4C3HH

Structure of 14-subunit rna polymerase i at 3.27 a resolution, crystal form c2-93
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
144
structure length
134
Chain Sequence
NTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLNATRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the 14-Subunit RNA Polymerase I
pubmed doi rcsb
molecule tags Transcription
molecule keywords DNA-DIRECTED RNA POLYMERASE I SUBUNIT RPA190
total genus 22
structure length 134
sequence length 144
ec nomenclature
pdb deposition date 2013-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4c3hH00
4YCUA 3E0EA 2Q2HA 3S2HH 4Y52H 1HZBA 3DM3A 5C4XG 1K0RA 2NVYH 4YY3Q 5IWAQ 1CSQA 3KDFA 2ZJPA 4BBSG 3CCUA 4L5SA 2KCMA 4PZ6A 3PO3G 4JV5Q 3HOWG 4C3JH 4JI8L 2N49A 3W1GA 3GDEA 1PH6A 1JT8A 3F2DA 1N9WA 1VQAA 5GAEC 4NXMQ 4POGA 2F4VL 4A3FH 5IP7H 1OTCA 1NE3A 1UEBA 2AWNA 5AJ3L 4HJ9A 2VUMH 1WYDA 1YIJA 1RIPA 5H1SE 3PSIA 2UUAL 4IFDG 1N32L 3TEHB 4HIDA 3J80c 3ULPA 1EQQA 3GTOH 4A75A 3GTPH 1OXTA 1IBLQ 1YZ6A 4DUYL 1SRUA 4HJAA 1PH3A 1HNZQ 4DR3Q 5LMNQ 4GNXB 3HOZG 2D0OA 5FLXc 5C3EH 1MJEA 1S3OA 4DR1L 4OX9Q 3NENA 5EAYA 1X54A 5C4XH 1HNXL 4JBKA 5IYDG 2MNAA 4KHZA 1N34L 3EIVA 4H02A 1XTDA 2VZAA 4AQYQ 3MEFA 4NPSA 4A3GG 4MNOA 1KL9A 5FLMG 3HOXG 3CC4A 5IYBG 4A3LH 2PMZE 2VQEQ 1WJJA 1YITA 1B8AA 4B3MQ 1CKNB 2I5HA 3CCEA 3RZDH 1VQPA 3U50C 1EIYB 2D0PA 4PMWA 1WI5A 1VQIA 3L7ZC 2ID0A 4Y7NH 2JQOA 1WCMH 4B3RQ 1E7ZA 4JI4Q 4A3LG 5M3FH 2NZHA 4X65L 1CSPA 1GKHA 4DV5Q 1YHAA 1TWHH 1QZHA 4A3KG 3TQYA 3TREA 1VQHA 4DR5L 2MFIA 3PO3H 1JJGA 4TQUS 4AYBG 4POFA 3T1HQ 4KLKA 1D8LA 3RZOH 4GKKQ 1EUJA 2VS1A 2YYZA 1PH4A 4DKAC 4DV7Q 4HJ8A 2WAQE 4DAMA 4GOPB 3HOVH 3FKIH 4LFAL 5K36G 4GLVB 1JJCB 4UP7A 2C35B 1GD7A 4NB3A 3U4ZA 4AYBE 1UE1A 5JJIA 1EFWA 1MKHA 4LFBQ 1I6HH 1TWFH 4OXPA 3EBEA 2I0QA 3CC2A 4LF5Q 2JE6I 1VQDA 4TVAB 4A3IH 1N33Q 3S1MH 3BZKA 4A3JG 2R93H 3I4NG 1CKNA 3RNUA 2LXJA 4A3BG 1PYBA 3KF6A 2I5MX 4YHHL 1YHQA 3AFPA 1YI2A 4RG1A 1KD1C 3CCRA 3I4NH 1IBMQ 3WWVA 2F52A 4A3DG 4GNXA 3HKSA 4PZ7A 4L5QA 3T1YL 1X3GA 2ES2A 1AE2A 3ICEA 1Y1WG 4K0KL 2UXDQ 4QJFA 3CF5A 2AWOA 4JI7Q 2E5LL 2NVTH 1NY4A 2YTXA 2R7ZG 3ERSX 3G71A 3CCJA 1FVIA 2L15A 1MIUA 4R4OA 4APVA 4XTCS 3W1BA 5HY6A 2XGTA 3CC7A 4HIOA 4A3EG 3CD6A 3GTQH 4UPAA 2OWOA 1VQJA 4A93G 2JJQA 1Q1BA 1Q46A 1QUQB 1U0LA 2RCNA 3PIOA 2WB1E 4JI7L 4K0KQ 2DUDA 3M4QA 1V9PA 4OWXB 1X6OA 1XMQQ 3T1YQ 2UXDL 3F8TA 4EQ5A 3BJUA 1J6QA 5FLMH 4DV6L 1S72A 2UXBQ 3HKZG 2Q2UA 3Q8DA 1OXUA 5E7NA 2OQ0A 3NEMA 2F3IA 1XNRL 4DNIA 3D31A 5ELNA 4DR6L 1SR3A 3CAMA 4LF5L 3ULJA 4AH6A 4GKJQ 3K0XA 2Z0SA 3KFUA 2CQOA 3PO2G 3HKZE 1J5EL 1X3FA 2RHSB 3PUXA 1A63A 4DV7L 4GOPC 4LF9Q 1YVCA 4A3MG 1PHJA 2KENA 4DUZL 1X65A 1KRTA 4IO9A 4LUOA 4DR5Q 4X65Q 4DV5L 1HR0Q 5ELOA 4JI4L 3AEVA 4IOAA 3JAMi 4BBRH 2ZTDA 3STBD 2OTJA 4JOIC 1QVFA 3JAMc 1EIFA 2HHHQ 3S2DH 4YWLA 2K75A 2BH8A 4DV0Q 4B3ML 2CKZB 3PIPA 4JC0A 1KRSA 4GNXC 2VQEL 3GTJH 4EX5A 1R9TH 3UDXA 1UE5A 1VS0A 4HIMA 1N34Q 3HOZH 1AH9A 1BBWA 2CFMA 1Q82C 2A8VA 3OTOQ 3RLNA 5M5YH 1IXRA 3A74A 2VQFQ 1YNXA 3F2BA 2CWAA 2IX1A 2GVAA 1I3QH 5LMNL 1HNZL 2VY3A 1ASYA 4DUYQ 1CKOA 2JA6H 4IPCA 3KJOA 1OXXK 1VQ9A 2YTVA 5IYCG 1N32Q 4A3IG 4JI2L 2UUAQ 1VQMA 3GTMH 1V1QA 3AFQA 1Y1VG 3K8AA 2JA7G 1D7QA 5AJ3Q 1G51A 4WJ4A 4YCWA 4J15A 1XMOL 3M85A 4NXML 1HZ9A 1U5KA 2F4VQ 2UXCL 2HT1A 5C0XI 4P72A 1K83H 1KAWA 4R4CA 4JI8Q 5M3FG 3PUVA 1UE7A 2OCEA 4BY1H 4GS3A 4JV5L 3PGZA 5IT9c 4C3HH 3GTGH 4LWCA 1IZ6A 2K14A 2N78A 1PV4A 2B29A 4BA1I 5IWAL 3CCVA 4YY3L 4B3TQ 4JI6L 4X62Q 4KI0A 5M5WH 4A3DH 5IYCH 3VDYA 1TWCH 1XJVA 2E2HH 1C9OA 2MO1A 4R4QA 1IL2A 3J7A5 1LM0A 5HGQA 3OW2A 3CCMA 1VQEA 4IPDA 4JG2A 2IHFA 1XNQL 1YJWA 3KF8B 3M4OH 1JMCA 5C44H 1PYSB 1IBKQ 1XNQQ 1C0AA 2WP8J 3JC66 1JJ2A 4QQBX 3AYHB 4IOCA 1E3PA 5JEAJ 1EOVA 1XPRA 1UE6A 1SFOH 2HIVA 4LF6Q 5C0XJ 1RL2A 4X62L 4JI6Q 3L2PA 1N8RC 4DK6C 2ZM6Q 4DAYB 1BKBA 1PH7A 5IY0A 4DV1L 5C3EG 4P74A 1B7YB 1QVCA 2ASBA 3G4SA 1I94L 1SN8A 1NMFA 4X66Q 1HH2P 4JI0L 4A3KH 2LXKA 4LFCQ 4JOIA 3CQZH 2YU9H 2Z6KA 2VL6A 1LTLA 1QVGA 2MO0A 1OXSC 2UXCQ 1XMOQ 4UP9A 4LF7L 3H3VI 2GN5A 1BBUA 1XPOA 3D0FA 5IE8A 4L5RC 5M3MH 3FP9A 1G291 4JI2Q 2R6GA 4DR4Q 2JA9A 4LUVA 2OQKA 3HFZB 4GOPA 4L5TA 1V43A 3STBC 3PUYA 2ZTEA 1NMGA 4DV4L 3H3VH 3J81c 2BA0A 4DV2Q 4JI5L 4BY7G 4WJ3M 1N36Q 1Y1VH 2Z6KC 3CPFA 1K3RA 2ALYB 3L0OA 4JI1L 2VQFL 3PF4A 1H95A 3FHWA 3G6EA 1E22A 2V1CC 3OTOL 1KHIA 2Y0SG 1YJNA 1T9HA 1E24A 1SMXA 1B70B 4GN3B 4GN5A 1K73C 1KIXA 3RN5A 1YBYA 2IX0A 3I56A 3M7NA 4KHPL 4A93H 1Q7YC 2FXQA 1I50H 1I5FA 5FJ8G 1A0IA 4IFDJ 3K7UC 2WB1G 4DK3C 2ZJQA 4DV0L 1W2BA 2HHHL 2Y0SE 4QIWE 4A3FG 2VUMG 4A76A 5BR8Q 2UUCQ 4GN4B 5M5XH 1PH8A 5LMUQ 1A62A 3KYHC 1VQ5A 2R7DA 4OWTB 1HR0L 1TWAH 2HQLA 4JBMA 1VQ8A 2B3GA 3RLOA 4YWMA 1VQ7A 3AQQA 5C0XG 3A5UA 3DLLA 4DUZQ 4LF8Q 1FJGL 1EYGA 2AMCB 3TRZA 3S16H 2JA6G 4LF9L 1G6PA 2NVQH 2R93G 2EQSA 4A4IA 3NELA 3NBHB 3PUWA 3SGIA 1HNWL 5FJ8H 3G48A 4BA2I 3CMEA 1J5EQ 3MXNB 3I4MG 1L1OC 1M90C 1VQGA 1WOCA 3UE0A 4GKJL 3GTLH 3GO5A 3E9IA 4A3JH 1KQSA 3HOVG 1Z9FA 3PUZA 3S1NH 4DR6Q 3CCLA 3B6YA 5GROA 1XNRQ 2PNHA 1Z47A 1GO3E 1NBWA 3F2CA 2JA5G 4O2DA 2UXBL 2PI2A 4DV6Q 2JK8A 3I2ZA 4YWKA 4BBRG 1VQ6A 1XMQL 1YEZA 2JA8G 4DR7L 5M3MG 2WAQG 1EWIA 1CKMA 3KDFB 1PFSA 4JI3Q 1IYJB 2K5HA 3UDFA 2KHJA 4DR2Q 2K50A 1CUKA 2B63H 4LF4L 1OXVA 1BVSA 1NTGA 3M4PA 3UDIA 4JBJA 2WFWA 4RMFA 2QGQA 5GAHC 2JEBI 2EIFA 2HIXA 1ASZA 2E5LQ 1HJPA 2GVBA 1X55A 4FDBA 1VQ4A 1IBML 2ZJRA 4IPGA 3ZJYC 5GQOA 4IJLA 4P73A 4NXNQ 2H5XA 4YHHQ 2K4KA 3PCOB 3M9BA 4R4TA 2JA7H 3CP0A 1Q81C 1HZAA 2LSSA 1K8AC 2JEAI 1N33L 1KXLA 5C44G 3J7ZC 3ULLA 1C7YA 4R1JA 4LFBL 3EN2A 4JCVE 4NXNL 2YV5A 1K8GA 2AHOB 2PI2E 3CW2C 4LFAQ 4IFDI 1HZCA 2YTYA 3TS2A 1P8LA 4ALPA 2E8GA 4O0AA 4AIMA 3KJPA 2N3SA 5DLQE 2QA4A 4GKKL 1VQFA 3T1HL 4BXXG 5IP9H 1YHBA 4QGUA 2IY5B 1SROA 4PZ8A 2IHEA 1Q86C 3UE1A 1PVOA 3RN2A 3I7FA 4BY1G 1GM5A 2K5NA 3HOWH 4LF4Q 4B3RL 2R92H 1X56A 2KCTA 4DPGA 3U4VA 2R7ZH 3CMAA 4DR2L 3CPWA 3J81i 2ZTCA 2JA5H 1XPUA 1QZGA 4JBWA 4A3BH 3BU2A 4JI3L 3HOUH 3KLWA 4DR7Q 4C3IH 3H0GG 4C2MH 4A3CG 1WFQA 3S17H 4AQYL 3S24A 1JB7A 2A1AA 2AKWB 4BXXH 3KF6B 4QY7A 4PG3A 1FGUA 4OWWB 4A3MH 2K5VA 1HNXQ 1VQBA 3GD7A 5IYBH 3TS0A 1W3SA 3HOXH 2ATWA 1VQOA 2DGYA 2R7FA 3PV0A 4DR1Q 4OX9L 1Q1EA 2PQAB 2RF4A 3J80i 2KBNA 3H15A 4DR3L 3PF5A 1AE3A 5JJKA 1IBLL 5IYDH 3PO2H 4BY7H 1JE5A 2KHIA 4P71A 3A0JA 1Y14B 3RLFA 4XIGS 4UP8A 1HNWQ 5GAGC 1YJ9A 1PA6A 2PQAA 2N8NA 2QEXA 1TXYA 2K52A 3CCSA 1KC8C 2CCZA 3ER0A 3BZCA 1FJGQ 4OO1G 4LF8L 4IPHA 4P75A 4UY8C 4X6AH 1VCIA 4QL5A 2IT1A 1X9NA 1SLJA 3S15H 2NZOA 4LNQA 5LMUL 4GLXA 2Q2TA 1M1KC 5BR8L 3I4OA 2UUCL 3K80C 1VQLA 5JJLA 1UWVA 2MQHA 3M3YH 3S1QH 4A3GH 2OTLA 1MJCA 3CCQA 3GTKH 4ME3A 3HOYG 1TWGH 4A3EH 1P16A 1X3EA 4KHPQ 3W5OA 2B63G 4HJ5A 3HOYH 3OYYA 2E2IH 4JYAQ 1PH5A 1VQKA 2UUBL 4B3TL 4OONA 1DGSA 1A8VA 1QUQA 3LGJA 4JYAL 4X64L 2CWPA 4HIKA 3K81C 1Y1WH 3CXCA 1VQNA 4JI1Q 4GLAC 4B3SQ 4MZ9A 3S1RH 1N36L 1E1OA 4JI5Q 3I4MH 4LW1A 4DV2L 5IP7G 4MTNA 4DV4Q 1K9MC 1SE8A 4IJHA 4R4IA 5C4JH 1EQRA 1O7IA 2EXDA 3H0GH 4A3CH 1Q12A 2BA1A 3KOJA 2NN6G 2RHQB 4DR4L 2BH2A 2NVXH 1L0WA 2VW9A 4LF7Q 4DV3L 4BBSH 2R92G 2D62A 4LUZA 1PH1A 2UU9L 5J3BA 3E9HA 2UU9Q 3U58A 4OO1I 3FKIG 3A5ZB 2VNUD 4DV3Q 4LFCL 4JI0Q 4X66L 1LYLA 1I94Q 5IP9G 5JEAG 1S40A 2JA8H 4DV1Q 1L2FA 2NN6I 1Q8KA 3F1ZA 3J81j 1LUZA 2ZM6L 5LMNW 2E2JH 3I55A 4LF6L 1L1OB 3RR5A 3S14H 1PH9A 1WCMG 3IRBA 1HR0W 1NJIC 1E1TA 2I5LX 4B3SL 2XTIA 1PH2A 1GVPA 3UDGA 3K7AH 1IBKL 2Q2IA 4X64Q 3HOUG 1FL0A 4YCVA 5GADC 1VQCA 2UUBQ 4HJ7A 1L1OA 2A19A
chains in the Genus database with same CATH superfamily
5C5LA 4YCUA 5T1IA 3C2PA 2B8FA 3S2HH 1BXTA 2RKSA 1CTMA 1HZBA 1I4RA 5NUCA 5C4XG 1LTGD 2O5IC 2NVYH 2LY7A 2ZJPA 1CSQA 3HGBA 3CCUA 2Y0SB 2F0WA 2JP1A 5HGTA 1FGBD 3HOWG 3W1GA 1JT8A 1DOLA 4BWGB 3TP5A 1SYBA 2UUAL 1F9SA 3TEHB 3J80c 1JICA 3GTPH 3MXGA 1D1KA 3DWQA 1HNZQ 5LMNQ 2F0GA 3SR1A 3GV3A 4K5XA 5ELFA 1FYCA 3NPPA 5C4XH 1HNXL 3S1QB 1O7YA 3MEFA 4MNOA 3CC4A 5LL6S 3N6RA 2DY7A 4S3SA 2VQEQ 4B3MQ 2X69A 2A69C 4X3TA 4MN3A 2F0PA 3QIAA 4A3KG 3VYTA 3EROA 4TQUS 5M5YB 2L11A 3RZOH 1D8LA 2VS1A 2M2LA 4DKAC 4DV7Q 2WAQE 1JQYD 2AUJD 4UP7A 1JJCB 3U4ZA 1GD7A 1UE1A 1EFWA 2WKCA 4LFBQ 2BE5D 5FKAC 2JE6I 1N33Q 4A3JG 3J80L 4BY1B 1Y8OB 1YI2A 3I4NH 1KD1C 1IBMQ 3ZYYX 3T1YL 1V1PB 2ES2A 4U68A 3I4MB 4JI7Q 2YTXA 2R7ZG 3CCJA 3MA2B 4FVMA 3A54A 1NAPA 4R4OA 5HY6A 4A3EG 3S2HB 4RFBA 1CZWA 2JJQA 5C44B 3D4WA 2B2WA 2B2UA 2WB1E 3M4QA 3T1YQ 1J6QA 3HKZG 1OXUA 2OQ0A 1G6ZA 5KYIA 3J80E 1SJHD 5ELNA 3EFXD 2ZXPA 1VMPA 1SR3A 2CW0D 1RKNA 3ULJA 3K0XA 2Z0SA 4J6HA 4B08A 2FMMA 4DXGA 4KY7A 3M7GA 4X3SA 5IT9L 4DV7L 5I6YA 2A6HC 1G8ZD 2A6EC 3V05A 2QDBA 3TDQA 1VMCA 2A6HD 4BBRH 3STBD 3P7JA 4JOIC 1MBYA 2HHHQ 4L8JA 4B3ML 2VQEL 3GTJH 5ELDA 1BBWA 1IHZA 2B2TC 2A8VA 1D5XC 1E2VA 4EQNA 5I2XA 1IXRA 5M5YH 4N8FA 1YNXA 3F2BA 4DXFA 3CU7A 1ASYA 1CT1D 1CKOA 3FVQA 4V0BA 2K32A 4RGNA 1N32Q 4A3IG 2UUAQ 5D3IB 1V1QA 1Y1VG 3K8AA 1D7QA 5AJ3Q 1G51A 4WJ4A 4DFAA 3M85A 4NXML 1U5KA 5C0XI 2X6GA 1IW7D 1ILQA 2A74C 1PZKD 1RJTA 5EPJA 4BY1H 1IKLA 5IT9c 3GTLB 1ICFB 2N78A 3S1NB 1CI3M 5T1GA 5IWAL 1VF7A 4BS9A 4JI6L 1LT6D 5M5WH 3RUZA 5IYCH 3VDYA 3J7A5 2MO1A 1LM0A 5HGQA 4FNFA 1EYCA 5J39A 2Z9HA 1VQEA 2IHFA 1XNQL 2XWJB 1YJWA 1STHA 5C44H 2LKVA 2G5DA 3L9AX 1HHVA 1LV9A 3JC66 4QQBX 2MP1A 1XWEA 2CH4A 1XPRA 1SFOH 2HIVA 4IUTA 4F87A 4JI6Q 2PCFB 5KIXA 4DK6C 3NQIA 4DAYB 1BKBA 1N8RC 5C3EG 5I2YA 1ZEQX 4X66Q 2QKIC 1HH2P 2LXKA 