4C3HH

Structure of 14-subunit rna polymerase i at 3.27 a resolution, crystal form c2-93
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
144
structure length
134
Chain Sequence
NTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLNATRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the 14-Subunit RNA Polymerase I
pubmed doi rcsb
molecule tags Transcription
molecule keywords DNA-DIRECTED RNA POLYMERASE I SUBUNIT RPA190
total genus 22
structure length 134
sequence length 144
ec nomenclature
pdb deposition date 2013-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4c3hH00
2NVYH 5M3FH 2OCEA 4DR5Q 1EYGA 2E5LQ 2UUCQ 4IFDG 3GDEA 4WJ4A 4A3DH 4B3RQ 3PCOB 3PSIA 1OXVA 4X6AH 3TS0A 1NJIC 4A93H 4UP9A 1MJCA 2KCMA 4DR5L 3KJPA 2E5LL 4B3ML 1X3FA 4YY3Q 2NN6G 3UDXA 2YTYA 4AIMA 4LFAQ 2WP8J 1OXSC 1QVCA 2D0OA 4JI0L 3KLWA 1L1OA 2R7ZG 2IHEA 3SGIA 3F2CA 1PH8A 1W2BA 4B3MQ 4RMFA 4LF5L 1A0IA 1O7IA 2AMCB 4DK6C 3RR5A 3CP0A 4JI6L 4NPSA 3KJOA 2YYZA 4BA1I 4A3JG 2MFIA 1RIPA 2VS1A 3W1GA 4LFCQ 5HY6A 1XMQL 2EIFA 3GTMH 1SMXA 4DAYB 1JJGA 4IOAA 2XGTA 1R9TH 1SE8A 2JEBI 3PO2H 4DV1L 3A0JA 1NMFA 2NN6I 1TWFH 5M3MG 1TWGH 2HIVA 3G4SA 3RLNA 3H15A 1B70B 4PMWA 4DV7L 3MXNB 4TQUS 1QUQA 4DR6Q 3MEFA 3M4PA 1N32Q 1Q1EA 2RF4A 2PQAA 3F2DA 4FDBA 4JBKA 4A3FG 4IOCA 5FJ8H 1U5KA 1WOCA 2LXKA 4GN5A 3GTJH 1HZCA 1PFSA 4DV7Q 1Y1WH 1YZ6A 3STBD 3HKZE 1YNXA 2JA6H 3BU2A 3OW2A 3G71A 2E2JH 1HJPA 2MNAA 4OX9Q 4P75A 2R7DA 4DR1L 4IJHA 2BA1A 3LGJA 4IJLA 5GAHC 4A3MG 1YITA 1JJ2A 4A3FH 3UE0A 2Q2UA 3TREA 2D0PA 1VQ7A 3DM3A 3NELA 5IT9c 2CWPA 4GNXA 2R92G 3BJUA 4ALPA 1N9WA 2IT1A 2K5VA 1S3OA 4DUZL 1E1TA 4B3SL 2R6GA 4RG1A 2D62A 1L1OC 3PO2G 1PH1A 2JA5G 4GNXB 3CCRA 1E22A 4GN3B 4P71A 2ZM6Q 1IBKQ 1JJCB 4JI8L 4A3JH 4GLXA 4GOPA 4YY3L 5ELOA 1XPOA 1U0LA 2R7FA 1YJ9A 1FVIA 1SR3A 1EUJA 1PYSB 4X64Q 5BR8L 4DUYQ 1K0RA 1IBMQ 5C0XJ 4LF4Q 1XNRQ 2Y0SE 2F3IA 2UUBQ 3K7AH 4DV6L 2CWAA 4LF8Q 1JB7A 5C0XG 4JYAL 5C4XH 1VQ4A 1L0WA 4GOPB 1V9PA 1YHQA 2KHJA 1VQ8A 2CCZA 5LMNW 5IY0A 4C3JH 2QA4A 1VQAA 3L0OA 3CC7A 1VQHA 5LMUQ 1PH9A 1FJGQ 2N49A 4LF7L 3GTPH 5LMUL 1FJGL 3TS2A 1HZBA 2OWOA 3PF5A 2BH2A 1YVCA 4BBSG 3BZKA 4QGUA 4AQYQ 2OQ0A 5M3FG 2UXCQ 1Q86C 1Y1VG 1HNWL 3DLLA 2V1CC 3CCUA 1I3QH 3I7FA 1YI2A 1CKMA 5IP9G 2AWNA 3ERSX 2AKWB 3U4ZA 4JI7Q 4B3TQ 2JA7H 3HOUG 2K14A 4YCVA 3S1QH 1HNWQ 2ZTEA 4DV0Q 4A3CH 4X65Q 2AHOB 3S24A 3J81c 2XTIA 3AYHB 2KCTA 3KDFA 2JA6G 1TWCH 2IX0A 2MQHA 1VQPA 4HJ9A 1PHJA 3IRBA 1S72A 4EQ5A 2JA8G 3RLFA 3CCJA 4JOIC 4B3TL 1Z9FA 4DV5L 2ES2A 1K3RA 4A3KH 1GD7A 2DGYA 1SN8A 1X65A 5AJ3Q 2QEXA 4DV0L 4A76A 4DR3L 3PUXA 1N33L 2R92H 4XTCS 2EQSA 5IP7G 3CCQA 1ASYA 1PYBA 2K4KA 2B29A 2Q2TA 1IZ6A 4KHZA 4DKAC 2OTLA 5M3MH 1K8GA 1XPUA 3CF5A 5AJ3L 2VUMG 2CFMA 2VUMH 1SROA 1NTGA 4DPGA 3CXCA 1K73C 4LF9Q 4BY7H 1SRUA 3OTOQ 1VQOA 3HOWH 3J80c 4HJAA 2ZTDA 4GN4B 4KLKA 4LW1A 3M4QA 5IP7H 2VQEQ 1HR0W 2NVXH 2JA7G 3HOUH 2OTJA 2I0QA 1GKHA 4OX9L 1J5EQ 3M3YH 1N8RC 5EAYA 2VW9A 3M7NA 4R4IA 4DR7Q 3NBHB 1A62A 2ZM6L 3S2DH 2CQOA 3KFUA 3CC2A 1XNRL 4DR7L 5GAEC 1YJWA 2UUCL 4GKJL 4DK3C 2K52A 4OO1G 4JG2A 1VQGA 1IBML 4BXXG 4L5TA 1QZHA 1P16A 4GKJQ 1PH2A 4OWWB 5FLMH 2K5NA 5JJLA 4YHHQ 1G6PA 3TQYA 1HZ9A 3G6EA 4DV6Q 2UUAL 1HH2P 4OWTB 4JCVE 2RHQB 1G51A 3U4VA 2WAQE 1G291 2PI2A 2JE6I 1YJNA 1VQMA 4BBSH 2UXDL 3GTOH 4LUOA 2UU9L 1EIFA 4DV4Q 1HNZQ 4R4QA 4YCWA 5DLQE 3S14H 3PIOA 1X6OA 1QVGA 5GQOA 1V43A 1X54A 4DR4Q 4NXNQ 2PI2E 4LFBL 1HNZL 1VQ9A 1T9HA 4AQYL 4JI1L 2F52A 3EN2A 3PUYA 4LF6Q 1TWAH 4GS3A 3S16H 4A3CG 2B3GA 4LFAL 3E9HA 2WFWA 1WI5A 2Q2IA 1Q1BA 1KL9A 1A8VA 2CKZB 1AE3A 3PUVA 1FL0A 4C3HH 3JAMc 5GROA 4IPCA 3CMEA 1WYDA 4PZ8A 3KYHC 2UXBQ 1CKNA 1UE7A 4A3DG 1UEBA 1KC8C 1CSQA 4X65L 4JI6Q 1QVFA 3PV0A 3AFPA 3CC4A 2Z6KA 3U58A 1RL2A 4Y7NH 1VQCA 2YTXA 5FLXc 4JYAQ 3RZDH 2GVAA 2QGQA 4NB3A 3M9BA 4R1JA 3ULJA 3F2BA 4JOIA 3RLOA 4POGA 4A3BG 1HNXQ 3CCSA 4IPGA 1N33Q 2R7ZH 1Q82C 4DV2Q 4IFDI 3Q8DA 4YWMA 1Q7YC 5FLMG 3JC66 4O2DA 5E7NA 1XMOL 3CCLA 3B6YA 2HIXA 5C44H 2H5XA 4A3IH 1VQLA 5C4XG 1IXRA 3FHWA 4TVAB 2E2IH 4A75A 4QL5A 2HHHL 4LF5Q 2C35B 4DV2L 3W1BA 3KDFB 4A3LG 1VQDA 4DV5Q 3OTOL 3I56A 1E1OA 1UWVA 4DR3Q 3L2PA 1K9MC 4R4CA 1UE6A 3E0EA 3ER0A 4GNXC 3F8TA 5IYBH 1Y1WG 1LM0A 3EIVA 4JI4Q 2WB1E 1D8LA 4APVA 3J81j 2JA5H 5IWAQ 1IL2A 1VQBA 2AWOA 4QIWE 3CCEA 3TEHB 5IYDG 1OXXK 2PQAB 3T1HL 5IWAL 3S15H 1WJJA 2KENA 4P72A 2RCNA 3STBC 3HOXH 2DUDA 1BBUA 3T1YQ 1S40A 4HIDA 2F4VL 1H95A 1M90C 3CPFA 2FXQA 3JAMi 5C3EG 4YHHL 2ZJRA 4A3EH 1PH5A 3GTQH 3S1NH 1OXTA 3T1YL 1N34Q 3ICEA 3H0GG 2UXDQ 4EX5A 1VQIA 4JI3L 4LF8L 2Z6KC 4BY1G 4DAMA 3HOWG 4BY7G 4C2MH 3S17H 5IYCH 3WWVA 4DNIA 4R4OA 1ASZA 4JBJA 3A5UA 3AQQA 2N8NA 4DR4L 4LFBQ 3I4OA 4NXML 4OXPA 4AH6A 1PA6A 2A1AA 4OWXB 4LF4L 1PV4A 1Q8KA 4JI1Q 2BA0A 1DGSA 5JEAG 2ID0A 4POFA 3HKZG 1NY4A 3HOYG 4JV5Q 3K81C 3F1ZA 3U50C 1MIUA 1M1KC 1I5FA 4B3SQ 4KHPQ 2B63H 1SFOH 3S1RH 2UXCL 1GO3E 4GLAC 1JE5A 1QZGA 1JMCA 4OO1I 1V1QA 1K83H 3ULLA 3FKIG 3FKIH 1LTLA 3J81i 1A63A 1QUQB 3I55A 3J7A5 4L5RC 1IBKL 5JJKA 3TRZA 2NVTH 3H3VH 1X9NA 4LF7Q 4P74A 4JI8Q 3AEVA 2B63G 5IP9H 1B8AA 2IY5B 3I4MG 4DV3L 1LYLA 1OTCA 3RZOH 1P8LA 2R93G 2A8VA 3A74A 4YCUA 5C3EH 5LMNL 3L7ZC 1VCIA 1I94Q 2Q2HA 3KF8B 4JI2L 2NVQH 1VQFA 3S1MH 4IFDJ 1N36L 5HGQA 4QQBX 2WB1G 5IYCG 3HOXG 1I94L 5J3BA 1PVOA 4BY1H 1KRSA 4GKKQ 4R4TA 3K80C 4H02A 5FJ8G 3CD6A 3PF4A 1I6HH 1I50H 3D31A 4LWCA 5LMNQ 2MO0A 4DR1Q 4KHPL 4X66Q 2PNHA 2I5LX 2NZOA 2YV5A 4LF9L 2ATWA 4DR2L 4GKKL 1E7ZA 4PZ7A 2KHIA 1XPRA 3KF6B 2MO1A 2HT1A 3GTKH 3UDIA 5M5YH 4K0KQ 5IYBG 1IBLL 1YBYA 2GVBA 1XMQQ 1NMGA 3HOVH 3NENA 3RNUA 2JA9A 3RN2A 3M4OH 3GD7A 3VDYA 1X3GA 4UPAA 2LXJA 3PUZA 1EWIA 1X56A 1MJEA 4JC0A 1KQSA 4YWLA 4JI4L 1N34L 4ME3A 1OXUA 1TXYA 1KIXA 3GTLH 3CMAA 2GN5A 1C7YA 1N32L 2JK8A 1E3PA 3GO5A 2PMZE 1Q81C 3PO3G 2K5HA 5BR8Q 4X64L 4DUYL 4A3BH 4A3LH 5IE8A 1KD1C 4A4IA 3CAMA 2R93H 2K50A 1CKOA 4X62L 2NZHA 1KHIA 5C44G 2VY3A 4A3IG 1VQ5A 1NBWA 1VQKA 3UE1A 4DV4L 1EQRA 3BZCA 3CQZH 2IHFA 3ULPA 2F4VQ 1YEZA 3HOZG 1HR0L 2E2HH 3CPWA 3EBEA 2ZJPA 3CCMA 1UE1A 2RHSB 4JI5Q 4YWKA 4JV5L 2E8GA 4MNOA 1WCMH 5ELNA 2JQOA 1BVSA 2OQKA 1NE3A 4X62Q 4UP7A 3I4NG 4LUZA 4PG3A 1KRTA 1VQJA 4KI0A 3PGZA 3ZJYC 1HR0Q 4LUVA 1EFWA 1LUZA 2JJQA 1PH6A 1C9OA 1J6QA 1VS0A 3I2ZA 4JI5L 1GM5A 4BBRH 1W3SA 1Y1VH 3UDGA 2WAQG 1KXLA 4JBMA 1IYJB 3K7UC 1VQEA 1FGUA 2Z0SA 3KF6A 4LF6L 3J80i 4JI2Q 1PH3A 1EIYB 4B3RL 2JEAI 2VNUD 2A19A 1N36Q 4JBWA 4PZ6A 2HQLA 4QY7A 1E24A 5K36G 4AYBG 2UUBL 2UXBL 3CW2C 4HJ7A 5M5XH 3NEMA 1Z47A 2YTVA 4C3IH 1L2FA 4IO9A 2UU9Q 5H1SE 1BBWA 4DR2Q 3CCVA 1VQNA 2ASBA 4HJ8A 2N3SA 1KAWA 1TWHH 2BH8A 3FP9A 2L15A 4P73A 4NXNL 4K0KL 3K0XA 3HOZH 1XTDA 4Y52H 1CUKA 1MKHA 5GADC 1IBLQ 1HNXL 3K8AA 4BXXH 4OONA 4XIGS 4JI0Q 1Q12A 4UP8A 3PIPA 3AFQA 1XMOQ 1C0AA 1B7YB 1WCMG 4AYBE 2I5MX 2VL6A 3A5ZB 5JEAJ 5C0XI 3G48A 4L5SA 4DR6L 4A93G 3J7ZC 2HHHQ 1XJVA 1J5EL 4WJ3M 4X66L 2KBNA 1BKBA 3HOVG 2N78A 2Y0SG 3KOJA 4LFCL 3UDFA 4JI7L 3T1HQ 4O0AA 2YU9H 4BA2I 4L5QA 1VQ6A 3M85A 2VZAA 3HOYH 4A3GH 5IYDH 1AH9A 3I4NH 2VQFQ 3OYYA 1PH7A 4DV1Q 4A3MH 3I4MH 1AE2A 4A3KG 3PUWA 3W5OA 3PO3H 4IPDA 2VQFL 4MTNA 1YIJA 5JJIA 4GOPC 1D7QA 4GLVB 4HIOA 2UUAQ 4QJFA 4J15A 1UE5A 5GAGC 1JT8A 4DV3Q 3HFZB 5C4JH 1EQQA 4MZ9A 4A3GG 2EXDA 3H0GH 1X55A 1XNQL 3D0FA 2IX1A 3H3VI 1CSPA 1EOVA 4LNQA 4NXMQ 1GVPA 1WFQA 4A3EG 2I5HA 2ZJQA 3HKSA 4HIMA 4UY8C 2JA8H 2ZTCA 1X3EA 2K75A 1PH4A 3GTGH 5M5WH 1XNQQ 4JI3Q 1CKNB 2VQEL 1K8AC 1L1OB 1Y14B 1YHAA 3RN5A 4IPHA 4DUZQ 3S2HH 2ALYB 4HIKA 2LSSA 4BBRG 1HZAA 1YHBA 1Q46A 1SLJA 4HJ5A 3E9IA
chains in the Genus database with same CATH superfamily
3C2PA 1F2LA 1EYGA 1TWGB 2B2UC 2ENBA 2SNMA 2F0DA 1TKWB 2E5LL 3NTIA 4B3ML 4KKSA 2NN6G 2B2TC 3S1NB 4LFAQ 2WP8J 1MHWC 1QWYA 2VXWA 5EQ0A 4KD4A 2D0OA 3Q22A 2IHEA 3C46A 4RMFA 1A0IA 1O7IA 5A35A 2AMCB 1B53A 1BDOA 1RIPA 3W1GA 2LKVA 3RZOB 1RHPA 3MXNA 1RD9D 4DAYB 5A2QL 2PW7A 1VDZA 1SE8A 2JEBI 4IALA 4K5VA 3OIQA 4DV1L 4KTAA 2FINB 1TWFH 2B2YA 4HTHA 3RLNA 3H15A 1STEA 2R61A 3MXNB 1KAAA 3GV6A 4TQUS 2ICIA 1DOMA 1SNOA 2B2WA 1XYIA 2PQAA 4A3FG 3R2IA 4IOCA 2NTSA 2LXKA 2EYJA 1Y1WH 2L12A 4FP5D 2JA6H 1DYQA 4ZRZA 3OW2A 2ZT9C 2F0EA 4OX9Q 2F0TA 1ENAA 1PRTD 3TREA 2B2VA 2D0PA 3KLSA 4J1MA 3DM3A 5IT9c 2JP1A 3OSOA 3BJUA 4ALPA 1S3OA 1I50B 1JWSD 2R6GA 4BY1B 4K5XA 4IZ8A 1QNUA 2H4OA 1E22A 2ZM6Q 2A6ED 3O13A 5C3EB 3H3VC 4A3JH 4YY3L 1I4GA 3HRZC 1I4HA 1A2TA 4LF4Q 4KJNA 1Z6HA 4DV6L 2CWAA 2E74C 4LF8Q 2A68D 4A3DB 1HUMA 2CCZA 2F0LA 4C3JG 1VQAA 2CW0C 1PH9A 3MTSA 2IL8A 3OWFA 4HR7B 1HUNA 2BH2A 1YVCA 5CV4A 4QGUA 4AQYQ 1IHZA 2AUKA 1Q86C 1K28A 1EY4A 1HNWL 1BCPB 3PO2B 3S17B 2AWNA 4XQNA 4JI7Q 4B3TQ 2K14A 3R8BA 5FO7B 4Z9CB 4FYDA 3KLSX 5C4JB 4DV0Q 4X65Q 1PTOD 2AHOB 1SEBD 2PMZB 2KCTA 2IX0A 1PHJA 1VQPA 1O7LA 4HJ9A 2JA8G 4EQ5A 1Q8IA 4JOIC 4DAYA 1ILPA 2DGYA 5AJ3Q 3I4MG 1MBYA 4YIJA 1ESFA 3S15B 4OELB 4L63B 2RDHA 3LWEA 2NWGA 1ASYA 4ZKCB 2Q2TA 3L3OC 4DKAC 3M4YA 1SXTA 1SROA 5CV6A 1V8QA 4DPGA 4TKOB 4LF9Q 4BBSB 3IKJA 2M00A 2IX3A 2ZTDA 3M4QA 3T4AC 3C1EA 2NVXH 2JA7G 2QDLA 1NAPA 4UDUC 1J5EQ 1N8RC 5EAYA 2VW9A 1A62A 2ZM6L 2MP1A 3S2DH 2SDFA 4BS9A 1JCKB 4KHVA 1MSHA 1QE6A 1VQGA 4BXXG 4L5TA 1P16A 4GKJQ 2JA8B 2F0JA 2F4IA 2JYOA 1G6PA 2UUAL 1HZ9A 4JK1C 2N88A 4BY7B 3GTOH 1S5BD 2ZXRA 2L5TA 3PIOA 1X6OA 1Y1VB 3G6JB 2XRSD 4DR4Q 1A3VA 2A74C 4CKEA 2K03A 3K0YA 3PUYA 2K6AA 3S16H 1WI5A 2Q2IA 1A8VA 2CKZB 3PUVA 4C3HH 1AE3A 1FYCA 2UXBQ 2K33A 5E4WC 1UEBA 4DXGA 4X65L 4BWGB 5DM73 4DK1A 3QOLA 