2K52A 4A3IB 3Q23A 1K73C 2JA7G 3LWEA 2B2TC 1HNZQ 2F0UA 3RD4A 1XMQL 2E2HH 4LF9L 1PTOD 3GP7A 4BBRB 3H09A 1EYGA 1SE2A 4HSPA 1EY4A 2X69A 3W1BA 2EXZA 1R9TB 2R7ZH 2M2LA 1EIYB 1I4HA 4GN3B 3A8JE 1GUWA 1TQOA 4L63B 4GNXA 3T53B 4BY7H 3PUWA 4UDUC 1A0IA 2KQ3A 5KNDA 2ENBA 1D8LA 1I6HH 2F0JA 1D5XC 2R61A 4P73A 1BBUA 3GTOH 3E5SA 1I3QB 1Q3LA 1EZ6A 1FJGL 2R93H 4NP5A 4DU9A 1WCMB 2R7FA 3A7LA 3GTJH 1MJCA 3FHWA 1BXTA 3GTKH 4FF2A 2CCZA 2N49A 3LWUA 3MHBA 4XT1B 4WFN3 3ULLA 3VR5A 3D6WA 5JEAG 5C3WA 2F52A 1Q12A 4RGMA 3FKIB 5D3DA 3T16A 4JI0Q 2KCMA 1U4LA 4C3HG 4K0KQ 2CH4A 4CDFC 1HZBA 3HOXH 1N8RC 3CCEA 2KJXA 4H0LC 3HOYH 5JJKA 4R4IA 2A69C 2DJFC 4IUPA 3HOWG 5K36G 4B9WA 1NCVA 4FDBA 3G6JB 3PUZA 3MC0B 5CR3A 4NXNL 1G51A 2UUBL 1CQVA 3KK7A 4KTAA 4PZ6A 1N34Q 1E3PA 1XTDA 4WORA 2MJ8A 2LY7A 4GLXA 5A35A 4DR5Q 1VQNA 3TP7A 4IO9A 3J7AF 2D9UA 1AE2A 1SLJA 4DUZQ 4A3JH 1RDPD 1CA5A 3P75A 2ZXRA 1GM5A 2UUBQ 1BUVT 4KKTA 1UE6A 2QW7A 3T51B 4EVOA 3HOXG 3DLLA 4DV7L 1N9WA 1WCMG 3NQTA 5KYLA 1B50A 1EY7A 3M7GA 4DR3Q 4OWXB 4O42A 3E3XA 4ID6A 1Z9FA 4K0KL 4L8JA 1FVIA 2MO0A 1L1OB 4ULLA 2IHFA 1PMRA 1JCKB 4IPCA 4TKOB 4QQBX 3NP8A 3GTMB 4JV5Q 3NEMA 4ZCKA 4AYBE 3GV6A 2K1BA 3X3MA 4A3BB 2NZHA 4F87A 4TSSA 2QCPX 5IP7G 1X3GA 3OWFA 1BCPC 2KCNA 4JI4Q 1H95A 3VA5A 4CKCA 2C35B 2EE1A 2Y0SE 4IUTA 4OX9L 4L6TB 1BDOA 1GHJA 1PRTD 1SNMA 2LKVA 4DV1Q 1TWGB 4CDDC 2K32A 3BVGA 1M8AA 3HOZG 4UP9A 1YIJA 4BY1B 3HOXB 1LACA 1EWCA 5J22A 5IWAQ 1RCVD 5J1ZA 4QUCA 3VYRA 3Q0AA 3I4NB 1K83H 2YV5A 5C3XA 3FKIH 4DFAA 3PGZA 5I6WA 5A2QL 2F0GA 2JK8A 3GQBA 2PO4A 1N36L 3NBHA 3CCUA 4POGA 2A68D 1VQDA 5AFWA 1QUQA 3EA6A 4GLVB 2MGSA 4XXEA 2ZXPA 2L0CA 1MSHA 2NVQH 1KXLA 1V8QA 2E5LQ 2B63G 3U4ZA 1HH2P 1EQTA 1L0YB 4B3ML 2BA0A 2LMCB 3HKSA 4A3CG 1FGUA 1FD7D 3SEBA 4TQUS 3GTOB 3KLSX 1YHAA 3ONAB 2AKWB 3FKIG 1NTGA 1BO0A 1Q7YC 3STBC 3HEJA 1I6HB 1EFID 5EKKA 3A8IE 2K75A 2YTXA 5CMDA 4BY7B 5FO8B 1QILA 1U9RA 4A3GB 5DM73 2WB1G 1FR3A 3CPFA 4XT3B 3I2ZA 5DM63 4DUYL 1QVGA 1JJCB 4PNYA 4ZUJA 2CFMA 4BY1G 4R4OA 1K0SA 4RGNA 1W2BA 2B8FA 4A3DG 1HZ9A 1KNEA 1S3OA 3SK8A 5K36H 2J0TD 3GTPB 3DEPA 3SHLA 1R9TH 3I73A 4ZAIA 5IT9L 3BZDB 1HUNA 3PUVA 4BS9A 2AWOA 3K80C 4XYQA 2QDBA 2KHIA 5J39A 4DV2L 4JI6L 4LF5Q 2E2HB 2RSNA 4X3UA 1JR0D 2SNSA 1HZCA 3T1YL 1IXRA 1PH4A 1M90C 3C1FA 5F2DA 1IBKL 4J1MA 4BBSB 5E1FA 1UUPA 2OQKA 5CYUA 4LF8L 1JJGA 3DWQA 3N52A 3TP5A 1CKMA 4C3JG 1OXVA 1QZHA 1K28A 3C46A 4C3HH 3NE5B 5GAEC 5ELCA 3S1MB 2Z6KC 5KNBA 3M9BA 1KDBA 4K14A 2XVSA 1YVCA 1O7LA 1D5MC 1KLUD 3HKZG 3ER0A 3T1HQ 1VMCA 5FLXL 3PO3G 2D62A 1HTLD 5BR8L 1J6QA 2I5MX 2EY2A 3R3OA 1S5CD 1PFMA 3OMGA 5DEHA 2B8GA 2ZM6L 1IBLL 1DOKA 4A93B 1HFGA 3NBHB 3EIVA 3UE1A 1QVCA 4K5WA 5BN4A 1WI5A 3A74A 5I2XA 2O4XA 4OL7A 2MNAA 2TMPA 4K8IA 1LTLA 2NN6G 4WRDA 1BNZA 2J4XA 3PQIA 5BN3A 4UP7A 2F4VQ 3CQZB 5FLXc 5GAHC 3U50C 2Q2UA 3S17H 4JI5Q 2A6EC 3E9HA 4XQQA 1A63A 1K8OA 1KHIA 1S5BD 4C3IG 1S5FD 1FNWA 2HQEA 4F7XA 5C6AA 2HDMA 4ILWA 1HZAA 4X65L 1S5ED 1VQ8A 1H9MA 1K8GA 1EUJA 1Q1BA 3KDFB 2R7ZG 3KF6A 1IL8A 4KHZA 2BH8A 4LF4L 4F8MA 1CHPD 3KOJA 3QIAA 4BY7G 3I4MB 1Z6HA 4GN4B 1EQVA 2Z6KA 3HGBA 4GOPA 2EJGC 2IHEA 4KHPQ 4LFBQ 3T4AC 2BOSA 4O2DA 1Q46A 1EEFD 4JI1L 1DM0B 1L1OA 3H3VH 4OIJA 3JAMc 2B2YA 3MZ5A 5C3EH 2H4OA 2E8GA 4DR5L 3G6EA 4DA2A 3GTLH 2X6GA 2E2IB 4BWGB 3S15H 1R4QB 2VQFQ 3VYUA 2L55A 2WV6D 2JA5B 3H15A 1SE8A 3OYYA 5FJ8H 3MXNB 2YTVA 3J7YW 1MGSA 3SR1A 3MXGA 1MD2D 2B2YC 4A3MH 5ELDA 2WP8J 1WTOA 1MIUA 1CQFA 3D4WA 2UXBL 2K50A 4WJWA 1AP0A 2NVXB 2K14A 4APVA 2NVYH 3H3VI 4OONA 1PRTF 1Q8IA 2Q8IB 3D31A 1LUZA 1W3SA 2NVYB 4X62L 3L3OC 4RHRA 1F9QA 1U4RA 1F9SA 1CK1A 2ID0A 2KEDA 3A56A 3D3RA 3VR6A 4QIWE 1B53A 3MTSA 1IHZA 2RVLA 3VDYA 5JVG3 4A3LH 3DM3A 4NXMQ 3VR4A 1I94Q 3I4LA 4KY6A 2ASBA 3S15B 2XTIA 4C1NI 1KAWA 4M1UB 2L15A 2Y0SG 4ZLTF 2E2IH 1ET6A 2IWHA 4DV3Q 3MVVA 2B63H 3MFGA 4CDEC 4A3KG 5DNFA 1Q82C 5GADC 5C3EB 4QF4A 1PDQA 5K5PA 3I55A 1C4QA 2PMZB 4IUUA 1Y1VB 2FXQA 1XNRL 4Q0FA 1SRUA 5HGQA 2NN6H 1UWVA 5D14A 4JOIC 2N78A 1XMOQ 3S16H 3NQIA 1HUMA 3T56B 2F0DA 3D6CA 3H94A 4LFCQ 3CCRA 2JA8G 1CKOA 1F2MA 4L5RC 1VQMA 3S1NB 1I94L 1B3AA 1L0WA 4ME5A 3J81j 4DR6Q 4DNIA 2AHOB 4A75A 3L9AX 1TY2A 3CQZH 3D0FA 4FXDA 2XSCA 5LMNQ 3C1EA 2WAQB 3OSOA 5M3FB 3HOZH 4GNXC 1IBLQ 5JJLA 4CJ1B 2L4NA 4KMUC 4DV1L 2K5DA 1A3TA 1AH9A 1ENCA 5HY6A 1FYCA 1WTQA 4FO2A 4JBJA 3I4OA 1MSGA 2KOLA 2UUCQ 4I7ZC 1JJ2A 3PV0A 4DF7A 1PRTB 5BR8Q 2R92B 3I4MG 2NZOA 1BQQT 1DJRD 4QJFA 5C4JH 1VQ4A 3OPOA 1JOQA 4JI3L 4B3SL 2EYHA 3S2DB 4PV1C 1GHKA 1W6KA 3M4YA 1D2BA 4G57A 1XTCD 1KAAA 2E75C 2WKDA 3UE0A 3PIO3 5IGCA 4IFDI 1LTSD 3DUZA 5EPLA 2EJFC 4DR6L 1R4PB 5ELEA 2EVBA 4R4CA 5D3IB 2K7VA 1TXYA 5IP7H 3ND8A 5GAGC 3M4QA 2O5IC 3CPWA 1L2FA 3J81L 5CGKA 1UEBA 2RDFA 2H5XA 2VUMH 4AIMA 1STGA 4GLAC 4XQNA 5EKIA 1WOCA 4C56C 2F3IA 1WJJA 1PV4A 1SNQA 2VB2X 3AU7A 3NELA 3HOYG 1X65A 1HRJA 5EPKA 3WWVA 1DOLA 1A2UA 3FP9A 1V1QA 2EY5A 2EY6A 2XRQD 2JA7B 2EYJA 1K9MC 1TWHH 4MIUA 4BBSH 3H91A 2D2CC 3BDOA 3EJIA 3VA7A 3J80L 4A3EG 3K58A 4FXGC 2A6HC 2KUMA 5C4XH 3CCLA 3PIPA 2JA8H 4KI0A 3J81c 2JP1A 1GO3E 1Q90A 2UUAQ 1EY5A 2G9DA 3WDNA 1Y1WB 5E4WC 4A3FH 1BVSA 2A73B 2ES2A 1H9JA 3D4DA 4V190 4OHJA 4JI7L 1L0XB 1EL0A 4A3LG 1UEAB 5FO9B 1M4VA 2YTYA 5TSSA 1TKWB 4YCVA 1NNXA 3QOLA 4HCEA 1X32A 3GDEA 1PTOC 5M9OA 1GOZA 3EFXD 4AYBB 1KLGD 4AH6A 2NTSA 2V4DA 4RAUC 3TREA 4B9XA 4QB4A 3OWEB 2AUKA 4A3KH 4EX5A 2F0HA 3ZJYC 1AN8A 3S1QB 2RHQB 2BH2A 4X3SA 2FHTA 4A3IG 4GS3A 1K83B 3P7JA 5IODA 4GNXB 3KF8B 3PIP3 5JAVA 5ELOA 1RL2A 4LFAQ 1EU4A 1CZWA 4JBMA 2E2JB 1TS5A 1TWGH 4KLKA 4RMFA 1X54A 1XMOL 2YU9B 4YWLA 3BZCA 5IGEA 4BA2I 5IYCG 3FRPB 3FVQA 2LFNA 4IPDA 2HHHL 1K3RA 5C4HA 4B3MQ 4KKUA 1QJOA 3ERQA 3KUPA 4B3SQ 4JI3Q 3NWSA 3W2DA 1U5KA 1CUKA 1EYAA 2EPBA 2K5NA 1CA6A 2QKIC 2D0PA 2IL8A 4JYAL 3BDCA 1VQLA 4LFCL 4HAEA 2MO1A 4JG2A 2A6HD 4MTNA 3OMCA 4OGQC 3OTOL 5ELBA 1HNXQ 1Z47A 1IW7C 1X3EA 2CQOA 1VS0A 1YHBA 1JICA 4A3JB 4M8AA 5C0XJ 1CKNB 1B8AA 1HTPA 4DV6L 5FOBB 3G48A 1T5XD 3ULPA 3HG9A 1Y1WH 4BXXG 5D65A 5KNCA 1BR9A 2VQEQ 1V9PA 1ENFA 2IJ0A 3K7AH 5KRUA 2JA8B 4DAPA 2DN8A 2L1BA 1RHPA 5EPJA 4HJ7A 3UDGA 4JK1C 1LTID 1EIGA 1LYLA 5M5WH 3CAMA 1SR3A 2UUAL 2BDNA 3RN2A 1D1KA 3S9WA 1YJ9A 5C0XH 1BBXC 3TZUA 3DWAA 4HJAA 1J5EL 1GJXA 2G5DA 3ERSX 2KCCA 2JA7H 2RDHA 1TU2B 4A3EH 4NDXA 1LT3D 3LGJA 2PMZE 1YI2A 4DR7L 1VQEA 2UXDQ 1JE4A 5IP9G 1PZKD 2Y0SB 1ASZA 5FLXE 1I3QH 1HHVA 3QOJA 1ESFA 3URYA 1O7IA 3GTGB 3GTQB 5IIFA 4Q5VA 4R4QA 4DXGA 5JVH3 4DR7Q 1O7ZA 4UHVA 3R8BA 1UE7A 1C0AA 2ALYB 3SK6A 1RD9D 2IW3A 1SYGA 2SDFA 3JAMi 4DUYQ 2A8VA 4DV4L 3IFDA 2EYLA 2PNRC 1MHWC 1QCBD 2J7ZA 3VYSA 3HZXA 1HNZL 3MA2B 2R7ZB 2NTTA 1B7YB 2O5JC 2MPMA 2F4VL 4DKAC 3S24A 4BBRH 4DAYA 4BA1I 4CHTB 5CC4A 4DV0L 2OWOA 2R92H 1S40A 1WTHA 3N6RA 4DV5L 1VQOA 3Q24A 1TS4A 1LTRD 2F3VA 3HOUG 3CCJA 1V1OA 1E0BA 4A3IH 3KF8A 2CKZB 3PUYA 1I5FA 2F0NA 3LX0A 3KF6B 1A3UA 1JOKA 2QEJC 1E1TA 5KEEA 1I4GA 3KFUA 4DAYB 1KABA 4C1NK 1N33L 4B3TQ 3HOZB 5M3FH 2UXCQ 2R7DA 3K8AA 1L1OC 3G7LA 3M4OH 1OTCA 4G7HC 1Y69U 4R4TA 1DCZA 2OEOA 1PVOA 3SK5A 4YCWA 2UXCL 3ITPA 4H13C 5DAUA 1G6PA 3DXJC 3S1NH 3K6OA 2Z8LA 2CVRA 1IBMQ 1WTVA 3H0GB 1GUSA 1H9RA 3NTIA 2QDLA 2EYPA 2IX0A 1GD7A 5M5YH 4DK0A 4DV0Q 4FF1A 1EIFA 4XTCS 1TS2A 3B6YA 4JI4L 4E6IA 1Y1VH 2DNCA 2XNAC 1MJEA 4CJ2C 1IYVA 2UUCL 4YCUA 4IURA 3TMEA 2F0TA 1CFMA 4R1JA 1WVLA 1V43A 4KN7C 3L0OA 