3CQZH 5E1FA 3G6JB 4OEMB 4AYBB 1LTLA 1Q90A 1HFNA 4UP9A 3HOUB 1XPOA 5CORA 2R6GA 3HFZB 4L5TA 1TU2B 3K5OA 1V43A 3H3VH 4JI5L 2Z6KC 3GV6A 4FXKC 1K3RA 4BBSB 2F0HA 3PO3B 3SK5A 2G9HD 4GN5A 1K73C 1BF4A 1C4QA 2VB3X 2IX0A 1IL8A 3BDOA 1I5FA 3WOEA 4DU9A 5CMDA 3Q22A 2WB1G 2CHBD 2K5QA 4DV0L 4CDFC 2HHHL 4NP5A 2K5WA 3NHHA 4A76A 2UUCQ 4GN4B 3QWNA 4C3IB 2X6LA 2HD3A 1H9RA 2AQ1B 4HTHA 4HMJA 1FNWA 1VQ8A 3DEOA 5C0XG 1FJGL 1EIHA 1EYGA 2AMCB 3PIO3 2JA6G 1ZYRD 3FDTA 2R93G 3D4DA 4CDCC 3VR3A 1A3VA 3G48A 4BA2I 2NVTB 2DJFC 3MXNB 3I4MG 2N88A 1NUCA 1STYA 2PZTA 1M90C 3BG3A 1ESRA 1VQGA 5JVH3 4GKJL 3GTLH 3IFTA 4KKUA 1KDBA 2NTSA 4A3JH 3PUZA 3S1NH 4DR6Q 3CCLA 2F1MA 1WTOA 1BCPF 4O2DA 2EYPA 5IGGA 1S5FD 1C8CA 3IFDA 1PRTC 5M3MG 3MHBA 3X3NA 2K50A 1E0BA 1HTPA 2F0LA 2B63H 1A2TA 3DUZA 4LF4L 1KABA 1OXVA 4XYQA 1NTGA 2OT2A 1DXMA 3E5SA 1SFOB 4UHVA 1BNZA 2QGQA 2JEBI 2EIFA 1B2TA 1B50A 4ZKBB 3SDZA 1Z6HA 3ZJYC 4P73A 4NXNQ 5CV7A 1D6EC 3M9BA 4KTAA 5COYA 1K8AC 2LSSA 1KXLA 1N33L 1EY0A 5C44G 1B4OA 4LFBL 3EN2A 2KHSA 4PNYA 2PI2E 2EYHA 3CW2C 1YNJC 4K6LA 4O0AA 5F2DA 2E2JB 5BN5A 1EY6A 4PZ8A 1XX8A 5C0XH 3RN2A 4DF7A 1HUNA 1GM5A 1EEID 2K5NA 4J8QA 4ZUIA 3U4VA 4IALA 1B53A 3J81i 2ZTCA 2JA5H 4A3BH 4JI3L 4DR7Q 4C3IH 3H0GG 4LMQD 3KBXA 4C2MH 3S17H 2BCOA 1D2BA 2K5VA 1HNXQ 1VQBA 3C3LA 1AZQA 1II3A 4DR1Q 4R9WA 1Q1EA 1QILA 2RF4A 3MTSA 5CV8A 2KBNA 5D65A 3H15A 5JJKA 3PO2H 2KHIA 3RLFA 2EYMA 5C4JB 4A3FB 2VUMB 4ME5A 3HP3A 1YJ9A 1SNQA 1SSOA 1U4PA 1TWCB 5KYLA 3CKIB 3LWUA 3OPOA 1F2ZA 3CCSA 4P2CB 3ER0A 4OO1G 4LF8L 4UY8C 4IFDH 4DAVA 3E6ZX 2MJ8A 5LMUL 4ZCKA 3I4OA 4A3GH 1IW7C 4ME3A 1TWGH 3H94A 4KHPQ 4HJ5A 3S1MB 1ZYRC 2H1EA 2PO4A 3OWFA 4X64L 2CWPA 2I46A 2F0NA 5KNDA 4GLAC 5M3FB 4B3SQ 1N36L 1E1OA 1TVXA 1SJED 4DV4Q 1CA5A 1EQRA 1O7IA 2EXDA 3M4YA 1BOSA 1Q12A 4DR4L 2NN6G 1SYGA 5IGEA 5EKLA 5C3WA 3TP6A 4LF7Q 2F0MA 2R92G 2UU9L 4LUZA 2ICEC 5J3BA 5K36H 3E9HA 1F9RA 2Q8RE 1HQRD 1I94Q 3KUPA 1L2FA 2NN6I 5LMNW 1LUZA 2E2JH 3I55A 3R2TA 1CHQD 3T53B 4K6DA 3IRBA 5EKKA 2I5LX 5G3LF 2QCPX 1HQMC 2D9UA 4H7BA 1FL0A 3HOUG 1VQCA 1DYQA 4HJ7A 2UUBQ 2JA5B 4B9WA 4JYAL 2SDFA 3GTQB 4WORA 3SEBA 2KA7A 4BBSG 3SVMA 4R8IA 4QIWB 4L5SA 3I8ZA 3PO3G 4JV5Q 1F2LA 1K3BC 4C3JH 4K2KA 2N49A 1TWHB 4KHVA 1N9WA 3D6CA 4X3KA 2F4VL 4A3FH 5IP7H 1OTCA 2VUMH 2AWNA 2F0DA 1Y8NB 1RIPA 2K5DA 5FO8B 4IFDG 4HIDA 3ULPA 4A75A 1O80A 1OXTA 1YZ6A 4HJAA 1PH3A 4DR3Q 4GNXB 4WRDA 2D0OA 1FNUA 1PMRA 1LTBD 2JA6B 1PTOC 2R93B 2RSOA 2K7VA 1U4MA 3KLSX 3EIVA 4K14A 5BN4A 2VZAA 3H09A 4NPSA 3TMEA 3NTKA 1KL9A 5FLMG 3BYTB 4L6TB 1YITA 4BY7B 4ILWA 1CKNB 3CCEA 1PFBA 3TP7A 3RZDH 1VQPA 3U50C 2D0PA 1PFMA 1VQIA 2EYLA 2JQOA 3A8IE 1E7ZA 4A3LG 5M3FH 4DV5Q 2QEJC 3TREA 3CRKC 2MFIA 3PO3H 1JJGA 4POFA 1JWSD 1PH4A 2K1BA 5CR3A 4QMGA 2EYOA 1W6KA 1MKHA 1GUNA 2DN8A 1WVLA 4LF5Q 2HDLA 3BZKA 1A3UA 1EIGA 1Q8IA 3KF6A 4OIJA 4RCOA 4TSSA 4YHHL 4RG1A 3CCRA 1IKMA 2F52A 4A3DG 4GNXA 3HKSA 4L5QA 3MAQA 3ICEA 4K0KL 2NVTH 1NY4A 3OOCA 3ERSX 3NP8A 3QOLA 2Z8LA 3H0GB 1FVIA 4MIUA 2L15A 1VF5C 3W1BA 3H6MA 3GTQH 2Z6BA 1MGSA 2K01A 1IYVA 2L5TA 2NYZD 3K5NA 2F0VA 1Q46A 1QUQB 1FR3A 4K0KQ 4OWXB 1V9PA 2UXDL 1X6OA 5IGCA 1H9SA 4EQ5A 1S72A 1B3QA 2EY5A 2AUKA 1TWFB 4DNIA 3KLRA 2NUCA 5HURA 3CAMA 1DOMA 3A55A 3NBIA 4LF5L 3KFUA 2CQAA 5M5XB 4LF9Q 1YVCA 4JW0A 3FEWX 1K0SA 1JWUD 3A8KE 4DUZL 4NMZA 4DR5Q 4C3IG 4X65Q 1HR0Q 1CQFA 4M8AA 1S4ZA 5BN3A 4C3HB 3GTGB 4XQNA 3JAMi 2ZTDA 2HCCA 2NB0A 2SEBD 1EIFA 4O42A 4IUUA 3S2DH 1LO5D 2CKZB 2F03A 1KRSA 1BCPD 4RKLA 4GZYC 1R9TH 2QF7A 5E4WC 1AH9A 1CQVA 1ET9A 2KOLA 1Q82C 1I4QA 3OTOQ 4NKLA 1BCPC 4NW2A 3A74A 2VQFQ 3TSSA 2IX1A 1EY7A 1TR5A 1KDAA 2JN4A 5EPKA 4RHSA 3KJOA 1OXXK 3P20A 1QJOA 1V1PA 5IYCG 4H0LC 3S17B 4QF4A 2JA7G 1XMOL 3QO2A 1HFGA 2F4VQ 4CJ0B 2HT1A 4RHRA 1K83H 5M3FG 4OWWB 2GA4B 5CV4A 4K2LA 1UE7A 4JV5L 3ITPA 2F0UA 2K14A 2WV6D 1SNPA 2B29A 3OSOA 5CC4A 2NTTA 1CK1A 4X62Q 1LTID 4KI0A 1LT4D 1TWCH 2RDFA 4PV1C 3U9OA 4J1MA 2VB2X 3HEJA 3OW2A 4RH6A 2B8GA 5C4ZA 2BOSA 1JMCA 2ENBA 3AYHB 4OHJA 1E3PA 1EOVA 2KEDA 1UE6A 1ENAA 5C0XJ 1S5BD 3NUCA 4X62L 1QCBD 5JVG3 1LLRD 4DV1L 1QVCA 1SN8A 4EQPA 1NMFA 4JI0L 2B2VC 2K04A 4A3KH 2Z6KA 1SYEA 2VL6A 1OXSC 2IWHA 1AEXA 4LF7L 1SYFA 2CVRA 3D0FA 2OQKA 3SHLA 3VA5A 1D5ZC 3PUYA 2ZTEA 1GUOA 4DV4L 2O2LD 5C5MA 4BY7G 2R3ZA 1EZ8A 5J1ZA 2VQFL 3PF4A 1PZID 3G6EA 1E22A 1YJNA 1E24A 1FD7D 1SMXA 4CDEC 1KIXA 5EPLA 4KHPL 1AFPA 4IFDJ 1ENCA 3MC0B 3K7UC 3HRZC 5EBCA 4DK3C 1W2BA 2Y0SE 1BBXC 4A3FG 2VUMG 4OGQC 2PZUA 2EVBA 5LMUQ 1I6HB 2R7DA 3V96A 1HR0L 4MTKA 1VQ7A 2XIWA 4LF8Q 4DUZQ 1EQTA 2AQ2B 1SEBD 4V190 1A15A 1PYWD 2NVQH 3TBIB 3NELA 3NBHB 2MGSA 4XT3B 2IX3A 3CMEA 1J5EQ 1K83B 1GUTA 1L1OC 3NTHA 2XNAC 3HOVG 4C56C 5GROA 4XYOA 5CBAE 1XNRQ 4EQOA 2PI2A 3I2ZA 4YWKA 1VQ6A 1XMQL 2NVXB 4DR7L 3NWSA 3Q6SA 1CKMA 2B2YC 2L9HA 3K5LA 4KK7A 2LFNA 2PZWA 1CUKA 3GTKB 2KQ3A 1K8MA 1IYUA 3HOWB 1PRTF 2R92B 1PXUA 4RA8A 3ONAB 1HJPA 2O5JC 2GVBA 4N9TA 5LL6X 1ENFA 3MZ5A 4FDBA 1VQ4A 1JCKB 2ZXRA 5GQOA 2H5XA 3PCOB 1TKWB 3CP0A 2WKDA 3J81E 1LT5D 1CZGA 1EYDA 4C1NI 2NVYB 1K8GA 2AHOB 3K58A 3A8JE 4IFDI 2M00A 3QJYA 2K03A 4ALPA 4FF4A 2N3SA 4CHTB 3T1HL 2V4DA 5IP9H 5JEAH 4QGUA 2IY5B 1SROA 2F0JA 1D1IA 2IHEA 1NSNS 3SK4A 3I7FA 4X3UA 4LF4Q 2KECA 3U9SA 3CMAA 3QR8A 4DR2L 2PPBC 1SYCA 1XPUA 1JOQA 2J7ZA 3I90A 5KGUA 1QZGA 1ILPA 1F9QA 1KAAA 4A3CG 1WFQA 4DAYA 4AQYL 4I7ZC 2AKWB 1TT2A 4A3MH 2JA7B 3GD7A 5IYBH 4HEDA 1W3SA 3HS0C 2ATWA 2KVMA 4OX9L 1EQVA 4RAUC 4DR3L 4XQQA 3PF5A 3MVVA 5IYDH 1JE5A 4I7AA 3A0JA 2EJMA 3QOJA 4XIGS 4UP8A 2XVSA 4UDUC 2PYKA 1PA6A 2PQAA 5CV5A 3KLSA 1YNND 2CCZA 4ODGA 4Q5VA 1FJGQ 4IPHA 4ZYSA 1SLJA 3S15H 2LS01 2EPBA 2A73B 2Q2TA 1S5ED 2UUCL 3R8BA 3K80C 3I91A 1JE4A 4RCNA 1W6JA 1UWVA 3OMCA 3M3YH 3VR5A 3GTKH 3HOYG 3S14B 1ICWA 4FXDA 1P16A 2B63G 1X32A 4LK1C 3KK7A 4IURA 1RF2D 2FMCA 3HKZB 3NE5B 1RCVD 2WACA 2UUBL 4OONA 1DGSA 1A8VA 4O1NA 1VQNA 4JI1Q 3OIQA 2JA8B 3I4MH 4JI5Q 3PQIA 4LW1A 4MTNA 3J7AF 4IJHA 4G57A 4JVZA 2BA1A 1R9TB 2DY8A 3MFYA 3MEHA 1I4XA 1L0WA 1DONA 1SE3A 2TMPA 1PTOD 1ET6A 2F4IA 2UU9Q 4OO1I 1CHPD 2G9DA 3FKIG 4WJWA 1A3TA 4QCLA 1UAPA 1S40A 3W3AA 5C4HA 5I9OA 1R4QB 1AZPA 2WINB 3RR5A 1PH9A 4FF1A 1NJIC 1KNEA 3QG1A 3VYRA 1PH2A 3AU7A 4EVOA 5I9PA 3UDGA 2Q2IA 4K8IA 5GADC 4CJ2C 4B3TQ 1L1OA 1AN8A 4H44C 3E0EA 3IKJA 3BVMA 4Y52H 4XXEA 4YY3Q 5IWAQ 3KDFA 2F0EA 1GHKA 3J81L 2VXWA 4CBVA 3TN2A 4JI8L 3GDEA 3F2DA 1Y69U 4NXMQ 1KDCA 5AJ3L 5A2QE 4HJ9A 1WYDA 3VR4A 5H1SE 3PSIA 1N32L 3W2DA 1EQQA 1IBLQ 2BE5C 1SRUA 4DUYL 2N55A 1A2UA 5IIFA 5C3EH 1S3OA 3BYYB 4DR1L 3NENA 3WDNA 5EAYA 1X54A 4JBKA 5IYDG 2MNAA 3M3YB 2IL8A 1EY5A 3VA7A 4A3GG 1EFID 3HOXG 4A3LH 4HN7A 1QNKA 2PMZE 1WJJA 1B8AA 4KJOA 3SE0A 2KEEA 3I3CA 4PMWA 1WI5A 2ID0A 2XN9C 2NZHA 2RSNA 2JA8H 4DNTB 4AYBG 5M5WB 4GKKQ 1EUJA 3BDLA 1A6XA 2PMZB 2YYZA 4HJ8A 3J7AV 3HOVH 3FKIH 4LFAL 1BO0A 2FINB 3DWPA 4NB3A 5JJIA 3QB3A 4NDXA 1I6HH 3GTMB 4I65A 3KBGA 4ZRZA 1F77A 2I0QA 5C6AA 4TVAB 1VQDA 4A3IH 3TZDA 1DOKA 3RNUA 4FF3A 5JPMC 2I5MX 3AFPA 5LHY1 4PZ7A 1L0YB 3NWTA 1EYAA 2AWOA 3GQBA 3G71A 3EA6A 1MIUA 4APVA 3CD6A 2XGTA 1OO9B 1M8AA 3LNNA 3D4RA 2MPMA 1VQJA 4A93G 4BBRB 1LACA 1Q1BA 2F0QA 4G7ZC 2KCNA 3PIOA 2WAQB 3EVQA 4JI7L 4ZUJA 4OIKA 2Z4HA 3F8TA 3BJUA 5JJZA 4DV6L 2UXBQ 2Q2UA 3Q8DA 4TRDA 5E7NA 2BDOA 4IQZA 1MD2D 3OWEB 3NEMA 3VR2A 2F3IA 1SMYC 3D31A 4DR6L 4AH6A 4GKJQ 4KN4C 5IGFA 2E75C 3ND8A 1RDPD 3HKZE 2EY1A 5DM73 1X3FA 2RHSB 3VYUA 2QW7A 1A63A 3H3VC 2ICIA 4FO2A 5KNCA 5M3MB 3HOYB 1KRTA 4LUOA 1SNOA 2K05A 2EZVA 5ELOA 4U673 3WOFA 3AEVA 1LTAD 2OTJA 3I73A 3ND9A 2KCCA 4YWLA 4DV0Q 4Z9CB 3PIPA 4F88A 2C9OA 1JB3A 2RA4A 3UDXA 1VS0A 1I50B 2CFMA 1KNAA 2QDLA 1STEA 4DNRB 4JK1C 2CWAA 3HOVB 5LMNL 3FKIB 1HNZL 4DUYQ 1PDQA 4FYDA 1F2YA 4IPCA 5C4XB 2RQXA 4HCEA 2EY2A 2YTVA 1VQ9A 2B63B 1B3AA 3GTMH 3NXWA 2EJGC 4G4KA 4YCWA 2UXCL 3CQZB 4P72A 4JI8Q 4JBMA 4R4CA 1FNVA 3PGZA 5FOBB 3I72A 2JXMB 1IZ6A 1TS2A 5FO9B 3CCVA 4HSVA 4YY3L 4B9XA 4KJNA 3C46A 5EJWA 2CH4W 3I70A 1IL2A 3T51B 3Q23A 3OIPA 1PFNA 2L0CA 3CCMA 1EEFD 4JG2A 2F0KA 3T16A 1EY8A 2L12A 1PYSB 1IBKQ 1XNQQ 3JAML 1GHJA 4K5WA 2XSCA 4ZAIA 1JORA 3P1HA 4PMBA 1B7YB 3VR6A 2ASBA 2E76C 3G4SA 5IODA 2KUMA 1JOKA 4LFCQ 1B9NA 4JOIA 2EE1A 2B39A 4KKTA 1HXYD 2UXCQ 4L63B 1U4LA 5IE8A 4L5RC 5M3MH 1ONLA 1GXDC 4LUVA 1UNSA 4PMCA 4GOPA 2TSSA 2BA0A 2PW5A 3A7LA 1Y1VH 3MXPA 1LTSD 3KF8A 4Y7NB 4KKSA 3Q0AA 2ALYB 4JI1L 1HRJA 3L3OC 4A3JB 1H95A 1G2SA 4TKOB 4FXGC 5FO7B 3PO2B 4GN3B 1SNCA 4CKBA 4DAPA 1BQQT 3M7NA 1Q7YC 4RGOS 1I50H 1QE6A 1A0IA 2R7ZB 1Z7TA 1LT3D 1STBA 2FFKB 3I4LA 1XXGA 1TY2A 4QIWE 5BR8Q 3K57A 2Q8TA 1PH8A 4IUNA 1A62A 1HA6A 3KYHC 2XWBB 2HQLA 5CV9A 3RLOA 1WD1A 3FRPB 5EGTA 3TRZA 4A3GB 4HAEA 3HOXB 2D2CC 3IL8A 5FJ8H 3GTJB 3A7AB 1K28A 3GO5A 1KQSA 1Z9FA 1I4PA 1PRTB 1GO3E 2DNEA 2D5DA 2JA5G 1DCZA 2UXBL 4DV6Q 2JK8A 1TY0A 4BBRG 4HMIA 2JA8G 1EU3A 2WAQG 1EWIA 3KDFB 1IYJB 2K5HA 4ZK9B 1X3QA 4DN4M 2KHJA 4DR2Q 2JYOA 5FLXL 1T5XD 2OF1A 1BVSA 3M4PA 2EXZA 1PLFA 3UDIA 3G7LA 2A68D 3EQLC 4RMFA 2HUGA 5GAHC 1ASZA 1WTPA 1JR0D 4A3BB 1QB5D 4CGYB 4DK1A 3DHQA 1IBML 2ZJRA 1L0XB 4IPGA 2PNRC 1GUGA 4LAAA 1Q81C 2JEAI 4N9PA 3DMUA 3ULLA 1C7YA 3V2TA 1F2MA 4LFAQ 1HZCA 3TS2A 1P8LA 1Y1VB 4AIMA 5DLQE 4GKKL 4OL7A 1VQFA 4C3JB 1EOTA 4DK0A 1WTVA 3UE1A 2P5ZX 5J22A 1X56A 2KCTA 1E2ZA 5IGBA 2R7ZH 3CPWA 1CA6A 2A6ED 3HOUH 3KLWA 3LWEA 5K5PA 1JB7A 2HCIA 1MHWC 1EL0A 4BXXH 4KD3A 4IUPA 4KD4A 2XRQD 3HOXH 1VQOA 3PV0A 4Q0FA 3J80i 5CV6A 5I4DA 1IBLL 4BY7H 4F7XA 1M4VA 3SXHA 1Y14B 1HNWQ 2RCFA 4A3DB 4YIJA 