3AFPA 3CC4A 1F9RA 1DCZA 4CJ0B 3U58A 1EYAA 4K5WA 3AU7A 2GVAA 2QGQA 3F2BA 5E1FA 2R7ZH 3Q8DA 1Q7YC 1CQFA 2IPKD 5E7NA 3CCLA 2HHHL 2C35B 1GUTA 3VR4A 4DV2L 1FR3A 4HAEA 4DV5Q 4KN4C 1VF7A 3NP8A 4FXDA 1RDPD 5IYBH 1Y1WG 4JI4Q 3EIVA 3A7AB 4KN7C 2QKIC 4Q5VA 1TY2A 2XVSA 2KCCA 4QIWE 1OXXK 1GUGA 4P72A 3STBC 2CHBD 3FMCA 3T1YQ 4HIDA 1H95A 5HURA 3JAMi 3J7YW 4YHHL 3I73A 2ZXPA 2JA5B 3NE5B 3H0GG 1BQQT 4KKTA 2BDOA 4C2MH 1LTGD 5IYCH 3S17H 4JBJA 3AQQA 1EY8A 4OXPA 1PA6A 3AB9A 1DGSA 1ZYRC 3U50C 5KNDA 1M1KC 4G7OC 2B63H 3S1RH 2EJFC 1QZGA 4OO1I 5M5WB 3FKIG 1H9JA 1LTLA 1QUQB 5IGBA 3I55A 2WIIB 5FO9B 4L5RC 3TRZA 2RKSA 3QB3A 4WFN3 1EIHA 2B2UA 2B63G 2F0PA 1CA6A 1SDFA 2IY5B 2A6HD 1LYLA 5LHY1 5M3MB 5DNFA 1B4OA 2A8VA 3A74A 3N52A 1I6HB 3OMCA 1WTWA 5JVG3 1N36L 4L6TB 2BE5C 2XNAC 3I4MB 1A15A 2KJXA 4DAPA 1PVOA 3WOFA 2RVLA 3K80C 4H02A 1I6HH 5LMNQ 2MO0A 4E6IA 2PNHA 2NZOA 4LF9L 2J4XA 1E7ZA 3U9SA 3K59A 3KF6B 2HT1A 3GTKH 5M5YH 4G7HC 1B9MA 1HCZA 2GVBA 2KQ3A 1XMQQ 2D5DA 2JA9A 3CU7A 3VDYA 1X3GA 4UPAA 2LXJA 1WTRA 1D2BA 3R3OA 2WV6D 4ME3A 1OXUA 2L55A 2PPBC 3MAQA 3CMAA 3GTLH 4N9PA 1TS5A 3PQIA 5BR8Q 4DUYL 1KD1C 2NVXB 3X3MA 2K50A 1XX8A 1CKOA 4X62L 2A5HA 1WD1A 1NBWA 2F4VQ 3JAME 1UEAB 2IHFA 3NUCA 2E2HH 2EYPA 3CCMA 3KLRA 4X3UA 2E8GA 1WCMH 5CR3A 1BVSA 5I9OA 4UP7A 5CGKA 3I4NG 4K2LA 4KI0A 4NW2A 1C9OA 1VS0A 4JI5L 4BBRH 3EVQA 1IYJB 1VQEA 3I70A 3MXUA 4LF6L 2O2LD 4JI2Q 4EGVA 2JEAI 4IUVA 5C5LA 2VNUD 2A19A 2B8FA 2HQLA 2K28A 1E24A 1SE4A 4AYBG 3BYYB 2YTVA 1I6VC 2PZTA 5L37A 4DR2Q 2R3ZA 2QF7A 1O7YA 2N3SA 1TWHH 2B8GA 4K0KL 2EDGA 1CUKA 1IBLQ 2ZXOA 4CDFC 4XIGS 1SYDA 1PTOF 1Q12A 3MXPA 1O78A 1XMOQ 3AFQA 3F2UA 4KY7A 3HOWB 2DY7A 4J8QA 1MI2A 1W6JA 3A5ZB 5JEAJ 3E6ZX 1J5EL 4R9WA 4WJ3M 1BKBA 3HOVG 2Y0SG 1STYA 3UDFA 5CBEE 5HGTA 2YU9H 2AQ3B 1IYUA 3M85A 3CHBD 2VQFQ 4A3MH 3PUWA 1FNVA 4O42A 3PO3H 3SEBA 2VQFL 4MTNA 1YIJA 4PMCA 4GOPC 2PW5A 3A56A 3SHLA 4J15A 4RGNA 1UE5A 3DEOA 3FVQA 3C1FA 3QWNA 4ZQ3A 2BCOA 3C3LA 1GVPA 1WFQA 3NXWA 3EJIA 3TBIB 2G9HD 2CVRA 2IJ0A 1AEXA 2RDFA 1EYCA 2JA8H 4A3BB 3GTGH 1K83B 4RA8A 2Y0SB 2EPBA 2XWBB 3RN5A 1LT5D 3GTPB 3OPOA 4BBRG 4XQJA 1B2TA 1RODA 2OCEA 2E5LQ 4IFDG 3GDEA 4WJ4A 1YNJC 1EQTA 5D14A 5BN5A 3WDNA 5IGEA 4EVOA 1AZQA 2L9HA 4ULLA 1MJCA 3D6WA 2KCMA 2A6HC 1X3FA 2OEOA 1H9MA 1M4VA 1VF5C 1TVXA 4AIMA 2OF1A 5IGCA 4JI0L 1L1OA 4A3KB 5IGFA 4RCOA 2Z4IA 4MHEA 1BNZA 2A6EC 2YYZA 4BA1I 4A3JG 2VS1A 4KD3A 5K36H 5HY6A 1XMQL 1F2YA 3SXHA 3GTMH 3OW7A 1SJHD 1KDBA 4ZLTF 4A93B 1R9TH 1RTNA 1CZGA 5JPNC 5M3MG 2HIVA 3G4SA 5IGDA 2OXPA 2LFNA 4DR6Q 3M4PA 2B63B 2RF4A 1HXYD 2DJGC 4FDBA 3KUPA 5FJ8H 1QB5D 1CZWA 1AFPA 5A2QE 1PZJD 4CDEC 4DV7Q 2NYZD 3TP6A 4EQPA 3BU2A 1RTOA 2E2JH 2MNAA 2R7DA 4IJHA 2BA1A 2SEBD 4IJLA 3PIP3 1LTSD 1EY9A 5JAVA 1U9RA 1N9WA 2K5VA 3QOJA 4DUZL 2PQEA 1LACA 1PZID 4DN4M 2D62A 1PTOH 4LMQD 1CFMA 2JA5G 3CCRA 4GN3B 5J1ZA 4GLXA 5ELOA 1XPOA 2R7FA 1FVIA 1SR3A 4X64Q 1D1IA 1IBMQ 1C48A 3FPPA 1KLGD 1JOKA 3DEPA 3MXGA 5C0XG 1JB7A 4JYAL 5CMDA 3DMUA 1VQ4A 3MWYW 1L0WA 1V9PA 3EQLC 4I65A 5FOBB 4OHJA 3RMHA 5IY0A 1Y1WB 3WOEA 2QA4A 2SNSA 1VQHA 4FXKC 3PIO3 3CC7A 2N49A 1STBA 5C4HA 1ICFB 4LF7L 2C5CA 2J0TD 3MFGA 2EY2A 4B9WA 4DGZA 5I2YA 2OQ0A 1QNKA 2UXCQ 5C4XB 3RUZA 5FO8B 1H9SB 1SBBB 2MPMA 2CH4A 3V2TA 1I4XA 3LNNA 3I7FA 1S5DD 5IP9G 1Y8PB 4G57A 3U4ZA 2JA7H 2D9UA 5AFWA 4CKBA 4DU9A 5I6YA 3NTHA 4A3CH 3S24A 3KDFA 2EYOA 3RLFA 2Q8TA 4B3TL 2EZVA 1Z9FA 4DV0L 3HOXB 1SN8A 2QEXA 4A76A 3PUXA 4FXGC 3NHHA 1IZ6A 1PRTC 2OTLA 5DAUA 5M3MH 3VYUA 1K8GA 5AJ3L 2VUMG 2CFMA 2DNEA 1G8ZD 1NTGA 3CXCA 4A3FB 3T51B 1K73C 3OTOQ 5M9OA 3VYTA 4LJZC 1I3QB 3J80c 3HOWH 1M8AA 1Y8OB 2I0QA 1GKHA 4HSVA 5CORA 3M7NA 3S1RB 4DR7Q 1VMCA 2DJFC 4RGMA 1SNQA 1VMPA 1CA5A 3KFUA 1LTAD 1EOTA 4IQZA 1WTXA 4DR7L 1U4MA 2IWHA 4I7AA 5BN3A 2K52A 4OO1G 4XT3B 4JG2A 1IBML 1QZHA 1RKNA 5FLMH 4HMIA 2EY5A 2K5NA 3HOUB 5JJLA 4NDXA 4JCVE 2RHQB 4G4KA 1G51A 1EIGA 4R4QA 2Z9HA 1QVGA 1LT6D 4LFBL 2Z4HA 1SMYC 2EY1A 1HNZL 1PZKD 4JI1L 2F52A 2BDNA 4LF6Q 4HEDA 1SYBA 2B3GA 5IOCA 3E9HA 2WFWA 4M8AA 3CRLC 4O1NA 3CMEA 1DD2A 2PZWA 4PZ8A 3KYHC 4IUNA 1CKNA 1SAPA 1DONA 3PV0A 2MGSA 4CGYB 3DM1A 2YTXA 4CKCA 1JQYD 3ULJA 3M9BA 4R1JA 3RLOA 4PMBA 4TRDA 5EJWA 3CCSA 1KTKA 1H9SA 4IFDI 2F0KA 2WACA 3GTJB 3IFDA 3JC66 1XMOL 3S2HB 3B6YA 5C44H 2H5XA 4TVAB 2E2IH 1HTLD 4RWSC 4LF5Q 3KDFB 1S5ED 4A3LG 1DJRD 2RSNA 4MTKA 4QB4A 2TSSA 3OTOL 4QUFA 3ONAB 1UWVA 3L2PA 3E0EA 4F87A 3F8TA 3M7GA 4XQQA 2F3WA 2WB1E 3IFTA 1D8LA 1A3UA 4APVA 5IWAQ 4IUTA 2AWOA 3ND9A 1GUSA 3X3NA 2WINB 5IWAL 4ME5A 3BDCA 2KENA 2CQAA 5FKAC 5ELDA 2DUDA 4XYOA 3TP5A 2O5IC 1S40A 2F4VL 5KYLA 1M90C 2FXQA 2ZJRA 3GTQH 5C6AA 1BCPF 1N34Q 1X3PA 2UXDQ 4HMJA 4B08A 1PFMA 4BY1G 4DAMA 3FEWX 5FLXE 2X6LA 1I4RA 5F2DA 1ASZA 5JVH3 2N8NA 4LFBQ 3I4OA 4NXML 4AH6A 2JA6B 2A1AA 2BA0A 2EJMA 5JEAG 1JB3A 2K7VA 4JV5Q 3K81C 2JN4A 3F1ZA 4KHPQ 1I5FA 2PZUA 1SFOH 3P1HA 5D3DA 1V1QA 3FKIH 3TP8A 3J81i 2AQ2B 5JJKA 1DOLA 2NVTH 3H3VH 3RD4A 4P74A 4JI8Q 1EEFD 4DNTB 2VUMB 2NUCA 3P75A 3GTQB 1UAPA 2C9OA 4YCUA 5CV7A 4BBRB 1I4QA 4S3SA 4K8JA 3HOXG 1I94L 1L0XB 5J3BA 1EU3A 1KRSA 4GKKQ 2NVQB 1E2VA 1D5XC 1I50H 1UNSA 1TWCB 2Q8RE 4RKBA 4DR1Q 2YV5A 4PZ7A 3SE0A 2HDLA 2MO1A 2PCFB 1D1KA 1XTCD 1NUCA 4K0KQ 1IBLL 3NENA 2K05A 3SR1A 3PUZA 3V96A 1X56A 1HTPA 3FKIB 3EROA 5M3FB 4JC0A 1KQSA 4YWLA 4JI4L 1DM0B 3S2DB 1R4QB 3HP3A 1E3PA 2JXMB 3E3XA 2RQXA 1Q81C 3PO3G 4X64L 1SNDA 4A3BH 5IE8A 5ELCA 2X69A 4Y7NB 5IODA 1TY0A 2NZHA 4A3IG 3CQZH 3H0GB 1WTPA 3CPWA 2ZJPA 1UE1A 4C3HG 4JV5L 4MNOA 3VA5A 2OQKA 4Q0FA 4LUZA 4PG3A 4C3IG 1BBXC 2HD3A 2TMPA 1BR9A 4LUVA 1ML0D 2E2DC 1PH6A 1STAA 1EFID 3UDGA 1R4PB 1V1PB 2WAQG 1KXLA 4NP5A 4JBMA 1K8OA 4K6LA 3KF6A 3MEHA 2M9VA 1EIYB 5EBDA 4DXFA 4DA2A 1SYEA 3H94A 3P20A 4ZAIA 3J81E 4JBWA 1GUOA 1J9OA 4QY7A 2B2TA 5K36G 4C56C 1SSOA 4N8X1 4IO9A 3NWTA 1BBWA 3A55A 3CCVA 3FPUB 4P73A 2BH8A 1W6KA 2L15A 1LTTD 4Y52H 4L8JA 1XTDA 1HNXL 2I46A 1B7YB 2I5MX 3TZDA 5C0XI 4DR6L 3V05A 4C1NK 4C1NI 1TIID 3J7ZC 1E2WA 2KHSA 1XJVA 1JOOA 4X66L 2KBNA 2B2YC 2N78A 3KOJA 4A3JB 3DWPA 1VQ6A 3NBIA 5IYDH 4KMUC 3E0JA 1PH7A 1FNWA 2F0OA 4EQNA 3I4MH 3BVGA 3W5OA 1IKMA 5BN4A 3NQIA 2YU9B 2IW3A 1X3QA 5KNCA 5GAGC 1JT8A 1RCVD 3HFZB 4UAIA 4MZ9A 5C4JH 3D6CA 1X55A 3S1QB 1XNQL 1EZ6A 4NXMQ 3G7LA 3HKSA 4HIMA 4H44C 2FMMA 3HG9A 5M5WH 4JI3Q 1BXTA 1K8AC 1L1OB 5C44B 4IPHA 3A8IE 1G6ZA 2LSSA 3P7JA 1HZAA 4IUQA 1YHBA 1NE3A 5K5PA 3E9IA 2E75C 1RJTA 2NVYH 3M3YB 5JEAH 4A3DH 4B3RQ 3PSIA 1OXVA 1ET9A 3K7AB 5CV9A 3TS0A 1NJIC 1SNCA 5M5YB 4DR5L 2NN6H 3UDXA 1SNMA 4H13C 2SOBA 3VYRA 3A8KE 1JWMD 1OXSC 2KECA 3SGIA 1ONLA 4LF5L 2MJ8A 2XWJB 3VR5A 4DK6C 3RR5A 1T5XD 3CP0A 1MSGA 4NPSA 3KJOA 3BG3A 1UUPA 4LFCQ 4UHVA 1YNNC 2O4XA 3HZXA 2XGTA 3PO2H 3A0JA 1NMFA 2E2JB 1TS3A 2R93B 4PMWA 3TN2A 2K5WA 4DV7L 1QUQA 3K57A 3MEFA 1AP0A 1N32Q 1Q1EA 3F2DA 5TSSA 4JBKA 3GTJH 4RGTA 1PFSA 5D65A 1YZ6A 2NBFA 3GQBA 4XDXA 4DFAA 5KRUA 3G71A 4RGOS 4P75A 3LGJA 5GAHC 1JJ2A 3SDZA 2NZ1D 2Q2UA 4JPBW 3TSSA 1PRTB 1F2ZA 3T16A 1E1TA 4M1UB 3CRKC 4XXEA 3LX0A 2QCPX 1L1OC 4LK1C 1PH1A 3S1MB 3K5LA 2NB0A 4P71A 1IBKQ 1JJCB 1F2MA 4IN3A 4JI8L 3BVZA 3QO2A 1F9PA 3VR3A 1TQOA 1U0LA 2F1MA 5BR8L 4DUYQ 4X3KA 4RHRA 2EYHA 1NR2A 3K7AH 5KNBA 2F0UA 1WTHA 2KUMA 4DAVA 2FMCA 4C3JH 1IYVA 2A73B 3E5SA 5ISRA 2Z1CA 2F0QA 2OWOA 3PF5A 3BZKA 3DXJC 4IFDH 3I91A 3Q23A 1Y1VG 1EEID 2V1CC 3CCUA 1I3QH 3VR6A 4EQOA 4PV1C 1YI2A 4QCLA 3ERSX 2AKWB 5KEEA 4FF3A 1HNWQ 4YCVA 1G2TA 2ZTEA 3GTMB 1STHA 3J81c 3AYHB 4R8NA 2JA6G 2MQHA 1S72A 3CCJA 1K0SA 1CHPD 1BF4A 2ES2A 1K3RA 4A3KH 2AQ1B 2WB1B 2FFKB 1X65A 4A3MB 3TMEA 1VQOA 4DR3L 1N33L 4XTCS 2EQSA 5IP7G 4IURA 5C0XH 3CCQA 1PYBA 4CDDC 4KHZA 2VB2X 4DNRB 2JA7B 4BY7H 1ILQA 1STGA 4GN4B 2D2CC 4KLKA 4LW1A 3R2TA 4RAUC 5IP7H 1HR0W 3HOUH 1IW7C 4F88A 1H9RA 1B3AA 1JWUD 4R4IA 3NBHB 1BCPD 4GZYC 1JC7A 1L0YB 1E2ZA 2CQOA 3NTKA 3CC2A 1XNRL 4OIKA 1KNAA 4GKJL 1S5CD 4DK3C 5ELFA 4OWWB 4YHHQ 4DV6Q 2BE5D 1HH2P 4OWTB 5I9PA 2A69D 2Z6BA 3OHXC 1YJNA 2PI2A 4OEMB 1VQMA 1Q90A 2UU9L 1PFNA 1EIFA 4DV4Q 2JSOA 5DLQE 1GUWA 1DXMA 5GQOA 2KA7A 4NXNQ 1VQ9A 2R92B 1T9HA 4PQXA 1PTOB 4AQYL 3EN2A 4GS3A 4XYQA 4A3CG 5ELBA 2XSCA 2RSOA 1KL9A 2F0SA 3TP7A 3SK5A 3JAMc 4IPCA 4FF2A 1WYDA 1K3BC 2E2HB 1JE4A 4V190 4A3DG 2EYMA 4JI6Q 2Z6KA 5EKIA 4Y7NH 3RZDH 4A3BG 3HGBA 2J7ZA 1HNXQ 4IPGA 1N33Q 4KY5A 1Q82C 5J39A 4YWMA 4KY6A 4O2DA 1FD7D 1KNEA 1E0BA 2HIXA 1VQLA 5C4XG 1IXRA 3FHWA 5JPMC 3W1BA 1B3QA 3ND8A 3I56A 5NUCA 3UI2A 1E1OA 1K9MC 1UE6A 4C2MB 1II3A 3ER0A 3MHBA 4NKLA 4GNXC 2XIWA 1ENCA 2JA5H 3I72A 1PFBA 1IL2A 3CCEA 3TEHB 4U68A 1HFNA 5IYDG 3T1HL 1NNXA 3HOXH 1EY0A 2WKDA 1GHJA 4FVMA 2F0NA 3CPFA 2L0CA 4A3EH 1PH5A 3S1NH 1OXTA 3T1YL 3J81L 4MIUA 3NK9A 3D4RA 4N8FA 4JI3L 1A3TA 2Z6KC 4LF8L 4BY7G 2VB3X 4DNIA 3KBXA 5I2XA 4DR4L 2F0GA 1Y69U 2E2IB 1B50A 2LS01 4POFA 2F0IA 3HKZG 1TWHB 1NY4A 1YNND 2KOLA 1I4PA 4B3SQ 4ABNA 1D5MC 4RHSA 1GO3E 4GLAC 1G91A 1JE5A 3ULLA 4WORA 4HSPA 5IT9L 2DY8A 1KDCA 3J7A5 3MFYA 1X9NA 4LF7Q 3AEVA 4QF4A 1FNUA 3BYTB 3QIAA 1B8AA 1HA5A 2QEJC 3MVVA 4DV3L 2HQEA 3NSWA 1P8LA 2QILA 4F8MA 1SJED 2RBMA 5C3EH 3BDOA 3L7ZC 1VCIA 2Q2HA 5IT9E 2A69C 2NVQH 1VQFA 1K8MA 3S1MH 1SE2A 4IFDJ 2B2WC 2ICEC 4QQBX 1DOKA 2WB1G 5IYCG 2HCIA 4R4TA 5FJ8G 3J80L 3PF4A 2BOSA 4X66Q 2I5LX 1U4PA 2KHIA 1TR5A 5G3LF 3UDIA 5T1IA 1EU4A 2Z8LA 1WD0A 3HOVH 3RNUA 1LLRD 3M4OH 3TDQA 3Q6SA 1EWIA 1Z7TA 2F0VA 1LABA 2N55A 1STNA 5ELEA 3JAML 3GTLB 1LO5D 1N34L 1MD2D 1ZKOA 2I07B 1C7YA 2GN5A 3URYA 2JK8A 4C3JB 2PMZE 2WKCA 