4A3CH 5C5MA 3J81i 1EZ8A 1EY9A 2B2UA 2XWJB 1LABA 2GN5A 1CT1D 5AJ3Q 1A15A 2KA7A 5FKAC 2UU9L 1NR4A 4HJ8A 3FDTA 2WKCA 3A5ZB 1SBBB 4NMZA 1YZ6A 1K8MA 5EBDA 5C4XG 1EY0A 4JI2Q 3CRLC 1LV9A 1QWYA 1I4RA 4IOAA 1RKNA 1OXTA 3M7NA 4KD3A 4IFDH 1STAA 2NWGA 2K5QA 4B3RQ 2JA6H 1CHQD 2F0LA 3SXHA 4GKKL 2K28A 4RCNA 2M00A 4X62Q 2ATWA 4JBKA 4JI6Q 1Y8NB 1F2YA 4DAMA 1IKLA 1A8VA 1KQSA 1ET9A 4G4KA 1TWAH 3FPPA 1HQMC 2CQAA 3UI2A 1P8LA 3OHXC 3PCOB 5IYBH 4JI0L 3NPPA 2D5DA 3NK9A 4KN4C 3E0JA 3X3NA 2UXBQ 2QILA 3UDXA 1KDAA 3GTLB 1JB3A 1LM0A 1O7YA 2A6ED 2A74C 2P5ZX 4PMBA 4RGTA 3F2BA 1PH9A 1TVXA 2E2DC 4NW2A 1WD1A 2B2VC 4ABNA 1EWHA 3AB9A 3IKJA 4N8FA 4EGVA 2XN9C 1ESRA 4K2KA 1EY8A 5C44H 2ZJPA 1ILQA 3V2TA 1VQIA 5CV6A 3EROA 1PYWD 3I4MH 3PUXA 4HCSA 2PZWA 5JEAJ 1TIID 4HJ5A 4UY8C 4LWCA 3A54A 4FVMA 4YWMA 1XWEA 3SDZA 2DGYA 3HOUB 3S14H 4OEMB 2XWBB 1YJNA 1TWCH 2Q8TA 5C4ZA 1E7ZA 2NYZD 1DYQA 2F0PA 3Q8DA 4KHPL 3W3AA 4ZKBB 2JA6B 4DV2Q 1UE1A 4QL5A 4JV5L 2QF7A 4KJOA 4IOCA 3S17B 4X65Q 1B44D 2KCTA 4AQYQ 5IYDG 5KYIA 4DNTB 4DK6C 3CMAA 1OXSC 4OIKA 1SFOB 4LF9Q 4XQJA 4FNFA 1G8ZD 4H44C 2NZ1D 2YYZA 1XMQQ 5IYBG 4WJ4A 4X6AH 1II3A 2JA5G 4IJLA 1LTBD 1VQGA 4S3SA 3TP8A 4LFAL 1SMYD 3QB3A 1DZ1A 1BBWA 2VW9A 4IPGA 2ZTDA 4DK1A 3RZDH 1I4PA 2VXWA 1PFSA 3E9IA 4GZYC 5ELFA 2LXJA 2R3ZA 1XPUA 4Z9CB 2RCNA 3KLWA 3OW7A 1BF4A 4YWKA 1J8IA 2F1MA 5M5YB 2X6LA 4LW1A 3G4SA 2B2WC 1KD1C 3I7FA 3U58A 2NVTB 3H0GH 3J7AV 1KTKA 2JE6I 4CJ0B 4JI5L 1TWFB 1X55A 1F2LA 2OXPA 3A7AB 4U673 2R93G 4P2CB 2A5HA 4RWSC 4FYDA 5IP9H 2JEAI 1JORA 3I3CA 1B70B 5JPMC 3DM1A 2VNUD 1SN8A 1E2WA 1C48A 2MHVA 1SYFA 2NVTH 1RJTA 1JQYD 1Z7TA 2DNEA 2DJGC 1JT8A 1VQKA 2PPBC 2I5HA 1JWSD 4QY7A 5I4DA 5FO7B 4FXKC 5H1SE 1QVFA 2DY7A 4C3JH 1LTAD 3QG1A 4RFBA 3R2IA 1PH2A 4LF8Q 1G291 4HIKA 1NBWA 2E76C 1M1KC 1J5EQ 3NUCA 3RNUA 3GTPH 2C9OA 5NUCA 1ZKOA 1IKMA 1EOTA 4LF7Q 1U4MA 4Y7NH 1WTRA 4CGYB 4A3GH 1SFOH 4K2LA 3A8KE 1STYA 2L9HA 1A3VA 4ME3A 1WYDA 3GTGH 1ML0D 4JBWA 3S2HB 4DR2Q 1ONLA 2VL6A 3TEHB 3CCVA 1EYCA 5I9PA 3K81C 4NXML 4PG3A 5EQ0A 1PH8A 4IPHA 3GD7A 1IYUA 3AQQA 3PMFA 4RKLA 1B4OA 4PZ7A 4WJ3M 1PH1A 2B2VA 3HOUH 3S14B 5IGBA 1KDCA 4LF5L 5E4XA 2OF1A 1CZGA 1EYDA 4RGOS 1GVPA 4BBRG 4DNRB 4GKJL 3CCMA 1SE4A 3F2UA 4RCOA 2KVMA 3O13A 1U4PA 2ICEC 2F0KA 3H3VC 2AWNA 2L11A 5C44B 2JA9A 5M5WB 5CBEE 2LSSA 2IY5B 1HQRD 1YNND 5CORA 1JOOA 3RLNA 4BY1H 2F0OA 3TS0A 1ZYRC 3K7AB 4XDXA 3BDLA 2F0QA 4CKEA 2AQ3B 1VDZA 4X3KA 4IUQA 1FL0A 1SYBA 5LMUQ 3G71A 3KDFA 1QUQB 2MQHA 1YITA 2UU9Q 4MTKA 3RR5A 3FMCA 1SMXA 5IGGA 4DR1L 4OO1I 2G9HD 1CKNA 3VR3A 3PO3H 3SGIA 1PTOH 2WAQG 2TSSA 1LT4D 3CF5A 4K5XA 5KGUA 3DWPA 1VQCA 2PCFB 2D0OA 4LFBL 3HOVG 1N36Q 3GTMH 4OX9Q 5I6YA 1ICWA 2F0EA 5J3BA 2V1CC 3K5MA 3AEVA 1C8CA 2Z4HA 1GUGA 1TR5A 4RHSA 1T5EA 1OO9B 1EQQA 4I65A 1Y1WG 2LS01 5IWAL 1VQ5A 4K5VA 2N55A 5CV9A 3AYHB 4HIMA 2HD3A 2BCOA 2F0WA 2FFKB 4IZ8A 4ZQ3A 1G2TA 1B1ZA 2VQEL 2HIXA 5IT9c 4CKBA 2GA4B 1SAPA 3F2CA 4LJZC 4KK7A 1PRTC 3DHQA 3CKIB 4N9PA 1SYCA 2JXMB 5M3MG 3HKZB 2IX1A 3C2PA 2F03A 4BXXH 3ICEA 4A4IA 2JYOA 1CI3M 2BE5D 1BCPD 1MI2A 3CP0A 1VQ6A 4JI1Q 4JCVE 1IL2A 2B2TA 4DN4M 5IY0A 1STHA 1W6JA 2HT1A 4K6DA 3K5OA 1OXUA 4LUZA 4XYOA 2EXDA 1WD0A 2E2JH 1PA6A 2CHBD 3HOYB 2AQ2B 1GUTA 4J6HA 4CBVA 1N34L 3FEWX 3BVMA 2PQAA 1H9SB 3JAME 4R8IA 3IFTA 1S5DD 2WFWA 1CM9A 2PQAB 3J7ZC 1G2SA 3NHHA 1LT6D 3EBEA 1VQJA 1PTOF 4KKSA 2FMCA 3JAML 4A3JG 5BN5A 2VUMG 3RZOB 1I4XA 3MAQA 2PQEA 2PNHA 3GTJB 1WCMH 1X3QA 2F3WA 2KENA 4HMIA 1PYSB 2R93B 2B29A 2H1EA 1XPOA 4AQYL 3HOWH 1UNSA 2KBNA 2RQXA 4IFDG 2KECA 3IL8A 3M3YH 3CHBD 1ZXTA 3VYTA 4U68A 1IYJB 3E6ZX 4X3TA 5C44G 4C2MB 1K3BC 4V0BA 3M4PA 4MHEA 4POFA 4YHHQ 3RMHA 4X64Q 1FJGQ 1H9SA 3MEHA 3A55A 5LMUL 2FINB 1EQRA 3TDQA 1STEA 1T9HA 1K0RA 4JPBW 3AFQA 4PMCA 3C3LA 1EIHA 4P74A 5FLMG 2A1AA 1HR0L 3BU2A 2C5CA 3F2DA
chains in the Genus database with same CATH topology
1RF2D 1STBA 4IN3A 4G7ZC 2PZUA 2PW7A 2KEEA 2DY8A 5HGTA 3EVQA 5A2QE 4ZYSA 1V1PA 2WACA 1WTXA 2B2WA 4NKLA 5CBAE 3I91A 1NAPA 4IUVA 1F9RA 1OXXK 3MWYW 2ZT9C 1SYEA 2PYKA 3NBIA 5C0XI 4IQZA 2VUMB 4A3EB 3TBIB 1QE6A 1GUOA 3J80E 2O2LD 1DOMA 1RTNA 2SOBA 4KY7A 2OT2A 3PO2B 4TRDA 1QOHA 1Y8OB 3OIQA 1SNPA 1QB5D 2NB0A 1SJED 1BCPF 1BOSA 3RUZA 4KD4A 3BS1A 2EJMA 3DMUA 1CTMA 4KHVA 3DEOA 2F4IA 3I90A 2SEBD 2F0SA 2NUCA 5COYA 4HTHA 3M3YB 1E2ZA 3ZYYX 3SE0A 3HOWB 1SDFA 3I72A 1QNKA 4B08A 1SSOA 2WINB 1NR2A 2IX3A 1ZEQX 4KV6A 3S16B 1Q1EA 3SVMA 4OO1H 3HOVB 2EDGA 4RA8A 3TSSA 1JC7A 4K8JA 5T1IA 4F88A 2K6AA 5CV8A 1GUNA 2B39A 1AZQA 3U9OA 1X3PA 2EZVA 1S4ZA 1FNUA 2WB1B 1SYDA 2SNMA 3QWNA 1PZJD 2MP1A 1SEBD 1XXGA 4EQOA 2PZTA 1LTGD 3FPUB 2A69D 3TZDA 4A3KB 5I2YA 1ZYRD 2NN6I 5LL6S 1F2ZA 5CV7A 3NTKA 3MFYA 5T1GA 3NSWA 2K05A 1TT2A 1NSNS 1XYIA 3OOCA 1G91A 1PTOB 1E2VA 4K6LA 3K59A 1B2TA 1A6XA 3PO3B 3SK4A 1Y8PB 3KLRA 2I46A 1DXMA 3QJYA 4A3FB 2NBFA 3VR2A 2AQ1B 1HCZA 4DXFA 4EQNA 1AEXA 5EGTA 1YNJD 2M9VA 5C4XB 1VMPA 3P1HA 1HXYD 4FF4A 2Q8RE 2R6GA 1JWMD 4HSVA 2EY1A 4XIGS 4IALA 1TWHB 5JJZA 2K5WA 1AW7A 1D5ZC 1A2TA 5IGDA 4RKBA 3CRKC 1EEID 3K5NA 5CV4A 3T13A 3AMUA 1WTPA 3K57A 4ODGA 3BYYB 5M5XB 2KHSA 2CW0D 4Y7NB 2L12A 3BYTB 1BCPB 1LO5D 2XIWA 2F0MA 1JWUD 5C4JB 5FK9C 3HS0C 3RLFA 1SXTA 4FP5D 5EBCA 1LT5D 4C3JB 4ZRZA 1RODA 4LK1C 2Z1CA 3R2TA 5HURA 2F0VA 4ZKCB 2A68C 2JEBI 3QO2A 1ILPA 5C5LA 5EKLA 1YNJC 1EU3A 1SMYC 4ZUIA 4N9TA 5CV5A 1QNUA 1VCIA 2E74C 3LNNA 1SNDA 2VB3X 3NTHA 1PFNA 1PZID 2Z4IA 1V1PB 2WIIB 2HCIA 4A3DB 1RTOA 1PXUA 2PW5A 2ICIA 2B2UC 1B9NA 4LAAA 4QIWB 3EQLC 2BE5C 3NWTA 3OIPA 4G7OC 3R93A 2CW0C 2FMMA 2K33A 3H6MA 4R9WA 1PLFA 2BDOA 5IGFA 3RZDB 1KNAA 2HUGA 2K04A 2EYOA 1SE3A 2B63B 1HPCA 5E3FA 3TP6A 1D1IA 3V05A 3L7ZC 3D4RA 1D6EC 4HMJA 1O78A 4IUNA 1HFNA 2N88A 1SNOA 4HEDA 1QG7A 1B9MA 3BG3A 3D8GA 2ZXOA 4QCLA 3I8ZA 5LL6X 4KY5A 3BVZA 5IT9E 1VF7A 4FF3A 2JSOA 4H7BA 4C3IB 1H9KA 1WTWA 1DD2A 2NVQB 1TWCB 5G3LD 2F0IA 4J8QA 1F77A 4A3MB 4MN3A 1O80A 2FJ2A 1J9OA 3WOEA 3KBGA 3Q6SA 1HA6A 1TS3A 4QMGA 3Q22A 2K01A 4PMWA 2RDGA 4DGZA 1IW7D 2HCCA 2F0FA 1NUCA 2AUJD 4KJNA 2K03A 4UAIA 5JPNC 2IPKD 3MXPA 4HR7B 3WOFA 1TWAB 2RBMA 2RA4A 3P20A 2EOTA 1UAPA 1GXDC 1ENAA 1HA5A 1SJHD 5I9OA 3GV3A 1AZPA 3K0YA 1STNA 2L5TA 1MBYA 3HP3A 4HN7A 2EYFA 1TY0A 1G6ZA 4DAVA 5G3LF 1I4QA 4OO1G 5C0XG 3HRZC 3ND9A 3U9SA 5KIXA 4R8NA 3M85A 1PFBA 5IOCA 2IT1A 2I07B 2RKSA 3J81E 3I70A 3IAYA 5JOBA 1I50B 3CU7A 2MUYA 4IFDJ 1SNCA 5ISRA 1LTTD 4PQXA 3TN2A 4LMQD 4ZK9B 2RSOA 3KLSA 2XRSD 4YIJA 5EJWA 3GTKB 4EQPA 2EYMA 3K5LA 3GO5A 2BA1A 4RH6A 1DONA 3NXWA 1I6VC 1EY6A 3MXNA 2HDLA 3KBXA 4QUFA 1YNNC 4O1NA 4C3HB 1FGBD 3V96A 3M4OB 1F9PA 1VF5C 5LHY1 3MXUA 1LLRD 5JEAH 1XX8A 5M3MB 1AFPA 3S1RB 1FNVA 4A3IB 3Q23A 3LWEA 2B2TC 2F0UA 3RD4A 1PTOD 3GP7A 4BBRB 3H09A 1SE2A 4HSPA 1EY4A 2X69A 1R9TB 2EXZA 2M2LA 1I4HA 3A8JE 1GUWA 1TQOA 4L63B 3T53B 3PUWA 4UDUC 5KNDA 2KQ3A 2ENBA 2F0JA 1D5XC 2R61A 3E5SA 1I3QB 1Q3LA 1EZ6A 4NP5A 4DU9A 1WCMB 3A7LA 1BXTA 4FF2A 3LWUA 3MHBA 4XT1B 4WFN3 3VR5A 3D6WA 5JEAG 5C3WA 1Q12A 4RGMA 3FKIB 5D3DA 3T16A 1U4LA 4C3HG 2KJXA 4H0LC 2A69C 4IUPA 5K36G 4B9WA 1NCVA 5CR3A 3G6JB 3PUZA 3MC0B 1CQVA 3KK7A 4KTAA 4WORA 2MJ8A 2LY7A 5A35A 3TP7A 3J7AF 2D9UA 1RDPD 1CA5A 3P75A 2ZXRA 1BUVT 4KKTA 3T51B 4EVOA 3NQTA 5KYLA 1B50A 1EY7A 3M7GA 4O42A 4ID6A 4L8JA 4ULLA 1PMRA 1JCKB 4TKOB 3NP8A 3GTMB 3GV6A 2K1BA 3X3MA 4A3BB 4F87A 4TSSA 2QCPX 3OWFA 1BCPC 