2E2HB 5A2QL 3DXJC 1TXYA 1KC8C 3K0YA 3BZCA 2KJXA 4X6AH 1PTOH 3R93A 1VCIA 2IT1A 1X9NA 1UEAB 3VYSA 3C1EA 4LNQA 2B2TA 1O7ZA 4GLXA 1M1KC 3O13A 1CM9A 1VQLA 1TQOA 5JJLA 3MXUA 2OTLA 1MJCA 4C2MB 2PQEA 1MI2A 4A3EH 3EJIA 3HOYH 4LJZC 4QUFA 1PH5A 1S5DD 4B3TL 1QUQA 1EY9A 4HIKA 3CXCA 5DNFA 3S1RH 1J9OA 4DV2L 1RHPA 5IP7G 1SE8A 5C4JH 3H0GH 1KLGD 2RHQB 4RGTA 3T13A 5EBDA 2D62A 1PH1A 3U58A 5CYUA 2VNUD 4DV3Q 4JI0Q 4M1UB 1H9MA 1LYLA 4C3HG 1BUVT 4A93B 4DV1Q 3IAYA 1Q8KA 2ZM6L 1HA5A 1U9RA 4LF6L 1XTCD 1TWGB 1WCMG 1HR0W 1E1TA 5IT9E 4G7OC 3NBHA 2L4NA 2I07B 4YCVA 5E4XA 5M9OA 2A19A 4RGMA 4ZKCB 2Q2HA 2ZT9C 2E2DC 3BZDB 1KTKA 3DM3A 1K0RA 4RKBA 4XDXA 2KCMA 4PZ6A 3K6OA 1G91A 2B2VA 3OW7A 1PH6A 2F0SA 2XRSD 1VQAA 5GAEC 4POGA 1NE3A 1UEBA 2BDNA 1YIJA 1U4RA 4CJ1B 3GTOH 1TIID 1WTWA 3HOZG 2H4OA 5FLXc 1MJEA 4OX9Q 1DM0B 1B1ZA 5L37A 1VDZA 3T56B 4KHZA 1N34L 4H02A 1XTDA 4AQYQ 5IOCA 5D3DA 2EYFA 4K8JA 5IYBG 2I5HA 2RDGA 3R3OA 4IUQA 1Q3LA 1EIYB 3C1FA 3L7ZC 5JAVA 4Y7NH 4B3RQ 1WCMH 3JAME 4JI4Q 1SYDA 4X65L 1CSPA 1GKHA 2R61A 1YHAA 1TWHH 3S1RB 1QZHA 3TQYA 4DR5L 1VQHA 1SMYD 4XQJA 3T1HQ 1GUWA 2EYJA 3R2IA 4KLKA 4ULLA 2NZ1D 1I3QB 4DAMA 4GOPB 4HSPA 5K36G 1DZ1A 4GLVB 3MFGA 2C35B 4AYBE 1AW7A 2M9VA 2MUYA 2Z1CA 1TWFH 4OXPA 2FHTA 1STNA 3EBEA 3CC2A 3S1MH 2R93H 3I4NG 1CKNA 2HDMA 2LXJA 4A3BG 1PYBA 1YHQA 1NNXA 3WWVA 2K28A 1X3GA 2UXDQ 1AE2A 1Y1WG 4QJFA 3CF5A 2E5LL 4EGVA 2RBMA 5ELCA 1O7LA 3TP8A 4HIOA 4XTCS 2K6AA 3CC7A 5KNBA 1E2WA 1ZKOA 4UPAA 2OWOA 5E3FA 1WTQA 4IN3A 4ABNA 3M4OB 1U0LA 2RCNA 5KEEA 3TZUA 2DUDA 2F0IA 1XMQQ 2SOBA 3RMHA 5FLMH 4HCSA 1QNUA 5DEHA 1QOHA 1ESFA 1XNRL 2OEOA 2CQOA 1EZ6A 3GTOB 3PO2G 3URYA 5IGDA 1J5EL 3N52A 2JSOA 3PUXA 3A56A 4CDDC 4GOPC 3D6WA 4A3MG 4UAIA 1PHJA 2KENA 2F0FA 1X65A 2E2IB 5A35A 4IO9A 3DM1A 2F3VA 1EY4A 1TS4A 4DV5L 2Z4IA 3X3MA 4JI4L 4IOAA 5EQ0A 1QVFA 3JAMc 2K75A 2BH8A 4KN7C 4JC0A 4GNXC 1WTRA 1G2TA 1O78A 4KY5A 4EX5A 5FK9C 1UE5A 5D14A 4HIMA 3BDCA 1V1OA 1N34Q 3HOZH 4CKEA 1STGA 1HCZA 1T5EA 3RLNA 1K8OA 4E6IA 5ELEA 2GVAA 1I3QH 1TWAB 2VY3A 2JA6H 3HZXA 4JI2L 1VQMA 3AFQA 1JOOA 3RD4A 5TSSA 4J15A 3AMUA 3S9WA 1HZ9A 4A3KB 3K7AB 3RZDB 5ISRA 1KAWA 1GOZA 3PUVA 2OCEA 4DA2A 4GS3A 2AQ3B 4C3HH 3GTGH 4LWCA 1PV4A 2K33A 3S2DB 4BA1I 4A3DH 3Q24A 1XJVA 2E2HH 1WTXA 1C9OA 1J8IA 4R4QA 1HUMA 2EDGA 4IPDA 1SNDA 1PTOB 2HQEA 3KF8B 3M4OH 1C0AA 2WP8J 1JJ2A 1DD2A 1SE4A 3BVGA 3NTIA 4IOCA 5JEAJ 3K59A 4LF6Q 1RL2A 1XYIA 1X3PA 4KY6A 3L2PA 2ZM6Q 3T4AC 1PH7A 2MHVA 4QUCA 5IY0A 3GTPB 1SDFA 4P74A 4A3EB 1I94L 5C3XA 4C3JG 2YU9H 1HTLD 1NR4A 1QVGA 2MO0A 1XMOQ 3H3VI 2GN5A 1BBUA 1KLUD 2A68C 4XT1B 3FP9A 1G291 4JI2Q 2C5CA 4FF2A 2JA9A 4DR4Q 2OXPA 1EWCA 1MSHA 3STBC 4ID6A 1NMGA 4WJ3M 3J81c 4DV2Q 1LABA 2RDHA 1N36Q 3CPFA 2Q8IB 1NR2A 3L0OA 2J4XA 1WTHA 3FHWA 3NK9A 2V1CC 3OTOL 1KHIA 4ZQ3A 2Y0SG 1T9HA 5ELBA 5KRUA 1B70B 1GJXA 3RN5A 3FPPA 1YBYA 3I56A 4A93H 1H9KA 1RTOA 2FXQA 1LTRD 2J0TD 3DEPA 5FJ8G 2IJ0A 3HOZB 5AFWA 2ZJQA 1C48A 3P75A 5M5XH 2E74C 1VQ5A 4OWTB 1H9SB 5G3LD 1WD0A 1TWAH 3FPUB 2B3GA 4YWMA 4KMUC 3AQQA 3A5UA 3DLLA 2RVLA 5JOBA 3S16H 3E3XA 1F9PA 3I4NB 1I4HA 4LF9L 1G6PA 2ZXOA 2EQSA 2NN6H 2NBFA 4A4IA 3PUWA 3D8GA 3SGIA 1HNWL 2F0OA 1LTTD 2EJFC 1NCVA 3CHBD 1WOCA 3UE0A 4K5VA 3E9IA 3B6YA 1B9MA 1QG7A 2PNHA 1Z47A 1EWHA 3F2CA 1NBWA 1I4GA 5I6WA 1S5CD 3NSWA 1V8QA 4IZ8A 1YEZA 5FLXE 1BR9A 2B2YA 1PFSA 1RTNA 4JI3Q 3UDFA 5EKIA 4IUVA 4HR7B 4OO1H 4JBJA 2L55A 2WFWA 2HIXA 3PMFA 1Y1WB 2NVQB 2E5LQ 1X55A 2F0TA 4KV6A 4IJLA 4YHHQ 2YU9B 2K4KA 2L1BA 4R4TA 4A3MB 2JA7H 1WCMB 1HZAA 3D3RA 3BVZA 2A5HA 3J7ZC 1ML0D 4R1JA 4JCVE 2NWGA 4NXNL 1RD9D 4G7HC 2YV5A 5CBEE 1TS3A 3GP7A 2SNSA 2YTYA 1JC7A 2E8GA 3MXNA 4FP5D 1H9JA 3KJPA 2QA4A 3MWYW 1R4PB 3FMCA 3DWAA 4BXXG 4WFN3 1YHBA 4QB4A 1Q86C 3E0JA 1HPCA 1PVOA 1EU4A 1Y8PB 4BY1G 3HOWH 4B3RL 2R92H 1B44D 4DPGA 2IW3A 4F8MA 2FJ2A 1DJRD 4JBWA 2B2WC 3BU2A 2IPKD 2CW0C 5CGKA 5JPNC 3S24A 2A1AA 3KF6B 4QY7A 4PG3A 1FGUA 4N8X1 1SNMA 3LX0A 3TS0A 1BDOA 3F2UA 1PTOF 1RODA 3S16B 2DGYA 2R7FA 3PIP3 1CFMA 2PQAB 1JWMD 2A69D 1AE3A 3ERQA 2WB1B 4PQXA 4P71A 1SXTA 3H91A 5GAGC 1PZJD 1MSGA 2N8NA 2QEXA 2K52A 2QILA 3K5MA 2DJGC 4P75A 4QL5A 4OELB 2NZOA 3UI2A 5BR8L 3OHXC 4H13C 2MQHA 3S1QH 1SBBB 3CCQA 3SK6A 1AP0A 1YNJD 1X3EA 4JPBW 1QWYA 3W5OA 4ZLTF 4A3IB 3CRLC 3OYYA 2E2IH 4JYAQ 2SNMA 1VQKA 1ZXTA 2F3WA 2EY6A 3LGJA 1SAPA 3K81C 4R8NA 1Y1WH 4C1NK 4MZ9A 1TS5A 1K9MC 4R4IA 3SK8A 4A3CH 4DGZA 3RZOB 3KOJA 1STAA 4RWSC 3BS1A 3OMGA 2BH2A 2NVXH 2VW9A 4DV3L 5DAUA 3J7YW 3NQTA 1YNNC 4BBSH 4MHEA 1UUPA 3S15B 3A5ZB 2WIIB 4LFCL 4X66L 2O4XA 2EOTA 5IP9G 5JEAG 1SE2A 2LMCB 5DM63 1I6VC 3F1ZA 3J81j 3HG9A 3AB9A 1GUSA 4CKCA 1L1OB 3S14H 1PRTD 2B2UC 4B3SL 2XTIA 1D5MC 5C3EB 1GVPA 2DNCA 1BCPB 3K7AH 1IBKL 4X64Q 2PW7A
chains in the Genus database with same CATH topology
4YCUA 3E0EA 2Q2HA 3S2HH 4Y52H 1HZBA 3DM3A 5C4XG 1K0RA 2NVYH 4YY3Q 5IWAQ 1CSQA 3KDFA 2ZJPA 4BBSG 3CCUA 4L5SA 2KCMA 4PZ6A 3PO3G 4JV5Q 3HOWG 4C3JH 4JI8L 2N49A 3W1GA 3GDEA 1PH6A 1JT8A 3F2DA 1N9WA 1VQAA 5GAEC 4NXMQ 4POGA 2F4VL 4A3FH 5IP7H 1OTCA 1NE3A 1UEBA 2AWNA 5AJ3L 4HJ9A 2VUMH 1WYDA 1YIJA 1RIPA 5H1SE 3PSIA 2UUAL 4IFDG 1N32L 3TEHB 4HIDA 3J80c 3ULPA 1EQQA 3GTOH 4A75A 3GTPH 1OXTA 1IBLQ 1YZ6A 4DUYL 1SRUA 4HJAA 1PH3A 1HNZQ 4DR3Q 5LMNQ 4GNXB 3HOZG 2D0OA 5FLXc 5C3EH 1MJEA 1S3OA 4DR1L 4OX9Q 3NENA 5EAYA 1X54A 5C4XH 1HNXL 4JBKA 5IYDG 2MNAA 4KHZA 1N34L 3EIVA 4H02A 1XTDA 2VZAA 4AQYQ 3MEFA 4NPSA 4A3GG 4MNOA 1KL9A 5FLMG 3HOXG 3CC4A 5IYBG 4A3LH 2PMZE 2VQEQ 1WJJA 1YITA 1B8AA 4B3MQ 1CKNB 2I5HA 3CCEA 3RZDH 1VQPA 3U50C 1EIYB 2D0PA 4PMWA 1WI5A 1VQIA 3L7ZC 2ID0A 4Y7NH 2JQOA 1WCMH 4B3RQ 1E7ZA 4JI4Q 4A3LG 5M3FH 2NZHA 4X65L 1CSPA 1GKHA 4DV5Q 1YHAA 1TWHH 1QZHA 4A3KG 3TQYA 3TREA 1VQHA 4DR5L 2MFIA 3PO3H 1JJGA 4TQUS 4AYBG 4POFA 3T1HQ 4KLKA 1D8LA 3RZOH 4GKKQ 1EUJA 2VS1A 2YYZA 1PH4A 4DKAC 4DV7Q 4HJ8A 2WAQE 4DAMA 4GOPB 3HOVH 3FKIH 4LFAL 5K36G 4GLVB 1JJCB 4UP7A 2C35B 1GD7A 4NB3A 3U4ZA 4AYBE 1UE1A 5JJIA 1EFWA 1MKHA 4LFBQ 1I6HH 1TWFH 4OXPA 3EBEA 2I0QA 3CC2A 4LF5Q 2JE6I 1VQDA 4TVAB 4A3IH 1N33Q 3S1MH 3BZKA 4A3JG 2R93H 3I4NG 1CKNA 3RNUA 2LXJA 4A3BG 1PYBA 3KF6A 2I5MX 4YHHL 1YHQA 3AFPA 1YI2A 4RG1A 1KD1C 3CCRA 3I4NH 1IBMQ 3WWVA 2F52A 4A3DG 4GNXA 3HKSA 4PZ7A 4L5QA 3T1YL 1X3GA 2ES2A 1AE2A 3ICEA 1Y1WG 4K0KL 2UXDQ 4QJFA 3CF5A 2AWOA 4JI7Q 2E5LL 2NVTH 1NY4A 2YTXA 2R7ZG 3ERSX 3G71A 3CCJA 1FVIA 2L15A 1MIUA 4R4OA 4APVA 4XTCS 3W1BA 5HY6A 2XGTA 3CC7A 4HIOA 4A3EG 3CD6A 3GTQH 4UPAA 2OWOA 1VQJA 4A93G 2JJQA 1Q1BA 1Q46A 1QUQB 1U0LA 2RCNA 3PIOA 2WB1E 4JI7L 4K0KQ 2DUDA 3M4QA 1V9PA 4OWXB 1X6OA 1XMQQ 3T1YQ 2UXDL 3F8TA 4EQ5A 3BJUA 1J6QA 5FLMH 4DV6L 1S72A 2UXBQ 3HKZG 2Q2UA 3Q8DA 1OXUA 5E7NA 2OQ0A 3NEMA 2F3IA 1XNRL 4DNIA 3D31A 5ELNA 4DR6L 1SR3A 3CAMA 4LF5L 3ULJA 4AH6A 4GKJQ 3K0XA 2Z0SA 3KFUA 2CQOA 3PO2G 3HKZE 1J5EL 1X3FA 2RHSB 3PUXA 1A63A 4DV7L 4GOPC 4LF9Q 1YVCA 4A3MG 1PHJA 2KENA 4DUZL 1X65A 1KRTA 4IO9A 4LUOA 4DR5Q 4X65Q 4DV5L 1HR0Q 5ELOA 4JI4L 3AEVA 4IOAA 3JAMi 4BBRH 2ZTDA 3STBD 2OTJA 4JOIC 1QVFA 3JAMc 1EIFA 2HHHQ 3S2DH 4YWLA 2K75A 2BH8A 4DV0Q 4B3ML 2CKZB 3PIPA 4JC0A 1KRSA 4GNXC 2VQEL 3GTJH 4EX5A 1R9TH 3UDXA 1UE5A 1VS0A 4HIMA 1N34Q 3HOZH 1AH9A 1BBWA 2CFMA 1Q82C 2A8VA 3OTOQ 3RLNA 5M5YH 1IXRA 3A74A 2VQFQ 1YNXA 3F2BA 2CWAA 2IX1A 2GVAA 1I3QH 5LMNL 1HNZL 2VY3A 1ASYA 4DUYQ 1CKOA 2JA6H 4IPCA 3KJOA 1OXXK 1VQ9A 2YTVA 5IYCG 1N32Q 4A3IG 4JI2L 2UUAQ 1VQMA 3GTMH 1V1QA 3AFQA 1Y1VG 3K8AA 2JA7G 1D7QA 5AJ3Q 1G51A 4WJ4A 4YCWA 4J15A 1XMOL 3M85A 4NXML 1HZ9A 1U5KA 2F4VQ 2UXCL 2HT1A 5C0XI 4P72A 1K83H 1KAWA 4R4CA 4JI8Q 5M3FG 3PUVA 1UE7A 2OCEA 4BY1H 4GS3A 4JV5L 3PGZA 5IT9c 4C3HH 3GTGH 4LWCA 1IZ6A 2K14A 2N78A 1PV4A 2B29A 4BA1I 5IWAL 3CCVA 4YY3L 4B3TQ 4JI6L 4X62Q 4KI0A 5M5WH 4A3DH 5IYCH 3VDYA 1TWCH 1XJVA 2E2HH 1C9OA 2MO1A 4R4QA 1IL2A 3J7A5 1LM0A 5HGQA 3OW2A 3CCMA 1VQEA 4IPDA 4JG2A 2IHFA 1XNQL 1YJWA 3KF8B 3M4OH 1JMCA 5C44H 1PYSB 1IBKQ 1XNQQ 1C0AA 2WP8J 3JC66 1JJ2A 4QQBX 3AYHB 4IOCA 1E3PA 5JEAJ 1EOVA 1XPRA 1UE6A 1SFOH 2HIVA 4LF6Q 5C0XJ 1RL2A 4X62L 4JI6Q 3L2PA 1N8RC 4DK6C 2ZM6Q 4DAYB 1BKBA 1PH7A 5IY0A 4DV1L 5C3EG 4P74A 1B7YB 1QVCA 2ASBA 3G4SA 1I94L 1SN8A 1NMFA 4X66Q 1HH2P 4JI0L 4A3KH 2LXKA 4LFCQ 4JOIA 3CQZH 2YU9H 2Z6KA 2VL6A 1LTLA 1QVGA 2MO0A 1OXSC 2UXCQ 1XMOQ 4UP9A 4LF7L 3H3VI 2GN5A 1BBUA 1XPOA 3D0FA 5IE8A 4L5RC 5M3MH 3FP9A 1G291 4JI2Q 2R6GA 4DR4Q 2JA9A 4LUVA 2OQKA 3HFZB 4GOPA 4L5TA 1V43A 3STBC 3PUYA 2ZTEA 1NMGA 4DV4L 3H3VH 3J81c 2BA0A 4DV2Q 4JI5L 4BY7G 4WJ3M 1N36Q 1Y1VH 2Z6KC 3CPFA 1K3RA 2ALYB 3L0OA 4JI1L 2VQFL 3PF4A 1H95A 3FHWA 3G6EA 1E22A 2V1CC 3OTOL 1KHIA 2Y0SG 1YJNA 1T9HA 1E24A 1SMXA 1B70B 4GN3B 4GN5A 1K73C 1KIXA 3RN5A 1YBYA 2IX0A 3I56A 3M7NA 4KHPL 4A93H 1Q7YC 2FXQA 1I50H 1I5FA 5FJ8G 1A0IA 4IFDJ 3K7UC 2WB1G 4DK3C 2ZJQA 4DV0L 1W2BA 2HHHL 2Y0SE 4QIWE 4A3FG 2VUMG 4A76A 5BR8Q 2UUCQ 4GN4B 5M5XH 1PH8A 5LMUQ 1A62A 3KYHC 1VQ5A 2R7DA 4OWTB 1HR0L 1TWAH 2HQLA 4JBMA 1VQ8A 2B3GA 3RLOA 4YWMA 1VQ7A 3AQQA 5C0XG 3A5UA 3DLLA 4DUZQ 4LF8Q 1FJGL 1EYGA 2AMCB 3TRZA 3S16H 2JA6G 4LF9L 1G6PA 2NVQH 2R93G 2EQSA 4A4IA 3NELA 3NBHB 3PUWA 3SGIA 1HNWL 5FJ8H 3G48A 4BA2I 3CMEA 1J5EQ 3MXNB 3I4MG 1L1OC 1M90C 1VQGA 1WOCA 3UE0A 4GKJL 3GTLH 3GO5A 3E9IA 4A3JH 1KQSA 3HOVG 1Z9FA 3PUZA 3S1NH 4DR6Q 3CCLA 3B6YA 5GROA 1XNRQ 2PNHA 1Z47A 1GO3E 1NBWA 3F2CA 2JA5G 4O2DA 2UXBL 2PI2A 4DV6Q 2JK8A 3I2ZA 4YWKA 4BBRG 1VQ6A 1XMQL 1YEZA 2JA8G 4DR7L 5M3MG 2WAQG 1EWIA 1CKMA 3KDFB 1PFSA 4JI3Q 1IYJB 2K5HA 3UDFA 2KHJA 4DR2Q 2K50A 