4A4IA 2R93H 3OIPA 2EYFA 1X32A 1VQ5A 1KHIA 1D7QA 2VY3A 1VQKA 4LAAA 3UE1A 4DV4L 1EQRA 3BZCA 1YEZA 1AZPA 1PDQA 1HR0L 3HOZG 2EYLA 3EBEA 1OO9B 2KEDA 2RHSB 4OGQC 4G7ZC 4A3EB 4FF1A 1KRTA 3QR8A 1VQJA 1KDAA 1PMRA 3AMUA 3DWQA 1GM5A 3VYSA 3KK7A 1Y1VH 1FGUA 1HQMC 1JICA 3CQZB 3H09A 1FGBD 1CT1D 1HRJA 2UUBL 3CW2C 1Z47A 4C3IH 1L2FA 2PNRC 4R8IA 1B1ZA 1JOQA 2ASBA 1KAWA 3K0XA 4K8IA 4C3IB 3K8AA 1QJOA 3OMGA 3Q24A 4ZK9B 3A54A 2DNCA 1WVLA 3QJYA 3VR2A 3M4OB 4K6DA 1EYDA 1JR0D 1BCPC 4ODGA 2HDMA 3G48A 4L5SA 5E4XA 4LFCL 1GUNA 3T1HQ 1B9NA 3GV3A 4L5QA 5DM63 3I4NH 3PO3B 5LL6X 4DV1Q 4CDCC 1AE2A 2RDGA 5FLXL 3I3CA 4A3GB 1F77A 3K5OA 4GLVB 4HIOA 2UUAQ 5G3LD 1GHKA 1EQQA 4A3GG 3H0GH 3SK8A 4J6HA 2B2VC 2IX1A 1F9SA 1EOVA 1EZ8A 4X3TA 3U9OA 4A3EG 2ZJQA 3HKZB 4UY8C 3DWAA 1X3EA 2K75A 1HPCA 1PH4A 1XNQQ 2VQEL 1Y14B 1YHAA 2EXZA 1V1OA 4DUZQ 3S2HH 2ALYB 3GP7A 2K1BA 1S4ZA 1SLJA 4HJ5A 5C4ZA 4H0LC 4CHTB 2OT2A 5M3FH 4DR5Q 4QIWB 2UUCQ 4KK7A 3DUZA 3PCOB 4ID6A 5KGUA 4X6AH 2KCNA 4A93H 4UP9A 1C4QA 2M2LA 3KJPA 1PLFA 1ESRA 4YY3Q 3J80E 1SYFA 2YTYA 1TS2A 3EFXD 1QVCA 2KVMA 3KLWA 1WTOA 2R7ZG 1PH8A 3F2CA 4B3MQ 1ICWA 3LWUA 1W2BA 2H1EA 1CK1A 3PMFA 1G2SA 3HOYB 1AN8A 1EY7A 5EKKA 2F03A 4JI6L 3NQTA 3S14B 4V0BA 2MFIA 5DEHA 2NTTA 2EIFA 1IL8A 3D4DA 1SMXA 1JJGA 2K32A 4FF4A 4IOAA 4F7XA 1PRTF 2NN6I 2G9DA 4K2KA 1CM9A 4RCNA 1TWGH 2XN9C 1B70B 3BZDB 1SYCA 3HOZB 4ZCKA 1D5ZC 1LT3D 2QDBA 1IW7D 1U5KA 1WOCA 4GN5A 4TSSA 2G5DA 1HZCA 3STBD 3HKZE 1YNXA 3ZYYX 1TWFB 1HJPA 4DR1L 4A3MG 1YITA 4JW0A 4KV6A 4A3FH 3UE0A 1VQ7A 3NELA 3K58A 2CWPA 2F0MA 4GNXA 2R92G 2PYKA 3R93A 2F0FA 5E3FA 2IT1A 2FJ2A 4WJWA 4B3SL 4RG1A 5EPLA 5EGTA 3PO2G 3HS0C 4GNXB 3W3AA 5EPKA 4GOPA 2MUYA 2RA4A 1YJ9A 3GTOB 1EUJA 1PYSB 3Q0AA 1XNRQ 1K0RA 5C0XJ 1EQVA 2Y0SE 5LL6S 1CI3M 2F3IA 2UUBQ 1EWHA 5C4XH 1YHQA 1BOSA 4GOPB 2KHJA 1VQ8A 4U673 5LMNW 3L0OA 5LMUQ 1FJGQ 2EJGC 3GTPH 4RFBA 5LMUL 1FJGL 3TS2A 1HZBA 3TZUA 4HCEA 1T5EA 5COYA 4BBSG 5M3FG 3DHQA 3OOCA 3N6RA 3DLLA 1R9TB 2F3VA 3H91A 5JJZA 1CKMA 3HOUG 4OO1H 3S1QH 1NCVA 3GTKB 2L11A 2XTIA 1TWCH 3T13A 4RH6A 1LV9A 1V1PA 3IRBA 1BO0A 4DV5L 1U4LA 1TT2A 1GD7A 2R92H 1CTMA 1EY6A 2K4KA 3K6OA 2B29A 5IGGA 4QUCA 4N9TA 4MN3A 1XPUA 3CF5A 2VUMH 1SYGA 1HFGA 1SRUA 4HJAA 4X3SA 2OTJA 2VQEQ 2EY6A 4OX9L 5I6WA 2NVYB 3I90A 5CBAE 3M3YH 2XRQD 2F0WA 5GAEC 1YJWA 2UUCL 3T56B 3J7AV 3GTGB 5C3XA 3RZDB 1PH2A 2L4NA 3TQYA 3G6EA 3BVMA 4ZYSA 3W2DA 3U4VA 2WAQE 1G291 2L1BA 2JE6I 4BBSH 2UXDL 1AW7A 4LUOA 1A2UA 1ZEQX 1HNZQ 4YCWA 3S14H 1V43A 1X54A 1GOZA 2CH4W 2PI2E 2KEEA 1D6EC 2AUJD 1TWAH 2O5JC 4LFAL 1Q1BA 4KHPL 4DV3Q 1FL0A 4P2CB 5GROA 1O80A 4FNFA 3HEJA 1UE7A 2RCFA 1KC8C 4KJOA 1CSQA 3A8JE 1QVFA 5KYIA 3SK4A 4IUUA 3QG1A 1RL2A 1VQCA 5FLXc 2K01A 1SE3A 4NB3A 4JOIA 4POGA 1ENFA 2EVBA 3SK6A 4DV2Q 1SFOB 1GXDC 1DZ1A 4CBVA 5FLMG 3FRPB 3A7LA 4ZUJA 1ET6A 4A3IH 4WRDA 4A75A 4QL5A 4QMGA 1VQDA 3K5MA 3NWSA 3S9WA 1CHQD 4DR3Q 1HQRD 4R4CA 1EL0A 1JORA 1LM0A 4RKLA 3J81j 1VQBA 2F0HA 3L9AX 1WTQA 3D3RA 2PQAB 3S15H 4XT1B 1WJJA 1HA6A 2RCNA 4B9XA 3NPPA 3I4NB 1BBUA 5CV8A 5FK9C 5C3EG 5T1GA 3H6MA 3FDTA 3ICEA 1S5FD 4EX5A 1LTBD 1VQIA 2HCCA 3WWVA 4R4OA 1U4RA 3A5UA 1KABA 5JOBA 4DK0A 1NR4A 3MC0B 1O7ZA 4OWXB 4LF4L 5IIFA 1PV4A 1Q8KA 2CW0D 4JI1Q 2K04A 2ID0A 3HOYG 5CC4A 5EBCA 1LT4D 1MIUA 3SVMA 2UXCL 2R7ZB 1JMCA 1PXUA 1K83H 1A63A 1YNJD 2K5QA 2EOTA 1IBKL 1B44D 1RF2D 5IP9H 2A68C 5EKLA 1A6XA 2EE1A 1OTCA 3RZOH 2R93G 4C3HB 3IL8A 3D8GA 5LMNL 1I94Q 3MA2B 3KF8B 4JI2L 3S16B 5HGQA 1C8CA 4BY1H 1KLUD 3CD6A 1QILA 1WCMB 3I8ZA 1SNPA 3D31A 4LWCA 3MZ5A 2ATWA 4GKKL 3KF8A 4DF7A 4DR2L 1XPRA 5I4DA 5IYBG 1BUVT 3EA6A 5CYUA 1YBYA 1NMGA 4NMZA 3RN2A 3OWEB 3GD7A 1MJEA 4IUPA 2B39A 1CQVA 4H7BA 1TXYA 1KIXA 1N32L 1PTOC 2PO4A 3GO5A 2GA4B 2K5HA 5M5XB 5EPJA 4A3LH 3CAMA 1EY5A 4CJ1B 3HOWG 3HOVB 5C44G 4JYAQ 1MGSA 3ULPA 1TU2B 2FHTA 3J7AF 4JI5Q 4YWKA 5ELNA 4X62Q 2JQOA 1XWEA 5CV5A 3PGZA 3ZJYC 1WTVA 1HR0Q 3ERQA 1XXGA 4I7ZC 1LUZA 1EFWA 2JJQA 1J6QA 3I2ZA 2LY7A 1W3SA 4K14A 4AYBB 3T53B 3K7UC 2Z0SA 3J80i 3NBHA 1PH3A 4B3RL 2Q8IB 1N36Q 2K5DA 4PZ6A 4HN7A 1ZYRD 1J8IA 1Q3LA 2QW7A 2P5ZX 4ZKBB 4CJ2C 3K5NA 2UXBL 4HJ7A 5M5XH 3NEMA 1NSNS 2UU9Q 5H1SE 4OL7A 2V4DA 1VQNA 2HUGA 2LMCB 4HJ8A 4ILWA 4NXNL 3FP9A 3HOZH 4PNYA 5GADC 1EWCA 1MKHA 1ZXTA 3D4WA 1LTID 4BXXH 4OONA 3BS1A 4JI0Q 1H9KA 3IAYA 1SMYD 4UP8A 3PIPA 3BDLA 1C0AA 1WCMG 1Y8NB 4AYBE 2VL6A 4A93G 2E76C 2HHHQ 1HHVA 1QOHA 3KBGA 1LTRD 4JI7L 1IKLA 4O0AA 4BA2I 3HOYH 1AH9A 2VZAA 4A3GH 1TWAB 3OYYA 4JVZA 4OIJA 4A3KG 1QG7A 4IPDA 2WAQB 5JJIA 5KIXA 5J22A 1QCBD 4QJFA 3VA7A 1GJXA 4FO2A 2EXDA 3D0FA 2X6GA 3H3VI 3I4LA 1CSPA 5C5MA 4HCSA 4LNQA 1PYWD 2I5HA 4ZUIA 2NVTB 3CKIB 2MHVA 2ZTCA 1TS4A 1F9QA 2DN8A 1CKNB 4A3IB 5D3IB 4HIKA 4KKUA 3ITPA 1Q46A 5C3WA
chains in the Genus database with same CATH topology
2NVYH 5M3FH 2OCEA 4DR5Q 1EYGA 2E5LQ 2UUCQ 4IFDG 3GDEA 4WJ4A 4A3DH 4B3RQ 3PCOB 3PSIA 1OXVA 4X6AH 3TS0A 1NJIC 4A93H 4UP9A 1MJCA 2KCMA 4DR5L 3KJPA 2E5LL 4B3ML 1X3FA 4YY3Q 2NN6G 3UDXA 2YTYA 4AIMA 4LFAQ 2WP8J 1OXSC 1QVCA 2D0OA 4JI0L 3KLWA 1L1OA 2R7ZG 2IHEA 3SGIA 3F2CA 1PH8A 1W2BA 4B3MQ 4RMFA 4LF5L 1A0IA 1O7IA 2AMCB 4DK6C 3RR5A 3CP0A 4JI6L 4NPSA 3KJOA 2YYZA 4BA1I 4A3JG 2MFIA 1RIPA 2VS1A 3W1GA 4LFCQ 5HY6A 1XMQL 2EIFA 3GTMH 1SMXA 4DAYB 1JJGA 4IOAA 2XGTA 1R9TH 1SE8A 2JEBI 3PO2H 4DV1L 3A0JA 1NMFA 2NN6I 1TWFH 5M3MG 1TWGH 2HIVA 3G4SA 3RLNA 3H15A 1B70B 4PMWA 4DV7L 3MXNB 4TQUS 1QUQA 4DR6Q 3MEFA 3M4PA 1N32Q 1Q1EA 2RF4A 2PQAA 3F2DA 4FDBA 4JBKA 4A3FG 4IOCA 5FJ8H 1U5KA 1WOCA 2LXKA 4GN5A 3GTJH 1HZCA 1PFSA 4DV7Q 1Y1WH 1YZ6A 3STBD 3HKZE 1YNXA 2JA6H 3BU2A 3OW2A 3G71A 2E2JH 1HJPA 2MNAA 4OX9Q 4P75A 2R7DA 4DR1L 4IJHA 2BA1A 3LGJA 4IJLA 5GAHC 4A3MG 1YITA 1JJ2A 4A3FH 3UE0A 2Q2UA 3TREA 2D0PA 1VQ7A 3DM3A 3NELA 5IT9c 2CWPA 4GNXA 2R92G 3BJUA 4ALPA 1N9WA 2IT1A 2K5VA 1S3OA 4DUZL 1E1TA 4B3SL 2R6GA 4RG1A 2D62A 1L1OC 3PO2G 1PH1A 2JA5G 4GNXB 3CCRA 1E22A 4GN3B 4P71A 2ZM6Q 1IBKQ 1JJCB 4JI8L 4A3JH 4GLXA 4GOPA 4YY3L 5ELOA 1XPOA 1U0LA 2R7FA 1YJ9A 1FVIA 1SR3A 1EUJA 1PYSB 4X64Q 5BR8L 4DUYQ 1K0RA 1IBMQ 5C0XJ 4LF4Q 1XNRQ 2Y0SE 2F3IA 2UUBQ 3K7AH 4DV6L 2CWAA 4LF8Q 1JB7A 5C0XG 4JYAL 5C4XH 1VQ4A 1L0WA 4GOPB 1V9PA 1YHQA 2KHJA 1VQ8A 2CCZA 5LMNW 5IY0A 4C3JH 2QA4A 1VQAA 3L0OA 3CC7A 1VQHA 5LMUQ 1PH9A 1FJGQ 2N49A 4LF7L 3GTPH 5LMUL 1FJGL 3TS2A 1HZBA 2OWOA 3PF5A 2BH2A 1YVCA 4BBSG 3BZKA 4QGUA 4AQYQ 2OQ0A 5M3FG 2UXCQ 1Q86C 1Y1VG 1HNWL 3DLLA 2V1CC 3CCUA 1I3QH 3I7FA 1YI2A 1CKMA 5IP9G 2AWNA 3ERSX 2AKWB 3U4ZA 4JI7Q 4B3TQ 2JA7H 3HOUG 2K14A 4YCVA 3S1QH 1HNWQ 2ZTEA 4DV0Q 4A3CH 4X65Q 2AHOB 3S24A 3J81c 2XTIA 3AYHB 2KCTA 3KDFA 2JA6G 1TWCH 2IX0A 2MQHA 1VQPA 4HJ9A 1PHJA 3IRBA 1S72A 4EQ5A 2JA8G 3RLFA 3CCJA 4JOIC 4B3TL 1Z9FA 4DV5L 2ES2A 1K3RA 4A3KH 1GD7A 2DGYA 1SN8A 1X65A 5AJ3Q 2QEXA 4DV0L 4A76A 4DR3L 3PUXA 1N33L 2R92H 4XTCS 2EQSA 5IP7G 3CCQA 1ASYA 1PYBA 2K4KA 2B29A 2Q2TA 1IZ6A 4KHZA 4DKAC 2OTLA 5M3MH 1K8GA 1XPUA 3CF5A 5AJ3L 2VUMG 2CFMA 2VUMH 1SROA 1NTGA 4DPGA 3CXCA 1K73C 4LF9Q 4BY7H 1SRUA 3OTOQ 1VQOA 3HOWH 3J80c 4HJAA 2ZTDA 4GN4B 4KLKA 4LW1A 3M4QA 5IP7H 2VQEQ 1HR0W 2NVXH 2JA7G 3HOUH 2OTJA 2I0QA 1GKHA 4OX9L 1J5EQ 3M3YH 1N8RC 5EAYA 2VW9A 3M7NA 4R4IA 4DR7Q 3NBHB 1A62A 2ZM6L 3S2DH 2CQOA 3KFUA 3CC2A 1XNRL 4DR7L 5GAEC 1YJWA 2UUCL 4GKJL 4DK3C 2K52A 4OO1G 4JG2A 1VQGA 1IBML 4BXXG 4L5TA 1QZHA 1P16A 4GKJQ 1PH2A 4OWWB 5FLMH 2K5NA 5JJLA 4YHHQ 1G6PA 3TQYA 1HZ9A 3G6EA 4DV6Q 2UUAL 1HH2P 4OWTB 4JCVE 2RHQB 1G51A 3U4VA 2WAQE 1G291 2PI2A 2JE6I 1YJNA 1VQMA 4BBSH 2UXDL 3GTOH 4LUOA 2UU9L 1EIFA 4DV4Q 1HNZQ 4R4QA 4YCWA 5DLQE 3S14H 3PIOA 1X6OA 1QVGA 5GQOA 1V43A 1X54A 4DR4Q 4NXNQ 2PI2E 4LFBL 1HNZL 1VQ9A 1T9HA 4AQYL 4JI1L 2F52A 3EN2A 3PUYA 4LF6Q 1TWAH 4GS3A 3S16H 4A3CG 2B3GA 4LFAL 3E9HA 2WFWA 1WI5A 2Q2IA 1Q1BA 1KL9A 1A8VA 2CKZB 1AE3A 3PUVA 1FL0A 4C3HH 3JAMc 5GROA 4IPCA 3CMEA 1WYDA 4PZ8A 3KYHC 2UXBQ 1CKNA 1UE7A 4A3DG 1UEBA 1KC8C 1CSQA 4X65L 4JI6Q 1QVFA 3PV0A 3AFPA 3CC4A 2Z6KA 3U58A 1RL2A 4Y7NH 1VQCA 2YTXA 5FLXc 4JYAQ 3RZDH 2GVAA 2QGQA 4NB3A 3M9BA 4R1JA 3ULJA 3F2BA 4JOIA 3RLOA 4POGA 4A3BG 1HNXQ 3CCSA 4IPGA 1N33Q 2R7ZH 1Q82C 4DV2Q 4IFDI 3Q8DA 4YWMA 1Q7YC 5FLMG 3JC66 4O2DA 5E7NA 1XMOL 3CCLA 3B6YA 2HIXA 5C44H 2H5XA 4A3IH 1VQLA 5C4XG 1IXRA 3FHWA 4TVAB 2E2IH 4A75A 4QL5A 2HHHL 4LF5Q 2C35B 4DV2L 3W1BA 3KDFB 4A3LG 1VQDA 4DV5Q 3OTOL 3I56A 1E1OA 1UWVA 4DR3Q 3L2PA 1K9MC 4R4CA 1UE6A 3E0EA 3ER0A 4GNXC 3F8TA 5IYBH 1Y1WG 1LM0A 3EIVA 4JI4Q 2WB1E 1D8LA 4APVA 3J81j 2JA5H 5IWAQ 1IL2A 1VQBA 2AWOA 4QIWE 3CCEA 3TEHB 5IYDG 1OXXK 2PQAB 3T1HL 5IWAL 3S15H 1WJJA 2KENA 4P72A 2RCNA 3STBC 3HOXH 2DUDA 1BBUA 3T1YQ 1S40A 4HIDA 2F4VL 1H95A 1M90C 3CPFA 2FXQA 3JAMi 5C3EG 4YHHL 2ZJRA 4A3EH 1PH5A 3GTQH 3S1NH 1OXTA 3T1YL 1N34Q 3ICEA 3H0GG 2UXDQ 4EX5A 1VQIA 4JI3L 4LF8L 2Z6KC 4BY1G 4DAMA 3HOWG 4BY7G 4C2MH 3S17H 5IYCH 3WWVA 4DNIA 4R4OA 1ASZA 4JBJA 3A5UA 3AQQA 2N8NA 4DR4L 4LFBQ 3I4OA 4NXML 4OXPA 4AH6A 1PA6A 2A1AA 4OWXB 4LF4L 1PV4A 1Q8KA 4JI1Q 2BA0A 1DGSA 5JEAG 2ID0A 4POFA 3HKZG 1NY4A 3HOYG 4JV5Q 3K81C 3F1ZA 3U50C 1MIUA 1M1KC 1I5FA 4B3SQ 4KHPQ 2B63H 1SFOH 3S1RH 2UXCL 1GO3E 4GLAC 1JE5A 1QZGA 1JMCA 4OO1I 1V1QA 1K83H 3ULLA 3FKIG 3FKIH 1LTLA 3J81i 1A63A 1QUQB 3I55A 3J7A5 4L5RC 1IBKL 5JJKA 3TRZA 2NVTH 3H3VH 1X9NA 4LF7Q 4P74A 4JI8Q 3AEVA 2B63G 5IP9H 1B8AA 2IY5B 3I4MG 4DV3L 1LYLA 1OTCA 3RZOH 1P8LA 2R93G 2A8VA 3A74A 4YCUA 5C3EH 5LMNL 3L7ZC 1VCIA 1I94Q 2Q2HA 3KF8B 4JI2L 2NVQH 1VQFA 3S1MH 4IFDJ 1N36L 5HGQA 4QQBX 2WB1G 5IYCG 3HOXG 1I94L 5J3BA 1PVOA 4BY1H 1KRSA 4GKKQ 4R4TA 3K80C 4H02A 5FJ8G 3CD6A 3PF4A 1I6HH 1I50H 3D31A 4LWCA 5LMNQ 2MO0A 4DR1Q 4KHPL 4X66Q 2PNHA 2I5LX 2NZOA 2YV5A 4LF9L 2ATWA 4DR2L 4GKKL 1E7ZA 4PZ7A 2KHIA 1XPRA 3KF6B 2MO1A 2HT1A 3GTKH 3UDIA 5M5YH 4K0KQ 5IYBG 1IBLL 1YBYA 2GVBA 1XMQQ 1NMGA 3HOVH 3NENA 3RNUA 2JA9A 3RN2A 3M4OH 3GD7A 3VDYA 1X3GA 4UPAA 2LXJA 3PUZA 1EWIA 1X56A 1MJEA 4JC0A 1KQSA 4YWLA 4JI4L 1N34L 4ME3A 1OXUA 1TXYA 1KIXA 3GTLH 3CMAA 2GN5A 1C7YA 1N32L 2JK8A 1E3PA 3GO5A 2PMZE 1Q81C 3PO3G 2K5HA 5BR8Q 4X64L 4DUYL 4A3BH 4A3LH 5IE8A 1KD1C 4A4IA 3CAMA 2R93H 2K50A 1CKOA 4X62L 2NZHA 1KHIA 5C44G 2VY3A 4A3IG 1VQ5A 1NBWA 1VQKA 3UE1A 4DV4L 1EQRA 3BZCA 3CQZH 2IHFA 3ULPA 2F4VQ 1YEZA 3HOZG 1HR0L 2E2HH 3CPWA 3EBEA 2ZJPA 3CCMA 1UE1A 2RHSB 4JI5Q 4YWKA 4JV5L 2E8GA 4MNOA 1WCMH 5ELNA 2JQOA 1BVSA 2OQKA 1NE3A 4X62Q 4UP7A 3I4NG 4LUZA 4PG3A 1KRTA 1VQJA 4KI0A 3PGZA 3ZJYC 1HR0Q 4LUVA 1EFWA 1LUZA 2JJQA 1PH6A 1C9OA 1J6QA 1VS0A 3I2ZA 4JI5L 1GM5A 4BBRH 1W3SA 1Y1VH 3UDGA 2WAQG 1KXLA 4JBMA 1IYJB 3K7UC 1VQEA 1FGUA 2Z0SA 3KF6A 4LF6L 3J80i 4JI2Q 1PH3A 1EIYB 4B3RL 2JEAI 2VNUD 2A19A 1N36Q 4JBWA 4PZ6A 2HQLA 4QY7A 1E24A 5K36G 4AYBG 2UUBL 2UXBL 3CW2C 4HJ7A 5M5XH 3NEMA 1Z47A 2YTVA 4C3IH 1L2FA 4IO9A 2UU9Q 5H1SE 1BBWA 4DR2Q 3CCVA 1VQNA 2ASBA 4HJ8A 2N3SA 1KAWA 1TWHH 2BH8A 3FP9A 2L15A 4P73A 4NXNL 4K0KL 3K0XA 3HOZH 1XTDA 4Y52H 1CUKA 1MKHA 5GADC 1IBLQ 1HNXL 3K8AA 4BXXH 4OONA 4XIGS 4JI0Q 1Q12A 4UP8A 3PIPA 3AFQA 1XMOQ 1C0AA 1B7YB 1WCMG 4AYBE 2I5MX 2VL6A 3A5ZB 5JEAJ 5C0XI 3G48A 4L5SA 4DR6L 4A93G 3J7ZC 2HHHQ 1XJVA 1J5EL 4WJ3M 4X66L 2KBNA 1BKBA 3HOVG 2N78A 2Y0SG 3KOJA 4LFCL 3UDFA 4JI7L 3T1HQ 4O0AA 2YU9H 4BA2I 4L5QA 1VQ6A 3M85A 2VZAA 3HOYH 4A3GH 5IYDH 1AH9A 3I4NH 2VQFQ 3OYYA 1PH7A 4DV1Q 4A3MH 3I4MH 1AE2A 4A3KG 3PUWA 3W5OA 3PO3H 4IPDA 2VQFL 4MTNA 1YIJA 5JJIA 4GOPC 1D7QA 4GLVB 4HIOA 2UUAQ 4QJFA 4J15A 1UE5A 5GAGC 1JT8A 4DV3Q 3HFZB 5C4JH 1EQQA 4MZ9A 4A3GG 2EXDA 3H0GH 1X55A 1XNQL 3D0FA 2IX1A 3H3VI 1CSPA 1EOVA 4LNQA 4NXMQ 1GVPA 1WFQA 4A3EG 2I5HA 2ZJQA 3HKSA 4HIMA 4UY8C 2JA8H 2ZTCA 1X3EA 2K75A 1PH4A 3GTGH 5M5WH 1XNQQ 4JI3Q 1CKNB 2VQEL 1K8AC 1L1OB 1Y14B 1YHAA 3RN5A 4IPHA 4DUZQ 3S2HH 2ALYB 4HIKA 2LSSA 4BBRG 1HZAA 1YHBA 1Q46A 1SLJA 4HJ5A 3E9IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NVY H;  5M3F H;  2OCE A;  4DR5 Q;  1EYG A;  2E5L Q;  2UUC Q;  4IFD G;  3GDE A;  4WJ4 A;  4A3D H;  4B3R Q;  3PCO B;  3PSI A;  1OXV A;  4X6A H;  3TS0 A;  1NJI C;  4A93 H;  4UP9 A;  1MJC A;  2KCM A;  4DR5 L;  3KJP A;  2E5L L;  4B3M L;  1X3F A;  4YY3 Q;  2NN6 G;  3UDX A;  2YTY A;  4AIM A;  4LFA Q;  2WP8 J;  1OXS C;  1QVC A;  2D0O A;  4JI0 L;  3KLW A;  1L1O A;  2R7Z G;  2IHE A;  3SGI A;  3F2C A;  1PH8 A;  1W2B A;  4B3M Q;  4RMF A;  4LF5 L;  1A0I A;  1O7I A;  2AMC B;  4DK6 C;  3RR5 A;  3CP0 A;  4JI6 L;  4NPS A;  3KJO A;  2YYZ A;  4BA1 I;  4A3J G;  2MFI A;  1RIP A;  2VS1 A;  3W1G A;  4LFC Q;  5HY6 A;  1XMQ L;  2EIF A;  3GTM H;  1SMX A;  4DAY B;  1JJG A;  4IOA A;  2XGT A;  1R9T H;  1SE8 A;  2JEB I;  3PO2 H;  4DV1 L;  3A0J A;  1NMF A;  2NN6 I;  1TWF H;  5M3M G;  1TWG H;  2HIV A;  3G4S A;  3RLN A;  3H15 A;  1B70 B;  4PMW A;  4DV7 L;  3MXN B;  4TQU S;  1QUQ A;  4DR6 Q;  3MEF A;  3M4P A;  1N32 Q;  1Q1E A;  2RF4 A;  2PQA A;  3F2D A;  4FDB A;  4JBK A;  4A3F G;  4IOC A;  5FJ8 H;  1U5K A;  1WOC A;  2LXK A;  4GN5 A;  3GTJ H;  1HZC A;  1PFS A;  4DV7 Q;  1Y1W H;  1YZ6 A;  3STB D;  3HKZ E;  1YNX A;  2JA6 H;  3BU2 A;  3OW2 A;  3G71 A;  2E2J H;  1HJP A;  2MNA A;  4OX9 Q;  4P75 A;  2R7D A;  4DR1 L;  4IJH A;  2BA1 A;  3LGJ A;  4IJL A;  5GAH C;  4A3M G;  1YIT A;  1JJ2 A;  4A3F H;  3UE0 A;  2Q2U A;  3TRE A;  2D0P A;  1VQ7 A;  3DM3 A;  3NEL A;  5IT9 c;  2CWP A;  4GNX A;  2R92 G;  3BJU A;  4ALP A;  1N9W A;  2IT1 A;  2K5V A;  1S3O A;  4DUZ L;  1E1T A;  4B3S L;  2R6G A;  4RG1 A;  2D62 A;  1L1O C;  3PO2 G;  1PH1 A;  2JA5 G;  4GNX B;  3CCR A;  1E22 A;  4GN3 B;  4P71 A;  2ZM6 Q;  1IBK Q;  1JJC B;  4JI8 L;  4A3J H;  4GLX A;  4GOP A;  4YY3 L;  5ELO A;  1XPO A;  1U0L A;  2R7F A;  1YJ9 A;  1FVI A;  1SR3 A;  1EUJ A;  1PYS B;  4X64 Q;  5BR8 L;  4DUY Q;  1K0R A;  1IBM Q;  5C0X J;  4LF4 Q;  1XNR Q;  2Y0S E;  2F3I A;  2UUB Q;  3K7A H;  4DV6 L;  2CWA A;  4LF8 Q;  1JB7 A;  5C0X G;  4JYA L;  5C4X H;  1VQ4 A;  1L0W A;  4GOP B;  1V9P A;  1YHQ A;  2KHJ A;  1VQ8 A;  2CCZ A;  5LMN W;  5IY0 A;  4C3J H;  2QA4 A;  1VQA A;  3L0O A;  3CC7 A;  1VQH A;  5LMU Q;  1PH9 A;  1FJG Q;  2N49 A;  4LF7 L;  3GTP H;  5LMU L;  1FJG L;  3TS2 A;  1HZB A;  2OWO A;  3PF5 A;  2BH2 A;  1YVC A;  4BBS G;  3BZK A;  4QGU A;  4AQY Q;  2OQ0 A;  5M3F G;  2UXC Q;  1Q86 C;  1Y1V G;  1HNW L;  3DLL A;  2V1C C;  3CCU A;  1I3Q H;  3I7F A;  1YI2 A;  1CKM A;  5IP9 G;  2AWN A;  3ERS X;  2AKW B;  3U4Z A;  4JI7 Q;  4B3T Q;  2JA7 H;  3HOU G;  2K14 A;  4YCV A;  3S1Q H;  1HNW Q;  2ZTE A;  4DV0 Q;  4A3C H;  4X65 Q;  2AHO B;  3S24 A;  3J81 c;  2XTI A;  3AYH B;  2KCT A;  3KDF A;  2JA6 G;  1TWC H;  2IX0 A;  2MQH A;  1VQP A;  4HJ9 A;  1PHJ A;  3IRB A;  1S72 A;  4EQ5 A;  2JA8 G;  3RLF A;  3CCJ A;  4JOI C;  4B3T L;  1Z9F A;  4DV5 L;  2ES2 A;  1K3R A;  4A3K H;  1GD7 A;  2DGY A;  1SN8 A;  1X65 A;  5AJ3 Q;  2QEX A;  4DV0 L;  4A76 A;  4DR3 L;  3PUX A;  1N33 L;  2R92 H;  4XTC S;  2EQS A;  5IP7 G;  3CCQ A;  1ASY A;  1PYB A;  2K4K A;  2B29 A;  2Q2T A;  1IZ6 A;  4KHZ A;  4DKA C;  2OTL A;  5M3M H;  1K8G A;  1XPU A;  3CF5 A;  5AJ3 L;  2VUM G;  2CFM A;  2VUM H;  1SRO A;  1NTG A;  4DPG A;  3CXC A;  1K73 C;  4LF9 Q;  4BY7 H;  1SRU A;  3OTO Q;  1VQO A;  3HOW H;  3J80 c;  4HJA A;  2ZTD A;  4GN4 B;  4KLK A;  4LW1 A;  3M4Q A;  5IP7 H;  2VQE Q;  1HR0 W;  2NVX H;  2JA7 G;  3HOU H;  2OTJ A;  2I0Q A;  1GKH A;  4OX9 L;  1J5E Q;  3M3Y H;  1N8R C;  5EAY A;  2VW9 A;  3M7N A;  4R4I A;  4DR7 Q;  3NBH B;  1A62 A;  2ZM6 L;  3S2D H;  2CQO A;  3KFU A;  3CC2 A;  1XNR L;  4DR7 L;  5GAE C;  1YJW A;  2UUC L;  4GKJ L;  4DK3 C;  2K52 A;  4OO1 G;  4JG2 A;  1VQG A;  1IBM L;  4BXX G;  4L5T A;  1QZH A;  1P16 A;  4GKJ Q;  1PH2 A;  4OWW B;  5FLM H;  2K5N A;  5JJL A;  4YHH Q;  1G6P A;  3TQY A;  1HZ9 A;  3G6E A;  4DV6 Q;  2UUA L;  1HH2 P;  4OWT B;  4JCV E;  2RHQ B;  1G51 A;  3U4V A;  2WAQ E;  1G29 1;  2PI2 A;  2JE6 I;  1YJN A;  1VQM A;  4BBS H;  2UXD L;  3GTO H;  4LUO A;  2UU9 L;  1EIF A;  4DV4 Q;  1HNZ Q;  4R4Q A;  4YCW A;  5DLQ E;  3S14 H;  3PIO A;  1X6O A;  1QVG A;  5GQO A;  1V43 A;  1X54 A;  4DR4 Q;  4NXN Q;  2PI2 E;  4LFB L;  1HNZ L;  1VQ9 A;  1T9H A;  4AQY L;  4JI1 L;  2F52 A;  3EN2 A;  3PUY A;  4LF6 Q;  1TWA H;  4GS3 A;  3S16 H;  4A3C G;  2B3G A;  4LFA L;  3E9H A;  2WFW A;  1WI5 A;  2Q2I A;  1Q1B A;  1KL9 A;  1A8V A;  2CKZ B;  1AE3 A;  3PUV A;  1FL0 A;  4C3H H;  3JAM c;  5GRO A;  4IPC A;  3CME A;  1WYD A;  4PZ8 A;  3KYH C;  2UXB Q;  1CKN A;  1UE7 A;  4A3D G;  1UEB A;  1KC8 C;  1CSQ A;  4X65 L;  4JI6 Q;  1QVF A;  3PV0 A;  3AFP A;  3CC4 A;  2Z6K A;  3U58 A;  1RL2 A;  4Y7N H;  1VQC A;  2YTX A;  5FLX c;  4JYA Q;  3RZD H;  2GVA A;  2QGQ A;  4NB3 A;  3M9B A;  4R1J A;  3ULJ A;  3F2B A;  4JOI A;  3RLO A;  4POG A;  4A3B G;  1HNX Q;  3CCS A;  4IPG A;  1N33 Q;  2R7Z H;  1Q82 C;  4DV2 Q;  4IFD I;  3Q8D A;  4YWM A;  1Q7Y C;  5FLM G;  3JC6 6;  4O2D A;  5E7N A;  1XMO L;  3CCL A;  3B6Y A;  2HIX A;  5C44 H;  2H5X A;  4A3I H;  1VQL A;  5C4X G;  1IXR A;  3FHW A;  4TVA B;  2E2I H;  4A75 A;  4QL5 A;  2HHH L;  4LF5 Q;  2C35 B;  4DV2 L;  3W1B A;  3KDF B;  4A3L G;  1VQD A;  4DV5 Q;  3OTO L;  3I56 A;  1E1O A;  1UWV A;  4DR3 Q;  3L2P A;  1K9M C;  4R4C A;  1UE6 A;  3E0E A;  3ER0 A;  4GNX C;  3F8T A;  5IYB H;  1Y1W G;  1LM0 A;  3EIV A;  4JI4 Q;  2WB1 E;  1D8L A;  4APV A;  3J81 j;  2JA5 H;  5IWA Q;  1IL2 A;  1VQB A;  2AWO A;  4QIW E;  3CCE A;  3TEH B;  5IYD G;  1OXX K;  2PQA B;  3T1H L;  5IWA L;  3S15 H;  1WJJ A;  2KEN A;  4P72 A;  2RCN A;  3STB C;  3HOX H;  2DUD A;  1BBU A;  3T1Y Q;  1S40 A;  4HID A;  2F4V L;  1H95 A;  1M90 C;  3CPF A;  2FXQ A;  3JAM i;  5C3E G;  4YHH L;  2ZJR A;  4A3E H;  1PH5 A;  3GTQ H;  3S1N H;  1OXT A;  3T1Y L;  1N34 Q;  3ICE A;  3H0G G;  2UXD Q;  4EX5 A;  1VQI A;  4JI3 L;  4LF8 L;  2Z6K C;  4BY1 G;  4DAM A;  3HOW G;  4BY7 G;  4C2M H;  3S17 H;  5IYC H;  3WWV A;  4DNI A;  4R4O A;  1ASZ A;  4JBJ A;  3A5U A;  3AQQ A;  2N8N A;  4DR4 L;  4LFB Q;  3I4O A;  4NXM L;  4OXP A;  4AH6 A;  1PA6 A;  2A1A A;  4OWX B;  4LF4 L;  1PV4 A;  1Q8K A;  4JI1 Q;  2BA0 A;  1DGS A;  5JEA G;  2ID0 A;  4POF A;  3HKZ G;  1NY4 A;  3HOY G;  4JV5 Q;  3K81 C;  3F1Z A;  3U50 C;  1MIU A;  1M1K C;  1I5F A;  4B3S Q;  4KHP Q;  2B63 H;  1SFO H;  3S1R H;  2UXC L;  1GO3 E;  4GLA C;  1JE5 A;  1QZG A;  1JMC A;  4OO1 I;  1V1Q A;  1K83 H;  3ULL A;  3FKI G;  3FKI H;  1LTL A;  3J81 i;  1A63 A;  1QUQ B;  3I55 A;  3J7A 5;  4L5R C;  1IBK L;  5JJK A;  3TRZ A;  2NVT H;  3H3V H;  1X9N A;  4LF7 Q;  4P74 A;  4JI8 Q;  3AEV A;  2B63 G;  5IP9 H;  1B8A A;  2IY5 B;  3I4M G;  4DV3 L;  1LYL A;  1OTC A;  3RZO H;  1P8L A;  2R93 G;  2A8V A;  3A74 A;  4YCU A;  5C3E H;  5LMN L;  3L7Z C;  1VCI A;  1I94 Q;  2Q2H A;  3KF8 B;  4JI2 L;  2NVQ H;  1VQF A;  3S1M H;  4IFD J;  1N36 L;  5HGQ A;  4QQB X;  2WB1 G;  5IYC G;  3HOX G;  1I94 L;  5J3B A;  1PVO A;  4BY1 H;  1KRS A;  4GKK Q;  4R4T A;  3K80 C;  4H02 A;  5FJ8 G;  3CD6 A;  3PF4 A;  1I6H H;  1I50 H;  3D31 A;  4LWC A;  5LMN Q;  2MO0 