4C3HH

Structure of 14-subunit rna polymerase i at 3.27 a resolution, crystal form c2-93
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
144
structure length
134
Chain Sequence
NTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLNATRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-DIRECTED RNA POLYMERASE I SUBUNIT RPA190
publication title Crystal Structure of the 14-Subunit RNA Polymerase I
pubmed doi rcsb
molecule tags Transcription
total genus 22
structure length 134
sequence length 144
ec nomenclature
pdb deposition date 2013-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4c3hH00
1GVPA 3HFZB 2AMCB 3GTGH 2B63G 1CKOA 1QUQA 3IRBA 2KCMA 2R7ZH 1VQOA 1W2BA 2UXBL 1SLJA 2RHSB 1HR0L 1HNWL 4X65Q 2IT1A 5LMNW 2QGQA 1E3PA 1WOCA 3U4ZA 2CWAA 2VZAA 1XMQL 4GKKL 1OXUA 4JOIA 4DV3L 4R1JA 1AH9A 3FP9A 1X3EA 3J7A5 1E22A 2ZTEA 4YCWA 2VNUD 1AE2A 1PH1A 4O0AA 1YITA 3AFPA 3S1NH 5AJ3Q 4JYAQ 3E0EA 4JBWA 1GKHA 1YHQA 1VQMA 5C0XJ 4X65L 1EWIA 2Y0SE 4QIWE 1OXTA 2OWOA 1J5EL 2JE6I 3RNUA 4A3KH 1PYBA 1BBUA 1PH9A 1VQAA 1NMFA 2BH8A 2YV5A 3AQQA 3PUVA 5GQOA 4DV1L 1VQ4A 5LMNQ 2UUAQ 4DKAC 4JBJA 4DV6Q 3MEFA 3TQYA 3J81i 2RF4A 4P75A 2E2IH 4L5SA 3PIOA 4AQYL 4DAMA 1XPUA 2NVTH 4OO1I 3H3VH 4LUOA 2Q2UA 3BU2A 1SE8A 2RCNA 3RZDH 3KDFB 3DM3A 1N8RC 2OTJA 2K5HA 1HH2P 1PH7A 1Q1EA 3JC66 3TEHB 4P72A 3UDFA 1M1KC 4LF9L 4JV5Q 4QQBX 3FKIH 3EN2A 1SROA 2HIXA 4YWMA 3T1HQ 2UUCL 4LF5Q 2I5HA 1G6PA 1B70B 4KHZA 4IFDG 3FKIG 1IBLL 2FXQA 1D7QA 1X6OA 3I56A 2D0OA 4DAYB 1V9PA 2JQOA 1YJWA 3EIVA 3JAMi 3J81c 3KLWA 5LMUL 4GLXA 2B29A 2JJQA 1JB7A 3HKZE 3NENA 4DR1L 1XTDA 5M3MH 3M7NA 1D8LA 3CD6A 3RZOH 4DR3Q 4YHHL 4FDBA 3PO3H 4A3MG 3CCLA 4A3DH 1N34L 3S17H 3M85A 2B3GA 2K14A 1J6QA 3PSIA 5M5XH 1S72A 1VQKA 2N78A 1QVGA 4A3DG 4IFDJ 4BY1H 1BVSA 1C7YA 3TREA 2E8GA 3CCUA 2R92H 1PH4A 2R6GA 2NN6I 3RLOA 3KYHC 4JI4L 3G4SA 1CUKA 1VS0A 1W3SA 1KIXA 2R92G 4BA2I 1XPOA 4DV0L 4JI8L 3A74A 1I5FA 2E5LL 3RLNA 2PI2E 5C4XH 3PUYA 1QVCA 1PFSA 3GDEA 2VQEQ 1CKNB 1E7ZA 1PYSB 5BR8Q 1TXYA 5C4JH 2IHFA 4GN4B 1SN8A 1X56A 1CKMA 3BJUA 5FLXc 3CC7A 1YJNA 4A3IG 