1CUKA 2B63H 4LF4L 1OXVA 1BVSA 1NTGA 3M4PA 3UDIA 4JBJA 2WFWA 4RMFA 2QGQA 5GAHC 2JEBI 2EIFA 2HIXA 1ASZA 2E5LQ 1HJPA 2GVBA 1X55A 4FDBA 1VQ4A 1IBML 2ZJRA 4IPGA 3ZJYC 5GQOA 4IJLA 4P73A 4NXNQ 2H5XA 4YHHQ 2K4KA 3PCOB 3M9BA 4R4TA 2JA7H 3CP0A 1Q81C 1HZAA 2LSSA 1K8AC 2JEAI 1N33L 1KXLA 5C44G 3J7ZC 3ULLA 1C7YA 4R1JA 4LFBL 3EN2A 4JCVE 4NXNL 2YV5A 1K8GA 2AHOB 2PI2E 3CW2C 4LFAQ 4IFDI 1HZCA 2YTYA 3TS2A 1P8LA 4ALPA 2E8GA 4O0AA 4AIMA 3KJPA 2N3SA 5DLQE 2QA4A 4GKKL 1VQFA 3T1HL 4BXXG 5IP9H 1YHBA 4QGUA 2IY5B 1SROA 4PZ8A 2IHEA 1Q86C 3UE1A 1PVOA 3RN2A 3I7FA 4BY1G 1GM5A 2K5NA 3HOWH 4LF4Q 4B3RL 2R92H 1X56A 2KCTA 4DPGA 3U4VA 2R7ZH 3CMAA 4DR2L 3CPWA 3J81i 2ZTCA 2JA5H 1XPUA 1QZGA 4JBWA 4A3BH 3BU2A 4JI3L 3HOUH 3KLWA 4DR7Q 4C3IH 3H0GG 4C2MH 4A3CG 1WFQA 3S17H 4AQYL 3S24A 1JB7A 2A1AA 2AKWB 4BXXH 3KF6B 4QY7A 4PG3A 1FGUA 4OWWB 4A3MH 2K5VA 1HNXQ 1VQBA 3GD7A 5IYBH 3TS0A 1W3SA 3HOXH 2ATWA 1VQOA 2DGYA 2R7FA 3PV0A 4DR1Q 4OX9L 1Q1EA 2PQAB 2RF4A 3J80i 2KBNA 3H15A 4DR3L 3PF5A 1AE3A 5JJKA 1IBLL 5IYDH 3PO2H 4BY7H 1JE5A 2KHIA 4P71A 3A0JA 1Y14B 3RLFA 4XIGS 4UP8A 1HNWQ 5GAGC 1YJ9A 1PA6A 2PQAA 2N8NA 2QEXA 1TXYA 2K52A 3CCSA 1KC8C 2CCZA 3ER0A 3BZCA 1FJGQ 4OO1G 4LF8L 4IPHA 4P75A 4UY8C 4X6AH 1VCIA 4QL5A 2IT1A 1X9NA 1SLJA 3S15H 2NZOA 4LNQA 5LMUL 4GLXA 2Q2TA 1M1KC 5BR8L 3I4OA 2UUCL 3K80C 1VQLA 5JJLA 1UWVA 2MQHA 3M3YH 3S1QH 4A3GH 2OTLA 1MJCA 3CCQA 3GTKH 4ME3A 3HOYG 1TWGH 4A3EH 1P16A 1X3EA 4KHPQ 3W5OA 2B63G 4HJ5A 3HOYH 3OYYA 2E2IH 4JYAQ 1PH5A 1VQKA 2UUBL 4B3TL 4OONA 1DGSA 1A8VA 1QUQA 3LGJA 4JYAL 4X64L 2CWPA 4HIKA 3K81C 1Y1WH 3CXCA 1VQNA 4JI1Q 4GLAC 4B3SQ 4MZ9A 3S1RH 1N36L 1E1OA 4JI5Q 3I4MH 4LW1A 4DV2L 5IP7G 4MTNA 4DV4Q 1K9MC 1SE8A 4IJHA 4R4IA 5C4JH 1EQRA 1O7IA 2EXDA 3H0GH 4A3CH 1Q12A 2BA1A 3KOJA 2NN6G 2RHQB 4DR4L 2BH2A 2NVXH 1L0WA 2VW9A 4LF7Q 4DV3L 4BBSH 2R92G 2D62A 4LUZA 1PH1A 2UU9L 5J3BA 3E9HA 2UU9Q 3U58A 4OO1I 3FKIG 3A5ZB 2VNUD 4DV3Q 4LFCL 4JI0Q 4X66L 1LYLA 1I94Q 5IP9G 5JEAG 1S40A 2JA8H 4DV1Q 1L2FA 2NN6I 1Q8KA 3F1ZA 3J81j 1LUZA 2ZM6L 5LMNW 2E2JH 3I55A 4LF6L 1L1OB 3RR5A 3S14H 1PH9A 1WCMG 3IRBA 1HR0W 1NJIC 1E1TA 2I5LX 4B3SL 2XTIA 1PH2A 1GVPA 3UDGA 3K7AH 1IBKL 2Q2IA 4X64Q 3HOUG 1FL0A 4YCVA 5GADC 1VQCA 2UUBQ 4HJ7A 1L1OA 2A19A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YCU A;  3E0E A;  2Q2H A;  3S2H H;  4Y52 H;  1HZB A;  3DM3 A;  5C4X G;  1K0R A;  2NVY H;  4YY3 Q;  5IWA Q;  1CSQ A;  3KDF A;  2ZJP A;  4BBS G;  3CCU A;  4L5S A;  2KCM A;  4PZ6 A;  3PO3 G;  4JV5 Q;  3HOW G;  4C3J H;  4JI8 L;  2N49 A;  3W1G A;  3GDE A;  1PH6 A;  1JT8 A;  3F2D A;  1N9W A;  1VQA A;  5GAE C;  4NXM Q;  4POG A;  2F4V L;  4A3F H;  5IP7 H;  1OTC A;  1NE3 A;  1UEB A;  2AWN A;  5AJ3 L;  4HJ9 A;  2VUM H;  1WYD A;  1YIJ A;  1RIP A;  5H1S E;  3PSI A;  2UUA L;  4IFD G;  1N32 L;  3TEH B;  4HID A;  3J80 c;  3ULP A;  1EQQ A;  3GTO H;  4A75 A;  3GTP H;  1OXT A;  1IBL Q;  1YZ6 A;  4DUY L;  1SRU A;  4HJA A;  1PH3 A;  1HNZ Q;  4DR3 Q;  5LMN Q;  4GNX B;  3HOZ G;  2D0O A;  5FLX c;  5C3E H;  1MJE A;  1S3O A;  4DR1 L;  4OX9 Q;  3NEN A;  5EAY A;  1X54 A;  5C4X H;  1HNX L;  4JBK A;  5IYD G;  2MNA A;  4KHZ A;  1N34 L;  3EIV A;  4H02 A;  1XTD A;  2VZA A;  4AQY Q;  3MEF A;  4NPS A;  4A3G G;  4MNO A;  1KL9 A;  5FLM G;  3HOX G;  3CC4 A;  5IYB G;  4A3L H;  2PMZ E;  2VQE Q;  1WJJ A;  1YIT A;  1B8A A;  4B3M Q;  1CKN B;  2I5H A;  3CCE A;  3RZD H;  1VQP A;  3U50 C;  1EIY B;  2D0P A;  4PMW A;  1WI5 A;  1VQI A;  3L7Z C;  2ID0 A;  4Y7N H;  2JQO A;  1WCM H;  4B3R Q;  1E7Z A;  4JI4 Q;  4A3L G;  5M3F H;  2NZH A;  4X65 L;  1CSP A;  1GKH A;  4DV5 Q;  1YHA A;  1TWH H;  1QZH A;  4A3K G;  3TQY A;  3TRE A;  1VQH A;  4DR5 L;  2MFI A;  3PO3 H;  1JJG A;  4TQU S;  4AYB G;  4POF A;  3T1H Q;  4KLK A;  1D8L A;  3RZO H;  4GKK Q;  1EUJ A;  2VS1 A;  2YYZ A;  1PH4 A;  4DKA C;  4DV7 Q;  4HJ8 A;  2WAQ E;  4DAM A;  4GOP B;  3HOV H;  3FKI H;  4LFA L;  5K36 G;  4GLV B;  1JJC B;  4UP7 A;  2C35 B;  1GD7 A;  4NB3 A;  3U4Z A;  4AYB E;  1UE1 A;  5JJI A;  1EFW A;  1MKH A;  4LFB Q;  1I6H H;  1TWF H;  4OXP A;  3EBE A;  2I0Q A;  3CC2 A;  4LF5 Q;  2JE6 I;  1VQD A;  4TVA B;  4A3I H;  1N33 Q;  3S1M H;  3BZK A;  4A3J G;  2R93 H;  3I4N G;  1CKN A;  3RNU A;  2LXJ A;  4A3B G;  1PYB A;  3KF6 A;  2I5M X;  4YHH L;  1YHQ A;  3AFP A;  1YI2 A;  4RG1 A;  1KD1 C;  3CCR A;  3I4N H;  1IBM Q;  3WWV A;  2F52 A;  4A3D G;  4GNX A;  3HKS A;  4PZ7 A;  4L5Q A;  3T1Y L;  1X3G A;  2ES2 A;  1AE2 A;  3ICE A;  1Y1W G;  4K0K L;  2UXD Q;  4QJF A;  3CF5 A;  2AWO A;  4JI7 Q;  2E5L L;  2NVT H;  1NY4 A;  2YTX A;  2R7Z G;  3ERS X;  3G71 A;  3CCJ A;  1FVI A;  2L15 A;  1MIU A;  4R4O A;  4APV A;  4XTC S;  3W1B A;  5HY6 A;  2XGT A;  3CC7 A;  4HIO A;  4A3E G;  3CD6 A;  3GTQ H;  4UPA A;  2OWO A;  1VQJ A;  4A93 G;  2JJQ A;  1Q1B A;  1Q46 A;  1QUQ B;  1U0L A;  2RCN A;  3PIO A;  2WB1 E;  4JI7 L;  4K0K Q;  2DUD A;  3M4Q A;  1V9P A;  4OWX B;  1X6O A;  1XMQ Q;  3T1Y Q;  2UXD L;  3F8T A;  4EQ5 A;  3BJU A;  1J6Q A;  5FLM H;  4DV6 L;  1S72 A;  2UXB Q;  3HKZ G;  2Q2U A;  3Q8D A;  1OXU A;  5E7N A;  2OQ0 A;  3NEM A;  2F3I A;  1XNR L;  4DNI A;  3D31 A;  5ELN A;  4DR6 L;  1SR3 A;  3CAM A;  4LF5 L;  3ULJ A;  4AH6 A;  4GKJ Q;  3K0X A;  2Z0S A;  3KFU A;  2CQO A;  3PO2 G;  3HKZ E;  1J5E L;  1X3F A;  2RHS B;  3PUX A;  1A63 A;  4DV7 L;  4GOP C;  4LF9 Q;  1YVC A;  4A3M G;  1PHJ A;  2KEN A;  4DUZ L;  1X65 A;  1KRT A;  4IO9 A;  4LUO A;  4DR5 Q;  4X65 Q;  4DV5 L;  1HR0 Q;  5ELO A;  4JI4 L;  3AEV A;  4IOA A;  3JAM i;  4BBR H;  2ZTD A;  3STB D;  2OTJ A;  4JOI C;  1QVF A;  3JAM c;  1EIF A;  2HHH Q;  3S2D H;  4YWL A;  2K75 A;  2BH8 A;  4DV0 Q;  4B3M L;  2CKZ B;  3PIP A;  4JC0 A;  1KRS A;  4GNX C;  2VQE L;  3GTJ H;  4EX5 A;  1R9T H;  3UDX A;  1UE5 A;  1VS0 A;  4HIM A;  1N34 Q;  3HOZ H;  1AH9 A;  1BBW A;  2CFM A;  1Q82 C;  2A8V A;  3OTO Q;  3RLN A;  5M5Y H;  1IXR A;  3A74 A;  2VQF Q;  1YNX A;  3F2B A;  2CWA A;  2IX1 A;  2GVA A;  1I3Q H;  5LMN L;  1HNZ L;  2VY3 A;  1ASY A;  4DUY Q;  1CKO A;  2JA6 H;  4IPC A;  3KJO A;  1OXX K;  1VQ9 A;  2YTV A;  5IYC G;  1N32 Q;  4A3I G;  4JI2 L;  2UUA Q;  1VQM A;  3GTM H;  1V1Q A;  3AFQ A;  1Y1V G;  3K8A A;  2JA7 G;  1D7Q A;  5AJ3 Q;  1G51 A;  4WJ4 A;  4YCW A;  4J15 A;  1XMO L;  3M85 A;  4NXM L;  1HZ9 A;  1U5K A;  2F4V Q;  2UXC L;  2HT1 A;  5C0X I;  4P72 A;  1K83 H;  1KAW A;  4R4C A;  4JI8 Q;  5M3F G;  3PUV A;  1UE7 A;  2OCE A;  4BY1 H;  4GS3 A;  4JV5 L;  3PGZ A;  5IT9 c;  4C3H H;  3GTG H;  4LWC A;  1IZ6 A;  2K14 A;  2N78 A;  1PV4 A;  2B29 A;  4BA1 I;  5IWA L;  3CCV A;  4YY3 L;  4B3T Q;  4JI6 L;  4X62 Q;  4KI0 A;  5M5W H;  4A3D H;  5IYC H;  3VDY A;  1TWC H;  1XJV A;  2E2H H;  1C9O A;  2MO1 A;  4R4Q A;  1IL2 A;  3J7A 5;  1LM0 A;  5HGQ A;  3OW2 A;  3CCM A;  1VQE A;  4IPD A;  4JG2 A;  2IHF A;  1XNQ L;  1YJW A;  3KF8 B;  3M4O H;  1JMC A;  5C44 H;  1PYS B;  1IBK Q;  1XNQ Q;  1C0A A;  2WP8 J;  3JC6 6;  1JJ2 A;  4QQB X;  3AYH B;  4IOC A;  1E3P A;  5JEA J;  1EOV A;  1XPR A;  1UE6 A;  1SFO H;  2HIV A;  4LF6 Q;  5C0X J;  1RL2 A;  4X62 L;  4JI6 Q;  3L2P A;  1N8R C;  4DK6 C;  2ZM6 Q;  4DAY B;  1BKB A;  1PH7 A;  5IY0 A;  4DV1 L;  5C3E G;  4P74 A;  1B7Y B;  1QVC A;  2ASB A;  3G4S A;  1I94 L;  1SN8 A;  1NMF A;  4X66 Q;  1HH2 P;  4JI0 L;  4A3K H;  2LXK A;  4LFC Q;  4JOI A;  3CQZ H;  2YU9 H;  2Z6K A;  2VL6 A;  1LTL A;  1QVG A;  2MO0 A;  1OXS C;  2UXC Q;  1XMO Q;  4UP9 A;  4LF7 L;  3H3V I;  2GN5 A;  1BBU A;  1XPO A;  3D0F A;  5IE8 A;  4L5R C;  5M3M H;  3FP9 A;  1G29 1;  4JI2 Q;  2R6G A;  4DR4 Q;  2JA9 A;  4LUV A;  2OQK A;  3HFZ B;  4GOP A;  4L5T A;  1V43 A;  3STB C;  3PUY A;  2ZTE A;  1NMG A;  4DV4 L;  3H3V H;  3J81 c;  2BA0 A;  4DV2 Q;  4JI5 L;  4BY7 G;  4WJ3 M;  1N36 Q;  1Y1V H;  2Z6K C;  3CPF A;  1K3R A;  2ALY B;  3L0O A;  4JI1 L;  2VQF L;  3PF4 A;  1H95 A;  3FHW A;  3G6E A;  1E22 A;  2V1C C;  3OTO L;  1KHI A;  2Y0S G;  1YJN A;  1T9H A;  1E24 A;  1SMX A;  1B70 B;  4GN3 B;  4GN5 A;  1K73 C;  1KIX A;  3RN5 A;  1YBY A;  2IX0 A;  3I56 A;  3M7N A;  4KHP L;  4A93 H;  1Q7Y C;  2FXQ A;  1I50 H;  1I5F A;  5FJ8 G;  1A0I A;  4IFD J;  3K7U C;  2WB1 G;  4DK3 C;  2ZJQ A;  4DV0 L;  1W2B A;  2HHH L;  2Y0S E;  4QIW E;  4A3F G;  2VUM G;  4A76 A;  5BR8 Q;  2UUC Q;  4GN4 B;  5M5X H;  1PH8 A;  5LMU Q;  1A62 A;  3KYH C;  1VQ5 A;  2R7D A;  4OWT B;  1HR0 L;  1TWA H;  2HQL A;  4JBM A;  1VQ8 A;  2B3G A;  3RLO A;  4YWM A;  1VQ7 A;  3AQQ A;  5C0X G;  3A5U A;  3DLL A;  4DUZ Q;  4LF8 Q;  1FJG L;  1EYG A;  2AMC B;  3TRZ A;  3S16 H;  2JA6 G;  4LF9 L;  1G6P A;  2NVQ H;  2R93 G;  2EQS A;  4A4I A;  3NEL A;  3NBH B;  3PUW A;  3SGI A;  1HNW L;  5FJ8 H;  3G48 A;  4BA2 I;  3CME A;  1J5E Q;  3MXN B;  3I4M G;  1L1O C;  1M90 C;  1VQG A;  1WOC A;  3UE0 A;  4GKJ L;  3GTL H;  3GO5 A;  3E9I A;  4A3J H;  1KQS A;  3HOV G;  1Z9F A;  3PUZ A;  3S1N H;  4DR6 Q;  3CCL A;  3B6Y A;  5GRO A;  1XNR Q;  2PNH A;  1Z47 A;  1GO3 E;  1NBW A;  3F2C A;  2JA5 G;  4O2D A;  2UXB L;  2PI2 A;  4DV6 Q;  2JK8 A;  3I2Z A;  4YWK A;  4BBR G;  1VQ6 A;  1XMQ L;  1YEZ A;  2JA8 G;  4DR7 L;  5M3M G;  2WAQ G;  1EWI A;  1CKM A;  3KDF B;  1PFS A;  4JI3 Q;  1IYJ B;  2K5H A;  3UDF A;  2KHJ A;  4DR2 Q;  2K50 A;  1CUK A;  2B63 H;  4LF4 L;  1OXV A;  1BVS A;  1NTG A;  3M4P A;  3UDI A;  4JBJ A;  2WFW A;  4RMF A;  2QGQ A;  5GAH C;  2JEB I;  2EIF A;  2HIX A;  1ASZ A;  2E5L Q;  1HJP A;  2GVB A;  1X55 A;  4FDB A;  1VQ4 A;  1IBM L;  2ZJR A;  4IPG A;  3ZJY C;  5GQO A;  4IJL A;  4P73 A;  4NXN Q;  2H5X A;  4YHH Q;  2K4K A;  3PCO B;  3M9B A;  4R4T A;  2JA7 H;  3CP0 A;  1Q81 C;  1HZA A;  2LSS A;  1K8A C;  2JEA I;  1N33 L;  1KXL A;  5C44 G;  3J7Z C;  3ULL A;  1C7Y A;  4R1J A;  4LFB L;  3EN2 A;  4JCV E;  4NXN L;  2YV5 A;  1K8G A;  2AHO B;  2PI2 E;  3CW2 C;  4LFA Q;  4IFD I;  1HZC A;  2YTY A;  3TS2 A;  1P8L A;  4ALP A;  2E8G A;  4O0A A;  4AIM A;  3KJP A;  2N3S A;  5DLQ E;  2QA4 A;  4GKK L;  1VQF A;  3T1H L;  4BXX G;  5IP9 H;  1YHB A;  4QGU A;  2IY5 B;  1SRO A;  4PZ8 A;  2IHE A;  1Q86 C;  3UE1 A;  1PVO A;  3RN2 A;  3I7F A;  4BY1 G;  1GM5 A;  2K5N A;  3HOW H;  4LF4 Q;  4B3R L;  2R92 H;  1X56 A;  2KCT A;  4DPG A;  3U4V A;  2R7Z H;  3CMA A;  4DR2 L;  3CPW A;  3J81 i;  2ZTC A;  2JA5 H;  1XPU A;  1QZG A;  4JBW A;  4A3B H;  3BU2 A;  4JI3 L;  3HOU H;  3KLW A;  4DR7 Q;  4C3I H;  3H0G G;  4C2M H;  4A3C G;  1WFQ A;  3S17 H;  4AQY L;  3S24 A;  1JB7 A;  2A1A A;  2AKW B;  4BXX H;  3KF6 B;  4QY7 A;  4PG3 A;  1FGU A;  4OWW B;  4A3M H;  2K5V A;  1HNX Q;  1VQB A;  3GD7 A;  5IYB H;  3TS0 A;  1W3S A;  3HOX H;  2ATW A;  1VQO A;  2DGY A;  2R7F A;  3PV0 A;  4DR1 Q;  4OX9 L;  1Q1E A;  2PQA B;  2RF4 A;  3J80 i;  2KBN A;  3H15 A;  4DR3 L;  3PF5 A;  1AE3 A;  5JJK A;  1IBL L;  5IYD H;  3PO2 H;  4BY7 H;  1JE5 A;  2KHI A;  4P71 A;  3A0J A;  1Y14 B;  3RLF A;  4XIG S;  4UP8 A;  1HNW Q;  5GAG C;  1YJ9 A;  1PA6 A;  2PQA A;  2N8N A;  2QEX A;  1TXY A;  2K52 A;  3CCS A;  1KC8 C;  2CCZ A;  3ER0 A;  3BZC A;  1FJG Q;  4OO1 G;  4LF8 L;  4IPH A;  4P75 A;  4UY8 C;  4X6A H;  1VCI A;  4QL5 A;  2IT1 A;  1X9N A;  1SLJ A;  3S15 H;  2NZO A;  4LNQ A;  5LMU L;  4GLX A;  2Q2T A;  1M1K C;  5BR8 L;  3I4O A;  2UUC L;  3K80 C;  1VQL A;  5JJL A;  1UWV A;  2MQH A;  3M3Y H;  3S1Q H;  4A3G H;  2OTL A;  1MJC A;  3CCQ A;  3GTK H;  4ME3 A;  3HOY G;  1TWG H;  4A3E H;  1P16 A;  1X3E A;  4KHP Q;  3W5O A;  2B63 G;  4HJ5 A;  3HOY H;  3OYY A;  2E2I H;  4JYA Q;  1PH5 A;  1VQK A;  2UUB L;  4B3T L;  4OON A;  1DGS A;  1A8V A;  1QUQ A;  3LGJ A;  4JYA L;  4X64 L;  2CWP A;  4HIK A;  3K81 C;  1Y1W H;  3CXC A;  1VQN A;  4JI1 Q;  4GLA C;  4B3S Q;  4MZ9 A;  3S1R H;  1N36 L;  1E1O A;  4JI5 Q;  3I4M H;  4LW1 A;  4DV2 L;  5IP7 G;  4MTN A;  4DV4 Q;  1K9M C;  1SE8 A;  4IJH A;  4R4I A;  5C4J H;  1EQR A;  1O7I A;  2EXD A;  3H0G H;  4A3C H;  1Q12 A;  2BA1 A;  3KOJ A;  2NN6 G;  2RHQ B;  4DR4 L;  2BH2 A;  2NVX H;  1L0W A;  2VW9 A;  4LF7 Q;  4DV3 L;  4BBS H;  2R92 G;  2D62 A;  4LUZ A;  1PH1 A;  2UU9 L;  5J3B A;  3E9H A;  2UU9 Q;  3U58 A;  4OO1 I;  3FKI G;  3A5Z B;  2VNU D;  4DV3 Q;  4LFC L;  4JI0 Q;  4X66 L;  1LYL A;  1I94 Q;  5IP9 G;  5JEA G;  1S40 A;  2JA8 H;  4DV1 Q;  1L2F A;  2NN6 I;  1Q8K A;  3F1Z A;  3J81 j;  1LUZ A;  2ZM6 L;  5LMN W;  2E2J H;  3I55 A;  4LF6 L;  1L1O B;  3RR5 A;  3S14 H;  1PH9 A;  1WCM G;  3IRB A;  1HR0 W;  1NJI C;  1E1T A;  2I5L X;  4B3S L;  2XTI A;  1PH2 A;  1GVP A;  3UDG A;  3K7A H;  1IBK L;  2Q2I A;  4X64 Q;  3HOU G;  1FL0 A;  4YCV A;  5GAD C;  1VQC A;  2UUB Q;  4HJ7 A;  1L1O A;  2A19 A; 
#chains in the Genus database with same CATH topology
 5C5L A;  4YCU A;  5T1I A;  3C2P A;  2B8F A;  3S2H H;  1BXT A;  2RKS A;  1CTM A;  1HZB A;  1I4R A;  5NUC A;  5C4X G;  1LTG D;  2O5I C;  2NVY H;  2LY7 A;  2ZJP A;  1CSQ A;  3HGB A;  3CCU A;  2Y0S B;  2F0W A;  2JP1 A;  5HGT A;  1FGB D;  3HOW G;  3W1G A;  1JT8 A;  1DOL A;  4BWG B;  3TP5 A;  1SYB A;  2UUA L;  1F9S A;  3TEH B;  3J80 c;  1JIC A;  3GTP H;  3MXG A;  1D1K A;  3DWQ A;  1HNZ Q;  5LMN Q;  2F0G A;  3SR1 A;  3GV3 A;  4K5X A;  5ELF A;  1FYC A;  3NPP A;  5C4X H;  1HNX L;  3S1Q B;  1O7Y A;  3MEF A;  4MNO A;  3CC4 A;  5LL6 S;  3N6R A;  2DY7 A;  4S3S A;  2VQE Q;  4B3M Q;  2X69 A;  2A69 C;  4X3T A;  4MN3 A;  2F0P A;  3QIA A;  4A3K G;  3VYT A;  3ERO A;  4TQU S;  5M5Y B;  2L11 A;  3RZO H;  1D8L A;  2VS1 A;  2M2L A;  4DKA C;  4DV7 Q;  2WAQ E;  1JQY D;  2AUJ D;  4UP7 A;  1JJC B;  3U4Z A;  1GD7 A;  1UE1 A;  1EFW A;  2WKC A;  4LFB Q;  2BE5 D;  5FKA C;  2JE6 I;  1N33 Q;  4A3J G;  3J80 L;  4BY1 B;  1Y8O B;  1YI2 A;  3I4N H;  1KD1 C;  1IBM Q;  3ZYY X;  3T1Y L;  1V1P B;  2ES2 A;  4U68 A;  3I4M B;  4JI7 Q;  2YTX A;  2R7Z G;  3CCJ A;  3MA2 B;  4FVM A;  3A54 A;  1NAP A;  4R4O A;  5HY6 A;  4A3E G;  3S2H B;  4RFB A;  1CZW A;  2JJQ A;  5C44 B;  3D4W A;  2B2W A;  2B2U A;  2WB1 E;  3M4Q A;  3T1Y Q;  1J6Q A;  3HKZ G;  1OXU A;  2OQ0 A;  1G6Z A;  5KYI A;  3J80 E;  1SJH D;  5ELN A;  3EFX D;  2ZXP A;  1VMP A;  1SR3 A;  2CW0 D;  1RKN A;  3ULJ A;  3K0X A;  2Z0S A;  4J6H A;  4B08 A;  2FMM A;  4DXG A;  4KY7 A;  3M7G A;  4X3S A;  5IT9 L;  4DV7 L;  5I6Y A;  2A6H C;  1G8Z D;  2A6E C;  3V05 A;  2QDB A;  3TDQ A;  1VMC A;  2A6H D;  4BBR H;  3STB D;  3P7J A;  4JOI C;  1MBY A;  2HHH Q;  4L8J A;  4B3M L;  2VQE L;  3GTJ H;  5ELD A;  1BBW A;  1IHZ A;  2B2T C;  2A8V A;  1D5X C;  1E2V A;  4EQN A;  5I2X A;  1IXR A;  5M5Y H;  4N8F A;  1YNX A;  3F2B A;  4DXF A;  3CU7 A;  1ASY A;  1CT1 D;  1CKO A;  3FVQ A;  4V0B A;  2K32 A;  4RGN A;  1N32 Q;  4A3I G;  2UUA Q;  5D3I B;  1V1Q A;  1Y1V G;  3K8A A;  1D7Q A;  5AJ3 Q;  1G51 A;  4WJ4 A;  4DFA A;  3M85 A;  4NXM L;  1U5K A;  5C0X I;  2X6G A;  1IW7 D;  1ILQ A;  2A74 C;  1PZK D;  1RJT A;  5EPJ A;  4BY1 H;  1IKL A;  5IT9 c;  3GTL B;  1ICF B;  2N78 A;  3S1N B;  1CI3 M;  5T1G A;  5IWA L;  1VF7 A;  4BS9 A;  4JI6 L;  1LT6 D;  5M5W H;  3RUZ A;  5IYC H;  3VDY A;  3J7A 5;  2MO1 A;  1LM0 A;  5HGQ A;  4FNF A;  1EYC A;  5J39 A;  2Z9H A;  1VQE A;  2IHF A;  1XNQ L;  2XWJ B;  1YJW A;  1STH A;  5C44 H;  2LKV A;  2G5D A;  3L9A X;  1HHV A;  1LV9 A;  3JC6 6;  4QQB X;  2MP1 A;  1XWE A;  2CH4 A;  1XPR A;  1SFO H;  2HIV A;  4IUT A;  4F87 A;  4JI6 Q;  2PCF B;  5KIX A;  4DK6 C;  3NQI A;  4DAY B;  1BKB A;  1N8R C;  5C3E G;  5I2Y A;  1ZEQ X;  4X66 Q;  2QKI C;  1HH2 P;  2LXK A;  3CQZ H;  5E1F A;  3G6J B;  4OEM B;  4AYB B;  1LTL A;  1Q90 A;  1HFN A;  4UP9 A;  3HOU B;  1XPO A;  5COR A;  2R6G A;  3HFZ B;  4L5T A;  1TU2 B;  3K5O A;  1V43 A;  3H3V H;  4JI5 L;  2Z6K C;  3GV6 A;  4FXK C;  1K3R A;  4BBS B;  2F0H A;  3PO3 B;  3SK5 A;  2G9H D;  4GN5 A;  1K73 C;  1BF4 A;  1C4Q A;  2VB3 X;  2IX0 A;  1IL8 A;  3BDO A;  1I5F A;  3WOE A;  4DU9 A;  5CMD A;  3Q22 A;  2WB1 G;  2CHB D;  2K5Q A;  4DV0 L;  4CDF C;  2HHH L;  4NP5 A;  2K5W A;  3NHH A;  4A76 A;  2UUC Q;  4GN4 B;  3QWN A;  4C3I B;  2X6L A;  2HD3 A;  1H9R A;  2AQ1 B;  4HTH A;  4HMJ A;  1FNW A;  1VQ8 A;  3DEO A;  5C0X G;  1FJG L;  1EIH A;  1EYG A;  2AMC B;  3PIO 3;  2JA6 G;  1ZYR D;  3FDT A;  2R93 G;  3D4D A;  4CDC C;  3VR3 A;  1A3V A;  3G48 A;  4BA2 I;  2NVT B;  2DJF C;  3MXN B;  3I4M G;  2N88 A;  1NUC A;  1STY A;  2PZT A;  1M90 C;  3BG3 A;  1ESR A;  1VQG A;  5JVH 3;  4GKJ L;  3GTL H;  3IFT A;  4KKU A;  1KDB A;  2NTS A;  4A3J H;  3PUZ A;  3S1N H;  4DR6 Q;  3CCL A;  2F1M A;  1WTO A;  1BCP F;  4O2D A;  2EYP A;  5IGG A;  1S5F D;  1C8C A;  3IFD A;  1PRT C;  5M3M G;  3MHB A;  3X3N A;  2K50 A;  1E0B A;  1HTP A;  2F0L A;  2B63 H;  1A2T A;  3DUZ A;  4LF4 L;  1KAB A;  1OXV A;  4XYQ A;  1NTG A;  2OT2 A;  1DXM A;  3E5S A;  1SFO B;  4UHV A;  1BNZ A;  2QGQ A;  2JEB I;  2EIF A;  1B2T A;  1B50 A;  4ZKB B;  3SDZ A;  1Z6H A;  3ZJY C;  4P73 A;  4NXN Q;  5CV7 A;  1D6E C;  3M9B A;  4KTA A;  5COY A;  1K8A C;  2LSS A;  1KXL A;  1N33 L;  1EY0 A;  5C44 G;  1B4O A;  4LFB L;  3EN2 A;  2KHS A;  4PNY A;  2PI2 E;  2EYH A;  3CW2 C;  1YNJ C;  4K6L A;  4O0A A;  5F2D A;  2E2J B;  5BN5 A;  1EY6 A;  4PZ8 A;  1XX8 A;  5C0X H;  3RN2 A;  4DF7 A;  1HUN A;  1GM5 A;  1EEI D;  2K5N A;  4J8Q A;  4ZUI A;  3U4V A;  4IAL A;  1B53 A;  3J81 i;  2ZTC A;  2JA5 H;  4A3B H;  4JI3 L;  4DR7 Q;  4C3I H;  3H0G G;  4LMQ D;  3KBX A;  4C2M H;  3S17 H;  2BCO A;  1D2B A;  2K5V A;  1HNX Q;  1VQB A;  3C3L A;  1AZQ A;  1II3 A;  4DR1 Q;  4R9W A;  1Q1E A;  1QIL A;  2RF4 A;  3MTS A;  5CV8 A;  2KBN A;  5D65 A;  3H15 A;  5JJK A;  3PO2 H;  2KHI A;  3RLF A;  2EYM A;  5C4J B;  4A3F B;  2VUM B;  4ME5 A;  3HP3 A;  1YJ9 A;  1SNQ A;  1SSO A;  1U4P A;  1TWC B;  5KYL A;  3CKI B;  3LWU A;  3OPO A;  1F2Z A;  3CCS A;  4P2C B;  3ER0 A;  4OO1 G;  4LF8 L;  4UY8 C;  4IFD H;  4DAV A;  3E6Z X;  2MJ8 A;  5LMU L;  4ZCK A;  3I4O A;  4A3G H;  1IW7 C;  4ME3 A;  1TWG H;  3H94 A;  4KHP Q;  4HJ5 A;  3S1M B;  1ZYR C;  2H1E A;  2PO4 A;  3OWF A;  4X64 L;  2CWP A;  2I46 A;  2F0N A;  5KND A;  4GLA C;  5M3F B;  4B3S Q;  1N36 L;  1E1O A;  1TVX A;  1SJE D;  4DV4 Q;  1CA5 A;  1EQR A;  1O7I A;  2EXD A;  3M4Y A;  1BOS A;  1Q12 A;  4DR4 L;  2NN6 G;  1SYG A;  5IGE A;  5EKL A;  5C3W A;  3TP6 A;  4LF7 Q;  2F0M A;  2R92 G;  2UU9 L;  4LUZ A;  2ICE C;  5J3B A;  5K36 H;  3E9H A;  1F9R A;  2Q8R E;  1HQR D;  1I94 Q;  3KUP A;  1L2F A;  2NN6 I;  5LMN W;  1LUZ A;  2E2J H;  3I55 A;  3R2T A;  1CHQ D;  3T53 B;  4K6D A;  3IRB A;  5EKK A;  2I5L X;  5G3L F;  2QCP X;  1HQM C;  2D9U A;  4H7B A;  1FL0 A;  3HOU G;  1VQC A;  1DYQ A;  4HJ7 A;  2UUB Q;  2JA5 B;  4B9W A;  4JYA L;  2SDF A;  3GTQ B;  4WOR A;  3SEB A;  2KA7 A;  4BBS G;  3SVM A;  4R8I A;  4QIW B;  4L5S A;  3I8Z A;  3PO3 G;  4JV5 Q;  1F2L A;  1K3B C;  4C3J H;  4K2K A;  2N49 A;  1TWH B;  4KHV A;  1N9W A;  3D6C A;  4X3K A;  2F4V L;  