A;  4DR1 Q;  4KHP L;  4X66 Q;  2PNH A;  2I5L X;  2NZO A;  2YV5 A;  4LF9 L;  2ATW A;  4DR2 L;  4GKK L;  1E7Z A;  4PZ7 A;  2KHI A;  1XPR A;  3KF6 B;  2MO1 A;  2HT1 A;  3GTK H;  3UDI A;  5M5Y H;  4K0K Q;  5IYB G;  1IBL L;  1YBY A;  2GVB A;  1XMQ Q;  1NMG A;  3HOV H;  3NEN A;  3RNU A;  2JA9 A;  3RN2 A;  3M4O H;  3GD7 A;  3VDY A;  1X3G A;  4UPA A;  2LXJ A;  3PUZ A;  1EWI A;  1X56 A;  1MJE A;  4JC0 A;  1KQS A;  4YWL A;  4JI4 L;  1N34 L;  4ME3 A;  1OXU A;  1TXY A;  1KIX A;  3GTL H;  3CMA A;  2GN5 A;  1C7Y A;  1N32 L;  2JK8 A;  1E3P A;  3GO5 A;  2PMZ E;  1Q81 C;  3PO3 G;  2K5H A;  5BR8 Q;  4X64 L;  4DUY L;  4A3B H;  4A3L H;  5IE8 A;  1KD1 C;  4A4I A;  3CAM A;  2R93 H;  2K50 A;  1CKO A;  4X62 L;  2NZH A;  1KHI A;  5C44 G;  2VY3 A;  4A3I G;  1VQ5 A;  1NBW A;  1VQK A;  3UE1 A;  4DV4 L;  1EQR A;  3BZC A;  3CQZ H;  2IHF A;  3ULP A;  2F4V Q;  1YEZ A;  3HOZ G;  1HR0 L;  2E2H H;  3CPW A;  3EBE A;  2ZJP A;  3CCM A;  1UE1 A;  2RHS B;  4JI5 Q;  4YWK A;  4JV5 L;  2E8G A;  4MNO A;  1WCM H;  5ELN A;  2JQO A;  1BVS A;  2OQK A;  1NE3 A;  4X62 Q;  4UP7 A;  3I4N G;  4LUZ A;  4PG3 A;  1KRT A;  1VQJ A;  4KI0 A;  3PGZ A;  3ZJY C;  1HR0 Q;  4LUV A;  1EFW A;  1LUZ A;  2JJQ A;  1PH6 A;  1C9O A;  1J6Q A;  1VS0 A;  3I2Z A;  4JI5 L;  1GM5 A;  4BBR H;  1W3S A;  1Y1V H;  3UDG A;  2WAQ G;  1KXL A;  4JBM A;  1IYJ B;  3K7U C;  1VQE A;  1FGU A;  2Z0S A;  3KF6 A;  4LF6 L;  3J80 i;  4JI2 Q;  1PH3 A;  1EIY B;  4B3R L;  2JEA I;  2VNU D;  2A19 A;  1N36 Q;  4JBW A;  4PZ6 A;  2HQL A;  4QY7 A;  1E24 A;  5K36 G;  4AYB G;  2UUB L;  2UXB L;  3CW2 C;  4HJ7 A;  5M5X H;  3NEM A;  1Z47 A;  2YTV A;  4C3I H;  1L2F A;  4IO9 A;  2UU9 Q;  5H1S E;  1BBW A;  4DR2 Q;  3CCV A;  1VQN A;  2ASB A;  4HJ8 A;  2N3S A;  1KAW A;  1TWH H;  2BH8 A;  3FP9 A;  2L15 A;  4P73 A;  4NXN L;  4K0K L;  3K0X A;  3HOZ H;  1XTD A;  4Y52 H;  1CUK A;  1MKH A;  5GAD C;  1IBL Q;  1HNX L;  3K8A A;  4BXX H;  4OON A;  4XIG S;  4JI0 Q;  1Q12 A;  4UP8 A;  3PIP A;  3AFQ A;  1XMO Q;  1C0A A;  1B7Y B;  1WCM G;  4AYB E;  2I5M X;  2VL6 A;  3A5Z B;  5JEA J;  5C0X I;  3G48 A;  4L5S A;  4DR6 L;  4A93 G;  3J7Z C;  2HHH Q;  1XJV A;  1J5E L;  4WJ3 M;  4X66 L;  2KBN A;  1BKB A;  3HOV G;  2N78 A;  2Y0S G;  3KOJ A;  4LFC L;  3UDF A;  4JI7 L;  3T1H Q;  4O0A A;  2YU9 H;  4BA2 I;  4L5Q A;  1VQ6 A;  3M85 A;  2VZA A;  3HOY H;  4A3G H;  5IYD H;  1AH9 A;  3I4N H;  2VQF Q;  3OYY A;  1PH7 A;  4DV1 Q;  4A3M H;  3I4M H;  1AE2 A;  4A3K G;  3PUW A;  3W5O A;  3PO3 H;  4IPD A;  2VQF L;  4MTN A;  1YIJ A;  5JJI A;  4GOP C;  1D7Q A;  4GLV B;  4HIO A;  2UUA Q;  4QJF A;  4J15 A;  1UE5 A;  5GAG C;  1JT8 A;  4DV3 Q;  3HFZ B;  5C4J H;  1EQQ A;  4MZ9 A;  4A3G G;  2EXD A;  3H0G H;  1X55 A;  1XNQ L;  3D0F A;  2IX1 A;  3H3V I;  1CSP A;  1EOV A;  4LNQ A;  4NXM Q;  1GVP A;  1WFQ A;  4A3E G;  2I5H A;  2ZJQ A;  3HKS A;  4HIM A;  4UY8 C;  2JA8 H;  2ZTC A;  1X3E A;  2K75 A;  1PH4 A;  3GTG H;  5M5W H;  1XNQ Q;  4JI3 Q;  1CKN B;  2VQE L;  1K8A C;  1L1O B;  1Y14 B;  1YHA A;  3RN5 A;  4IPH A;  4DUZ Q;  3S2H H;  2ALY B;  4HIK A;  2LSS A;  4BBR G;  1HZA A;  1YHB A;  1Q46 A;  1SLJ A;  4HJ5 A;  3E9I A; 
#chains in the Genus database with same CATH topology
 3C2P A;  1F2L A;  1EYG A;  1TWG B;  2B2U C;  2ENB A;  2SNM A;  2F0D A;  1TKW B;  2E5L L;  3NTI A;  4B3M L;  4KKS A;  2NN6 G;  2B2T C;  3S1N B;  4LFA Q;  2WP8 J;  1MHW C;  1QWY A;  2VXW A;  5EQ0 A;  4KD4 A;  2D0O A;  3Q22 A;  2IHE A;  3C46 A;  4RMF A;  1A0I A;  1O7I A;  5A35 A;  2AMC B;  1B53 A;  1BDO A;  1RIP A;  3W1G A;  2LKV A;  3RZO B;  1RHP A;  3MXN A;  1RD9 D;  4DAY B;  5A2Q L;  2PW7 A;  1VDZ A;  1SE8 A;  2JEB I;  4IAL A;  4K5V A;  3OIQ A;  4DV1 L;  4KTA A;  2FIN B;  1TWF H;  2B2Y A;  4HTH A;  3RLN A;  3H15 A;  1STE A;  2R61 A;  3MXN B;  1KAA A;  3GV6 A;  4TQU S;  2ICI A;  1DOM A;  1SNO A;  2B2W A;  1XYI A;  2PQA A;  4A3F G;  3R2I A;  4IOC A;  2NTS A;  2LXK A;  2EYJ A;  1Y1W H;  2L12 A;  4FP5 D;  2JA6 H;  1DYQ A;  4ZRZ A;  3OW2 A;  2ZT9 C;  2F0E A;  4OX9 Q;  2F0T A;  1ENA A;  1PRT D;  3TRE A;  2B2V A;  2D0P A;  3KLS A;  4J1M A;  3DM3 A;  5IT9 c;  2JP1 A;  3OSO A;  3BJU A;  4ALP A;  1S3O A;  1I50 B;  1JWS D;  2R6G A;  4BY1 B;  4K5X A;  4IZ8 A;  1QNU A;  2H4O A;  1E22 A;  2ZM6 Q;  2A6E D;  3O13 A;  5C3E B;  3H3V C;  4A3J H;  4YY3 L;  1I4G A;  3HRZ C;  1I4H A;  1A2T A;  4LF4 Q;  4KJN A;  1Z6H A;  4DV6 L;  2CWA A;  2E74 C;  4LF8 Q;  2A68 D;  4A3D B;  1HUM A;  2CCZ A;  2F0L A;  4C3J G;  1VQA A;  2CW0 C;  1PH9 A;  3MTS A;  2IL8 A;  3OWF A;  4HR7 B;  1HUN A;  2BH2 A;  1YVC A;  5CV4 A;  4QGU A;  4AQY Q;  1IHZ A;  2AUK A;  1Q86 C;  1K28 A;  1EY4 A;  1HNW L;  1BCP B;  3PO2 B;  3S17 B;  2AWN A;  4XQN A;  4JI7 Q;  4B3T Q;  2K14 A;  3R8B A;  5FO7 B;  4Z9C B;  4FYD A;  3KLS X;  5C4J B;  4DV0 Q;  4X65 Q;  1PTO D;  2AHO B;  1SEB D;  2PMZ B;  2KCT A;  2IX0 A;  1PHJ A;  1VQP A;  1O7L A;  4HJ9 A;  2JA8 G;  4EQ5 A;  1Q8I A;  4JOI C;  4DAY A;  1ILP A;  2DGY A;  5AJ3 Q;  3I4M G;  1MBY A;  4YIJ A;  1ESF A;  3S15 B;  4OEL B;  4L63 B;  2RDH A;  3LWE A;  2NWG A;  1ASY A;  4ZKC B;  2Q2T A;  3L3O C;  4DKA C;  3M4Y A;  1SXT A;  1SRO A;  5CV6 A;  1V8Q A;  4DPG A;  4TKO B;  4LF9 Q;  4BBS B;  3IKJ A;  2M00 A;  2IX3 A;  2ZTD A;  3M4Q A;  3T4A C;  3C1E A;  2NVX H;  2JA7 G;  2QDL A;  1NAP A;  4UDU C;  1J5E Q;  1N8R C;  5EAY A;  2VW9 A;  1A62 A;  2ZM6 L;  2MP1 A;  3S2D H;  2SDF A;  4BS9 A;  1JCK B;  4KHV A;  1MSH A;  1QE6 A;  1VQG A;  4BXX G;  4L5T A;  1P16 A;  4GKJ Q;  2JA8 B;  2F0J A;  2F4I A;  2JYO A;  1G6P A;  2UUA L;  1HZ9 A;  4JK1 C;  2N88 A;  4BY7 B;  3GTO H;  1S5B D;  2ZXR A;  2L5T A;  3PIO A;  1X6O A;  1Y1V B;  3G6J B;  2XRS D;  4DR4 Q;  1A3V A;  2A74 C;  4CKE A;  2K03 A;  3K0Y A;  3PUY A;  2K6A A;  3S16 H;  1WI5 A;  2Q2I A;  1A8V A;  2CKZ B;  3PUV A;  4C3H H;  1AE3 A;  1FYC A;  2UXB Q;  2K33 A;  5E4W C;  1UEB A;  4DXG A;  4X65 L;  4BWG B;  5DM7 3;  4DK1 A;  3QOL A;  3AFP A;  3CC4 A;  1F9R A;  1DCZ A;  4CJ0 B;  3U58 A;  1EYA A;  4K5W A;  3AU7 A;  2GVA A;  2QGQ A;  3F2B A;  5E1F A;  2R7Z H;  3Q8D A;  1Q7Y C;  1CQF A;  2IPK D;  5E7N A;  3CCL A;  2HHH L;  2C35 B;  1GUT A;  3VR4 A;  4DV2 L;  1FR3 A;  4HAE A;  4DV5 Q;  4KN4 C;  1VF7 A;  3NP8 A;  4FXD A;  1RDP D;  5IYB H;  1Y1W G;  4JI4 Q;  3EIV A;  3A7A B;  4KN7 C;  2QKI C;  4Q5V A;  1TY2 A;  2XVS A;  2KCC A;  4QIW E;  1OXX K;  1GUG A;  4P72 A;  3STB C;  2CHB D;  3FMC A;  3T1Y Q;  4HID A;  1H95 A;  5HUR A;  3JAM i;  3J7Y W;  4YHH L;  3I73 A;  2ZXP A;  2JA5 B;  3NE5 B;  3H0G G;  1BQQ T;  4KKT A;  2BDO A;  4C2M H;  1LTG D;  5IYC H;  3S17 H;  4JBJ A;  3AQQ A;  1EY8 A;  4OXP A;  1PA6 A;  3AB9 A;  1DGS A;  1ZYR C;  3U50 C;  5KND A;  1M1K C;  4G7O C;  2B63 H;  3S1R H;  2EJF C;  1QZG A;  4OO1 I;  5M5W B;  3FKI G;  1H9J A;  1LTL A;  1QUQ B;  5IGB A;  3I55 A;  2WII B;  5FO9 B;  4L5R C;  3TRZ A;  2RKS A;  3QB3 A;  4WFN 3;  1EIH A;  2B2U A;  2B63 G;  2F0P A;  1CA6 A;  1SDF A;  2IY5 B;  2A6H D;  1LYL A;  5LHY 1;  5M3M B;  5DNF A;  1B4O A;  2A8V A;  3A74 A;  3N52 A;  1I6H B;  3OMC A;  1WTW A;  5JVG 3;  1N36 L;  4L6T B;  2BE5 C;  2XNA C;  3I4M B;  1A15 A;  2KJX A;  4DAP A;  1PVO A;  3WOF A;  2RVL A;  3K80 C;  4H02 A;  1I6H H;  5LMN Q;  2MO0 A;  4E6I A;  2PNH A;  2NZO A;  4LF9 L;  2J4X A;  1E7Z A;  3U9S A;  3K59 A;  3KF6 B;  2HT1 A;  3GTK H;  5M5Y H;  4G7H C;  1B9M A;  1HCZ A;  2GVB A;  2KQ3 A;  1XMQ Q;  2D5D A;  2JA9 A;  3CU7 A;  3VDY A;  1X3G A;  4UPA A;  2LXJ A;  1WTR A;  1D2B A;  3R3O A;  2WV6 D;  4ME3 A;  1OXU A;  2L55 A;  2PPB C;  3MAQ A;  3CMA A;  3GTL H;  4N9P A;  1TS5 A;  3PQI A;  5BR8 Q;  4DUY L;  1KD1 C;  2NVX B;  3X3M A;  2K50 A;  1XX8 A;  1CKO A;  4X62 L;  2A5H A;  1WD1 A;  1NBW A;  2F4V Q;  3JAM E;  1UEA B;  2IHF A;  3NUC A;  2E2H H;  2EYP A;  3CCM A;  3KLR A;  4X3U A;  2E8G A;  1WCM H;  5CR3 A;  1BVS A;  5I9O A;  4UP7 A;  5CGK A;  3I4N G;  4K2L A;  4KI0 A;  4NW2 A;  1C9O A;  1VS0 A;  4JI5 L;  4BBR H;  3EVQ A;  1IYJ B;  1VQE A;  3I70 A;  3MXU A;  4LF6 L;  2O2L D;  4JI2 Q;  4EGV A;  2JEA I;  4IUV A;  5C5L A;  2VNU D;  2A19 A;  2B8F A;  2HQL A;  2K28 A;  1E24 A;  1SE4 A;  4AYB G;  3BYY B;  2YTV A;  1I6V C;  2PZT A;  5L37 A;  4DR2 Q;  2R3Z A;  2QF7 A;  1O7Y A;  2N3S A;  1TWH H;  2B8G A;  4K0K L;  2EDG A;  1CUK A;  1IBL Q;  2ZXO A;  4CDF C;  4XIG S;  1SYD A;  1PTO F;  1Q12 A;  3MXP A;  1O78 A;  1XMO Q;  3AFQ A;  3F2U A;  4KY7 A;  3HOW B;  2DY7 A;  4J8Q A;  1MI2 A;  1W6J A;  3A5Z B;  5JEA J;  3E6Z X;  1J5E L;  4R9W A;  4WJ3 M;  1BKB A;  3HOV G;  2Y0S G;  1STY A;  3UDF A;  5CBE E;  5HGT A;  2YU9 H;  2AQ3 B;  1IYU A;  3M85 A;  3CHB D;  2VQF Q;  4A3M H;  3PUW A;  1FNV A;  4O42 A;  3PO3 H;  3SEB A;  2VQF L;  4MTN A;  1YIJ A;  4PMC A;  4GOP C;  2PW5 A;  3A56 A;  3SHL A;  4J15 A;  4RGN A;  1UE5 A;  3DEO A;  3FVQ A;  3C1F A;  3QWN A;  4ZQ3 A;  2BCO A;  3C3L A;  1GVP A;  1WFQ A;  3NXW A;  3EJI A;  3TBI B;  2G9H D;  2CVR A;  2IJ0 A;  1AEX A;  2RDF A;  1EYC A;  2JA8 H;  4A3B B;  3GTG H;  1K83 B;  4RA8 A;  2Y0S B;  2EPB A;  2XWB B;  3RN5 A;  1LT5 D;  3GTP B;  3OPO A;  4BBR G;  4XQJ A;  1B2T A;  1ROD A;  2OCE A;  2E5L Q;  4IFD G;  3GDE A;  4WJ4 A;  1YNJ C;  1EQT A;  5D14 A;  5BN5 A;  3WDN A;  5IGE A;  4EVO A;  1AZQ A;  2L9H A;  4ULL A;  1MJC A;  3D6W A;  2KCM A;  