2KCNA 3VA5A 4CKCA 2EE1A 4IUTA 4L6TB 1BDOA 1GHJA 1PRTD 1SNMA 2LKVA 1TWGB 2K32A 3BVGA 1M8AA 4BY1B 3HOXB 1LACA 1EWCA 5J22A 1RCVD 5J1ZA 4QUCA 3VYRA 3Q0AA 3I4NB 5C3XA 4DFAA 5I6WA 5A2QL 2F0GA 3GQBA 2PO4A 3NBHA 2A68D 5AFWA 3EA6A 2MGSA 4XXEA 2ZXPA 2L0CA 1MSHA 1V8QA 1L0YB 1EQTA 2BA0A 2LMCB 1FD7D 3SEBA 4TQUS 3GTOB 3KLSX 3ONAB 1BO0A 3HEJA 1I6HB 1EFID 5EKKA 3A8IE 5CMDA 4BY7B 5FO8B 1QILA 1U9RA 4A3GB 5DM73 1FR3A 4XT3B 5DM63 4PNYA 4ZUJA 4RGNA 2B8FA 1KNEA 3SK8A 5K36H 2J0TD 3GTPB 3DEPA 3SHLA 3I73A 4ZAIA 5IT9L 3BZDB 1HUNA 3PUVA 4BS9A 2AWOA 4XYQA 2QDBA 5J39A 2E2HB 2RSNA 4X3UA 1JR0D 2SNSA 3C1FA 5F2DA 4BBSB 4J1MA 5E1FA 1UUPA 5CYUA 3DWQA 3N52A 3TP5A 4C3JG 1OXVA 3C46A 3NE5B 5ELCA 3S1MB 5KNBA 1KDBA 4K14A 2XVSA 1O7LA 1D5MC 1KLUD 1VMCA 5FLXL 2D62A 1HTLD 2EY2A 3R3OA 1S5CD 1PFMA 3OMGA 5DEHA 2B8GA 1DOKA 4A93B 1HFGA 4K5WA 5BN4A 5I2XA 2O4XA 4OL7A 2TMPA 4K8IA 2NN6G 4WRDA 1BNZA 2J4XA 5BN3A 3CQZB 2A6EC 4XQQA 1K8OA 1S5BD 4C3IG 1S5FD 1FNWA 2HQEA 4F7XA 5C6AA 2HDMA 4ILWA 1S5ED 1H9MA 1Q1BA 1IL8A 4KHZA 4F8MA 1CHPD 3QIAA 3I4MB 1Z6HA 1EQVA 3HGBA 2EJGC 3T4AC 2BOSA 1EEFD 1DM0B 4OIJA 2B2YA 3MZ5A 2H4OA 4DA2A 2X6GA 2E2IB 4BWGB 1R4QB 3VYUA 2L55A 2WV6D 2JA5B 3J7YW 1MGSA 3SR1A 3MXGA 1MD2D 2B2YC 5ELDA 2WP8J 1WTOA 1CQFA 3D4WA 4WJWA 1AP0A 2NVXB 1PRTF 1Q8IA 2Q8IB 3D31A 2NVYB 3L3OC 4RHRA 1F9QA 1U4RA 1F9SA 1CK1A 2ID0A 2KEDA 3A56A 3D3RA 3VR6A 1B53A 3MTSA 1IHZA 2RVLA 5JVG3 3VR4A 3I4LA 4KY6A 3S15B 4C1NI 4ZLTF 4M1UB 1ET6A 2IWHA 3MVVA 3MFGA 5DNFA 5C3EB 4QF4A 1PDQA 5K5PA 1C4QA 2PMZB 4IUUA 1Y1VB 4Q0FA 2NN6H 5D14A 3NQIA 1HUMA 3T56B 2F0DA 3D6CA 3H94A 1F2MA 3S1NB 1B3AA 4ME5A 3L9AX 1TY2A 4FXDA 2XSCA 3C1EA 2WAQB 3OSOA 5M3FB 4CJ1B 2L4NA 4KMUC 2K5DA 1A3TA 1ENCA 1FYCA 1WTQA 4FO2A 1MSGA 2KOLA 4I7ZC 3PV0A 4DF7A 1PRTB 2R92B 1BQQT 1DJRD 3OPOA 1JOQA 2EYHA 3S2DB 4PV1C 1GHKA 1W6KA 3M4YA 1D2BA 4G57A 1XTCD 1KAAA 2E75C 2WKDA 3PIO3 5IGCA 4IFDI 1LTSD 3DUZA 5EPLA 2EJFC 1R4PB 5ELEA 2EVBA 5D3IB 2K7VA 3ND8A 2O5IC 3J81L 5CGKA 2RDFA 1STGA 4XQNA 5EKIA 4C56C 1SNQA 2VB2X 3AU7A 1HRJA 5EPKA 1DOLA 1A2UA 2EY5A 2EY6A 2XRQD 2JA7B 2EYJA 4MIUA 3H91A 2D2CC 3BDOA 3EJIA 3VA7A 3J80L 3K58A 4FXGC 2A6HC 2KUMA 4KI0A 2JP1A 1Q90A 1EY5A 2G9DA 3WDNA 1Y1WB 5E4WC 2A73B 1H9JA 3D4DA 4V190 4OHJA 1L0XB 1EL0A 1UEAB 5FO9B 1M4VA 5TSSA 1TKWB 3QOLA 4HCEA 1X32A 1PTOC 5M9OA 1GOZA 3EFXD 4AYBB 1KLGD 2NTSA 2V4DA 4RAUC 4B9XA 4QB4A 3OWEB 2AUKA 2F0HA 1AN8A 3S1QB 4X3SA 2FHTA 1K83B 3P7JA 5IODA 3PIP3 5JAVA 1EU4A 1CZWA 2E2JB 1TS5A 2YU9B 5IGEA 4BA2I 3FRPB 3FVQA 2LFNA 5C4HA 4KKUA 1QJOA 3ERQA 3KUPA 3NWSA 3W2DA 1EYAA 2EPBA 1CA6A 2QKIC 2IL8A 3BDCA 4HAEA 2A6HD 3OMCA 4OGQC 5ELBA 1Z47A 1IW7C 1JICA 4A3JB 4M8AA 5C0XJ 1HTPA 5FOBB 1T5XD 3HG9A 5D65A 5KNCA 1BR9A 1ENFA 2IJ0A 5KRUA 2JA8B 4DAPA 2DN8A 2L1BA 5EPJA 1RHPA 4JK1C 1LTID 1EIGA 2BDNA 1D1KA 3S9WA 5C0XH 1BBXC 3TZUA 3DWAA 1GJXA 2KCCA 2RDHA 1TU2B 4NDXA 1LT3D 1JE4A 1PZKD 2Y0SB 5FLXE 1HHVA 3QOJA 1ESFA 3URYA 3GTGB 3GTQB 5IIFA 4Q5VA 4DXGA 5JVH3 1O7ZA 3R8BA 3SK6A 1RD9D 2IW3A 1SYGA 2SDFA 3IFDA 2EYLA 2PNRC 1QCBD 2J7ZA 3VYSA 3HZXA 3MA2B 2R7ZB 2NTTA 2O5JC 2MPMA 4DAYA 4BA1I 4CHTB 5CC4A 3N6RA 3Q24A 1TS4A 1LTRD 2F3VA 1V1OA 1E0BA 3KF8A 3PUYA 2F0NA 3LX0A 1A3UA 1JOKA 2QEJC 5KEEA 1I4GA 1KABA 4C1NK 3HOZB 3G7LA 4G7HC 1Y69U 1DCZA 2OEOA 3SK5A 3ITPA 4H13C 5DAUA 3DXJC 3K6OA 2Z8LA 2CVRA 1WTVA 3H0GB 1GUSA 1H9RA 3NTIA 2EYPA 2IX0A 4DK0A 4FF1A 4XTCS 1TS2A 4E6IA 2DNCA 2XNAC 1IYVA 4CJ2C 4IURA 3TMEA 2F0TA 1CFMA 1WVLA 1V43A 4KN7C 5C5MA 1EZ8A 1EY9A 2B2UA 2XWJB 1LABA 1CT1D 1A15A 2KA7A 5FKAC 1NR4A 3FDTA 2WKCA 1SBBB 4NMZA 1K8MA 5EBDA 1EY0A 3CRLC 1LV9A 1QWYA 1I4RA 1RKNA 1OXTA 3M7NA 4KD3A 4IFDH 1STAA 2NWGA 2K5QA 1CHQD 2F0LA 3SXHA 2K28A 4RCNA 2M00A 1Y8NB 1F2YA 1IKLA 1ET9A 4G4KA 3FPPA 1HQMC 2CQAA 3UI2A 3OHXC 3NPPA 2D5DA 3NK9A 4KN4C 3E0JA 3X3NA 2QILA 1KDAA 3GTLB 1JB3A 1O7YA 2A6ED 2A74C 4RGTA 4PMBA 1TVXA 2E2DC 4NW2A 1WD1A 2B2VC 4ABNA 1EWHA 3AB9A 3IKJA 4EGVA 2XN9C 1ESRA 1EY8A 4K2KA 1ILQA 3V2TA 5CV6A 3EROA 1PYWD 3PUXA 4HCSA 2PZWA 5JEAJ 1TIID 3A54A 4FVMA 1XWEA 3SDZA 3HOUB 2XWBB 2Q8TA 5C4ZA 2NYZD 1DYQA 2F0PA 3W3AA 4ZKBB 2JA6B 2QF7A 4KJOA 3S17B 1B44D 5KYIA 4DNTB 1OXSC 4OIKA 1SFOB 4XQJA 4FNFA 1G8ZD 4H44C 2NZ1D 2YYZA 1II3A 1LTBD 3TP8A 4S3SA 1SMYD 3QB3A 1DZ1A 4DK1A 1I4PA 2VXWA 4GZYC 5ELFA 2R3ZA 4Z9CB 3OW7A 1BF4A 1J8IA 2F1MA 5M5YB 2X6LA 2B2WC 2NVTB 3J7AV 1KTKA 2JE6I 4CJ0B 1TWFB 1F2LA 2OXPA 3A7AB 4U673 4P2CB 2A5HA 4RWSC 4FYDA 2JEAI 1JORA 3I3CA 5JPMC 3DM1A 2VNUD 1E2WA 1C48A 2MHVA 1SYFA 1RJTA 1JQYD 1Z7TA 2DNEA 2PPBC 1JWSD 5I4DA 5FO7B 4FXKC 2DY7A 1LTAD 3QG1A 4RFBA 3R2IA 1G291 2E76C 3NUCA 2C9OA 5NUCA 1ZKOA 1IKMA 1EOTA 1U4MA 1WTRA 4CGYB 4K2LA 3A8KE 1STYA 2L9HA 1A3VA 3S2HB 1ML0D 4JBWA 1ONLA 1EYCA 5I9PA 5EQ0A 3GD7A 1IYUA 4RKLA 3PMFA 1B4OA 2B2VA 3S14B 5IGBA 1KDCA 5E4XA 2OF1A 1CZGA 1EYDA 4RGOS 4DNRB 1SE4A 3F2UA 4RCOA 2KVMA 3O13A 1U4PA 2ICEC 2F0KA 3H3VC 2AWNA 2L11A 5C44B 5M5WB 5CBEE 1HQRD 1YNND 5CORA 1JOOA 2F0OA 1ZYRC 3K7AB 4XDXA 4CKEA 2F0QA 3BDLA 2AQ3B 1VDZA 4X3KA 4IUQA 1SYBA 3FMCA 5IGGA 4OO1I 2G9HD 3VR3A 1PTOH 2TSSA 1LT4D 4K5XA 3DWPA 2PCFB 5I6YA 1ICWA 2F0EA 3K5MA 1C8CA 2Z4HA 1GUGA 1TR5A 4RHSA 1T5EA 1OO9B 4I65A 2LS01 4K5VA 2N55A 5CV9A 2BCOA 4ZQ3A 2F0WA 2FFKB 4IZ8A 1G2TA 1B1ZA 4CKBA 2GA4B 1SAPA 4LJZC 4KK7A 1PRTC 3DHQA 3CKIB 4N9PA 1SYCA 2JXMB 3HKZB 2IX1A 3C2PA 2F03A 2JYOA 1CI3M 2BE5D 1BCPD 1MI2A 2B2TA 4DN4M 1STHA 1W6JA 4K6DA 3K5OA 1OXUA 4XYOA 1WD0A 2CHBD 3HOYB 2AQ2B 1GUTA 4J6HA 4CBVA 3FEWX 3BVMA 1H9SB 3JAME 4R8IA 3IFTA 1S5DD 1CM9A 1G2SA 3NHHA 1LT6D 1PTOF 4KKSA 2FMCA 3JAML 5BN5A 3RZOB 1I4XA 3MAQA 2PQEA 3GTJB 1X3QA 2F3WA 4HMIA 2R93B 2H1EA 1UNSA 2RQXA 4IFDG 2KECA 3IL8A 3CHBD 1ZXTA 3VYTA 4U68A 4X3TA 3E6ZX 4C2MB 4V0BA 4MHEA 3RMHA 1H9SA 3MEHA 3A55A 2FINB 3TDQA 1STEA 4PMCA 3C3LA 1EIHA 5KGUA 2C5CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4C3H G;  4C3I G;  4C3J G; 
#chains in the Genus database with same CATH topology
 1RF2 D;  3K0X A;  1STB A;  4IN3 A;  1GKH A;  2VY3 A;  4G7Z C;  3MEF A;  3PO2 H;  4LF7 L;  2PZU A;  2PW7 A;  2KEE A;  2DY8 A;  3S1R H;  5M3M H;  5HGT A;  3EVQ A;  5A2Q E;  2WB1 E;  4ZYS A;  1V1P A;  2Q2H A;  2WAC A;  1WTX A;  5GRO A;  3GTQ H;  2B2W A;  4NKL A;  5CBA E;  4DV4 Q;  4NPS A;  3I91 A;  1NAP A;  1XJV A;  3KJO A;  4IUV A;  4X64 L;  1F9R A;  1OXX K;  3MWY W;  1YNX A;  2ZT9 C;  1E1O A;  1SYE A;  3W5O A;  4DV6 Q;  2PYK A;  3NBI A;  5C0X I;  1NY4 A;  4IQZ A;  2VUM B;  5EAY A;  2HQL A;  1IZ6 A;  2I0Q A;  4LF4 Q;  4A3E B;  3TBI B;  1QE6 A;  4IJH A;  1VQA A;  1GUO A;  3J80 E;  1VQ7 A;  3KYH C;  2O2L D;  4B3R L;  3J80 i;  1DOM A;  1S72 A;  4A3M G;  1RTN A;  2SOB A;  4KY7 A;  1NE3 A;  1YHQ A;  2OT2 A;  1UE5 A;  3CC4 A;  3PO2 B;  2ZM6 Q;  4TRD A;  1QOH A;  1X3F A;  1Y8O B;  3OIQ A;  4JYA Q;  1SNP A;  1QB5 D;  2NB0 A;  1SJE D;  4GN5 A;  1I50 H;  4HIO A;  4QGU A;  2KHJ A;  1BCP F;  3IRB A;  1BOS A;  1XNQ Q;  2HIV A;  3RUZ A;  1HR0 W;  4KD4 A;  3BS1 A;  2OTJ A;  3HKZ E;  3PIO A;  2UXD L;  2EJM A;  4RG1 A;  4MZ9 A;  1JB7 A;  3DMU A;  1CTM A;  4KHV A;  3DEO A;  2F4I A;  3I90 A;  2SEB D;  4C2M H;  2OTL A;  2F0S A;  3HFZ B;  4LUO A;  2NUC A;  5COY A;  4HTH A;  1C7Y A;  1X56 A;  3M3Y B;  1E2Z A;  3ZYY X;  3SE0 A;  2N3S A;  3NEN A;  5C3E G;  3HOW B;  2R92 G;  1SDF A;  3I72 A;  1N32 Q;  