4A3F H;  5IP7 H;  1OTC A;  2VUM H;  2AWN A;  2F0D A;  1Y8N B;  1RIP A;  2K5D A;  5FO8 B;  4IFD G;  4HID A;  3ULP A;  4A75 A;  1O80 A;  1OXT A;  1YZ6 A;  4HJA A;  1PH3 A;  4DR3 Q;  4GNX B;  4WRD A;  2D0O A;  1FNU A;  1PMR A;  1LTB D;  2JA6 B;  1PTO C;  2R93 B;  2RSO A;  2K7V A;  1U4M A;  3KLS X;  3EIV A;  4K14 A;  5BN4 A;  2VZA A;  3H09 A;  4NPS A;  3TME A;  3NTK A;  1KL9 A;  5FLM G;  3BYT B;  4L6T B;  1YIT A;  4BY7 B;  4ILW A;  1CKN B;  3CCE A;  1PFB A;  3TP7 A;  3RZD H;  1VQP A;  3U50 C;  2D0P A;  1PFM A;  1VQI A;  2EYL A;  2JQO A;  3A8I E;  1E7Z A;  4A3L G;  5M3F H;  4DV5 Q;  2QEJ C;  3TRE A;  3CRK C;  2MFI A;  3PO3 H;  1JJG A;  4POF A;  1JWS D;  1PH4 A;  2K1B A;  5CR3 A;  4QMG A;  2EYO A;  1W6K A;  1MKH A;  1GUN A;  2DN8 A;  1WVL A;  4LF5 Q;  2HDL A;  3BZK A;  1A3U A;  1EIG A;  1Q8I A;  3KF6 A;  4OIJ A;  4RCO A;  4TSS A;  4YHH L;  4RG1 A;  3CCR A;  1IKM A;  2F52 A;  4A3D G;  4GNX A;  3HKS A;  4L5Q A;  3MAQ A;  3ICE A;  4K0K L;  2NVT H;  1NY4 A;  3OOC A;  3ERS X;  3NP8 A;  3QOL A;  2Z8L A;  3H0G B;  1FVI A;  4MIU A;  2L15 A;  1VF5 C;  3W1B A;  3H6M A;  3GTQ H;  2Z6B A;  1MGS A;  2K01 A;  1IYV A;  2L5T A;  2NYZ D;  3K5N A;  2F0V A;  1Q46 A;  1QUQ B;  1FR3 A;  4K0K Q;  4OWX B;  1V9P A;  2UXD L;  1X6O A;  5IGC A;  1H9S A;  4EQ5 A;  1S72 A;  1B3Q A;  2EY5 A;  2AUK A;  1TWF B;  4DNI A;  3KLR A;  2NUC A;  5HUR A;  3CAM A;  1DOM A;  3A55 A;  3NBI A;  4LF5 L;  3KFU A;  2CQA A;  5M5X B;  4LF9 Q;  1YVC A;  4JW0 A;  3FEW X;  1K0S A;  1JWU D;  3A8K E;  4DUZ L;  4NMZ A;  4DR5 Q;  4C3I G;  4X65 Q;  1HR0 Q;  1CQF A;  4M8A A;  1S4Z A;  5BN3 A;  4C3H B;  3GTG B;  4XQN A;  3JAM i;  2ZTD A;  2HCC A;  2NB0 A;  2SEB D;  1EIF A;  4O42 A;  4IUU A;  3S2D H;  1LO5 D;  2CKZ B;  2F03 A;  1KRS A;  1BCP D;  4RKL A;  4GZY C;  1R9T H;  2QF7 A;  5E4W C;  1AH9 A;  1CQV A;  1ET9 A;  2KOL A;  1Q82 C;  1I4Q A;  3OTO Q;  4NKL A;  1BCP C;  4NW2 A;  3A74 A;  2VQF Q;  3TSS A;  2IX1 A;  1EY7 A;  1TR5 A;  1KDA A;  2JN4 A;  5EPK A;  4RHS A;  3KJO A;  1OXX K;  3P20 A;  1QJO A;  1V1P A;  5IYC G;  4H0L C;  3S17 B;  4QF4 A;  2JA7 G;  1XMO L;  3QO2 A;  1HFG A;  2F4V Q;  4CJ0 B;  2HT1 A;  4RHR A;  1K83 H;  5M3F G;  4OWW B;  2GA4 B;  5CV4 A;  4K2L A;  1UE7 A;  4JV5 L;  3ITP A;  2F0U A;  2K14 A;  2WV6 D;  1SNP A;  2B29 A;  3OSO A;  5CC4 A;  2NTT A;  1CK1 A;  4X62 Q;  1LTI D;  4KI0 A;  1LT4 D;  1TWC H;  2RDF A;  4PV1 C;  3U9O A;  4J1M A;  2VB2 X;  3HEJ A;  3OW2 A;  4RH6 A;  2B8G A;  5C4Z A;  2BOS A;  1JMC A;  2ENB A;  3AYH B;  4OHJ A;  1E3P A;  1EOV A;  2KED A;  1UE6 A;  1ENA A;  5C0X J;  1S5B D;  3NUC A;  4X62 L;  1QCB D;  5JVG 3;  1LLR D;  4DV1 L;  1QVC A;  1SN8 A;  4EQP A;  1NMF A;  4JI0 L;  2B2V C;  2K04 A;  4A3K H;  2Z6K A;  1SYE A;  2VL6 A;  1OXS C;  2IWH A;  1AEX A;  4LF7 L;  1SYF A;  2CVR A;  3D0F A;  2OQK A;  3SHL A;  3VA5 A;  1D5Z C;  3PUY A;  2ZTE A;  1GUO A;  4DV4 L;  2O2L D;  5C5M A;  4BY7 G;  2R3Z A;  1EZ8 A;  5J1Z A;  2VQF L;  3PF4 A;  1PZI D;  3G6E A;  1E22 A;  1YJN A;  1E24 A;  1FD7 D;  1SMX A;  4CDE C;  1KIX A;  5EPL A;  4KHP L;  1AFP A;  4IFD J;  1ENC A;  3MC0 B;  3K7U C;  3HRZ C;  5EBC A;  4DK3 C;  1W2B A;  2Y0S E;  1BBX C;  4A3F G;  2VUM G;  4OGQ C;  2PZU A;  2EVB A;  5LMU Q;  1I6H B;  2R7D A;  3V96 A;  1HR0 L;  4MTK A;  1VQ7 A;  2XIW A;  4LF8 Q;  4DUZ Q;  1EQT A;  2AQ2 B;  1SEB D;  4V19 0;  1A15 A;  1PYW D;  2NVQ H;  3TBI B;  3NEL A;  3NBH B;  2MGS A;  4XT3 B;  2IX3 A;  3CME A;  1J5E Q;  1K83 B;  1GUT A;  1L1O C;  3NTH A;  2XNA C;  3HOV G;  4C56 C;  5GRO A;  4XYO A;  5CBA E;  1XNR Q;  4EQO A;  2PI2 A;  3I2Z A;  4YWK A;  1VQ6 A;  1XMQ L;  2NVX B;  4DR7 L;  3NWS A;  3Q6S A;  1CKM A;  2B2Y C;  2L9H A;  3K5L A;  4KK7 A;  2LFN A;  2PZW A;  1CUK A;  3GTK B;  2KQ3 A;  1K8M A;  1IYU A;  3HOW B;  1PRT F;  2R92 B;  1PXU A;  4RA8 A;  3ONA B;  1HJP A;  2O5J C;  2GVB A;  4N9T A;  5LL6 X;  1ENF A;  3MZ5 A;  4FDB A;  1VQ4 A;  1JCK B;  2ZXR A;  5GQO A;  2H5X A;  3PCO B;  1TKW B;  3CP0 A;  2WKD A;  3J81 E;  1LT5 D;  1CZG A;  1EYD A;  4C1N I;  2NVY B;  1K8G A;  2AHO B;  3K58 A;  3A8J E;  4IFD I;  2M00 A;  3QJY A;  2K03 A;  4ALP A;  4FF4 A;  2N3S A;  4CHT B;  3T1H L;  2V4D A;  5IP9 H;  5JEA H;  4QGU A;  2IY5 B;  1SRO A;  2F0J A;  1D1I A;  2IHE A;  1NSN S;  3SK4 A;  3I7F A;  4X3U A;  4LF4 Q;  2KEC A;  3U9S A;  3CMA A;  3QR8 A;  4DR2 L;  2PPB C;  1SYC A;  1XPU A;  1JOQ A;  2J7Z A;  3I90 A;  5KGU A;  1QZG A;  1ILP A;  1F9Q A;  1KAA A;  4A3C G;  1WFQ A;  4DAY A;  4AQY L;  4I7Z C;  2AKW B;  1TT2 A;  4A3M H;  2JA7 B;  3GD7 A;  5IYB H;  4HED A;  1W3S A;  3HS0 C;  2ATW A;  2KVM A;  4OX9 L;  1EQV A;  4RAU C;  4DR3 L;  4XQQ A;  3PF5 A;  3MVV A;  5IYD H;  1JE5 A;  4I7A A;  3A0J A;  2EJM A;  3QOJ A;  4XIG S;  4UP8 A;  2XVS A;  4UDU C;  2PYK A;  1PA6 A;  2PQA A;  5CV5 A;  3KLS A;  1YNN D;  2CCZ A;  4ODG A;  4Q5V A;  1FJG Q;  4IPH A;  4ZYS A;  1SLJ A;  3S15 H;  2LS0 1;  2EPB A;  2A73 B;  2Q2T A;  1S5E D;  2UUC L;  3R8B A;  3K80 C;  3I91 A;  1JE4 A;  4RCN A;  1W6J A;  1UWV A;  3OMC A;  3M3Y H;  3VR5 A;  3GTK H;  3HOY G;  3S14 B;  1ICW A;  4FXD A;  1P16 A;  2B63 G;  1X32 A;  4LK1 C;  3KK7 A;  4IUR A;  1RF2 D;  2FMC A;  3HKZ B;  3NE5 B;  1RCV D;  2WAC A;  2UUB L;  4OON A;  1DGS A;  1A8V A;  4O1N A;  1VQN A;  4JI1 Q;  3OIQ A;  2JA8 B;  3I4M H;  4JI5 Q;  3PQI A;  4LW1 A;  4MTN A;  3J7A F;  4IJH A;  4G57 A;  4JVZ A;  2BA1 A;  1R9T B;  2DY8 A;  3MFY A;  3MEH A;  1I4X A;  1L0W A;  1DON A;  1SE3 A;  2TMP A;  1PTO D;  1ET6 A;  2F4I A;  2UU9 Q;  4OO1 I;  1CHP D;  2G9D A;  3FKI G;  4WJW A;  1A3T A;  4QCL A;  1UAP A;  1S40 A;  3W3A A;  5C4H A;  5I9O A;  1R4Q B;  1AZP A;  2WIN B;  3RR5 A;  1PH9 A;  4FF1 A;  1NJI C;  1KNE A;  3QG1 A;  3VYR A;  1PH2 A;  3AU7 A;  4EVO A;  5I9P A;  3UDG A;  2Q2I A;  4K8I A;  5GAD C;  4CJ2 C;  4B3T Q;  1L1O A;  1AN8 A;  4H44 C;  3E0E A;  3IKJ A;  3BVM A;  4Y52 H;  4XXE A;  4YY3 Q;  5IWA Q;  3KDF A;  2F0E A;  1GHK A;  3J81 L;  2VXW A;  4CBV A;  3TN2 A;  4JI8 L;  3GDE A;  3F2D A;  1Y69 U;  4NXM Q;  1KDC A;  5AJ3 L;  5A2Q E;  4HJ9 A;  1WYD A;  3VR4 A;  5H1S E;  3PSI A;  1N32 L;  3W2D A;  1EQQ A;  1IBL Q;  2BE5 C;  1SRU A;  4DUY L;  2N55 A;  1A2U A;  5IIF A;  5C3E H;  1S3O A;  3BYY B;  4DR1 L;  3NEN A;  3WDN A;  5EAY A;  1X54 A;  4JBK A;  5IYD G;  2MNA A;  3M3Y B;  2IL8 A;  1EY5 A;  3VA7 A;  4A3G G;  1EFI D;  3HOX G;  4A3L H;  4HN7 A;  1QNK A;  2PMZ E;  1WJJ A;  1B8A A;  4KJO A;  3SE0 A;  2KEE A;  3I3C A;  4PMW A;  1WI5 A;  2ID0 A;  2XN9 C;  2NZH A;  2RSN A;  2JA8 H;  4DNT B;  4AYB G;  5M5W B;  4GKK Q;  1EUJ A;  3BDL A;  1A6X A;  2PMZ B;  2YYZ A;  4HJ8 A;  3J7A V;  3HOV H;  3FKI H;  4LFA L;  1BO0 A;  2FIN B;  3DWP A;  4NB3 A;  5JJI A;  3QB3 A;  4NDX A;  1I6H H;  3GTM B;  4I65 A;  3KBG A;  4ZRZ A;  1F77 A;  2I0Q A;  5C6A A;  4TVA B;  1VQD A;  4A3I H;  3TZD A;  1DOK A;  3RNU A;  4FF3 A;  5JPM C;  2I5M X;  3AFP A;  5LHY 1;  4PZ7 A;  1L0Y B;  3NWT A;  1EYA A;  2AWO A;  3GQB A;  3G71 A;  3EA6 A;  1MIU A;  4APV A;  3CD6 A;  2XGT A;  1OO9 B;  1M8A A;  3LNN A;  3D4R A;  2MPM A;  1VQJ A;  4A93 G;  4BBR B;  1LAC A;  1Q1B A;  2F0Q A;  4G7Z C;  2KCN A;  3PIO A;  2WAQ B;  3EVQ A;  4JI7 L;  4ZUJ A;  4OIK A;  2Z4H A;  3F8T A;  3BJU A;  5JJZ A;  4DV6 L;  2UXB Q;  2Q2U A;  3Q8D A;  4TRD A;  5E7N A;  2BDO A;  4IQZ A;  1MD2 D;  3OWE B;  3NEM A;  3VR2 A;  2F3I A;  1SMY C;  3D31 A;  4DR6 L;  4AH6 A;  4GKJ Q;  4KN4 C;  5IGF A;  2E75 C;  3ND8 A;  1RDP D;  3HKZ E;  2EY1 A;  5DM7 3;  1X3F A;  2RHS B;  3VYU A;  2QW7 A;  1A63 A;  3H3V C;  2ICI A;  4FO2 A;  5KNC A;  5M3M B;  3HOY B;  1KRT A;  4LUO A;  1SNO A;  2K05 A;  2EZV A;  5ELO A;  4U67 3;  3WOF A;  3AEV A;  1LTA D;  2OTJ A;  3I73 A;  3ND9 A;  2KCC A;  4YWL A;  4DV0 Q;  4Z9C B;  3PIP A;  4F88 A;  2C9O A;  1JB3 A;  2RA4 A;  3UDX A;  1VS0 A;  1I50 B;  2CFM A;  1KNA A;  2QDL A;  1STE A;  4DNR B;  4JK1 C;  2CWA A;  3HOV B;  5LMN L;  3FKI B;  1HNZ L;  4DUY Q;  1PDQ A;  4FYD A;  1F2Y A;  4IPC A;  5C4X B;  2RQX A;  4HCE A;  2EY2 A;  2YTV A;  1VQ9 A;  2B63 B;  1B3A A;  3GTM H;  3NXW A;  2EJG C;  4G4K A;  4YCW A;  2UXC L;  3CQZ B;  4P72 A;  4JI8 Q;  4JBM A;  4R4C A;  1FNV A;  3PGZ A;  5FOB B;  3I72 A;  2JXM B;  1IZ6 A;  1TS2 A;  5FO9 B;  3CCV A;  4HSV A;  4YY3 L;  4B9X A;  4KJN A;  3C46 A;  5EJW A;  2CH4 W;  3I70 A;  1IL2 A;  3T51 B;  3Q23 A;  3OIP A;  1PFN A;  2L0C A;  3CCM A;  1EEF D;  4JG2 A;  2F0K A;  3T16 A;  1EY8 A;  2L12 A;  1PYS B;  1IBK Q;  1XNQ Q;  3JAM L;  1GHJ A;  4K5W A;  2XSC A;  4ZAI A;  1JOR A;  3P1H A;  4PMB A;  1B7Y B;  3VR6 A;  2ASB A;  2E76 C;  3G4S A;  5IOD A;  2KUM A;  1JOK A;  4LFC Q;  1B9N A;  4JOI A;  2EE1 A;  2B39 A;  4KKT A;  1HXY D;  2UXC Q;  4L63 B;  1U4L A;  5IE8 A;  4L5R C;  5M3M H;  1ONL A;  1GXD C;  4LUV A;  1UNS A;  4PMC A;  4GOP A;  2TSS A;  2BA0 A;  2PW5 A;  3A7L A;  1Y1V H;  3MXP A;  1LTS D;  3KF8 A;  4Y7N B;  4KKS A;  3Q0A A;  2ALY B;  4JI1 L;  1HRJ A;  3L3O C;  4A3J B;  1H95 A;  1G2S A;  4TKO B;  4FXG C;  5FO7 B;  3PO2 B;  4GN3 B;  1SNC A;  4CKB A;  4DAP A;  1BQQ T;  3M7N A;  1Q7Y C;  4RGO S;  1I50 H;  1QE6 A;  1A0I A;  2R7Z B;  1Z7T A;  1LT3 D;  1STB A;  2FFK B;  3I4L A;  1XXG A;  1TY2 A;  4QIW E;  5BR8 Q;  3K57 A;  2Q8T A;  1PH8 A;  4IUN A;  1A62 A;  1HA6 A;  3KYH C;  