2A6H C;  1X3F A;  2OEO A;  1H9M A;  1M4V A;  1VF5 C;  1TVX A;  4AIM A;  2OF1 A;  5IGC A;  4JI0 L;  1L1O A;  4A3K B;  5IGF A;  4RCO A;  2Z4I A;  4MHE A;  1BNZ A;  2A6E C;  2YYZ A;  4BA1 I;  4A3J G;  2VS1 A;  4KD3 A;  5K36 H;  5HY6 A;  1XMQ L;  1F2Y A;  3SXH A;  3GTM H;  3OW7 A;  1SJH D;  1KDB A;  4ZLT F;  4A93 B;  1R9T H;  1RTN A;  1CZG A;  5JPN C;  5M3M G;  2HIV A;  3G4S A;  5IGD A;  2OXP A;  2LFN A;  4DR6 Q;  3M4P A;  2B63 B;  2RF4 A;  1HXY D;  2DJG C;  4FDB A;  3KUP A;  5FJ8 H;  1QB5 D;  1CZW A;  1AFP A;  5A2Q E;  1PZJ D;  4CDE C;  4DV7 Q;  2NYZ D;  3TP6 A;  4EQP A;  3BU2 A;  1RTO A;  2E2J H;  2MNA A;  2R7D A;  4IJH A;  2BA1 A;  2SEB D;  4IJL A;  3PIP 3;  1LTS D;  1EY9 A;  5JAV A;  1U9R A;  1N9W A;  2K5V A;  3QOJ A;  4DUZ L;  2PQE A;  1LAC A;  1PZI D;  4DN4 M;  2D62 A;  1PTO H;  4LMQ D;  1CFM A;  2JA5 G;  3CCR A;  4GN3 B;  5J1Z A;  4GLX A;  5ELO A;  1XPO A;  2R7F A;  1FVI A;  1SR3 A;  4X64 Q;  1D1I A;  1IBM Q;  1C48 A;  3FPP A;  1KLG D;  1JOK A;  3DEP A;  3MXG A;  5C0X G;  1JB7 A;  4JYA L;  5CMD A;  3DMU A;  1VQ4 A;  3MWY W;  1L0W A;  1V9P A;  3EQL C;  4I65 A;  5FOB B;  4OHJ A;  3RMH A;  5IY0 A;  1Y1W B;  3WOE A;  2QA4 A;  2SNS A;  1VQH A;  4FXK C;  3PIO 3;  3CC7 A;  2N49 A;  1STB A;  5C4H A;  1ICF B;  4LF7 L;  2C5C A;  2J0T D;  3MFG A;  2EY2 A;  4B9W A;  4DGZ A;  5I2Y A;  2OQ0 A;  1QNK A;  2UXC Q;  5C4X B;  3RUZ A;  5FO8 B;  1H9S B;  1SBB B;  2MPM A;  2CH4 A;  3V2T A;  1I4X A;  3LNN A;  3I7F A;  1S5D D;  5IP9 G;  1Y8P B;  4G57 A;  3U4Z A;  2JA7 H;  2D9U A;  5AFW A;  4CKB A;  4DU9 A;  5I6Y A;  3NTH A;  4A3C H;  3S24 A;  3KDF A;  2EYO A;  3RLF A;  2Q8T A;  4B3T L;  2EZV A;  1Z9F A;  4DV0 L;  3HOX B;  1SN8 A;  2QEX A;  4A76 A;  3PUX A;  4FXG C;  3NHH A;  1IZ6 A;  1PRT C;  2OTL A;  5DAU A;  5M3M H;  3VYU A;  1K8G A;  5AJ3 L;  2VUM G;  2CFM A;  2DNE A;  1G8Z D;  1NTG A;  3CXC A;  4A3F B;  3T51 B;  1K73 C;  3OTO Q;  5M9O A;  3VYT A;  4LJZ C;  1I3Q B;  3J80 c;  3HOW H;  1M8A A;  1Y8O B;  2I0Q A;  1GKH A;  4HSV A;  5COR A;  3M7N A;  3S1R B;  4DR7 Q;  1VMC A;  2DJF C;  4RGM A;  1SNQ A;  1VMP A;  1CA5 A;  3KFU A;  1LTA D;  1EOT A;  4IQZ A;  1WTX A;  4DR7 L;  1U4M A;  2IWH A;  4I7A A;  5BN3 A;  2K52 A;  4OO1 G;  4XT3 B;  4JG2 A;  1IBM L;  1QZH A;  1RKN A;  5FLM H;  4HMI A;  2EY5 A;  2K5N A;  3HOU B;  5JJL A;  4NDX A;  4JCV E;  2RHQ B;  4G4K A;  1G51 A;  1EIG A;  4R4Q A;  2Z9H A;  1QVG A;  1LT6 D;  4LFB L;  2Z4H A;  1SMY C;  2EY1 A;  1HNZ L;  1PZK D;  4JI1 L;  2F52 A;  2BDN A;  4LF6 Q;  4HED A;  1SYB A;  2B3G A;  5IOC A;  3E9H A;  2WFW A;  4M8A A;  3CRL C;  4O1N A;  3CME A;  1DD2 A;  2PZW A;  4PZ8 A;  3KYH C;  4IUN A;  1CKN A;  1SAP A;  1DON A;  3PV0 A;  2MGS A;  4CGY B;  3DM1 A;  2YTX A;  4CKC A;  1JQY D;  3ULJ A;  3M9B A;  4R1J A;  3RLO A;  4PMB A;  4TRD A;  5EJW A;  3CCS A;  1KTK A;  1H9S A;  4IFD I;  2F0K A;  2WAC A;  3GTJ B;  3IFD A;  3JC6 6;  1XMO L;  3S2H B;  3B6Y A;  5C44 H;  2H5X A;  4TVA B;  2E2I H;  1HTL D;  4RWS C;  4LF5 Q;  3KDF B;  1S5E D;  4A3L G;  1DJR D;  2RSN A;  4MTK A;  4QB4 A;  2TSS A;  3OTO L;  4QUF A;  3ONA B;  1UWV A;  3L2P A;  3E0E A;  4F87 A;  3F8T A;  3M7G A;  4XQQ A;  2F3W A;  2WB1 E;  3IFT A;  1D8L A;  1A3U A;  4APV A;  5IWA Q;  4IUT A;  2AWO A;  3ND9 A;  1GUS A;  3X3N A;  2WIN B;  5IWA L;  4ME5 A;  3BDC A;  2KEN A;  2CQA A;  5FKA C;  5ELD A;  2DUD A;  4XYO A;  3TP5 A;  2O5I C;  1S40 A;  2F4V L;  5KYL A;  1M90 C;  2FXQ A;  2ZJR A;  3GTQ H;  5C6A A;  1BCP F;  1N34 Q;  1X3P A;  2UXD Q;  4HMJ A;  4B08 A;  1PFM A;  4BY1 G;  4DAM A;  3FEW X;  5FLX E;  2X6L A;  1I4R A;  5F2D A;  1ASZ A;  5JVH 3;  2N8N A;  4LFB Q;  3I4O A;  4NXM L;  4AH6 A;  2JA6 B;  2A1A A;  2BA0 A;  2EJM A;  5JEA G;  1JB3 A;  2K7V A;  4JV5 Q;  3K81 C;  2JN4 A;  3F1Z A;  4KHP Q;  1I5F A;  2PZU A;  1SFO H;  3P1H A;  5D3D A;  1V1Q A;  3FKI H;  3TP8 A;  3J81 i;  2AQ2 B;  5JJK A;  1DOL A;  2NVT H;  3H3V H;  3RD4 A;  4P74 A;  4JI8 Q;  1EEF D;  4DNT B;  2VUM B;  2NUC A;  3P75 A;  3GTQ B;  1UAP A;  2C9O A;  4YCU A;  5CV7 A;  4BBR B;  1I4Q A;  4S3S A;  4K8J A;  3HOX G;  1I94 L;  1L0X B;  5J3B A;  1EU3 A;  1KRS A;  4GKK Q;  2NVQ B;  1E2V A;  1D5X C;  1I50 H;  1UNS A;  1TWC B;  2Q8R E;  4RKB A;  4DR1 Q;  2YV5 A;  4PZ7 A;  3SE0 A;  2HDL A;  2MO1 A;  2PCF B;  1D1K A;  1XTC D;  1NUC A;  4K0K Q;  1IBL L;  3NEN A;  2K05 A;  3SR1 A;  3PUZ A;  3V96 A;  1X56 A;  1HTP A;  3FKI B;  3ERO A;  5M3F B;  4JC0 A;  1KQS A;  4YWL A;  4JI4 L;  1DM0 B;  3S2D B;  1R4Q B;  3HP3 A;  1E3P A;  2JXM B;  3E3X A;  2RQX A;  1Q81 C;  3PO3 G;  4X64 L;  1SND A;  4A3B H;  5IE8 A;  5ELC A;  2X69 A;  4Y7N B;  5IOD A;  1TY0 A;  2NZH A;  4A3I G;  3CQZ H;  3H0G B;  1WTP A;  3CPW A;  2ZJP A;  1UE1 A;  4C3H G;  4JV5 L;  4MNO A;  3VA5 A;  2OQK A;  4Q0F A;  4LUZ A;  4PG3 A;  4C3I G;  1BBX C;  2HD3 A;  2TMP A;  1BR9 A;  4LUV A;  1ML0 D;  2E2D C;  1PH6 A;  1STA A;  1EFI D;  3UDG A;  1R4P B;  1V1P B;  2WAQ G;  1KXL A;  4NP5 A;  4JBM A;  1K8O A;  4K6L A;  3KF6 A;  3MEH A;  2M9V A;  1EIY B;  5EBD A;  4DXF A;  4DA2 A;  1SYE A;  3H94 A;  3P20 A;  4ZAI A;  3J81 E;  4JBW A;  1GUO A;  1J9O A;  4QY7 A;  2B2T A;  5K36 G;  4C56 C;  1SSO A;  4N8X 1;  4IO9 A;  3NWT A;  1BBW A;  3A55 A;  3CCV A;  3FPU B;  4P73 A;  2BH8 A;  1W6K A;  2L15 A;  1LTT D;  4Y52 H;  4L8J A;  1XTD A;  1HNX L;  2I46 A;  1B7Y B;  2I5M X;  3TZD A;  5C0X I;  4DR6 L;  3V05 A;  4C1N K;  4C1N I;  1TII D;  3J7Z C;  1E2W A;  2KHS A;  1XJV A;  1JOO A;  4X66 L;  2KBN A;  2B2Y C;  2N78 A;  3KOJ A;  4A3J B;  3DWP A;  1VQ6 A;  3NBI A;  5IYD H;  4KMU C;  3E0J A;  1PH7 A;  1FNW A;  2F0O A;  4EQN A;  3I4M H;  3BVG A;  3W5O A;  1IKM A;  5BN4 A;  3NQI A;  2YU9 B;  2IW3 A;  1X3Q A;  5KNC A;  5GAG C;  1JT8 A;  1RCV D;  3HFZ B;  4UAI A;  4MZ9 A;  5C4J H;  3D6C A;  1X55 A;  3S1Q B;  1XNQ L;  1EZ6 A;  4NXM Q;  3G7L A;  3HKS A;  4HIM A;  4H44 C;  2FMM A;  3HG9 A;  5M5W H;  4JI3 Q;  1BXT A;  1K8A C;  1L1O B;  5C44 B;  4IPH A;  3A8I E;  1G6Z A;  2LSS A;  3P7J A;  1HZA A;  4IUQ A;  1YHB A;  1NE3 A;  5K5P A;  3E9I A;  2E75 C;  1RJT A;  2NVY H;  3M3Y B;  5JEA H;  4A3D H;  4B3R Q;  3PSI A;  1OXV A;  1ET9 A;  3K7A B;  5CV9 A;  3TS0 A;  1NJI C;  1SNC A;  5M5Y B;  4DR5 L;  2NN6 H;  3UDX A;  1SNM A;  4H13 C;  2SOB A;  3VYR A;  3A8K E;  1JWM D;  1OXS C;  2KEC A;  3SGI A;  1ONL A;  4LF5 L;  2MJ8 A;  2XWJ B;  3VR5 A;  4DK6 C;  3RR5 A;  1T5X D;  3CP0 A;  1MSG A;  4NPS A;  3KJO A;  3BG3 A;  1UUP A;  4LFC Q;  4UHV A;  1YNN C;  2O4X A;  3HZX A;  2XGT A;  3PO2 H;  3A0J A;  1NMF A;  2E2J B;  1TS3 A;  2R93 B;  4PMW A;  3TN2 A;  2K5W A;  4DV7 L;  1QUQ A;  3K57 A;  3MEF A;  1AP0 A;  1N32 Q;  1Q1E A;  3F2D A;  5TSS A;  4JBK A;  3GTJ H;  4RGT A;  1PFS A;  5D65 A;  1YZ6 A;  2NBF A;  3GQB A;  4XDX A;  4DFA A;  5KRU A;  3G71 A;  4RGO S;  4P75 A;  3LGJ A;  5GAH C;  1JJ2 A;  3SDZ A;  2NZ1 D;  2Q2U A;  4JPB W;  3TSS A;  1PRT B;  1F2Z A;  3T16 A;  1E1T A;  4M1U B;  3CRK C;  4XXE A;  3LX0 A;  2QCP X;  1L1O C;  4LK1 C;  1PH1 A;  3S1M B;  3K5L A;  2NB0 A;  4P71 A;  1IBK Q;  1JJC B;  1F2M A;  4IN3 A;  4JI8 L;  3BVZ A;  3QO2 A;  1F9P A;  3VR3 A;  1TQO A;  1U0L A;  2F1M A;  5BR8 L;  4DUY Q;  4X3K A;  4RHR A;  2EYH A;  1NR2 A;  3K7A H;  5KNB A;  2F0U A;  1WTH A;  2KUM A;  4DAV A;  2FMC A;  4C3J H;  1IYV A;  2A73 B;  3E5S A;  5ISR A;  2Z1C A;  2F0Q A;  2OWO A;  3PF5 A;  3BZK A;  3DXJ C;  4IFD H;  3I91 A;  3Q23 A;  1Y1V G;  1EEI D;  2V1C C;  3CCU A;  1I3Q H;  3VR6 A;  4EQO A;  4PV1 C;  1YI2 A;  4QCL A;  3ERS X;  2AKW B;  5KEE A;  4FF3 A;  1HNW Q;  4YCV A;  1G2T A;  2ZTE A;  3GTM B;  1STH A;  3J81 c;  3AYH B;  4R8N A;  2JA6 G;  2MQH A;  1S72 A;  3CCJ A;  1K0S A;  1CHP D;  1BF4 A;  2ES2 A;  1K3R A;  4A3K H;  2AQ1 B;  2WB1 B;  2FFK B;  1X65 A;  4A3M B;  3TME A;  1VQO A;  4DR3 L;  1N33 L;  4XTC S;  2EQS A;  5IP7 G;  4IUR A;  5C0X H;  3CCQ A;  1PYB A;  4CDD C;  4KHZ A;  2VB2 X;  4DNR B;  2JA7 B;  4BY7 H;  1ILQ A;  1STG A;  4GN4 B;  2D2C C;  4KLK A;  4LW1 A;  3R2T A;  4RAU C;  5IP7 H;  1HR0 W;  3HOU H;  1IW7 C;  4F88 A;  1H9R A;  1B3A A;  1JWU D;  4R4I A;  3NBH B;  1BCP D;  4GZY C;  1JC7 A;  1L0Y B;  1E2Z A;  2CQO A;  3NTK A;  3CC2 A;  1XNR L;  4OIK A;  1KNA A;  4GKJ L;  1S5C D;  4DK3 C;  5ELF A;  4OWW B;  4YHH Q;  4DV6 Q;  2BE5 D;  1HH2 P;  4OWT B;  5I9P A;  2A69 D;  2Z6B A;  3OHX C;  1YJN A;  2PI2 A;  4OEM B;  1VQM A;  1Q90 A;  2UU9 L;  1PFN A;  1EIF A;  4DV4 Q;  2JSO A;  5DLQ E;  1GUW A;  1DXM A;  5GQO A;  2KA7 A;  4NXN Q;  1VQ9 A;  2R92 B;  1T9H A;  4PQX A;  1PTO B;  4AQY L;  3EN2 A;  4GS3 A;  4XYQ A;  4A3C G;  5ELB A;  2XSC A;  2RSO A;  1KL9 A;  2F0S A;  3TP7 A;  3SK5 A;  3JAM c;  4IPC A;  4FF2 A;  1WYD A;  1K3B C;  2E2H B;  1JE4 A;  4V19 0;  4A3D G;  2EYM A;  4JI6 Q;  2Z6K A;  5EKI A;  4Y7N H;  3RZD H;  4A3B G;  3HGB A;  2J7Z A;  1HNX Q;  4IPG A;  1N33 Q;  4KY5 A;  1Q82 C;  5J39 A;  4YWM A;  4KY6 A;  4O2D A;  1FD7 D;  1KNE A;  1E0B A;  2HIX A;  1VQL A;  5C4X G;  1IXR A;  3FHW A;  5JPM C;  3W1B A;  1B3Q A;  3ND8 A;  3I56 A;  5NUC A;  3UI2 A;  1E1O A;  1K9M C;  1UE6 A;  4C2M B;  1II3 A;  3ER0 A;  3MHB A;  4NKL A;  4GNX C;  2XIW A;  1ENC A;  2JA5 H;  3I72 A;  1PFB A;  1IL2 A;  3CCE A;  3TEH B;  4U68 A;  1HFN A;  5IYD G;  3T1H L;  1NNX A;  3HOX H;  1EY0 A;  