1QNK A;  4B08 A;  1SSO A;  2CWA A;  2WIN B;  1NR2 A;  2IX3 A;  1ZEQ X;  4OWT B;  3RZO H;  4KV6 A;  4P72 A;  3S16 B;  1Q1E A;  3SVM A;  1N32 L;  4OO1 H;  3HOV B;  4DPG A;  2AMC B;  4JVZ A;  1P16 A;  2EDG A;  4RA8 A;  3TSS A;  1JC7 A;  4K8J A;  5T1I A;  4F88 A;  2K6A A;  4DV7 Q;  5CV8 A;  1GUN A;  5IE8 A;  3RN5 A;  2B39 A;  2A19 A;  4A93 G;  1AZQ A;  2MFI A;  3EN2 A;  2OQ0 A;  2WAQ E;  3U9O A;  1X3P A;  2EZV A;  1S4Z A;  1FNU A;  2YU9 H;  2K5H A;  2WB1 B;  4EQ5 A;  1SYD A;  2SNM A;  1ICF B;  3QWN A;  1PZJ D;  2MP1 A;  3J7A 5;  2GVB A;  1SEB D;  1XXG A;  5ELN A;  3TS2 A;  4EQO A;  2PZT A;  1LTG D;  4A76 A;  3S1Q H;  1VQ9 A;  3FPU B;  4X66 L;  1RIP A;  2A69 D;  3TZD A;  5JJI A;  1MKH A;  4A3K B;  5I2Y A;  2ZJQ A;  1ZYR D;  2NN6 I;  1PHJ A;  5LL6 S;  1F2Z A;  3F1Z A;  5CV7 A;  1XPR A;  4JOI A;  3NTK A;  4C3I H;  1X9N A;  3BZK A;  1PH3 A;  3STB D;  1SRO A;  3MFY A;  5T1G A;  1AE3 A;  3NSW A;  2K05 A;  1TT2 A;  3I4N G;  1PH7 A;  1E22 A;  1NSN S;  4LF6 Q;  1XYI A;  3OOC A;  1G91 A;  1PTO B;  1E2V A;  4K6L A;  4YY3 L;  3K59 A;  1B2T A;  2JA5 H;  1A6X A;  3PO3 B;  3SK4 A;  1N33 Q;  1D7Q A;  1Y8P B;  3KLR A;  2I46 A;  4DR2 L;  1DXM A;  3QJY A;  4A3F B;  2NBF A;  3VR2 A;  2AQ1 B;  3UDI A;  4LF6 L;  1HCZ A;  4N8X 1;  3ULJ A;  4DXF A;  1EWI A;  4AYB G;  4EQN A;  1AEX A;  5EGT A;  1YNJ D;  2M9V A;  5C4X B;  1HR0 Q;  2VQF L;  1VMP A;  1KRT A;  2ZTC A;  3P1H A;  1HXY D;  4FF4 A;  4O0A A;  2PI2 A;  2Q8R E;  3K7U C;  2R6G A;  1JWM D;  2PI2 E;  4HSV A;  2EY1 A;  4XIG S;  4IAL A;  1TWH B;  5JJZ A;  3PSI A;  3A5U A;  2K5V A;  1CSP A;  2K5W A;  1AW7 A;  1YBY A;  1D5Z C;  3J80 c;  1A2T A;  2ZJR A;  5IGD A;  4RKB A;  4A3D H;  3CRK C;  2QA4 A;  3CW2 C;  1EOV A;  1EEI D;  3K5N A;  5CV4 A;  1KRS A;  3JC6 6;  5IYC H;  3T13 A;  3AMU A;  1WTP A;  3AFP A;  2DUD A;  3S2H H;  3K57 A;  2VZA A;  4ODG A;  3BYY B;  2LXK A;  4UP8 A;  5M5X B;  2KHS A;  2Q2T A;  3H0G G;  2CW0 D;  4Y7N B;  1HNW Q;  2L12 A;  3BYT B;  1B3Q A;  1BCP B;  1LO5 D;  1NJI C;  2XIW A;  2CWP A;  1JE5 A;  2F0M A;  3S2D H;  1JWU D;  3OTO Q;  5C4J B;  5FK9 C;  3HS0 C;  3RLF A;  1SXT A;  3T1Y Q;  1EFW A;  4FP5 D;  5EBC A;  1LT5 D;  4C3J B;  4ZRZ A;  1ROD A;  4LK1 C;  2Z1C A;  3R2T A;  2K4K A;  5HUR A;  1NMF A;  5M5X H;  3CCQ A;  2F0V A;  4ZKC B;  5L37 A;  2A68 C;  2JEB I;  1KL9 A;  3QO2 A;  4A3B G;  4BBS G;  1ILP A;  4NB3 A;  5C5L A;  5EKL A;  1YNJ C;  1EU3 A;  1SMY C;  4ZUI A;  4DV3 L;  4N9T A;  5CV5 A;  1QNU A;  1VCI A;  2E74 C;  3E0E A;  1SND A;  2VB3 X;  3LNN A;  3NTH A;  1PFN A;  1PZI D;  2B3G A;  2Z4I A;  4A3F G;  3CME A;  4DR4 Q;  2EIF A;  3KJP A;  1V1P B;  2WII B;  5AJ3 L;  2HCI A;  1VQH A;  4A3D B;  1RTO A;  2JA6 G;  1TWF H;  1PXU A;  1Q86 C;  5FLM H;  3PF4 A;  2PW5 A;  4J15 A;  2ICI A;  3OW2 A;  2B2U C;  4DV5 Q;  4DR4 L;  1B9N A;  3W1G A;  4LAA A;  4QIW B;  3EQL C;  2BE5 C;  1A62 A;  1PYB A;  3NWT A;  1KC8 C;  2OCE A;  3OIP A;  4JI8 Q;  5IYD H;  3PO2 G;  4G7O C;  3R93 A;  5LMN W;  3TQY A;  2CW0 C;  2FMM A;  2K33 A;  3H6M A;  4R9W A;  5GQO A;  1PLF A;  2BDO A;  5IGF A;  3L2P A;  2CH4 W;  3RZD B;  1KNA A;  2HUG A;  1YJW A;  2K04 A;  2EYO A;  1IBK Q;  1SE3 A;  1C9O A;  3T1H L;  2B63 B;  1HPC A;  5E3F A;  2HHH Q;  3TP6 A;  1QZG A;  1D1I A;  3V05 A;  3L7Z C;  3D4R A;  1D6E C;  1IBM L;  2N8N A;  4HMJ A;  2EQS A;  1O78 A;  3BJU A;  4IUN A;  1HFN A;  2N88 A;  1SNO A;  4HED A;  1QG7 A;  1B9M A;  4L5T A;  4UPA A;  3BG3 A;  3D8G A;  2ZXO A;  4QCL A;  3I8Z A;  2Z6B A;  5LL6 X;  4KY5 A;  1ASY A;  1JMC A;  1KIX A;  3BVZ A;  5IT9 E;  2RCF A;  1Q8K A;  1VF7 A;  4FF3 A;  2JSO A;  4LNQ A;  4H7B A;  4GOP C;  4X66 Q;  1K8A C;  4C3I B;  1H9K A;  4YY3 Q;  1VQP A;  1WTW A;  1DD2 A;  2NVQ B;  4JC0 A;  1TWC B;  1PH5 A;  2XGT A;  4H02 A;  2QGQ A;  2NVX H;  2Q2I A;  5G3L D;  2F0I A;  4J8Q A;  4PZ8 A;  1F77 A;  4A3M B;  4MN3 A;  2ZTE A;  5M3F G;  2RHS B;  1O80 A;  2FJ2 A;  4I7A A;  1J9O A;  3WOE A;  3I4N H;  2JQO A;  3KBG A;  3Q6S A;  2JN4 A;  1TS3 A;  4QMG A;  4OEL B;  1HA6 A;  3Q22 A;  4ALP A;  1CSQ A;  2K01 A;  4JW0 A;  4L5S A;  4PMW A;  2RDG A;  1Q81 C;  4Y52 H;  4CDC C;  4DGZ A;  1IW7 D;  2HCC A;  2F0F A;  3CCS A;  1NUC A;  2AUJ D;  4TVA B;  4KJN A;  1U0L A;  2K03 A;  1HNX L;  4UAI A;  5JPN C;  2IPK D;  3MXP A;  3RLO A;  4HR7 B;  3WOF A;  4LUV A;  1TWA B;  2RBM A;  2E5L L;  1PH6 A;  4A3B H;  1Y1V G;  3HOV H;  2RA4 A;  1X6O A;  4P75 A;  4HJ9 A;  3P20 A;  2EOT A;  1UAP A;  1YEZ A;  1GXD C;  3QR8 A;  1ENA A;  1BKB A;  1HA5 A;  3CC2 A;  1SJH D;  5I9O A;  3GV3 A;  1AZP A;  3K0Y A;  1STN A;  1Y14 B;  4GKK Q;  2L5T A;  1MBY A;  3A0J A;  3HP3 A;  4HN7 A;  2EYF A;  1TY0 A;  1G6Z A;  4DAV A;  3TRZ A;  3CC7 A;  4OXP A;  5G3L F;  1I4Q A;  5FJ8 G;  4DR3 L;  4OO1 G;  5C0X G;  4JI2 L;  2JJQ A;  3HRZ C;  3F8T A;  3CXC A;  1VQF A;  1NMG A;  1HJP A;  3ND9 A;  3U9S A;  5KIX A;  1WFQ A;  4B3T L;  4R8N A;  4YHH L;  3M85 A;  1PFB A;  5IOC A;  4A93 H;  2Z9H A;  2IT1 A;  4DUZ L;  4JI8 L;  3I56 A;  1HNW L;  2I07 B;  2RKS A;  3J81 E;  3I70 A;  3IAY A;  5JOB A;  1I50 B;  3CU7 A;  4L5Q A;  2MUY A;  4IFD J;  1SNC A;  4MNO A;  5ISR A;  3U4V A;  1LTT D;  4PQX A;  4A3G G;  4P71 A;  2I5L X;  3TN2 A;  4LMQ D;  5E7N A;  2GVA A;  4ZK9 B;  4NXN Q;  2RSO A;  1XNQ L;  2VS1 A;  3KLS A;  4GOP B;  2XRS D;  4YIJ A;  5EJW A;  3GTK B;  4EQP A;  2EYM A;  3K5L A;  3GO5 A;  2BA1 A;  4RH6 A;  1DON A;  3NXW A;  1I6V C;  2Z0S A;  1EY6 A;  3MXN A;  4HID A;  3CD6 A;  3S1M H;  2HDL A;  3KBX A;  5LMN L;  1XNR Q;  4QUF A;  4JI7 Q;  3PF5 A;  1YNN C;  4O1N A;  4DK3 C;  4C3H B;  1FGB D;  1DGS A;  3V96 A;  3M4O B;  2QEX A;  1F9P A;  5DLQ E;  2RF4 A;  1VQB A;  1VF5 C;  4DR1 Q;  3UDF A;  5LHY 1;  3MXU A;  1E24 A;  4GKJ Q;  1LLR D;  5JEA H;  4OWW B;  1XX8 A;  5M3M B;  1AFP A;  3S1R B;  1FNV A;  2K52 A;  4A3I B;  3Q23 A;  1K73 C;  2JA7 G;  3LWE A;  2B2T C;  1HNZ Q;  2F0U A;  3RD4 A;  1XMQ L;  2E2H H;  4LF9 L;  1PTO D;  3GP7 A;  4BBR B;  3H09 A;  1EYG A;  1SE2 A;  4HSP A;  1EY4 A;  2X69 A;  3W1B A;  2EXZ A;  1R9T B;  2R7Z H;  2M2L A;  1EIY B;  1I4H A;  4GN3 B;  3A8J E;  1GUW A;  1TQO A;  4L63 B;  4GNX A;  3T53 B;  4BY7 H;  3PUW A;  4UDU C;  1A0I A;  2KQ3 A;  5KND A;  2ENB A;  1D8L A;  1I6H H;  2F0J A;  1D5X C;  2R61 A;  4P73 A;  1BBU A;  3GTO H;  3E5S A;  1I3Q B;  1Q3L A;  1EZ6 A;  1FJG L;  2R93 H;  4NP5 A;  4DU9 A;  1WCM B;  2R7F A;  3A7L A;  3GTJ H;  1MJC A;  3FHW A;  1BXT A;  3GTK H;  4FF2 A;  2CCZ A;  2N49 A;  3LWU A;  3MHB A;  4XT1 B;  4WFN 3;  3ULL A;  3VR5 A;  3D6W A;  5JEA G;  5C3W A;  2F52 A;  1Q12 A;  4RGM A;  3FKI B;  5D3D A;  3T16 A;  4JI0 Q;  2KCM A;  1U4L A;  4C3H G;  4K0K Q;  2CH4 A;  4CDF C;  1HZB A;  3HOX H;  1N8R C;  3CCE A;  2KJX A;  4H0L C;  3HOY H;  5JJK A;  4R4I A;  2A69 C;  2DJF C;  4IUP A;  3HOW G;  5K36 G;  4B9W A;  1NCV A;  4FDB A;  3G6J B;  3PUZ A;  3MC0 B;  5CR3 A;  4NXN L;  1G51 A;  2UUB L;  1CQV A;  3KK7 A;  4KTA A;  4PZ6 A;  1N34 Q;  1E3P A;  1XTD A;  4WOR A;  2MJ8 A;  2LY7 A;  4GLX A;  5A35 A;  4DR5 Q;  1VQN A;  3TP7 A;  4IO9 A;  3J7A F;  2D9U A;  1AE2 A;  1SLJ A;  4DUZ Q;  4A3J H;  1RDP D;  1CA5 A;  3P75 A;  2ZXR A;  1GM5 A;  2UUB Q;  1BUV T;  4KKT A;  