2XWB B;  2HQL A;  5CV9 A;  3RLO A;  1WD1 A;  3FRP B;  5EGT A;  3TRZ A;  4A3G B;  4HAE A;  3HOX B;  2D2C C;  3IL8 A;  5FJ8 H;  3GTJ B;  3A7A B;  1K28 A;  3GO5 A;  1KQS A;  1Z9F A;  1I4P A;  1PRT B;  1GO3 E;  2DNE A;  2D5D A;  2JA5 G;  1DCZ A;  2UXB L;  4DV6 Q;  2JK8 A;  1TY0 A;  4BBR G;  4HMI A;  2JA8 G;  1EU3 A;  2WAQ G;  1EWI A;  3KDF B;  1IYJ B;  2K5H A;  4ZK9 B;  1X3Q A;  4DN4 M;  2KHJ A;  4DR2 Q;  2JYO A;  5FLX L;  1T5X D;  2OF1 A;  1BVS A;  3M4P A;  2EXZ A;  1PLF A;  3UDI A;  3G7L A;  2A68 D;  3EQL C;  4RMF A;  2HUG A;  5GAH C;  1ASZ A;  1WTP A;  1JR0 D;  4A3B B;  1QB5 D;  4CGY B;  4DK1 A;  3DHQ A;  1IBM L;  2ZJR A;  1L0X B;  4IPG A;  2PNR C;  1GUG A;  4LAA A;  1Q81 C;  2JEA I;  4N9P A;  3DMU A;  3ULL A;  1C7Y A;  3V2T A;  1F2M A;  4LFA Q;  1HZC A;  3TS2 A;  1P8L A;  1Y1V B;  4AIM A;  5DLQ E;  4GKK L;  4OL7 A;  1VQF A;  4C3J B;  1EOT A;  4DK0 A;  1WTV A;  3UE1 A;  2P5Z X;  5J22 A;  1X56 A;  2KCT A;  1E2Z A;  5IGB A;  2R7Z H;  3CPW A;  1CA6 A;  2A6E D;  3HOU H;  3KLW A;  3LWE A;  5K5P A;  1JB7 A;  2HCI A;  1MHW C;  1EL0 A;  4BXX H;  4KD3 A;  4IUP A;  4KD4 A;  2XRQ D;  3HOX H;  1VQO A;  3PV0 A;  4Q0F A;  3J80 i;  5CV6 A;  5I4D A;  1IBL L;  4BY7 H;  4F7X A;  1M4V A;  3SXH A;  1Y14 B;  1HNW Q;  2RCF A;  4A3D B;  4YIJ A;  2E2H B;  5A2Q L;  3DXJ C;  1TXY A;  1KC8 C;  3K0Y A;  3BZC A;  2KJX A;  4X6A H;  1PTO H;  3R93 A;  1VCI A;  2IT1 A;  1X9N A;  1UEA B;  3VYS A;  3C1E A;  4LNQ A;  2B2T A;  1O7Z A;  4GLX A;  1M1K C;  3O13 A;  1CM9 A;  1VQL A;  1TQO A;  5JJL A;  3MXU A;  2OTL A;  1MJC A;  4C2M B;  2PQE A;  1MI2 A;  4A3E H;  3EJI A;  3HOY H;  4LJZ C;  4QUF A;  1PH5 A;  1S5D D;  4B3T L;  1QUQ A;  1EY9 A;  4HIK A;  3CXC A;  5DNF A;  3S1R H;  1J9O A;  4DV2 L;  1RHP A;  5IP7 G;  1SE8 A;  5C4J H;  3H0G H;  1KLG D;  2RHQ B;  4RGT A;  3T13 A;  5EBD A;  2D62 A;  1PH1 A;  3U58 A;  5CYU A;  2VNU D;  4DV3 Q;  4JI0 Q;  4M1U B;  1H9M A;  1LYL A;  4C3H G;  1BUV T;  4A93 B;  4DV1 Q;  3IAY A;  1Q8K A;  2ZM6 L;  1HA5 A;  1U9R A;  4LF6 L;  1XTC D;  1TWG B;  1WCM G;  1HR0 W;  1E1T A;  5IT9 E;  4G7O C;  3NBH A;  2L4N A;  2I07 B;  4YCV A;  5E4X A;  5M9O A;  2A19 A;  4RGM A;  4ZKC B;  2Q2H A;  2ZT9 C;  2E2D C;  3BZD B;  1KTK A;  3DM3 A;  1K0R A;  4RKB A;  4XDX A;  2KCM A;  4PZ6 A;  3K6O A;  1G91 A;  2B2V A;  3OW7 A;  1PH6 A;  2F0S A;  2XRS D;  1VQA A;  5GAE C;  4POG A;  1NE3 A;  1UEB A;  2BDN A;  1YIJ A;  1U4R A;  4CJ1 B;  3GTO H;  1TII D;  1WTW A;  3HOZ G;  2H4O A;  5FLX c;  1MJE A;  4OX9 Q;  1DM0 B;  1B1Z A;  5L37 A;  1VDZ A;  3T56 B;  4KHZ A;  1N34 L;  4H02 A;  1XTD A;  4AQY Q;  5IOC A;  5D3D A;  2EYF A;  4K8J A;  5IYB G;  2I5H A;  2RDG A;  3R3O A;  4IUQ A;  1Q3L A;  1EIY B;  3C1F A;  3L7Z C;  5JAV A;  4Y7N H;  4B3R Q;  1WCM H;  3JAM E;  4JI4 Q;  1SYD A;  4X65 L;  1CSP A;  1GKH A;  2R61 A;  1YHA A;  1TWH H;  3S1R B;  1QZH A;  3TQY A;  4DR5 L;  1VQH A;  1SMY D;  4XQJ A;  3T1H Q;  1GUW A;  2EYJ A;  3R2I A;  4KLK A;  4ULL A;  2NZ1 D;  1I3Q B;  4DAM A;  4GOP B;  4HSP A;  5K36 G;  1DZ1 A;  4GLV B;  3MFG A;  2C35 B;  4AYB E;  1AW7 A;  2M9V A;  2MUY A;  2Z1C A;  1TWF H;  4OXP A;  2FHT A;  1STN A;  3EBE A;  3CC2 A;  3S1M H;  2R93 H;  3I4N G;  1CKN A;  2HDM A;  2LXJ A;  4A3B G;  1PYB A;  1YHQ A;  1NNX A;  3WWV A;  2K28 A;  1X3G A;  2UXD Q;  1AE2 A;  1Y1W G;  4QJF A;  3CF5 A;  2E5L L;  4EGV A;  2RBM A;  5ELC A;  1O7L A;  3TP8 A;  4HIO A;  4XTC S;  2K6A A;  3CC7 A;  5KNB A;  1E2W A;  1ZKO A;  4UPA A;  2OWO A;  5E3F A;  1WTQ A;  4IN3 A;  4ABN A;  3M4O B;  1U0L A;  2RCN A;  5KEE A;  3TZU A;  2DUD A;  2F0I A;  1XMQ Q;  2SOB A;  3RMH A;  5FLM H;  4HCS A;  1QNU A;  5DEH A;  1QOH A;  1ESF A;  1XNR L;  2OEO A;  2CQO A;  1EZ6 A;  3GTO B;  3PO2 G;  3URY A;  5IGD A;  1J5E L;  3N52 A;  2JSO A;  3PUX A;  3A56 A;  4CDD C;  4GOP C;  3D6W A;  4A3M G;  4UAI A;  1PHJ A;  2KEN A;  2F0F A;  1X65 A;  2E2I B;  5A35 A;  4IO9 A;  3DM1 A;  2F3V A;  1EY4 A;  1TS4 A;  4DV5 L;  2Z4I A;  3X3M A;  4JI4 L;  4IOA A;  5EQ0 A;  1QVF A;  3JAM c;  2K75 A;  2BH8 A;  4KN7 C;  4JC0 A;  4GNX C;  1WTR A;  1G2T A;  1O78 A;  4KY5 A;  4EX5 A;  5FK9 C;  1UE5 A;  5D14 A;  4HIM A;  3BDC A;  1V1O A;  1N34 Q;  3HOZ H;  4CKE A;  1STG A;  1HCZ A;  1T5E A;  3RLN A;  1K8O A;  4E6I A;  5ELE A;  2GVA A;  1I3Q H;  1TWA B;  2VY3 A;  2JA6 H;  3HZX A;  4JI2 L;  1VQM A;  3AFQ A;  1JOO A;  3RD4 A;  5TSS A;  4J15 A;  3AMU A;  3S9W A;  1HZ9 A;  4A3K B;  3K7A B;  3RZD B;  5ISR A;  1KAW A;  1GOZ A;  3PUV A;  2OCE A;  4DA2 A;  4GS3 A;  2AQ3 B;  4C3H H;  3GTG H;  4LWC A;  1PV4 A;  2K33 A;  3S2D B;  4BA1 I;  4A3D H;  3Q24 A;  1XJV A;  2E2H H;  1WTX A;  1C9O A;  1J8I A;  4R4Q A;  1HUM A;  2EDG A;  4IPD A;  1SND A;  1PTO B;  2HQE A;  3KF8 B;  3M4O H;  1C0A A;  2WP8 J;  1JJ2 A;  1DD2 A;  1SE4 A;  3BVG A;  3NTI A;  4IOC A;  5JEA J;  3K59 A;  4LF6 Q;  1RL2 A;  1XYI A;  1X3P A;  4KY6 A;  3L2P A;  2ZM6 Q;  3T4A C;  1PH7 A;  2MHV A;  4QUC A;  5IY0 A;  3GTP B;  1SDF A;  4P74 A;  4A3E B;  1I94 L;  5C3X A;  4C3J G;  2YU9 H;  1HTL D;  1NR4 A;  1QVG A;  2MO0 A;  1XMO Q;  3H3V I;  2GN5 A;  1BBU A;  1KLU D;  2A68 C;  4XT1 B;  3FP9 A;  1G29 1;  4JI2 Q;  2C5C A;  4FF2 A;  2JA9 A;  4DR4 Q;  2OXP A;  1EWC A;  1MSH A;  3STB C;  4ID6 A;  1NMG A;  4WJ3 M;  3J81 c;  4DV2 Q;  1LAB A;  2RDH A;  1N36 Q;  3CPF A;  2Q8I B;  1NR2 A;  3L0O A;  2J4X A;  1WTH A;  3FHW A;  3NK9 A;  2V1C C;  3OTO L;  1KHI A;  4ZQ3 A;  2Y0S G;  1T9H A;  5ELB A;  5KRU A;  1B70 B;  1GJX A;  3RN5 A;  3FPP A;  1YBY A;  3I56 A;  4A93 H;  1H9K A;  1RTO A;  2FXQ A;  1LTR D;  2J0T D;  3DEP A;  5FJ8 G;  2IJ0 A;  3HOZ B;  5AFW A;  2ZJQ A;  1C48 A;  3P75 A;  5M5X H;  2E74 C;  1VQ5 A;  4OWT B;  1H9S B;  5G3L D;  1WD0 A;  1TWA H;  3FPU B;  2B3G A;  4YWM A;  4KMU C;  3AQQ A;  3A5U A;  3DLL A;  2RVL A;  5JOB A;  3S16 H;  3E3X A;  1F9P A;  3I4N B;  1I4H A;  4LF9 L;  1G6P A;  2ZXO A;  2EQS A;  2NN6 H;  2NBF A;  4A4I A;  3PUW A;  3D8G A;  3SGI A;  1HNW L;  2F0O A;  1LTT D;  2EJF C;  1NCV A;  3CHB D;  1WOC A;  3UE0 A;  4K5V A;  3E9I A;  3B6Y A;  1B9M A;  1QG7 A;  2PNH A;  1Z47 A;  1EWH A;  3F2C A;  1NBW A;  1I4G A;  5I6W A;  1S5C D;  3NSW A;  1V8Q A;  4IZ8 A;  1YEZ A;  5FLX E;  1BR9 A;  2B2Y A;  1PFS A;  1RTN A;  4JI3 Q;  3UDF A;  5EKI A;  4IUV A;  4HR7 B;  4OO1 H;  4JBJ A;  2L55 A;  2WFW A;  2HIX A;  3PMF A;  1Y1W B;  2NVQ B;  2E5L Q;  1X55 A;  2F0T A;  4KV6 A;  4IJL A;  4YHH Q;  2YU9 B;  2K4K A;  2L1B A;  4R4T A;  4A3M B;  2JA7 H;  1WCM B;  1HZA A;  3D3R A;  3BVZ A;  2A5H A;  3J7Z C;  1ML0 D;  4R1J A;  4JCV E;  2NWG A;  4NXN L;  1RD9 D;  4G7H C;  2YV5 A;  5CBE E;  1TS3 A;  3GP7 A;  2SNS A;  2YTY A;  1JC7 A;  2E8G A;  3MXN A;  4FP5 D;  1H9J A;  3KJP A;  2QA4 A;  3MWY W;  1R4P B;  3FMC A;  3DWA A;  4BXX G;  4WFN 3;  1YHB A;  4QB4 A;  1Q86 C;  3E0J A;  1HPC A;  1PVO A;  1EU4 A;  1Y8P B;  4BY1 G;  3HOW H;  4B3R L;  2R92 H;  1B44 D;  4DPG A;  2IW3 A;  4F8M A;  2FJ2 A;  1DJR D;  4JBW A;  2B2W C;  3BU2 A;  2IPK D;  2CW0 C;  5CGK A;  5JPN C;  3S24 A;  2A1A A;  3KF6 B;  4QY7 A;  4PG3 A;  1FGU A;  4N8X 1;  1SNM A;  3LX0 A;  3TS0 A;  1BDO A;  3F2U A;  1PTO F;  1ROD A;  3S16 B;  2DGY A;  2R7F A;  3PIP 3;  1CFM A;  2PQA B;  1JWM D;  2A69 D;  1AE3 A;  3ERQ A;  2WB1 B;  4PQX A;  4P71 A;  1SXT A;  3H91 A;  5GAG C;  1PZJ D;  1MSG A;  2N8N A;  2QEX A;  2K52 A;  2QIL A;  3K5M A;  2DJG C;  4P75 A;  4QL5 A;  4OEL B;  2NZO A;  3UI2 A;  5BR8 L;  3OHX C;  4H13 C;  2MQH A;  3S1Q H;  1SBB B;  3CCQ A;  3SK6 A;  1AP0 A;  1YNJ D;  1X3E A;  4JPB W;  1QWY A;  3W5O A;  4ZLT F;  4A3I B;  3CRL C;  3OYY A;  2E2I H;  4JYA Q;  2SNM A;  1VQK A;  1ZXT A;  2F3W A;  2EY6 A;  3LGJ A;  1SAP A;  3K81 C;  4R8N A;  1Y1W H;  4C1N K;  4MZ9 A;  1TS5 A;  1K9M C;  4R4I A;  3SK8 A;  4A3C H;  4DGZ A;  3RZO B;  3KOJ A;  1STA A;  4RWS C;  3BS1 A;  3OMG A;  2BH2 A;  2NVX H;  2VW9 A;  4DV3 L;  5DAU A;  3J7Y W;  3NQT A;  1YNN C;  4BBS H;  4MHE A;  1UUP A;  3S15 B;  3A5Z B;  2WII B;  4LFC L;  4X66 L;  2O4X A;  2EOT A;  5IP9 G;  5JEA G;  1SE2 A;  2LMC B;  5DM6 3;  1I6V C;  3F1Z A;  3J81 j;  3HG9 A;  3AB9 A;  1GUS A;  4CKC A;  1L1O B;  3S14 H;  1PRT D;  2B2U C;  4B3S L;  2XTI A;  1D5M C;  5C3E B;  1GVP A;  2DNC A;  1BCP B;  3K7A H;  1IBK L;  4X64 Q;  2PW7 A; 
#chains in the Genus database with same CATH homology