2WKD A;  1GHJ A;  4FVM A;  2F0N A;  3CPF A;  2L0C A;  4A3E H;  1PH5 A;  3S1N H;  1OXT A;  3T1Y L;  3J81 L;  4MIU A;  3NK9 A;  3D4R A;  4N8F A;  4JI3 L;  1A3T A;  2Z6K C;  4LF8 L;  4BY7 G;  2VB3 X;  4DNI A;  3KBX A;  5I2X A;  4DR4 L;  2F0G A;  1Y69 U;  2E2I B;  1B50 A;  2LS0 1;  4POF A;  2F0I A;  3HKZ G;  1TWH B;  1NY4 A;  1YNN D;  2KOL A;  1I4P A;  4B3S Q;  4ABN A;  1D5M C;  4RHS A;  1GO3 E;  4GLA C;  1G91 A;  1JE5 A;  3ULL A;  4WOR A;  4HSP A;  5IT9 L;  2DY8 A;  1KDC A;  3J7A 5;  3MFY A;  1X9N A;  4LF7 Q;  3AEV A;  4QF4 A;  1FNU A;  3BYT B;  3QIA A;  1B8A A;  1HA5 A;  2QEJ C;  3MVV A;  4DV3 L;  2HQE A;  3NSW A;  1P8L A;  2QIL A;  4F8M A;  1SJE D;  2RBM A;  5C3E H;  3BDO A;  3L7Z C;  1VCI A;  2Q2H A;  5IT9 E;  2A69 C;  2NVQ H;  1VQF A;  1K8M A;  3S1M H;  1SE2 A;  4IFD J;  2B2W C;  2ICE C;  4QQB X;  1DOK A;  2WB1 G;  5IYC G;  2HCI A;  4R4T A;  5FJ8 G;  3J80 L;  3PF4 A;  2BOS A;  4X66 Q;  2I5L X;  1U4P A;  2KHI A;  1TR5 A;  5G3L F;  3UDI A;  5T1I A;  1EU4 A;  2Z8L A;  1WD0 A;  3HOV H;  3RNU A;  1LLR D;  3M4O H;  3TDQ A;  3Q6S A;  1EWI A;  1Z7T A;  2F0V A;  1LAB A;  2N55 A;  1STN A;  5ELE A;  3JAM L;  3GTL B;  1LO5 D;  1N34 L;  1MD2 D;  1ZKO A;  2I07 B;  1C7Y A;  2GN5 A;  3URY A;  2JK8 A;  4C3J B;  2PMZ E;  2WKC A;  4A4I A;  2R93 H;  3OIP A;  2EYF A;  1X32 A;  1VQ5 A;  1KHI A;  1D7Q A;  2VY3 A;  1VQK A;  4LAA A;  3UE1 A;  4DV4 L;  1EQR A;  3BZC A;  1YEZ A;  1AZP A;  1PDQ A;  1HR0 L;  3HOZ G;  2EYL A;  3EBE A;  1OO9 B;  2KED A;  2RHS B;  4OGQ C;  4G7Z C;  4A3E B;  4FF1 A;  1KRT A;  3QR8 A;  1VQJ A;  1KDA A;  1PMR A;  3AMU A;  3DWQ A;  1GM5 A;  3VYS A;  3KK7 A;  1Y1V H;  1FGU A;  1HQM C;  1JIC A;  3CQZ B;  3H09 A;  1FGB D;  1CT1 D;  1HRJ A;  2UUB L;  3CW2 C;  1Z47 A;  4C3I H;  1L2F A;  2PNR C;  4R8I A;  1B1Z A;  1JOQ A;  2ASB A;  1KAW A;  3K0X A;  4K8I A;  4C3I B;  3K8A A;  1QJO A;  3OMG A;  3Q24 A;  4ZK9 B;  3A54 A;  2DNC A;  1WVL A;  3QJY A;  3VR2 A;  3M4O B;  4K6D A;  1EYD A;  1JR0 D;  1BCP C;  4ODG A;  2HDM A;  3G48 A;  4L5S A;  5E4X A;  4LFC L;  1GUN A;  3T1H Q;  1B9N A;  3GV3 A;  4L5Q A;  5DM6 3;  3I4N H;  3PO3 B;  5LL6 X;  4DV1 Q;  4CDC C;  1AE2 A;  2RDG A;  5FLX L;  3I3C A;  4A3G B;  1F77 A;  3K5O A;  4GLV B;  4HIO A;  2UUA Q;  5G3L D;  1GHK A;  1EQQ A;  4A3G G;  3H0G H;  3SK8 A;  4J6H A;  2B2V C;  2IX1 A;  1F9S A;  1EOV A;  1EZ8 A;  4X3T A;  3U9O A;  4A3E G;  2ZJQ A;  3HKZ B;  4UY8 C;  3DWA A;  1X3E A;  2K75 A;  1HPC A;  1PH4 A;  1XNQ Q;  2VQE L;  1Y14 B;  1YHA A;  2EXZ A;  1V1O A;  4DUZ Q;  3S2H H;  2ALY B;  3GP7 A;  2K1B A;  1S4Z A;  1SLJ A;  4HJ5 A;  5C4Z A;  4H0L C;  4CHT B;  2OT2 A;  5M3F H;  4DR5 Q;  4QIW B;  2UUC Q;  4KK7 A;  3DUZ A;  3PCO B;  4ID6 A;  5KGU A;  4X6A H;  2KCN A;  4A93 H;  4UP9 A;  1C4Q A;  2M2L A;  3KJP A;  1PLF A;  1ESR A;  4YY3 Q;  3J80 E;  1SYF A;  2YTY A;  1TS2 A;  3EFX D;  1QVC A;  2KVM A;  3KLW A;  1WTO A;  2R7Z G;  1PH8 A;  3F2C A;  4B3M Q;  1ICW A;  3LWU A;  1W2B A;  2H1E A;  1CK1 A;  3PMF A;  1G2S A;  3HOY B;  1AN8 A;  1EY7 A;  5EKK A;  2F03 A;  4JI6 L;  3NQT A;  3S14 B;  4V0B A;  2MFI A;  5DEH A;  2NTT A;  2EIF A;  1IL8 A;  3D4D A;  1SMX A;  1JJG A;  2K32 A;  4FF4 A;  4IOA A;  4F7X A;  1PRT F;  2NN6 I;  2G9D A;  4K2K A;  1CM9 A;  4RCN A;  1TWG H;  2XN9 C;  1B70 B;  3BZD B;  1SYC A;  3HOZ B;  4ZCK A;  1D5Z C;  1LT3 D;  2QDB A;  1IW7 D;  1U5K A;  1WOC A;  4GN5 A;  4TSS A;  2G5D A;  1HZC A;  3STB D;  3HKZ E;  1YNX A;  3ZYY X;  1TWF B;  1HJP A;  4DR1 L;  4A3M G;  1YIT A;  4JW0 A;  4KV6 A;  4A3F H;  3UE0 A;  1VQ7 A;  3NEL A;  3K58 A;  2CWP A;  2F0M A;  4GNX A;  2R92 G;  2PYK A;  3R93 A;  2F0F A;  5E3F A;  2IT1 A;  2FJ2 A;  4WJW A;  4B3S L;  4RG1 A;  5EPL A;  5EGT A;  3PO2 G;  3HS0 C;  4GNX B;  3W3A A;  5EPK A;  4GOP A;  2MUY A;  2RA4 A;  1YJ9 A;  3GTO B;  1EUJ A;  1PYS B;  3Q0A A;  1XNR Q;  1K0R A;  5C0X J;  1EQV A;  2Y0S E;  5LL6 S;  1CI3 M;  2F3I A;  2UUB Q;  1EWH A;  5C4X H;  1YHQ A;  1BOS A;  4GOP B;  2KHJ A;  1VQ8 A;  4U67 3;  5LMN W;  3L0O A;  5LMU Q;  1FJG Q;  2EJG C;  3GTP H;  4RFB A;  5LMU L;  1FJG L;  3TS2 A;  1HZB A;  3TZU A;  4HCE A;  1T5E A;  5COY A;  4BBS G;  5M3F G;  3DHQ A;  3OOC A;  3N6R A;  3DLL A;  1R9T B;  2F3V A;  3H91 A;  5JJZ A;  1CKM A;  3HOU G;  4OO1 H;  3S1Q H;  1NCV A;  3GTK B;  2L11 A;  2XTI A;  1TWC H;  3T13 A;  4RH6 A;  1LV9 A;  1V1P A;  3IRB A;  1BO0 A;  4DV5 L;  1U4L A;  1TT2 A;  1GD7 A;  2R92 H;  1CTM A;  1EY6 A;  2K4K A;  3K6O A;  2B29 A;  5IGG A;  4QUC A;  4N9T A;  4MN3 A;  1XPU A;  3CF5 A;  2VUM H;  1SYG A;  1HFG A;  1SRU A;  4HJA A;  4X3S A;  2OTJ A;  2VQE Q;  2EY6 A;  4OX9 L;  5I6W A;  2NVY B;  3I90 A;  5CBA E;  3M3Y H;  2XRQ D;  2F0W A;  5GAE C;  1YJW A;  2UUC L;  3T56 B;  3J7A V;  3GTG B;  5C3X A;  3RZD B;  1PH2 A;  2L4N A;  3TQY A;  3G6E A;  3BVM A;  4ZYS A;  3W2D A;  3U4V A;  2WAQ E;  1G29 1;  2L1B A;  2JE6 I;  4BBS H;  2UXD L;  1AW7 A;  4LUO A;  1A2U A;  1ZEQ X;  1HNZ Q;  4YCW A;  3S14 H;  1V43 A;  1X54 A;  1GOZ A;  2CH4 W;  2PI2 E;  2KEE A;  1D6E C;  2AUJ D;  1TWA H;  2O5J C;  4LFA L;  1Q1B A;  4KHP L;  4DV3 Q;  1FL0 A;  4P2C B;  5GRO A;  1O80 A;  4FNF A;  3HEJ A;  1UE7 A;  2RCF A;  1KC8 C;  4KJO A;  1CSQ A;  3A8J E;  1QVF A;  5KYI A;  3SK4 A;  4IUU A;  3QG1 A;  1RL2 A;  1VQC A;  5FLX c;  2K01 A;  1SE3 A;  4NB3 A;  4JOI A;  4POG A;  1ENF A;  2EVB A;  3SK6 A;  4DV2 Q;  1SFO B;  1GXD C;  1DZ1 A;  4CBV A;  5FLM G;  3FRP B;  3A7L A;  4ZUJ A;  1ET6 A;  4A3I H;  4WRD A;  4A75 A;  4QL5 A;  4QMG A;  1VQD A;  3K5M A;  3NWS A;  3S9W A;  1CHQ D;  4DR3 Q;  1HQR D;  4R4C A;  1EL0 A;  1JOR A;  1LM0 A;  4RKL A;  3J81 j;  1VQB A;  2F0H A;  3L9A X;  1WTQ A;  3D3R A;  2PQA B;  3S15 H;  4XT1 B;  1WJJ A;  1HA6 A;  2RCN A;  4B9X A;  3NPP A;  3I4N B;  1BBU A;  5CV8 A;  5FK9 C;  5C3E G;  5T1G A;  3H6M A;  3FDT A;  3ICE A;  1S5F D;  4EX5 A;  1LTB D;  1VQI A;  2HCC A;  3WWV A;  4R4O A;  1U4R A;  3A5U A;  1KAB A;  5JOB A;  4DK0 A;  1NR4 A;  3MC0 B;  1O7Z A;  4OWX B;  4LF4 L;  5IIF A;  1PV4 A;  1Q8K A;  2CW0 D;  4JI1 Q;  2K04 A;  2ID0 A;  3HOY G;  5CC4 A;  5EBC A;  1LT4 D;  1MIU A;  3SVM A;  2UXC L;  2R7Z B;  1JMC A;  1PXU A;  1K83 H;  1A63 A;  1YNJ D;  2K5Q A;  2EOT A;  1IBK L;  1B44 D;  1RF2 D;  5IP9 H;  2A68 C;  5EKL A;  1A6X A;  2EE1 A;  1OTC A;  3RZO H;  2R93 G;  4C3H B;  3IL8 A;  3D8G A;  5LMN L;  1I94 Q;  3MA2 B;  3KF8 B;  4JI2 L;  3S16 B;  5HGQ A;  1C8C A;  4BY1 H;  1KLU D;  3CD6 A;  1QIL A;  1WCM B;  3I8Z A;  1SNP A;  3D31 A;  4LWC A;  3MZ5 A;  2ATW A;  4GKK L;  3KF8 A;  4DF7 A;  4DR2 L;  1XPR A;  5I4D A;  5IYB G;  1BUV T;  3EA6 A;  5CYU A;  1YBY A;  1NMG A;  4NMZ A;  3RN2 A;  3OWE B;  3GD7 A;  1MJE A;  4IUP A;  2B39 A;  1CQV A;  4H7B A;  1TXY A;  1KIX A;  1N32 L;  1PTO C;  2PO4 A;  3GO5 A;  2GA4 B;  2K5H A;  5M5X B;  5EPJ A;  4A3L H;  3CAM A;  1EY5 A;  4CJ1 B;  3HOW G;  3HOV B;  5C44 G;  4JYA Q;  1MGS A;  3ULP A;  1TU2 B;  2FHT A;  3J7A F;  4JI5 Q;  4YWK A;  5ELN A;  4X62 Q;  2JQO A;  1XWE A;  5CV5 A;  3PGZ A;  3ZJY C;  1WTV A;  1HR0 Q;  3ERQ A;  1XXG A;  4I7Z C;  1LUZ A;  1EFW A;  2JJQ A;  1J6Q A;  3I2Z A;  2LY7 A;  1W3S A;  4K14 A;  4AYB B;  3T53 B;  3K7U C;  2Z0S A;  3J80 i;  3NBH A;  1PH3 A;  4B3R L;  2Q8I B;  1N36 Q;  2K5D A;  4PZ6 A;  4HN7 A;  1ZYR D;  1J8I A;  1Q3L A;  2QW7 A;  2P5Z X;  4ZKB B;  4CJ2 C;  3K5N A;  2UXB L;  4HJ7 A;  5M5X H;  3NEM A;  1NSN S;  2UU9 Q;  5H1S E;  4OL7 A;  2V4D A;  1VQN A;  2HUG A;  2LMC B;  4HJ8 A;  4ILW A;  4NXN L;  3FP9 A;  3HOZ H;  4PNY A;  5GAD C;  1EWC A;  1MKH A;  1ZXT A;  3D4W A;  1LTI D;  4BXX H;  4OON A;  3BS1 A;  4JI0 Q;  1H9K A;  3IAY A;  1SMY D;  4UP8 A;  3PIP A;  3BDL A;  1C0A A;  1WCM G;  1Y8N B;  4AYB E;  2VL6 A;  4A93 G;  2E76 C;  2HHH Q;  1HHV A;  1QOH A;  3KBG A;  1LTR D;  4JI7 L;  1IKL A;  4O0A A;  4BA2 I;  3HOY H;  1AH9 A;  2VZA A;  4A3G H;  1TWA B;  3OYY A;  4JVZ A;  4OIJ A;  4A3K G;  1QG7 A;  4IPD A;  2WAQ B;  5JJI A;  5KIX A;  5J22 A;  1QCB D;  4QJF A;  3VA7 A;  1GJX A;  4FO2 A;  2EXD A;  3D0F A;  2X6G A;  3H3V I;  3I4L A;  1CSP A;  5C5M A;  4HCS A;  4LNQ A;  1PYW D;  2I5H A;  4ZUI A;  2NVT B;  3CKI B;  2MHV A;  2ZTC A;  1TS4 A;  1F9Q A;  2DN8 A;  1CKN B;  4A3I B;  5D3I B;  4HIK A;  4KKU A;  3ITP A;  1Q46 A;  5C3W A; 
#chains in the Genus database with same CATH homology