1UE6 A;  2QW7 A;  3T51 B;  4EVO A;  3HOX G;  3DLL A;  4DV7 L;  1N9W A;  1WCM G;  3NQT A;  5KYL A;  1B50 A;  1EY7 A;  3M7G A;  4DR3 Q;  4OWX B;  4O42 A;  3E3X A;  4ID6 A;  1Z9F A;  4K0K L;  4L8J A;  1FVI A;  2MO0 A;  1L1O B;  4ULL A;  2IHF A;  1PMR A;  1JCK B;  4IPC A;  4TKO B;  4QQB X;  3NP8 A;  3GTM B;  4JV5 Q;  3NEM A;  4ZCK A;  4AYB E;  3GV6 A;  2K1B A;  3X3M A;  4A3B B;  2NZH A;  4F87 A;  4TSS A;  2QCP X;  5IP7 G;  1X3G A;  3OWF A;  1BCP C;  2KCN A;  4JI4 Q;  1H95 A;  3VA5 A;  4CKC A;  2C35 B;  2EE1 A;  2Y0S E;  4IUT A;  4OX9 L;  4L6T B;  1BDO A;  1GHJ A;  1PRT D;  1SNM A;  2LKV A;  4DV1 Q;  1TWG B;  4CDD C;  2K32 A;  3BVG A;  1M8A A;  3HOZ G;  4UP9 A;  1YIJ A;  4BY1 B;  3HOX B;  1LAC A;  1EWC A;  5J22 A;  5IWA Q;  1RCV D;  5J1Z A;  4QUC A;  3VYR A;  3Q0A A;  3I4N B;  1K83 H;  2YV5 A;  5C3X A;  3FKI H;  4DFA A;  3PGZ A;  5I6W A;  5A2Q L;  2F0G A;  2JK8 A;  3GQB A;  2PO4 A;  1N36 L;  3NBH A;  3CCU A;  4POG A;  2A68 D;  1VQD A;  5AFW A;  1QUQ A;  3EA6 A;  4GLV B;  2MGS A;  4XXE A;  2ZXP A;  2L0C A;  1MSH A;  2NVQ H;  1KXL A;  1V8Q A;  2E5L Q;  2B63 G;  3U4Z A;  1HH2 P;  1EQT A;  1L0Y B;  4B3M L;  2BA0 A;  2LMC B;  3HKS A;  4A3C G;  1FGU A;  1FD7 D;  3SEB A;  4TQU S;  3GTO B;  3KLS X;  1YHA A;  3ONA B;  2AKW B;  3FKI G;  1NTG A;  1BO0 A;  1Q7Y C;  3STB C;  3HEJ A;  1I6H B;  1EFI D;  5EKK A;  3A8I E;  2K75 A;  2YTX A;  5CMD A;  4BY7 B;  5FO8 B;  1QIL A;  1U9R A;  4A3G B;  5DM7 3;  2WB1 G;  1FR3 A;  3CPF A;  4XT3 B;  3I2Z A;  5DM6 3;  4DUY L;  1QVG A;  1JJC B;  4PNY A;  4ZUJ A;  2CFM A;  4BY1 G;  4R4O A;  1K0S A;  4RGN A;  1W2B A;  2B8F A;  4A3D G;  1HZ9 A;  1KNE A;  1S3O A;  3SK8 A;  5K36 H;  2J0T D;  3GTP B;  3DEP A;  3SHL A;  1R9T H;  3I73 A;  4ZAI A;  5IT9 L;  3BZD B;  1HUN A;  3PUV A;  4BS9 A;  2AWO A;  3K80 C;  4XYQ A;  2QDB A;  2KHI A;  5J39 A;  4DV2 L;  4JI6 L;  4LF5 Q;  2E2H B;  2RSN A;  4X3U A;  1JR0 D;  2SNS A;  1HZC A;  3T1Y L;  1IXR A;  1PH4 A;  1M90 C;  3C1F A;  5F2D A;  1IBK L;  4J1M A;  4BBS B;  5E1F A;  1UUP A;  2OQK A;  5CYU A;  4LF8 L;  1JJG A;  3DWQ A;  3N52 A;  3TP5 A;  1CKM A;  4C3J G;  1OXV A;  1QZH A;  1K28 A;  3C46 A;  4C3H H;  3NE5 B;  5GAE C;  5ELC A;  3S1M B;  2Z6K C;  5KNB A;  3M9B A;  1KDB A;  4K14 A;  2XVS A;  1YVC A;  1O7L A;  1D5M C;  1KLU D;  3HKZ G;  3ER0 A;  3T1H Q;  1VMC A;  5FLX L;  3PO3 G;  2D62 A;  1HTL D;  5BR8 L;  1J6Q A;  2I5M X;  2EY2 A;  3R3O A;  1S5C D;  1PFM A;  3OMG A;  5DEH A;  2B8G A;  2ZM6 L;  1IBL L;  1DOK A;  4A93 B;  1HFG A;  3NBH B;  3EIV A;  3UE1 A;  1QVC A;  4K5W A;  5BN4 A;  1WI5 A;  3A74 A;  5I2X A;  2O4X A;  4OL7 A;  2MNA A;  2TMP A;  4K8I A;  1LTL A;  2NN6 G;  4WRD A;  1BNZ A;  2J4X A;  3PQI A;  5BN3 A;  4UP7 A;  2F4V Q;  3CQZ B;  5FLX c;  5GAH C;  3U50 C;  2Q2U A;  3S17 H;  4JI5 Q;  2A6E C;  3E9H A;  4XQQ A;  1A63 A;  1K8O A;  1KHI A;  1S5B D;  4C3I G;  1S5F D;  1FNW A;  2HQE A;  4F7X A;  5C6A A;  2HDM A;  4ILW A;  1HZA A;  4X65 L;  1S5E D;  1VQ8 A;  1H9M A;  1K8G A;  1EUJ A;  1Q1B A;  3KDF B;  2R7Z G;  3KF6 A;  1IL8 A;  4KHZ A;  2BH8 A;  4LF4 L;  4F8M A;  1CHP D;  3KOJ A;  3QIA A;  4BY7 G;  3I4M B;  1Z6H A;  4GN4 B;  1EQV A;  2Z6K A;  3HGB A;  4GOP A;  2EJG C;  2IHE A;  4KHP Q;  4LFB Q;  3T4A C;  2BOS A;  4O2D A;  1Q46 A;  1EEF D;  4JI1 L;  1DM0 B;  1L1O A;  3H3V H;  4OIJ A;  3JAM c;  2B2Y A;  3MZ5 A;  5C3E H;  2H4O A;  2E8G A;  4DR5 L;  3G6E A;  4DA2 A;  3GTL H;  2X6G A;  2E2I B;  4BWG B;  3S15 H;  1R4Q B;  2VQF Q;  3VYU A;  2L55 A;  2WV6 D;  2JA5 B;  3H15 A;  1SE8 A;  3OYY A;  5FJ8 H;  3MXN B;  2YTV A;  3J7Y W;  1MGS A;  3SR1 A;  3MXG A;  1MD2 D;  2B2Y C;  4A3M H;  5ELD A;  2WP8 J;  1WTO A;  1MIU A;  1CQF A;  3D4W A;  2UXB L;  2K50 A;  4WJW A;  1AP0 A;  2NVX B;  2K14 A;  4APV A;  2NVY H;  3H3V I;  4OON A;  1PRT F;  1Q8I A;  2Q8I B;  3D31 A;  1LUZ A;  1W3S A;  2NVY B;  4X62 L;  3L3O C;  4RHR A;  1F9Q A;  1U4R A;  1F9S A;  1CK1 A;  2ID0 A;  2KED A;  3A56 A;  3D3R A;  3VR6 A;  4QIW E;  1B53 A;  3MTS A;  1IHZ A;  2RVL A;  3VDY A;  5JVG 3;  4A3L H;  3DM3 A;  4NXM Q;  3VR4 A;  1I94 Q;  3I4L A;  4KY6 A;  2ASB A;  3S15 B;  2XTI A;  4C1N I;  1KAW A;  4M1U B;  2L15 A;  2Y0S G;  4ZLT F;  2E2I H;  1ET6 A;  2IWH A;  4DV3 Q;  3MVV A;  2B63 H;  3MFG A;  4CDE C;  4A3K G;  5DNF A;  1Q82 C;  5GAD C;  5C3E B;  4QF4 A;  1PDQ A;  5K5P A;  3I55 A;  1C4Q A;  2PMZ B;  4IUU A;  1Y1V B;  2FXQ A;  1XNR L;  4Q0F A;  1SRU A;  5HGQ A;  2NN6 H;  1UWV A;  5D14 A;  4JOI C;  2N78 A;  1XMO Q;  3S16 H;  3NQI A;  1HUM A;  3T56 B;  2F0D A;  3D6C A;  3H94 A;  4LFC Q;  3CCR A;  2JA8 G;  1CKO A;  1F2M A;  4L5R C;  1VQM A;  3S1N B;  1I94 L;  1B3A A;  1L0W A;  4ME5 A;  3J81 j;  4DR6 Q;  4DNI A;  2AHO B;  4A75 A;  3L9A X;  1TY2 A;  3CQZ H;  3D0F A;  4FXD A;  2XSC A;  5LMN Q;  3C1E A;  2WAQ B;  3OSO A;  5M3F B;  3HOZ H;  4GNX C;  1IBL Q;  5JJL A;  4CJ1 B;  2L4N A;  4KMU C;  4DV1 L;  2K5D A;  1A3T A;  1AH9 A;  1ENC A;  5HY6 A;  1FYC A;  1WTQ A;  4FO2 A;  4JBJ A;  3I4O A;  1MSG A;  2KOL A;  2UUC Q;  4I7Z C;  1JJ2 A;  3PV0 A;  4DF7 A;  1PRT B;  5BR8 Q;  2R92 B;  3I4M G;  2NZO A;  1BQQ T;  1DJR D;  4QJF A;  5C4J H;  1VQ4 A;  3OPO A;  1JOQ A;  4JI3 L;  4B3S L;  2EYH A;  3S2D B;  4PV1 C;  1GHK A;  1W6K A;  3M4Y A;  1D2B A;  4G57 A;  1XTC D;  1KAA A;  2E75 C;  2WKD A;  3UE0 A;  3PIO 3;  5IGC A;  4IFD I;  1LTS D;  3DUZ A;  5EPL A;  2EJF C;  4DR6 L;  1R4P B;  5ELE A;  2EVB A;  4R4C A;  5D3I B;  2K7V A;  1TXY A;  5IP7 H;  3ND8 A;  5GAG C;  3M4Q A;  2O5I C;  3CPW A;  1L2F A;  3J81 L;  5CGK A;  1UEB A;  2RDF A;  2H5X A;  2VUM H;  4AIM A;  1STG A;  4GLA C;  4XQN A;  5EKI A;  1WOC A;  4C56 C;  2F3I A;  1WJJ A;  1PV4 A;  1SNQ A;  2VB2 X;  3AU7 A;  3NEL A;  3HOY G;  1X65 A;  1HRJ A;  5EPK A;  3WWV A;  1DOL A;  1A2U A;  3FP9 A;  1V1Q A;  2EY5 A;  2EY6 A;  2XRQ D;  2JA7 B;  2EYJ A;  1K9M C;  1TWH H;  4MIU A;  4BBS H;  3H91 A;  2D2C C;  3BDO A;  3EJI A;  3VA7 A;  3J80 L;  4A3E G;  3K58 A;  4FXG C;  2A6H C;  2KUM A;  5C4X H;  3CCL A;  3PIP A;  2JA8 H;  4KI0 A;  3J81 c;  2JP1 A;  1GO3 E;  1Q90 A;  2UUA Q;  1EY5 A;  2G9D A;  3WDN A;  1Y1W B;  5E4W C;  4A3F H;  1BVS A;  2A73 B;  2ES2 A;  1H9J A;  3D4D A;  4V19 0;  4OHJ A;  4JI7 L;  1L0X B;  1EL0 A;  4A3L G;  1UEA B;  5FO9 B;  1M4V A;  2YTY A;  5TSS A;  1TKW B;  4YCV A;  1NNX A;  3QOL A;  4HCE A;  1X32 A;  3GDE A;  1PTO C;  5M9O A;  1GOZ A;  3EFX D;  4AYB B;  1KLG D;  4AH6 A;  2NTS A;  2V4D A;  4RAU C;  3TRE A;  4B9X A;  4QB4 A;  3OWE B;  2AUK A;  4A3K H;  4EX5 A;  2F0H A;  3ZJY C;  1AN8 A;  3S1Q B;  2RHQ B;  2BH2 A;  4X3S A;  2FHT A;  4A3I G;  4GS3 A;  1K83 B;  3P7J A;  5IOD A;  4GNX B;  3KF8 B;  3PIP 3;  5JAV A;  5ELO A;  1RL2 A;  4LFA Q;  1EU4 A;  1CZW A;  4JBM A;  2E2J B;  1TS5 A;  1TWG H;  4KLK A;  4RMF A;  1X54 A;  1XMO L;  2YU9 B;  4YWL A;  3BZC A;  5IGE A;  4BA2 I;  5IYC G;  3FRP B;  3FVQ A;  2LFN A;  4IPD A;  2HHH L;  1K3R A;  5C4H A;  4B3M Q;  4KKU A;  1QJO A;  3ERQ A;  3KUP A;  4B3S Q;  4JI3 Q;  3NWS A;  3W2D A;  1U5K A;  1CUK A;  1EYA A;  2EPB A;  2K5N A;  1CA6 A;  2QKI C;  2D0P A;  2IL8 A;  4JYA L;  3BDC A;  1VQL A;  4LFC L;  4HAE A;  2MO1 A;  4JG2 A;  2A6H D;  4MTN A;  3OMC A;  