 4YCU A;  3E0E A;  2Q2H A;  3S2H H;  4Y52 H;  1HZB A;  3DM3 A;  5C4X G;  1K0R A;  2NVY H;  4YY3 Q;  5IWA Q;  1CSQ A;  3KDF A;  2ZJP A;  4BBS G;  3CCU A;  4L5S A;  2KCM A;  4PZ6 A;  3PO3 G;  4JV5 Q;  3HOW G;  4C3J H;  4JI8 L;  2N49 A;  3W1G A;  3GDE A;  1PH6 A;  1JT8 A;  3F2D A;  1N9W A;  1VQA A;  5GAE C;  4NXM Q;  4POG A;  2F4V L;  4A3F H;  5IP7 H;  1OTC A;  1NE3 A;  1UEB A;  2AWN A;  5AJ3 L;  4HJ9 A;  2VUM H;  1WYD A;  1YIJ A;  1RIP A;  5H1S E;  3PSI A;  2UUA L;  4IFD G;  1N32 L;  3TEH B;  4HID A;  3J80 c;  3ULP A;  1EQQ A;  3GTO H;  4A75 A;  3GTP H;  1OXT A;  1IBL Q;  1YZ6 A;  4DUY L;  1SRU A;  4HJA A;  1PH3 A;  1HNZ Q;  4DR3 Q;  5LMN Q;  4GNX B;  3HOZ G;  2D0O A;  5FLX c;  5C3E H;  1MJE A;  1S3O A;  4DR1 L;  4OX9 Q;  3NEN A;  5EAY A;  1X54 A;  5C4X H;  1HNX L;  4JBK A;  5IYD G;  2MNA A;  4KHZ A;  1N34 L;  3EIV A;  4H02 A;  1XTD A;  2VZA A;  4AQY Q;  3MEF A;  4NPS A;  4A3G G;  4MNO A;  1KL9 A;  5FLM G;  3HOX G;  3CC4 A;  5IYB G;  4A3L H;  2PMZ E;  2VQE Q;  1WJJ A;  1YIT A;  1B8A A;  4B3M Q;  1CKN B;  2I5H A;  3CCE A;  3RZD H;  1VQP A;  3U50 C;  1EIY B;  2D0P A;  4PMW A;  1WI5 A;  1VQI A;  3L7Z C;  2ID0 A;  4Y7N H;  2JQO A;  1WCM H;  4B3R Q;  1E7Z A;  4JI4 Q;  4A3L G;  5M3F H;  2NZH A;  4X65 L;  1CSP A;  1GKH A;  4DV5 Q;  1YHA A;  1TWH H;  1QZH A;  4A3K G;  3TQY A;  3TRE A;  1VQH A;  4DR5 L;  2MFI A;  3PO3 H;  1JJG A;  4TQU S;  4AYB G;  4POF A;  3T1H Q;  4KLK A;  1D8L A;  3RZO H;  4GKK Q;  1EUJ A;  2VS1 A;  2YYZ A;  1PH4 A;  4DKA C;  4DV7 Q;  4HJ8 A;  2WAQ E;  4DAM A;  4GOP B;  3HOV H;  3FKI H;  4LFA L;  5K36 G;  4GLV B;  1JJC B;  4UP7 A;  2C35 B;  1GD7 A;  4NB3 A;  3U4Z A;  4AYB E;  1UE1 A;  5JJI A;  1EFW A;  1MKH A;  4LFB Q;  1I6H H;  1TWF H;  4OXP A;  3EBE A;  2I0Q A;  3CC2 A;  4LF5 Q;  2JE6 I;  1VQD A;  4TVA B;  4A3I H;  1N33 Q;  3S1M H;  3BZK A;  4A3J G;  2R93 H;  3I4N G;  1CKN A;  3RNU A;  2LXJ A;  4A3B G;  1PYB A;  3KF6 A;  2I5M X;  4YHH L;  1YHQ A;  3AFP A;  1YI2 A;  4RG1 A;  1KD1 C;  3CCR A;  3I4N H;  1IBM Q;  3WWV A;  2F52 A;  4A3D G;  4GNX A;  3HKS A;  4PZ7 A;  4L5Q A;  3T1Y L;  1X3G A;  2ES2 A;  1AE2 A;  3ICE A;  1Y1W G;  4K0K L;  2UXD Q;  4QJF A;  3CF5 A;  2AWO A;  4JI7 Q;  2E5L L;  2NVT H;  1NY4 A;  2YTX A;  2R7Z G;  3ERS X;  3G71 A;  3CCJ A;  1FVI A;  2L15 A;  1MIU A;  4R4O A;  4APV A;  4XTC S;  3W1B A;  5HY6 A;  2XGT A;  3CC7 A;  4HIO A;  4A3E G;  3CD6 A;  3GTQ H;  4UPA A;  2OWO A;  1VQJ A;  4A93 G;  2JJQ A;  1Q1B A;  1Q46 A;  1QUQ B;  1U0L A;  2RCN A;  3PIO A;  2WB1 E;  4JI7 L;  4K0K Q;  2DUD A;  3M4Q A;  1V9P A;  4OWX B;  1X6O A;  1XMQ Q;  3T1Y Q;  2UXD L;  3F8T A;  4EQ5 A;  3BJU A;  1J6Q A;  5FLM H;  4DV6 L;  1S72 A;  2UXB Q;  3HKZ G;  2Q2U A;  3Q8D A;  1OXU A;  5E7N A;  2OQ0 A;  3NEM A;  2F3I A;  1XNR L;  4DNI A;  3D31 A;  5ELN A;  4DR6 L;  1SR3 A;  3CAM A;  4LF5 L;  3ULJ A;  4AH6 A;  4GKJ Q;  3K0X A;  2Z0S A;  3KFU A;  2CQO A;  3PO2 G;  3HKZ E;  1J5E L;  1X3F A;  2RHS B;  3PUX A;  1A63 A;  4DV7 L;  4GOP C;  4LF9 Q;  1YVC A;  4A3M G;  1PHJ A;  2KEN A;  4DUZ L;  1X65 A;  1KRT A;  4IO9 A;  4LUO A;  4DR5 Q;  4X65 Q;  4DV5 L;  1HR0 Q;  5ELO A;  4JI4 L;  3AEV A;  4IOA A;  3JAM i;  4BBR H;  2ZTD A;  3STB D;  2OTJ A;  4JOI C;  1QVF A;  3JAM c;  1EIF A;  2HHH Q;  3S2D H;  4YWL A;  2K75 A;  2BH8 A;  4DV0 Q;  4B3M L;  2CKZ B;  3PIP A;  4JC0 A;  1KRS A;  4GNX C;  2VQE L;  3GTJ H;  4EX5 A;  1R9T H;  3UDX A;  1UE5 A;  1VS0 A;  4HIM A;  1N34 Q;  3HOZ H;  1AH9 A;  1BBW A;  2CFM A;  1Q82 C;  2A8V A;  3OTO Q;  3RLN A;  5M5Y H;  1IXR A;  3A74 A;  2VQF Q;  1YNX A;  3F2B A;  2CWA A;  2IX1 A;  2GVA A;  1I3Q H;  5LMN L;  1HNZ L;  2VY3 A;  1ASY A;  4DUY Q;  1CKO A;  2JA6 H;  4IPC A;  3KJO A;  1OXX K;  1VQ9 A;  2YTV A;  5IYC G;  1N32 Q;  4A3I G;  4JI2 L;  2UUA Q;  1VQM A;  3GTM H;  1V1Q A;  3AFQ A;  1Y1V G;  3K8A A;  2JA7 G;  1D7Q A;  5AJ3 Q;  1G51 A;  4WJ4 A;  4YCW A;  4J15 A;  1XMO L;  3M85 A;  4NXM L;  1HZ9 A;  1U5K A;  2F4V Q;  2UXC L;  2HT1 A;  5C0X I;  4P72 A;  1K83 H;  1KAW A;  4R4C A;  4JI8 Q;  5M3F G;  3PUV A;  1UE7 A;  2OCE A;  4BY1 H;  4GS3 A;  4JV5 L;  3PGZ A;  5IT9 c;  4C3H H;  3GTG H;  4LWC A;  1IZ6 A;  2K14 A;  2N78 A;  1PV4 A;  2B29 A;  4BA1 I;  5IWA L;  3CCV A;  4YY3 L;  4B3T Q;  4JI6 L;  4X62 Q;  4KI0 A;  5M5W H;  4A3D H;  5IYC H;  3VDY A;  1TWC H;  1XJV A;  2E2H H;  1C9O A;  2MO1 A;  4R4Q A;  1IL2 A;  3J7A 5;  1LM0 A;  5HGQ A;  3OW2 A;  3CCM A;  1VQE A;  4IPD A;  4JG2 A;  2IHF A;  1XNQ L;  1YJW A;  3KF8 B;  3M4O H;  1JMC A;  5C44 H;  1PYS B;  1IBK Q;  1XNQ Q;  1C0A A;  2WP8 J;  3JC6 6;  1JJ2 A;  4QQB X;  3AYH B;  4IOC A;  1E3P A;  5JEA J;  1EOV A;  1XPR A;  1UE6 A;  1SFO H;  2HIV A;  4LF6 Q;  5C0X J;  1RL2 A;  4X62 L;  4JI6 Q;  3L2P A;  1N8R C;  4DK6 C;  2ZM6 Q;  4DAY B;  1BKB A;  1PH7 A;  5IY0 A;  4DV1 L;  5C3E G;  4P74 A;  1B7Y B;  1QVC A;  2ASB A;  3G4S A;  1I94 L;  1SN8 A;  1NMF A;  4X66 Q;  1HH2 P;  4JI0 L;  4A3K H;  2LXK A;  4LFC Q;  4JOI A;  3CQZ H;  2YU9 H;  2Z6K A;  2VL6 A;  1LTL A;  1QVG A;  2MO0 A;  1OXS C;  2UXC Q;  1XMO Q;  4UP9 A;  4LF7 L;  3H3V I;  2GN5 A;  1BBU A;  1XPO A;  3D0F A;  5IE8 A;  4L5R C;  5M3M H;  3FP9 A;  1G29 1;  4JI2 Q;  2R6G A;  4DR4 Q;  2JA9 A;  4LUV A;  2OQK A;  3HFZ B;  4GOP A;  4L5T A;  1V43 A;  3STB C;  3PUY A;  2ZTE A;  1NMG A;  4DV4 L;  3H3V H;  3J81 c;  2BA0 A;  4DV2 Q;  4JI5 L;  4BY7 G;  4WJ3 M;  1N36 Q;  1Y1V H;  2Z6K C;  3CPF A;  1K3R A;  2ALY B;  3L0O A;  4JI1 L;  2VQF L;  3PF4 A;  1H95 A;  3FHW A;  3G6E A;  1E22 A;  2V1C C;  3OTO L;  1KHI A;  2Y0S G;  1YJN A;  1T9H A;  1E24 A;  1SMX A;  1B70 B;  4GN3 B;  4GN5 A;  1K73 C;  1KIX A;  3RN5 A;  1YBY A;  2IX0 A;  3I56 A;  3M7N A;  4KHP L;  4A93 H;  1Q7Y C;  2FXQ A;  1I50 H;  1I5F A;  5FJ8 G;  1A0I A;  4IFD J;  3K7U C;  2WB1 G;  4DK3 C;  2ZJQ A;  4DV0 L;  1W2B A;  2HHH L;  2Y0S E;  4QIW E;  4A3F G;  2VUM G;  4A76 A;  5BR8 Q;  2UUC Q;  4GN4 B;  5M5X H;  1PH8 A;  5LMU Q;  1A62 A;  3KYH C;  1VQ5 A;  2R7D A;  4OWT B;  1HR0 L;  1TWA H;  2HQL A;  4JBM A;  1VQ8 A;  2B3G A;  3RLO A;  4YWM A;  1VQ7 A;  3AQQ A;  5C0X G;  3A5U A;  3DLL A;  4DUZ Q;  4LF8 Q;  1FJG L;  1EYG A;  2AMC B;  3TRZ A;  3S16 H;  2JA6 G;  4LF9 L;  1G6P A;  2NVQ H;  2R93 G;  2EQS A;  4A4I A;  3NEL A;  3NBH B;  3PUW A;  3SGI A;  1HNW L;  5FJ8 H;  3G48 A;  4BA2 I;  3CME A;  1J5E Q;  3MXN B;  3I4M G;  1L1O C;  1M90 C;  1VQG A;  1WOC A;  3UE0 A;  4GKJ L;  3GTL H;  3GO5 A;  3E9I A;  4A3J H;  1KQS A;  3HOV G;  1Z9F A;  3PUZ A;  3S1N H;  4DR6 Q;  3CCL A;  3B6Y A;  5GRO A;  1XNR Q;  2PNH A;  1Z47 A;  1GO3 E;  1NBW A;  3F2C A;  2JA5 G;  4O2D A;  2UXB L;  2PI2 A;  4DV6 Q;  2JK8 A;  3I2Z A;  4YWK A;  4BBR G;  1VQ6 A;  1XMQ L;  1YEZ A;  2JA8 G;  4DR7 L;  5M3M G;  2WAQ G;  1EWI A;  1CKM A;  3KDF B;  1PFS A;  4JI3 Q;  1IYJ B;  2K5H A;  3UDF A;  2KHJ A;  4DR2 Q;  2K50 A;  1CUK A;  2B63 H;  4LF4 L;  1OXV A;  1BVS A;  1NTG A;  3M4P A;  3UDI A;  4JBJ A;  2WFW A;  4RMF A;  2QGQ A;  5GAH C;  2JEB I;  2EIF A;  2HIX A;  1ASZ A;  2E5L Q;  1HJP A;  2GVB A;  1X55 A;  4FDB A;  1VQ4 A;  1IBM L;  2ZJR A;  4IPG A;  3ZJY C;  5GQO A;  4IJL A;  4P73 A;  4NXN Q;  2H5X A;  4YHH Q;  2K4K A;  3PCO B;  3M9B A;  4R4T A;  2JA7 H;  3CP0 A;  1Q81 C;  1HZA A;  2LSS A;  1K8A C;  2JEA I;  1N33 L;  1KXL A;  5C44 G;  3J7Z C;  3ULL A;  1C7Y A;  4R1J A;  4LFB L;  3EN2 A;  4JCV E;  4NXN L;  2YV5 A;  1K8G A;  2AHO B;  2PI2 E;  3CW2 C;  4LFA Q;  4IFD I;  1HZC A;  2YTY A;  3TS2 A;  1P8L A;  4ALP A;  2E8G A;  4O0A A;  4AIM A;  3KJP A;  2N3S A;  5DLQ E;  2QA4 A;  4GKK L;  1VQF A;  3T1H L;  4BXX G;  5IP9 H;  1YHB A;  4QGU A;  2IY5 B;  1SRO A;  4PZ8 A;  2IHE A;  1Q86 C;  3UE1 A;  1PVO A;  3RN2 A;  3I7F A;  4BY1 G;  1GM5 A;  2K5N A;  3HOW H;  4LF4 Q;  4B3R L;  2R92 H;  1X56 A;  2KCT A;  4DPG A;  3U4V A;  2R7Z H;  3CMA A;  4DR2 L;  3CPW A;  3J81 i;  2ZTC A;  2JA5 H;  1XPU A;  1QZG A;  4JBW A;  4A3B H;  3BU2 A;  4JI3 L;  3HOU H;  3KLW A;  4DR7 Q;  4C3I H;  3H0G G;  4C2M H;  4A3C G;  1WFQ A;  3S17 H;  4AQY L;  3S24 A;  1JB7 A;  2A1A A;  2AKW B;  4BXX H;  3KF6 B;  4QY7 A;  4PG3 A;  1FGU A;  4OWW B;  4A3M H;  2K5V A;  1HNX Q;  1VQB A;  3GD7 A;  5IYB H;  3TS0 A;  1W3S A;  3HOX H;  2ATW A;  1VQO A;  2DGY A;  2R7F A;  3PV0 A;  4DR1 Q;  4OX9 L;  1Q1E A;  2PQA B;  2RF4 A;  3J80 i;  2KBN A;  3H15 A;  4DR3 L;  3PF5 A;  1AE3 A;  5JJK A;  1IBL L;  5IYD H;  3PO2 H;  4BY7 H;  1JE5 A;  2KHI A;  4P71 A;  3A0J A;  1Y14 B;  3RLF A;  4XIG S;  4UP8 A;  1HNW Q;  5GAG C;  1YJ9 A;  1PA6 A;  2PQA A;  2N8N A;  2QEX A;  1TXY A;  2K52 A;  3CCS A;  1KC8 C;  2CCZ A;  3ER0 A;  3BZC A;  1FJG Q;  4OO1 G;  4LF8 L;  4IPH A;  4P75 A;  4UY8 C;  4X6A H;  1VCI A;  4QL5 A;  2IT1 A;  1X9N A;  1SLJ A;  3S15 H;  2NZO A;  4LNQ A;  5LMU L;  4GLX A;  2Q2T A;  1M1K C;  5BR8 L;  3I4O A;  2UUC L;  3K80 C;  1VQL A;  5JJL A;  1UWV A;  2MQH A;  3M3Y H;  3S1Q H;  4A3G H;  2OTL A;  1MJC A;  3CCQ A;  3GTK H;  4ME3 A;  3HOY G;  1TWG H;  4A3E H;  1P16 A;  1X3E A;  4KHP Q;  3W5O A;  2B63 G;  4HJ5 A;  3HOY H;  3OYY A;  2E2I H;  4JYA Q;  1PH5 A;  1VQK A;  2UUB L;  4B3T L;  4OON A;  1DGS A;  1A8V A;  1QUQ A;  3LGJ A;  4JYA L;  4X64 L;  2CWP A;  4HIK A;  3K81 C;  1Y1W H;  3CXC A;  1VQN A;  4JI1 Q;  4GLA C;  4B3S Q;  4MZ9 A;  3S1R H;  1N36 L;  1E1O A;  4JI5 Q;  3I4M H;  4LW1 A;  4DV2 L;  5IP7 G;  4MTN A;  4DV4 Q;  1K9M C;  1SE8 A;  4IJH A;  4R4I A;  5C4J H;  1EQR A;  1O7I A;  2EXD A;  3H0G H;  4A3C H;  1Q12 A;  2BA1 A;  3KOJ A;  2NN6 G;  2RHQ B;  4DR4 L;  2BH2 A;  2NVX H;  1L0W A;  2VW9 A;  4LF7 Q;  4DV3 L;  4BBS H;  2R92 G;  2D62 A;  4LUZ A;  1PH1 A;  2UU9 L;  5J3B A;  3E9H A;  2UU9 Q;  3U58 A;  4OO1 I;  3FKI G;  3A5Z B;  2VNU D;  4DV3 Q;  4LFC L;  4JI0 Q;  4X66 L;  1LYL A;  1I94 Q;  5IP9 G;  5JEA G;  1S40 A;  2JA8 H;  4DV1 Q;  1L2F A;  2NN6 I;  1Q8K A;  3F1Z A;  3J81 j;  1LUZ A;  2ZM6 L;  5LMN W;  2E2J H;  3I55 A;  4LF6 L;  1L1O B;  3RR5 A;  3S14 H;  1PH9 A;  1WCM G;  3IRB A;  1HR0 W;  1NJI C;  1E1T A;  2I5L X;  4B3S L;  2XTI A;  1PH2 A;  1GVP A;  3UDG A;  3K7A H;  1IBK L;  2Q2I A;  4X64 Q;  3HOU G;  1FL0 A;  4YCV A;  5GAD C;  1VQC A;  2UUB Q;  4HJ7 A;  1L1O A;  2A19 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...