 2NVY H;  5M3F H;  2OCE A;  4DR5 Q;  1EYG A;  2E5L Q;  2UUC Q;  4IFD G;  3GDE A;  4WJ4 A;  4A3D H;  4B3R Q;  3PCO B;  3PSI A;  1OXV A;  4X6A H;  3TS0 A;  1NJI C;  4A93 H;  4UP9 A;  1MJC A;  2KCM A;  4DR5 L;  3KJP A;  2E5L L;  4B3M L;  1X3F A;  4YY3 Q;  2NN6 G;  3UDX A;  2YTY A;  4AIM A;  4LFA Q;  2WP8 J;  1OXS C;  1QVC A;  2D0O A;  4JI0 L;  3KLW A;  1L1O A;  2R7Z G;  2IHE A;  3SGI A;  3F2C A;  1PH8 A;  1W2B A;  4B3M Q;  4RMF A;  4LF5 L;  1A0I A;  1O7I A;  2AMC B;  4DK6 C;  3RR5 A;  3CP0 A;  4JI6 L;  4NPS A;  3KJO A;  2YYZ A;  4BA1 I;  4A3J G;  2MFI A;  1RIP A;  2VS1 A;  3W1G A;  4LFC Q;  5HY6 A;  1XMQ L;  2EIF A;  3GTM H;  1SMX A;  4DAY B;  1JJG A;  4IOA A;  2XGT A;  1R9T H;  1SE8 A;  2JEB I;  3PO2 H;  4DV1 L;  3A0J A;  1NMF A;  2NN6 I;  1TWF H;  5M3M G;  1TWG H;  2HIV A;  3G4S A;  3RLN A;  3H15 A;  1B70 B;  4PMW A;  4DV7 L;  3MXN B;  4TQU S;  1QUQ A;  4DR6 Q;  3MEF A;  3M4P A;  1N32 Q;  1Q1E A;  2RF4 A;  2PQA A;  3F2D A;  4FDB A;  4JBK A;  4A3F G;  4IOC A;  5FJ8 H;  1U5K A;  1WOC A;  2LXK A;  4GN5 A;  3GTJ H;  1HZC A;  1PFS A;  4DV7 Q;  1Y1W H;  1YZ6 A;  3STB D;  3HKZ E;  1YNX A;  2JA6 H;  3BU2 A;  3OW2 A;  3G71 A;  2E2J H;  1HJP A;  2MNA A;  4OX9 Q;  4P75 A;  2R7D A;  4DR1 L;  4IJH A;  2BA1 A;  3LGJ A;  4IJL A;  5GAH C;  4A3M G;  1YIT A;  1JJ2 A;  4A3F H;  3UE0 A;  2Q2U A;  3TRE A;  2D0P A;  1VQ7 A;  3DM3 A;  3NEL A;  5IT9 c;  2CWP A;  4GNX A;  2R92 G;  3BJU A;  4ALP A;  1N9W A;  2IT1 A;  2K5V A;  1S3O A;  4DUZ L;  1E1T A;  4B3S L;  2R6G A;  4RG1 A;  2D62 A;  1L1O C;  3PO2 G;  1PH1 A;  2JA5 G;  4GNX B;  3CCR A;  1E22 A;  4GN3 B;  4P71 A;  2ZM6 Q;  1IBK Q;  1JJC B;  4JI8 L;  4A3J H;  4GLX A;  4GOP A;  4YY3 L;  5ELO A;  1XPO A;  1U0L A;  2R7F A;  1YJ9 A;  1FVI A;  1SR3 A;  1EUJ A;  1PYS B;  4X64 Q;  5BR8 L;  4DUY Q;  1K0R A;  1IBM Q;  5C0X J;  4LF4 Q;  1XNR Q;  2Y0S E;  2F3I A;  2UUB Q;  3K7A H;  4DV6 L;  2CWA A;  4LF8 Q;  1JB7 A;  5C0X G;  4JYA L;  5C4X H;  1VQ4 A;  1L0W A;  4GOP B;  1V9P A;  1YHQ A;  2KHJ A;  1VQ8 A;  2CCZ A;  5LMN W;  5IY0 A;  4C3J H;  2QA4 A;  1VQA A;  3L0O A;  3CC7 A;  1VQH A;  5LMU Q;  1PH9 A;  1FJG Q;  2N49 A;  4LF7 L;  3GTP H;  5LMU L;  1FJG L;  3TS2 A;  1HZB A;  2OWO A;  3PF5 A;  2BH2 A;  1YVC A;  4BBS G;  3BZK A;  4QGU A;  4AQY Q;  2OQ0 A;  5M3F G;  2UXC Q;  1Q86 C;  1Y1V G;  1HNW L;  3DLL A;  2V1C C;  3CCU A;  1I3Q H;  3I7F A;  1YI2 A;  1CKM A;  5IP9 G;  2AWN A;  3ERS X;  2AKW B;  3U4Z A;  4JI7 Q;  4B3T Q;  2JA7 H;  3HOU G;  2K14 A;  4YCV A;  3S1Q H;  1HNW Q;  2ZTE A;  4DV0 Q;  4A3C H;  4X65 Q;  2AHO B;  3S24 A;  3J81 c;  2XTI A;  3AYH B;  2KCT A;  3KDF A;  2JA6 G;  1TWC H;  2IX0 A;  2MQH A;  1VQP A;  4HJ9 A;  1PHJ A;  3IRB A;  1S72 A;  4EQ5 A;  2JA8 G;  3RLF A;  3CCJ A;  4JOI C;  4B3T L;  1Z9F A;  4DV5 L;  2ES2 A;  1K3R A;  4A3K H;  1GD7 A;  2DGY A;  1SN8 A;  1X65 A;  5AJ3 Q;  2QEX A;  4DV0 L;  4A76 A;  4DR3 L;  3PUX A;  1N33 L;  2R92 H;  4XTC S;  2EQS A;  5IP7 G;  3CCQ A;  1ASY A;  1PYB A;  2K4K A;  2B29 A;  2Q2T A;  1IZ6 A;  4KHZ A;  4DKA C;  2OTL A;  5M3M H;  1K8G A;  1XPU A;  3CF5 A;  5AJ3 L;  2VUM G;  2CFM A;  2VUM H;  1SRO A;  1NTG A;  4DPG A;  3CXC A;  1K73 C;  4LF9 Q;  4BY7 H;  1SRU A;  3OTO Q;  1VQO A;  3HOW H;  3J80 c;  4HJA A;  2ZTD A;  4GN4 B;  4KLK A;  4LW1 A;  3M4Q A;  5IP7 H;  2VQE Q;  1HR0 W;  2NVX H;  2JA7 G;  3HOU H;  2OTJ A;  2I0Q A;  1GKH A;  4OX9 L;  1J5E Q;  3M3Y H;  1N8R C;  5EAY A;  2VW9 A;  3M7N A;  4R4I A;  4DR7 Q;  3NBH B;  1A62 A;  2ZM6 L;  3S2D H;  2CQO A;  3KFU A;  3CC2 A;  1XNR L;  4DR7 L;  5GAE C;  1YJW A;  2UUC L;  4GKJ L;  4DK3 C;  2K52 A;  4OO1 G;  4JG2 A;  1VQG A;  1IBM L;  4BXX G;  4L5T A;  1QZH A;  1P16 A;  4GKJ Q;  1PH2 A;  4OWW B;  5FLM H;  2K5N A;  5JJL A;  4YHH Q;  1G6P A;  3TQY A;  1HZ9 A;  3G6E A;  4DV6 Q;  2UUA L;  1HH2 P;  4OWT B;  4JCV E;  2RHQ B;  1G51 A;  3U4V A;  2WAQ E;  1G29 1;  2PI2 A;  2JE6 I;  1YJN A;  1VQM A;  4BBS H;  2UXD L;  3GTO H;  4LUO A;  2UU9 L;  1EIF A;  4DV4 Q;  1HNZ Q;  4R4Q A;  4YCW A;  5DLQ E;  3S14 H;  3PIO A;  1X6O A;  1QVG A;  5GQO A;  1V43 A;  1X54 A;  4DR4 Q;  4NXN Q;  2PI2 E;  4LFB L;  1HNZ L;  1VQ9 A;  1T9H A;  4AQY L;  4JI1 L;  2F52 A;  3EN2 A;  3PUY A;  4LF6 Q;  1TWA H;  4GS3 A;  3S16 H;  4A3C G;  2B3G A;  4LFA L;  3E9H A;  2WFW A;  1WI5 A;  2Q2I A;  1Q1B A;  1KL9 A;  1A8V A;  2CKZ B;  1AE3 A;  3PUV A;  1FL0 A;  4C3H H;  3JAM c;  5GRO A;  4IPC A;  3CME A;  1WYD A;  4PZ8 A;  3KYH C;  2UXB Q;  1CKN A;  1UE7 A;  4A3D G;  1UEB A;  1KC8 C;  1CSQ A;  4X65 L;  4JI6 Q;  1QVF A;  3PV0 A;  3AFP A;  3CC4 A;  2Z6K A;  3U58 A;  1RL2 A;  4Y7N H;  1VQC A;  2YTX A;  5FLX c;  4JYA Q;  3RZD H;  2GVA A;  2QGQ A;  4NB3 A;  3M9B A;  4R1J A;  3ULJ A;  3F2B A;  4JOI A;  3RLO A;  4POG A;  4A3B G;  1HNX Q;  3CCS A;  4IPG A;  1N33 Q;  2R7Z H;  1Q82 C;  4DV2 Q;  4IFD I;  3Q8D A;  4YWM A;  1Q7Y C;  5FLM G;  3JC6 6;  4O2D A;  5E7N A;  1XMO L;  3CCL A;  3B6Y A;  2HIX A;  5C44 H;  2H5X A;  4A3I H;  1VQL A;  5C4X G;  1IXR A;  3FHW A;  4TVA B;  2E2I H;  4A75 A;  4QL5 A;  2HHH L;  4LF5 Q;  2C35 B;  4DV2 L;  3W1B A;  3KDF B;  4A3L G;  1VQD A;  4DV5 Q;  3OTO L;  3I56 A;  1E1O A;  1UWV A;  4DR3 Q;  3L2P A;  1K9M C;  4R4C A;  1UE6 A;  3E0E A;  3ER0 A;  4GNX C;  3F8T A;  5IYB H;  1Y1W G;  1LM0 A;  3EIV A;  4JI4 Q;  2WB1 E;  1D8L A;  4APV A;  3J81 j;  2JA5 H;  5IWA Q;  1IL2 A;  1VQB A;  2AWO A;  4QIW E;  3CCE A;  3TEH B;  5IYD G;  1OXX K;  2PQA B;  3T1H L;  5IWA L;  3S15 H;  1WJJ A;  2KEN A;  4P72 A;  2RCN A;  3STB C;  3HOX H;  2DUD A;  1BBU A;  3T1Y Q;  1S40 A;  4HID A;  2F4V L;  1H95 A;  1M90 C;  3CPF A;  2FXQ A;  3JAM i;  5C3E G;  4YHH L;  2ZJR A;  4A3E H;  1PH5 A;  3GTQ H;  3S1N H;  1OXT A;  3T1Y L;  1N34 Q;  3ICE A;  3H0G G;  2UXD Q;  4EX5 A;  1VQI A;  4JI3 L;  4LF8 L;  2Z6K C;  4BY1 G;  4DAM A;  3HOW G;  4BY7 G;  4C2M H;  3S17 H;  5IYC H;  3WWV A;  4DNI A;  4R4O A;  1ASZ A;  4JBJ A;  3A5U A;  3AQQ A;  2N8N A;  4DR4 L;  4LFB Q;  3I4O A;  4NXM L;  4OXP A;  4AH6 A;  1PA6 A;  2A1A A;  4OWX B;  4LF4 L;  1PV4 A;  1Q8K A;  4JI1 Q;  2BA0 A;  1DGS A;  5JEA G;  2ID0 A;  4POF A;  3HKZ G;  1NY4 A;  3HOY G;  4JV5 Q;  3K81 C;  3F1Z A;  3U50 C;  1MIU A;  1M1K C;  1I5F A;  4B3S Q;  4KHP Q;  2B63 H;  1SFO H;  3S1R H;  2UXC L;  1GO3 E;  4GLA C;  1JE5 A;  1QZG A;  1JMC A;  4OO1 I;  1V1Q A;  1K83 H;  3ULL A;  3FKI G;  3FKI H;  1LTL A;  3J81 i;  1A63 A;  1QUQ B;  3I55 A;  3J7A 5;  4L5R C;  1IBK L;  5JJK A;  3TRZ A;  2NVT H;  3H3V H;  1X9N A;  4LF7 Q;  4P74 A;  4JI8 Q;  3AEV A;  2B63 G;  5IP9 H;  1B8A A;  2IY5 B;  3I4M G;  4DV3 L;  1LYL A;  1OTC A;  3RZO H;  1P8L A;  2R93 G;  2A8V A;  3A74 A;  4YCU A;  5C3E H;  5LMN L;  3L7Z C;  1VCI A;  1I94 Q;  2Q2H A;  3KF8 B;  4JI2 L;  2NVQ H;  1VQF A;  3S1M H;  4IFD J;  1N36 L;  5HGQ A;  4QQB X;  2WB1 G;  5IYC G;  3HOX G;  1I94 L;  5J3B A;  1PVO A;  4BY1 H;  1KRS A;  4GKK Q;  4R4T A;  3K80 C;  4H02 A;  5FJ8 G;  3CD6 A;  3PF4 A;  1I6H H;  1I50 H;  3D31 A;  4LWC A;  5LMN Q;  2MO0 A;  4DR1 Q;  4KHP L;  4X66 Q;  2PNH A;  2I5L X;  2NZO A;  2YV5 A;  4LF9 L;  2ATW A;  4DR2 L;  4GKK L;  1E7Z A;  4PZ7 A;  2KHI A;  1XPR A;  3KF6 B;  2MO1 A;  2HT1 A;  3GTK H;  3UDI A;  5M5Y H;  4K0K Q;  5IYB G;  1IBL L;  1YBY A;  2GVB A;  1XMQ Q;  1NMG A;  3HOV H;  3NEN A;  3RNU A;  2JA9 A;  3RN2 A;  3M4O H;  3GD7 A;  3VDY A;  1X3G A;  4UPA A;  2LXJ A;  3PUZ A;  1EWI A;  1X56 A;  1MJE A;  4JC0 A;  1KQS A;  4YWL A;  4JI4 L;  1N34 L;  4ME3 A;  1OXU A;  1TXY A;  1KIX A;  3GTL H;  3CMA A;  2GN5 A;  1C7Y A;  1N32 L;  2JK8 A;  1E3P A;  3GO5 A;  2PMZ E;  1Q81 C;  3PO3 G;  2K5H A;  5BR8 Q;  4X64 L;  4DUY L;  4A3B H;  4A3L H;  5IE8 A;  1KD1 C;  4A4I A;  3CAM A;  2R93 H;  2K50 A;  1CKO A;  4X62 L;  2NZH A;  1KHI A;  5C44 G;  2VY3 A;  4A3I G;  1VQ5 A;  1NBW A;  1VQK A;  3UE1 A;  4DV4 L;  1EQR A;  3BZC A;  3CQZ H;  2IHF A;  3ULP A;  2F4V Q;  1YEZ A;  3HOZ G;  1HR0 L;  2E2H H;  3CPW A;  3EBE A;  2ZJP A;  3CCM A;  1UE1 A;  2RHS B;  4JI5 Q;  4YWK A;  4JV5 L;  2E8G A;  4MNO A;  1WCM H;  5ELN A;  2JQO A;  1BVS A;  2OQK A;  1NE3 A;  4X62 Q;  4UP7 A;  3I4N G;  4LUZ A;  4PG3 A;  1KRT A;  1VQJ A;  4KI0 A;  3PGZ A;  3ZJY C;  1HR0 Q;  4LUV A;  1EFW A;  1LUZ A;  2JJQ A;  1PH6 A;  1C9O A;  1J6Q A;  1VS0 A;  3I2Z A;  4JI5 L;  1GM5 A;  4BBR H;  1W3S A;  1Y1V H;  3UDG A;  2WAQ G;  1KXL A;  4JBM A;  1IYJ B;  3K7U C;  1VQE A;  1FGU A;  2Z0S A;  3KF6 A;  4LF6 L;  3J80 i;  4JI2 Q;  1PH3 A;  1EIY B;  4B3R L;  2JEA I;  2VNU D;  2A19 A;  1N36 Q;  4JBW A;  4PZ6 A;  2HQL A;  4QY7 A;  1E24 A;  5K36 G;  4AYB G;  2UUB L;  2UXB L;  3CW2 C;  4HJ7 A;  5M5X H;  3NEM A;  1Z47 A;  2YTV A;  4C3I H;  1L2F A;  4IO9 A;  2UU9 Q;  5H1S E;  1BBW A;  4DR2 Q;  3CCV A;  1VQN A;  2ASB A;  4HJ8 A;  2N3S A;  1KAW A;  1TWH H;  2BH8 A;  3FP9 A;  2L15 A;  4P73 A;  4NXN L;  4K0K L;  3K0X A;  3HOZ H;  1XTD A;  4Y52 H;  1CUK A;  1MKH A;  5GAD C;  1IBL Q;  1HNX L;  3K8A A;  4BXX H;  4OON A;  4XIG S;  4JI0 Q;  1Q12 A;  4UP8 A;  3PIP A;  3AFQ A;  1XMO Q;  1C0A A;  1B7Y B;  1WCM G;  4AYB E;  2I5M X;  2VL6 A;  3A5Z B;  5JEA J;  5C0X I;  3G48 A;  4L5S A;  4DR6 L;  4A93 G;  3J7Z C;  2HHH Q;  1XJV A;  1J5E L;  4WJ3 M;  4X66 L;  2KBN A;  1BKB A;  3HOV G;  2N78 A;  2Y0S G;  3KOJ A;  4LFC L;  3UDF A;  4JI7 L;  3T1H Q;  4O0A A;  2YU9 H;  4BA2 I;  4L5Q A;  1VQ6 A;  3M85 A;  2VZA A;  3HOY H;  4A3G H;  5IYD H;  1AH9 A;  3I4N H;  2VQF Q;  3OYY A;  1PH7 A;  4DV1 Q;  4A3M H;  3I4M H;  1AE2 A;  4A3K G;  3PUW A;  3W5O A;  3PO3 H;  4IPD A;  2VQF L;  4MTN A;  1YIJ A;  5JJI A;  4GOP C;  1D7Q A;  4GLV B;  4HIO A;  2UUA Q;  4QJF A;  4J15 A;  1UE5 A;  5GAG C;  1JT8 A;  4DV3 Q;  3HFZ B;  5C4J H;  1EQQ A;  4MZ9 A;  4A3G G;  2EXD A;  3H0G H;  1X55 A;  1XNQ L;  3D0F A;  2IX1 A;  3H3V I;  1CSP A;  1EOV A;  4LNQ A;  4NXM Q;  1GVP A;  1WFQ A;  4A3E G;  2I5H A;  2ZJQ A;  3HKS A;  4HIM A;  4UY8 C;  2JA8 H;  2ZTC A;  1X3E A;  2K75 A;  1PH4 A;  3GTG H;  5M5W H;  1XNQ Q;  4JI3 Q;  1CKN B;  2VQE L;  1K8A C;  1L1O B;  1Y14 B;  1YHA A;  3RN5 A;  4IPH A;  4DUZ Q;  3S2H H;  2ALY B;  4HIK A;  2LSS A;  4BBR G;  1HZA A;  1YHB A;  1Q46 A;  1SLJ A;  4HJ5 A;  3E9I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...