4OGQ C;  3OTO L;  5ELB A;  1HNX Q;  1Z47 A;  1IW7 C;  1X3E A;  2CQO A;  1VS0 A;  1YHB A;  1JIC A;  4A3J B;  4M8A A;  5C0X J;  1CKN B;  1B8A A;  1HTP A;  4DV6 L;  5FOB B;  3G48 A;  1T5X D;  3ULP A;  3HG9 A;  1Y1W H;  4BXX G;  5D65 A;  5KNC A;  1BR9 A;  2VQE Q;  1V9P A;  1ENF A;  2IJ0 A;  3K7A H;  5KRU A;  2JA8 B;  4DAP A;  2DN8 A;  2L1B A;  1RHP A;  5EPJ A;  4HJ7 A;  3UDG A;  4JK1 C;  1LTI D;  1EIG A;  1LYL A;  5M5W H;  3CAM A;  1SR3 A;  2UUA L;  2BDN A;  3RN2 A;  1D1K A;  3S9W A;  1YJ9 A;  5C0X H;  1BBX C;  3TZU A;  3DWA A;  4HJA A;  1J5E L;  1GJX A;  2G5D A;  3ERS X;  2KCC A;  2JA7 H;  2RDH A;  1TU2 B;  4A3E H;  4NDX A;  1LT3 D;  3LGJ A;  2PMZ E;  1YI2 A;  4DR7 L;  1VQE A;  2UXD Q;  1JE4 A;  5IP9 G;  1PZK D;  2Y0S B;  1ASZ A;  5FLX E;  1I3Q H;  1HHV A;  3QOJ A;  1ESF A;  3URY A;  1O7I A;  3GTG B;  3GTQ B;  5IIF A;  4Q5V A;  4R4Q A;  4DXG A;  5JVH 3;  4DR7 Q;  1O7Z A;  4UHV A;  3R8B A;  1UE7 A;  1C0A A;  2ALY B;  3SK6 A;  1RD9 D;  2IW3 A;  1SYG A;  2SDF A;  3JAM i;  4DUY Q;  2A8V A;  4DV4 L;  3IFD A;  2EYL A;  2PNR C;  1MHW C;  1QCB D;  2J7Z A;  3VYS A;  3HZX A;  1HNZ L;  3MA2 B;  2R7Z B;  2NTT A;  1B7Y B;  2O5J C;  2MPM A;  2F4V L;  4DKA C;  3S24 A;  4BBR H;  4DAY A;  4BA1 I;  4CHT B;  5CC4 A;  4DV0 L;  2OWO A;  2R92 H;  1S40 A;  1WTH A;  3N6R A;  4DV5 L;  1VQO A;  3Q24 A;  1TS4 A;  1LTR D;  2F3V A;  3HOU G;  3CCJ A;  1V1O A;  1E0B A;  4A3I H;  3KF8 A;  2CKZ B;  3PUY A;  1I5F A;  2F0N A;  3LX0 A;  3KF6 B;  1A3U A;  1JOK A;  2QEJ C;  1E1T A;  5KEE A;  1I4G A;  3KFU A;  4DAY B;  1KAB A;  4C1N K;  1N33 L;  4B3T Q;  3HOZ B;  5M3F H;  2UXC Q;  2R7D A;  3K8A A;  1L1O C;  3G7L A;  3M4O H;  1OTC A;  4G7H C;  1Y69 U;  4R4T A;  1DCZ A;  2OEO A;  1PVO A;  3SK5 A;  4YCW A;  2UXC L;  3ITP A;  4H13 C;  5DAU A;  1G6P A;  3DXJ C;  3S1N H;  3K6O A;  2Z8L A;  2CVR A;  1IBM Q;  1WTV A;  3H0G B;  1GUS A;  1H9R A;  3NTI A;  2QDL A;  2EYP A;  2IX0 A;  1GD7 A;  5M5Y H;  4DK0 A;  4DV0 Q;  4FF1 A;  1EIF A;  4XTC S;  1TS2 A;  3B6Y A;  4JI4 L;  4E6I A;  1Y1V H;  2DNC A;  2XNA C;  1MJE A;  4CJ2 C;  1IYV A;  2UUC L;  4YCU A;  4IUR A;  3TME A;  2F0T A;  1CFM A;  4R1J A;  1WVL A;  1V43 A;  4KN7 C;  3L0O A;  4A3C H;  5C5M A;  3J81 i;  1EZ8 A;  1EY9 A;  2B2U A;  2XWJ B;  1LAB A;  2GN5 A;  1CT1 D;  5AJ3 Q;  1A15 A;  2KA7 A;  5FKA C;  2UU9 L;  1NR4 A;  4HJ8 A;  3FDT A;  2WKC A;  3A5Z B;  1SBB B;  4NMZ A;  1YZ6 A;  1K8M A;  5EBD A;  5C4X G;  1EY0 A;  4JI2 Q;  3CRL C;  1LV9 A;  1QWY A;  1I4R A;  4IOA A;  1RKN A;  1OXT A;  3M7N A;  4KD3 A;  4IFD H;  1STA A;  2NWG A;  2K5Q A;  4B3R Q;  2JA6 H;  1CHQ D;  2F0L A;  3SXH A;  4GKK L;  2K28 A;  4RCN A;  2M00 A;  4X62 Q;  2ATW A;  4JBK A;  4JI6 Q;  1Y8N B;  1F2Y A;  4DAM A;  1IKL A;  1A8V A;  1KQS A;  1ET9 A;  4G4K A;  1TWA H;  3FPP A;  1HQM C;  2CQA A;  3UI2 A;  1P8L A;  3OHX C;  3PCO B;  5IYB H;  4JI0 L;  3NPP A;  2D5D A;  3NK9 A;  4KN4 C;  3E0J A;  3X3N A;  2UXB Q;  2QIL A;  3UDX A;  1KDA A;  3GTL B;  1JB3 A;  1LM0 A;  1O7Y A;  2A6E D;  2A74 C;  2P5Z X;  4PMB A;  4RGT A;  3F2B A;  1PH9 A;  1TVX A;  2E2D C;  4NW2 A;  1WD1 A;  2B2V C;  4ABN A;  1EWH A;  3AB9 A;  3IKJ A;  4N8F A;  4EGV A;  2XN9 C;  1ESR A;  4K2K A;  1EY8 A;  5C44 H;  2ZJP A;  1ILQ A;  3V2T A;  1VQI A;  5CV6 A;  3ERO A;  1PYW D;  3I4M H;  3PUX A;  4HCS A;  2PZW A;  5JEA J;  1TII D;  4HJ5 A;  4UY8 C;  4LWC A;  3A54 A;  4FVM A;  4YWM A;  1XWE A;  3SDZ A;  2DGY A;  3HOU B;  3S14 H;  4OEM B;  2XWB B;  1YJN A;  1TWC H;  2Q8T A;  5C4Z A;  1E7Z A;  2NYZ D;  1DYQ A;  2F0P A;  3Q8D A;  4KHP L;  3W3A A;  4ZKB B;  2JA6 B;  4DV2 Q;  1UE1 A;  4QL5 A;  4JV5 L;  2QF7 A;  4KJO A;  4IOC A;  3S17 B;  4X65 Q;  1B44 D;  2KCT A;  4AQY Q;  5IYD G;  5KYI A;  4DNT B;  4DK6 C;  3CMA A;  1OXS C;  4OIK A;  1SFO B;  4LF9 Q;  4XQJ A;  4FNF A;  1G8Z D;  4H44 C;  2NZ1 D;  2YYZ A;  1XMQ Q;  5IYB G;  4WJ4 A;  4X6A H;  1II3 A;  2JA5 G;  4IJL A;  1LTB D;  1VQG A;  4S3S A;  3TP8 A;  4LFA L;  1SMY D;  3QB3 A;  1DZ1 A;  1BBW A;  2VW9 A;  4IPG A;  2ZTD A;  4DK1 A;  3RZD H;  1I4P A;  2VXW A;  1PFS A;  3E9I A;  4GZY C;  5ELF A;  2LXJ A;  2R3Z A;  1XPU A;  4Z9C B;  2RCN A;  3KLW A;  3OW7 A;  1BF4 A;  4YWK A;  1J8I A;  2F1M A;  5M5Y B;  2X6L A;  4LW1 A;  3G4S A;  2B2W C;  1KD1 C;  3I7F A;  3U58 A;  2NVT B;  3H0G H;  3J7A V;  1KTK A;  2JE6 I;  4CJ0 B;  4JI5 L;  1TWF B;  1X55 A;  1F2L A;  2OXP A;  3A7A B;  4U67 3;  2R93 G;  4P2C B;  2A5H A;  4RWS C;  4FYD A;  5IP9 H;  2JEA I;  1JOR A;  3I3C A;  1B70 B;  5JPM C;  3DM1 A;  2VNU D;  1SN8 A;  1E2W A;  1C48 A;  2MHV A;  1SYF A;  2NVT H;  1RJT A;  1JQY D;  1Z7T A;  2DNE A;  2DJG C;  1JT8 A;  1VQK A;  2PPB C;  2I5H A;  1JWS D;  4QY7 A;  5I4D A;  5FO7 B;  4FXK C;  5H1S E;  1QVF A;  2DY7 A;  4C3J H;  1LTA D;  3QG1 A;  4RFB A;  3R2I A;  1PH2 A;  4LF8 Q;  1G29 1;  4HIK A;  1NBW A;  2E76 C;  1M1K C;  1J5E Q;  3NUC A;  3RNU A;  3GTP H;  2C9O A;  5NUC A;  1ZKO A;  1IKM A;  1EOT A;  4LF7 Q;  1U4M A;  4Y7N H;  1WTR A;  4CGY B;  4A3G H;  1SFO H;  4K2L A;  3A8K E;  1STY A;  2L9H A;  1A3V A;  4ME3 A;  1WYD A;  3GTG H;  1ML0 D;  4JBW A;  3S2H B;  4DR2 Q;  1ONL A;  2VL6 A;  3TEH B;  3CCV A;  1EYC A;  5I9P A;  3K81 C;  4NXM L;  4PG3 A;  5EQ0 A;  1PH8 A;  4IPH A;  3GD7 A;  1IYU A;  3AQQ A;  3PMF A;  4RKL A;  1B4O A;  4PZ7 A;  4WJ3 M;  1PH1 A;  2B2V A;  3HOU H;  3S14 B;  5IGB A;  1KDC A;  4LF5 L;  5E4X A;  2OF1 A;  1CZG A;  1EYD A;  4RGO S;  1GVP A;  4BBR G;  4DNR B;  4GKJ L;  3CCM A;  1SE4 A;  3F2U A;  4RCO A;  2KVM A;  3O13 A;  1U4P A;  2ICE C;  2F0K A;  3H3V C;  2AWN A;  2L11 A;  5C44 B;  2JA9 A;  5M5W B;  5CBE E;  2LSS A;  2IY5 B;  1HQR D;  1YNN D;  5COR A;  1JOO A;  3RLN A;  4BY1 H;  2F0O A;  3TS0 A;  1ZYR C;  3K7A B;  4XDX A;  3BDL A;  2F0Q A;  4CKE A;  2AQ3 B;  1VDZ A;  4X3K A;  4IUQ A;  1FL0 A;  1SYB A;  5LMU Q;  3G71 A;  3KDF A;  1QUQ B;  2MQH A;  1YIT A;  2UU9 Q;  4MTK A;  3RR5 A;  3FMC A;  1SMX A;  5IGG A;  4DR1 L;  4OO1 I;  2G9H D;  1CKN A;  3VR3 A;  3PO3 H;  3SGI A;  1PTO H;  2WAQ G;  2TSS A;  1LT4 D;  3CF5 A;  4K5X A;  5KGU A;  3DWP A;  1VQC A;  2PCF B;  2D0O A;  4LFB L;  3HOV G;  1N36 Q;  3GTM H;  4OX9 Q;  5I6Y A;  1ICW A;  2F0E A;  5J3B A;  2V1C C;  3K5M A;  3AEV A;  1C8C A;  2Z4H A;  1GUG A;  1TR5 A;  4RHS A;  1T5E A;  1OO9 B;  1EQQ A;  4I65 A;  1Y1W G;  2LS0 1;  5IWA L;  1VQ5 A;  4K5V A;  2N55 A;  5CV9 A;  3AYH B;  4HIM A;  2HD3 A;  2BCO A;  2F0W A;  2FFK B;  4IZ8 A;  4ZQ3 A;  1G2T A;  1B1Z A;  2VQE L;  2HIX A;  5IT9 c;  4CKB A;  2GA4 B;  1SAP A;  3F2C A;  4LJZ C;  4KK7 A;  1PRT C;  3DHQ A;  3CKI B;  4N9P A;  1SYC A;  2JXM B;  5M3M G;  3HKZ B;  2IX1 A;  3C2P A;  2F03 A;  4BXX H;  3ICE A;  4A4I A;  2JYO A;  1CI3 M;  2BE5 D;  1BCP D;  1MI2 A;  3CP0 A;  1VQ6 A;  4JI1 Q;  4JCV E;  1IL2 A;  2B2T A;  4DN4 M;  5IY0 A;  1STH A;  1W6J A;  2HT1 A;  4K6D A;  3K5O A;  1OXU A;  4LUZ A;  4XYO A;  2EXD A;  1WD0 A;  2E2J H;  1PA6 A;  2CHB D;  3HOY B;  2AQ2 B;  1GUT A;  4J6H A;  4CBV A;  1N34 L;  3FEW X;  3BVM A;  2PQA A;  1H9S B;  3JAM E;  4R8I A;  3IFT A;  1S5D D;  2WFW A;  1CM9 A;  2PQA B;  3J7Z C;  1G2S A;  3NHH A;  1LT6 D;  3EBE A;  1VQJ A;  1PTO F;  4KKS A;  2FMC A;  3JAM L;  4A3J G;  5BN5 A;  2VUM G;  3RZO B;  1I4X A;  3MAQ A;  2PQE A;  2PNH A;  3GTJ B;  1WCM H;  1X3Q A;  2F3W A;  2KEN A;  4HMI A;  1PYS B;  2R93 B;  2B29 A;  2H1E A;  1XPO A;  4AQY L;  3HOW H;  1UNS A;  2KBN A;  2RQX A;  4IFD G;  2KEC A;  3IL8 A;  3M3Y H;  3CHB D;  1ZXT A;  3VYT A;  4U68 A;  1IYJ B;  3E6Z X;  4X3T A;  5C44 G;  4C2M B;  1K3B C;  4V0B A;  3M4P A;  4MHE A;  4POF A;  4YHH Q;  3RMH A;  4X64 Q;  1FJG Q;  1H9S A;  3MEH A;  3A55 A;  5LMU L;  2FIN B;  1EQR A;  3TDQ A;  1STE A;  1T9H A;  1K0R A;  4JPB W;  3AFQ A;  4PMC A;  3C3L A;  1EIH A;  4P74 A;  5FLM G;  2A1A A;  1HR0 L;  3BU2 A;  2C5C A;  3F2D A; 
#chains in the Genus database with same CATH homology
 1RF2 D;  1STB A;  4IN3 A;  4G7Z C;  2PZU A;  2PW7 A;  2KEE A;  2DY8 A;  5HGT A;  3EVQ A;  5A2Q E;  4ZYS A;  1V1P A;  2WAC A;  1WTX A;  2B2W A;  4NKL A;  5CBA E;  3I91 A;  1NAP A;  4IUV A;  1F9R A;  1OXX K;  3MWY W;  2ZT9 C;  1SYE A;  2PYK A;  3NBI A;  5C0X I;  4IQZ A;  2VUM B;  4A3E B;  3TBI B;  1QE6 A;  1GUO A;  3J80 E;  2O2L D;  1DOM A;  1RTN A;  2SOB A;  4KY7 A;  2OT2 A;  3PO2 B;  4TRD A;  1QOH A;  1Y8O B;  3OIQ A;  1SNP A;  1QB5 D;  2NB0 A;  1SJE D;  1BCP F;  1BOS A;  3RUZ A;  4KD4 A;  3BS1 A;  2EJM A;  3DMU A;  1CTM A;  4KHV A;  3DEO A;  2F4I A;  3I90 A;  2SEB D;  2F0S A;  2NUC A;  5COY A;  4HTH A;  3M3Y B;  1E2Z A;  3ZYY X;  3SE0 A;  3HOW B;  1SDF A;  3I72 A;  1QNK A;  4B08 A;  1SSO A;  2WIN B;  1NR2 A;  2IX3 A;  1ZEQ X;  4KV6 A;  3S16 B;  1Q1E A;  3SVM A;  4OO1 H;  3HOV B;  2EDG A;  4RA8 A;  3TSS A;  1JC7 A;  4K8J A;  5T1I A;  4F88 A;  2K6A A;  5CV8 A;  1GUN A;  2B39 A;  1AZQ A;  3U9O A;  1X3P A;  2EZV A;  1S4Z A;  1FNU A;  2WB1 B;  1SYD A;  2SNM A;  3QWN A;  1PZJ D;  2MP1 A;  1SEB D;  1XXG A;  4EQO A;  2PZT A;  1LTG D;  3FPU B;  2A69 D;  3TZD A;  4A3K B;  5I2Y A;  1ZYR D;  2NN6 I;  5LL6 S;  1F2Z A;  5CV7 A;  3NTK A;  3MFY A;  5T1G A;  3NSW A;  2K05 A;  1TT2 A;  1NSN S;  1XYI A;  3OOC A;  1G91 A;  1PTO B;  1E2V A;  4K6L A;  3K59 A;  1B2T A;  1A6X A;  3PO3 B;  3SK4 A;  1Y8P B;  3KLR A;  2I46 A;  1DXM A;  3QJY A;  4A3F B;  2NBF A;  3VR2 A;  2AQ1 B;  1HCZ A;  4DXF A;  4EQN A;  1AEX A;  5EGT A;  1YNJ D;  2M9V A;  5C4X B;  1VMP A;  3P1H A;  1HXY D;  4FF4 A;  2Q8R E;  2R6G A;  1JWM D;  4HSV A;  2EY1 A;  4XIG S;  4IAL A;  1TWH B;  5JJZ A;  2K5W A;  1AW7 A;  1D5Z C;  1A2T A;  5IGD A;  4RKB A;  3CRK C;  1EEI D;  3K5N A;  5CV4 A;  3T13 A;  3AMU A;  1WTP A;  3K57 A;  4ODG A;  3BYY B;  5M5X B;  2KHS A;  2CW0 D;  4Y7N B;  2L12 A;  3BYT B;  1BCP B;  1LO5 D;  2XIW A;  2F0M A;  1JWU D;  5C4J B;  5FK9 C;  3HS0 C;  3RLF A;  1SXT A;  4FP5 D;  5EBC A;  1LT5 D;  4C3J B;  4ZRZ A;  1ROD A;  4LK1 C;  2Z1C A;  3R2T A;  5HUR A;  2F0V A;  4ZKC B;  2A68 C;  2JEB I;  3QO2 A;  1ILP A;  5C5L A;  5EKL A;  1YNJ C;  1EU3 A;  1SMY C;  4ZUI A;  4N9T A;  5CV5 A;  1QNU A;  1VCI A;  2E74 C;  3LNN A;  1SND A;  2VB3 X;  3NTH A;  1PFN A;  1PZI D;  2Z4I A;  1V1P B;  2WII B;  2HCI A;  4A3D B;  1RTO A;  1PXU A;  2PW5 A;  2ICI A;  2B2U C;  1B9N A;  4LAA A;  4QIW B;  3EQL C;  2BE5 C;  3NWT A;  3OIP A;  4G7O C;  3R93 A;  2CW0 C;  2FMM A;  2K33 A;  3H6M A;  4R9W A;  1PLF A;  2BDO A;  5IGF A;  3RZD B;  1KNA A;  2HUG A;  2K04 A;  2EYO A;  1SE3 A;  2B63 B;  1HPC A;  5E3F A;  3TP6 A;  1D1I A;  3V05 A;  3L7Z C;  3D4R A;  1D6E C;  4HMJ A;  1O78 A;  4IUN A;  1HFN A;  2N88 A;  1SNO A;  4HED A;  1QG7 A;  1B9M A;  3BG3 A;  3D8G A;  2ZXO A;  4QCL A;  3I8Z A;  5LL6 X;  4KY5 A;  3BVZ A;  5IT9 E;  1VF7 A;  4FF3 A;  2JSO A;  4H7B A;  4C3I B;  1H9K A;  1WTW A;  1DD2 A;  2NVQ B;  1TWC B;  5G3L D;  2F0I A;  4J8Q A;  1F77 A;  4A3M B;  4MN3 A;  1O80 A;  2FJ2 A;  1J9O A;  3WOE A;  3KBG A;  3Q6S A;  1HA6 A;  1TS3 A;  4QMG A;  3Q22 A;  2K01 A;  4PMW A;  2RDG A;  4DGZ A;  1IW7 D;  2HCC A;  2F0F A;  1NUC A;  2AUJ D;  4KJN A;  2K03 A;  4UAI A;  5JPN C;  2IPK D;  3MXP A;  4HR7 B;  3WOF A;  1TWA B;  2RBM A;  2RA4 A;  3P20 A;  2EOT A;  1UAP A;  1GXD C;  1ENA A;  1HA5 A;  1SJH D;  5I9O A;  3GV3 A;  1AZP A;  3K0Y A;  1STN A;  2L5T A;  1MBY A;  3HP3 A;  4HN7 A;  2EYF A;  1TY0 A;  1G6Z A;  4DAV A;  5G3L F;  1I4Q A;  4OO1 G;  5C0X G;  3HRZ C;  3ND9 A;  3U9S A;  5KIX A;  4R8N A;  3M85 A;  1PFB A;  5IOC A;  2IT1 A;  2I07 B;  2RKS A;  3J81 E;  3I70 A;  3IAY A;  5JOB A;  1I50 B;  3CU7 A;  2MUY A;  4IFD J;  1SNC A;  5ISR A;  1LTT D;  4PQX A;  3TN2 A;  4LMQ D;  4ZK9 B;  2RSO A;  3KLS A;  2XRS D;  4YIJ A;  5EJW A;  3GTK B;  4EQP A;  2EYM A;  3K5L A;  3GO5 A;  2BA1 A;  4RH6 A;  1DON A;  3NXW A;  1I6V C;  1EY6 A;  3MXN A;  2HDL A;  3KBX A;  4QUF A;  1YNN C;  4O1N A;  4C3H B;  1FGB D;  3V96 A;  3M4O B;  1F9P A;  1VF5 C;  5LHY 1;  3MXU A;  1LLR D;  5JEA H;  1XX8 A;  5M3M B;  1AFP A;  3S1R B;  1FNV A;  4A3I B;  3Q23 A;  3LWE A;  2B2T C;  2F0U A;  3RD4 A;  1PTO D;  3GP7 A;  4BBR B;  3H09 A;  1SE2 A;  4HSP A;  1EY4 A;  2X69 A;  1R9T B;  2EXZ A;  2M2L A;  1I4H A;  3A8J E;  1GUW A;  1TQO A;  4L63 B;  3T53 B;  3PUW A;  4UDU C;  5KND A;  2KQ3 A;  2ENB A;  2F0J A;  1D5X C;  2R61 A;  3E5S A;  1I3Q B;  1Q3L A;  1EZ6 A;  4NP5 A;  4DU9 A;  1WCM B;  3A7L A;  1BXT A;  4FF2 A;  3LWU A;  3MHB A;  4XT1 B;  4WFN 3;  3VR5 A;  3D6W A;  5JEA G;  5C3W A;  1Q12 A;  4RGM A;  3FKI B;  5D3D A;  3T16 A;  1U4L A;  4C3H G;  2KJX A;  4H0L C;  2A69 C;  4IUP A;  5K36 G;  4B9W A;  1NCV A;  5CR3 A;  3G6J B;  3PUZ A;  3MC0 B;  1CQV A;  3KK7 A;  4KTA A;  4WOR A;  2MJ8 A;  2LY7 A;  5A35 A;  3TP7 A;  3J7A F;  2D9U A;  1RDP D;  1CA5 A;  3P75 A;  2ZXR A;  1BUV T;  4KKT A;  3T51 B;  4EVO A;  3NQT A;  5KYL A;  1B50 A;  1EY7 A;  3M7G A;  4O42 A;  4ID6 A;  4L8J A;  4ULL A;  1PMR A;  1JCK B;  4TKO B;  3NP8 A;  3GTM B;  3GV6 A;  2K1B A;  3X3M A;  4A3B B;  4F87 A;  4TSS A;  2QCP X;  3OWF A;  1BCP C;  2KCN A;  3VA5 A;  4CKC A;  2EE1 A;  4IUT A;  4L6T B;  1BDO A;  1GHJ A;  1PRT D;  1SNM A;  2LKV A;  1TWG B;  2K32 A;  3BVG A;  1M8A A;  4BY1 B;  3HOX B;  1LAC A;  1EWC A;  5J22 A;  1RCV D;  5J1Z A;  4QUC A;  3VYR A;  3Q0A A;  3I4N B;  5C3X A;  4DFA A;  5I6W A;  5A2Q L;  2F0G A;  3GQB A;  2PO4 A;  3NBH A;  2A68 D;  5AFW A;  3EA6 A;  2MGS A;  4XXE A;  2ZXP A;  2L0C A;  1MSH A;  1V8Q A;  1L0Y B;  1EQT A;  2BA0 A;  2LMC B;  1FD7 D;  3SEB A;  4TQU S;  3GTO B;  3KLS X;  3ONA B;  1BO0 A;  3HEJ A;  1I6H B;  1EFI D;  5EKK A;  3A8I E;  5CMD A;  4BY7 B;  5FO8 B;  1QIL A;  1U9R A;  4A3G B;  5DM7 3;  1FR3 A;  4XT3 B;  5DM6 3;  4PNY A;  4ZUJ A;  4RGN A;  2B8F A;  1KNE A;  3SK8 A;  5K36 H;  2J0T D;  3GTP B;  3DEP A;  3SHL A;  3I73 A;  4ZAI A;  5IT9 L;  3BZD B;  1HUN A;  3PUV A;  4BS9 A;  2AWO A;  4XYQ A;  2QDB A;  5J39 A;  2E2H B;  2RSN A;  4X3U A;  1JR0 D;  2SNS A;  3C1F A;  5F2D A;  4BBS B;  4J1M A;  5E1F A;  1UUP A;  5CYU A;  3DWQ A;  3N52 A;  3TP5 A;  4C3J G;  1OXV A;  3C46 A;  3NE5 B;  5ELC A;  3S1M B;  5KNB A;  1KDB A;  4K14 A;  2XVS A;  1O7L A;  1D5M C;  1KLU D;  1VMC A;  5FLX L;  2D62 A;  1HTL D;  2EY2 A;  3R3O A;  1S5C D;  1PFM A;  3OMG A;  5DEH A;  2B8G A;  1DOK A;  4A93 B;  1HFG A;  4K5W A;  5BN4 A;  5I2X A;  2O4X A;  4OL7 A;  2TMP A;  4K8I A;  2NN6 G;  4WRD A;  1BNZ A;  2J4X A;  5BN3 A;  3CQZ B;  2A6E C;  4XQQ A;  1K8O A;  1S5B D;  4C3I G;  1S5F D;  1FNW A;  2HQE A;  4F7X A;  5C6A A;  2HDM A;  4ILW A;  1S5E D;  1H9M A;  1Q1B A;  1IL8 A;  4KHZ A;  4F8M A;  1CHP D;  3QIA A;  3I4M B;  1Z6H A;  1EQV A;  3HGB A;  2EJG C;  3T4A C;  2BOS A;  1EEF D;  1DM0 B;  4OIJ A;  2B2Y A;  3MZ5 A;  2H4O A;  4DA2 A;  2X6G A;  2E2I B;  4BWG B;  1R4Q B;  3VYU A;  2L55 A;  2WV6 D;  2JA5 B;  3J7Y W;  1MGS A;  3SR1 A;  3MXG A;  1MD2 D;  2B2Y C;  5ELD A;  2WP8 J;  1WTO A;  1CQF A;  3D4W A;  4WJW A;  1AP0 A;  2NVX B;  1PRT F;  1Q8I A;  2Q8I B;  3D31 A;  2NVY B;  3L3O C;  4RHR A;  1F9Q A;  1U4R A;  1F9S A;  1CK1 A;  2ID0 A;  2KED A;  3A56 A;  3D3R A;  3VR6 A;  1B53 A;  3MTS A;  1IHZ A;  2RVL A;  5JVG 3;  3VR4 A;  3I4L A;  4KY6 A;  3S15 B;  4C1N I;  4ZLT F;  4M1U B;  1ET6 A;  2IWH A;  3MVV A;  3MFG A;  5DNF A;  5C3E B;  4QF4 A;  1PDQ A;  5K5P A;  1C4Q A;  2PMZ B;  4IUU A;  1Y1V B;  4Q0F A;  2NN6 H;  5D14 A;  3NQI A;  1HUM A;  3T56 B;  2F0D A;  3D6C A;  3H94 A;  1F2M A;  3S1N B;  1B3A A;  4ME5 A;  3L9A X;  1TY2 A;  4FXD A;  2XSC A;  3C1E A;  2WAQ B;  3OSO A;  5M3F B;  4CJ1 B;  2L4N A;  4KMU C;  2K5D A;  1A3T A;  1ENC A;  1FYC A;  1WTQ A;  4FO2 A;  1MSG A;  2KOL A;  4I7Z C;  3PV0 A;  4DF7 A;  1PRT B;  2R92 B;  1BQQ T;  1DJR D;  3OPO A;  1JOQ A;  2EYH A;  3S2D B;  4PV1 C;  1GHK A;  1W6K A;  3M4Y A;  1D2B A;  4G57 A;  1XTC D;  1KAA A;  2E75 C;  2WKD A;  3PIO 3;  5IGC A;  4IFD I;  1LTS D;  3DUZ A;  5EPL A;  2EJF C;  1R4P B;  5ELE A;  2EVB A;  5D3I B;  2K7V A;  3ND8 A;  2O5I C;  3J81 L;  5CGK A;  2RDF A;  1STG A;  4XQN A;  5EKI A;  4C56 C;  1SNQ A;  2VB2 X;  3AU7 A;  1HRJ A;  5EPK A;  1DOL A;  1A2U A;  2EY5 A;  2EY6 A;  2XRQ D;  2JA7 B;  2EYJ A;  4MIU A;  3H91 A;  2D2C C;  3BDO A;  3EJI A;  3VA7 A;  3J80 L;  3K58 A;  4FXG C;  2A6H C;  2KUM A;  4KI0 A;  2JP1 A;  1Q90 A;  1EY5 A;  2G9D A;  3WDN A;  1Y1W B;  5E4W C;  2A73 B;  1H9J A;  3D4D A;  4V19 0;  4OHJ A;  1L0X B;  1EL0 A;  1UEA B;  5FO9 B;  1M4V A;  5TSS A;  1TKW B;  3QOL A;  4HCE A;  1X32 A;  1PTO C;  5M9O A;  1GOZ A;  3EFX D;  4AYB B;  1KLG D;  2NTS A;  2V4D A;  4RAU C;  4B9X A;  4QB4 A;  3OWE B;  2AUK A;  2F0H A;  1AN8 A;  3S1Q B;  4X3S A;  2FHT A;  1K83 B;  3P7J A;  5IOD A;  3PIP 3;  5JAV A;  1EU4 A;  1CZW A;  2E2J B;  1TS5 A;  2YU9 B;  5IGE A;  4BA2 I;  3FRP B;  3FVQ A;  2LFN A;  5C4H A;  4KKU A;  1QJO A;  3ERQ A;  3KUP A;  3NWS A;  3W2D A;  1EYA A;  2EPB A;  1CA6 A;  2QKI C;  2IL8 A;  3BDC A;  4HAE A;  2A6H D;  3OMC A;  4OGQ C;  5ELB A;  1Z47 A;  1IW7 C;  1JIC A;  4A3J B;  4M8A A;  5C0X J;  1HTP A;  5FOB B;  1T5X D;  3HG9 A;  5D65 A;  5KNC A;  1BR9 A;  1ENF A;  2IJ0 A;  5KRU A;  2JA8 B;  4DAP A;  2DN8 A;  2L1B A;  5EPJ A;  1RHP A;  4JK1 C;  1LTI D;  1EIG A;  2BDN A;  1D1K A;  3S9W A;  5C0X H;  1BBX C;  3TZU A;  3DWA A;  1GJX A;  2KCC A;  2RDH A;  1TU2 B;  4NDX A;  1LT3 D;  1JE4 A;  1PZK D;  2Y0S B;  5FLX E;  1HHV A;  3QOJ A;  1ESF A;  3URY A;  3GTG B;  3GTQ B;  5IIF A;  4Q5V A;  4DXG A;  5JVH 3;  1O7Z A;  3R8B A;  3SK6 A;  1RD9 D;  2IW3 A;  1SYG A;  2SDF A;  3IFD A;  2EYL A;  2PNR C;  1QCB D;  2J7Z A;  3VYS A;  3HZX A;  3MA2 B;  2R7Z B;  2NTT A;  2O5J C;  2MPM A;  4DAY A;  4BA1 I;  4CHT B;  5CC4 A;  3N6R A;  3Q24 A;  1TS4 A;  1LTR D;  2F3V A;  1V1O A;  1E0B A;  3KF8 A;  3PUY A;  2F0N A;  3LX0 A;  1A3U A;  1JOK A;  2QEJ C;  5KEE A;  1I4G A;  1KAB A;  4C1N K;  3HOZ B;  3G7L A;  4G7H C;  1Y69 U;  1DCZ A;  2OEO A;  3SK5 A;  3ITP A;  4H13 C;  5DAU A;  3DXJ C;  3K6O A;  2Z8L A;  2CVR A;  1WTV A;  3H0G B;  1GUS A;  1H9R A;  3NTI A;  2EYP A;  2IX0 A;  4DK0 A;  4FF1 A;  4XTC S;  1TS2 A;  4E6I A;  2DNC A;  2XNA C;  1IYV A;  4CJ2 C;  4IUR A;  3TME A;  2F0T A;  1CFM A;  1WVL A;  1V43 A;  4KN7 C;  5C5M A;  1EZ8 A;  1EY9 A;  2B2U A;  2XWJ B;  1LAB A;  1CT1 D;  1A15 A;  2KA7 A;  5FKA C;  1NR4 A;  3FDT A;  2WKC A;  1SBB B;  4NMZ A;  1K8M A;  5EBD A;  1EY0 A;  3CRL C;  1LV9 A;  1QWY A;  1I4R A;  1RKN A;  1OXT A;  3M7N A;  4KD3 A;  4IFD H;  1STA A;  2NWG A;  2K5Q A;  1CHQ D;  2F0L A;  3SXH A;  2K28 A;  4RCN A;  2M00 A;  1Y8N B;  1F2Y A;  1IKL A;  1ET9 A;  4G4K A;  3FPP A;  1HQM C;  2CQA A;  3UI2 A;  3OHX C;  3NPP A;  2D5D A;  3NK9 A;  4KN4 C;  3E0J A;  3X3N A;  2QIL A;  1KDA A;  3GTL B;  1JB3 A;  1O7Y A;  2A6E D;  2A74 C;  4RGT A;  4PMB A;  1TVX A;  2E2D C;  4NW2 A;  1WD1 A;  2B2V C;  4ABN A;  1EWH A;  3AB9 A;  3IKJ A;  4EGV A;  2XN9 C;  1ESR A;  1EY8 A;  4K2K A;  1ILQ A;  3V2T A;  5CV6 A;  3ERO A;  1PYW D;  3PUX A;  4HCS A;  2PZW A;  5JEA J;  1TII D;  3A54 A;  4FVM A;  1XWE A;  3SDZ A;  3HOU B;  2XWB B;  2Q8T A;  5C4Z A;  2NYZ D;  1DYQ A;  2F0P A;  3W3A A;  4ZKB B;  2JA6 B;  2QF7 A;  4KJO A;  3S17 B;  1B44 D;  5KYI A;  4DNT B;  1OXS C;  4OIK A;  1SFO B;  4XQJ A;  4FNF A;  1G8Z D;  4H44 C;  2NZ1 D;  2YYZ A;  1II3 A;  1LTB D;  3TP8 A;  4S3S A;  1SMY D;  3QB3 A;  1DZ1 A;  4DK1 A;  1I4P A;  2VXW A;  4GZY C;  5ELF A;  2R3Z A;  4Z9C B;  3OW7 A;  1BF4 A;  1J8I A;  2F1M A;  5M5Y B;  2X6L A;  2B2W C;  2NVT B;  3J7A V;  1KTK A;  2JE6 I;  4CJ0 B;  1TWF B;  1F2L A;  2OXP A;  3A7A B;  4U67 3;  4P2C B;  2A5H A;  4RWS C;  4FYD A;  2JEA I;  1JOR A;  3I3C A;  5JPM C;  3DM1 A;  2VNU D;  1E2W A;  1C48 A;  2MHV A;  1SYF A;  1RJT A;  1JQY D;  1Z7T A;  2DNE A;  2PPB C;  1JWS D;  5I4D A;  5FO7 B;  4FXK C;  2DY7 A;  1LTA D;  3QG1 A;  4RFB A;  3R2I A;  1G29 1;  2E76 C;  3NUC A;  2C9O A;  5NUC A;  1ZKO A;  1IKM A;  1EOT A;  1U4M A;  1WTR A;  4CGY B;  4K2L A;  3A8K E;  1STY A;  2L9H A;  1A3V A;  3S2H B;  1ML0 D;  4JBW A;  1ONL A;  1EYC A;  5I9P A;  5EQ0 A;  3GD7 A;  1IYU A;  4RKL A;  3PMF A;  1B4O A;  2B2V A;  3S14 B;  5IGB A;  1KDC A;  5E4X A;  2OF1 A;  1CZG A;  1EYD A;  4RGO S;  4DNR B;  1SE4 A;  3F2U A;  4RCO A;  2KVM A;  3O13 A;  1U4P A;  2ICE C;  2F0K A;  3H3V C;  2AWN A;  2L11 A;  5C44 B;  5M5W B;  5CBE E;  1HQR D;  1YNN D;  5COR A;  1JOO A;  2F0O A;  1ZYR C;  3K7A B;  4XDX A;  4CKE A;  2F0Q A;  3BDL A;  2AQ3 B;  1VDZ A;  4X3K A;  4IUQ A;  1SYB A;  3FMC A;  5IGG A;  4OO1 I;  2G9H D;  3VR3 A;  1PTO H;  2TSS A;  1LT4 D;  4K5X A;  3DWP A;  2PCF B;  5I6Y A;  1ICW A;  2F0E A;  3K5M A;  1C8C A;  2Z4H A;  1GUG A;  1TR5 A;  4RHS A;  1T5E A;  1OO9 B;  4I65 A;  2LS0 1;  4K5V A;  2N55 A;  5CV9 A;  2BCO A;  4ZQ3 A;  2F0W A;  2FFK B;  4IZ8 A;  1G2T A;  1B1Z A;  4CKB A;  2GA4 B;  1SAP A;  4LJZ C;  4KK7 A;  1PRT C;  3DHQ A;  3CKI B;  4N9P A;  1SYC A;  2JXM B;  3HKZ B;  2IX1 A;  3C2P A;  2F03 A;  2JYO A;  1CI3 M;  2BE5 D;  1BCP D;  1MI2 A;  2B2T A;  4DN4 M;  1STH A;  1W6J A;  4K6D A;  3K5O A;  1OXU A;  4XYO A;  1WD0 A;  2CHB D;  3HOY B;  2AQ2 B;  1GUT A;  4J6H A;  4CBV A;  3FEW X;  3BVM A;  1H9S B;  3JAM E;  4R8I A;  3IFT A;  1S5D D;  1CM9 A;  1G2S A;  3NHH A;  1LT6 D;  1PTO F;  4KKS A;  2FMC A;  3JAM L;  5BN5 A;  3RZO B;  1I4X A;  3MAQ A;  2PQE A;  3GTJ B;  1X3Q A;  2F3W A;  4HMI A;  2R93 B;  2H1E A;  1UNS A;  2RQX A;  4IFD G;  2KEC A;  3IL8 A;  3CHB D;  1ZXT A;  3VYT A;  4U68 A;  4X3T A;  3E6Z X;  4C2M B;  4V0B A;  4MHE A;  3RMH A;  1H9S A;  3MEH A;  3A55 A;  2FIN B;  3TDQ A;  1STE A;  4PMC A;  3C3L A;  1EIH A;  5KGU A;  2C5C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...