2JA5H 1NMGA 4LF8L 4GKJL 2I0QA 4DR7Q 2N49A 1DGSA 1VQHA 4LF4L 3A0JA 3L0OA 4UP9A 4OX9L 3L2PA 1UE7A 4BXXH 2D0PA 1A63A 4DV4Q 4UP7A 4YCVA 1VQDA 5IP7H 3OTOQ 1HR0W 1VQNA 4C3JH 5JEAG 1IBKQ 3D0FA 4X64Q 4X62L 1VQLA 3S24A 1JJ2A 4QGUA 3W1GA 1EIFA 3M9BA 3CCRA 3RLFA 4PZ8A 4DR5L 3CXCA 3AYHB 3STBC 5IP9H 2UXDQ 1H95A 4JI1Q 3I2ZA 4DR7L 1VQ8A 4A3FH 3HOUH 1OXVA 1XPRA 1MJCA 3RN5A 3B6YA 5IP9G 4B3MQ 2N8NA 1L1OB 3NELA 3BZKA 4A3FG 3HOUG 4IPDA 4AIMA 3FHWA 2E2JH 2UXBQ 3ZJYC 3HOZG 4NB3A 1HR0Q 1K73C 1HNWQ 1K0RA 2Q2TA 5M3FH 1VQBA 1GO3E 1RL2A 1TWGH 5JEAJ 1NTGA 4OO1G 1UE1A 4TVAB 2IX1A 1PHJA 1XMQQ 4GKKQ 2IHEA 4DV3Q 4IPHA 2YTYA 4OWTB 4EX5A 3AEVA 4GNXB 2ZTCA 2B63H 1A0IA 2LSSA 1Q81C 3BZCA 1QZGA 5IYCH 2JA7G 2F3IA 3E9HA 4LW1A 3CCMA 1VQPA 1PH3A 2F4VQ 4DR6L 2EXDA 2K52A 1I6HH 3PGZA 5IYCG 2L15A 3KF6A 3K81C 4L5QA 4JI5L 1R9TH 1J5EQ 4BBSG 4IJHA 1V43A 4DV1Q 1X3GA 4Y7NH 2NVQH 1HZBA 3GTMH 4L5RC 1PH6A 5DLQE 2ES2A 1UEBA 4LFAL 4B3RL 4JI7L 3KJOA 4AQYQ 4AYBG 2JA8H 1EQRA 1Y1VG 4JI3L 4A3BG 1U0LA 3ERSX 2DUDA 2VL6A 2F4VL 3PF4A 2KBNA 2JA8G 2KCTA 1Q12A 3GTOH 1IBML 1YHAA 4LF7L 2A19A 3W5OA 4A3GG 1K83H 5IWAL 4LF6L 4LF9Q 3G71A 4P71A 2UUCQ 1XNQQ 1AE3A 2CKZB 4YCUA 5GAHC 4GOPA 2K75A 1SRUA 4B3TL 1UE5A 4LWCA 1A8VA 4O2DA 1ASZA 3A5ZB 4ME3A 1IBLQ 4YY3L 2NN6G 4NXML 2HT1A 3HOWG 4X66L 1Q7YC 4C3IH 5FJ8H 1KD1C 4OWXB 3S2HH 2I5MX 3NBHB 2ZTDA 4IPCA 5LMUQ 4A3CG 4LFBL 1L2FA 2OQKA 2KHIA 5FJ8G 3PUZA 4DR1Q 2CCZA 1OXSC 1VQFA 4KLKA 3KF8B 4DUYL 2JEBI 1X9NA 1XNQL 3TRZA 1MJEA 4A93G 4ALPA 1TWFH 4YHHQ 3MXNB 4LFCL 5ELOA 1HNXL 4JCVE 4JI2L 2PI2A 3I55A 3F2CA 4XTCS 1N34Q 2EQSA 3OW2A 4JBKA 2PQAB 2IX0A 1NBWA 4H02A 3ICEA 5JJKA 3EBEA 1IL2A 1L0WA 5JJIA 4DR4L 2WB1G 4QL5A 4JI4Q 2JEAI 1I50H 2MO1A 4IOCA 4A3MH 3S15H 5C44H 4DV0Q 3F2BA 4JI8Q 4MNOA 3HOYG 2E5LQ 3CC4A 1Q1BA 1O7IA 4BY7H 2IY5B 5C44G 1KRSA 3J81j 4LUVA 4JI0L 1QUQB 1YEZA 4IPGA 4BY7G 2UU9L 4JI6L 3UE1A 1KXLA 1TWHH 2MFIA 1YVCA 1PA6A 4LF8Q 4GKJQ 4QJFA 4HJ5A 4C2MH 2XTIA 3JAMc 5IYBH 1ASYA 2YU9H 4LF4Q 3CF5A 3GO5A 4OX9Q 4P74A 3S1MH 5IYBG 1Q8KA 4DNIA 4EQ5A 4IO9A 1G291 3ULJA 1X54A 1XJVA 1VQIA 4PG3A 4DUZL 1OXXK 2XGTA 3K0XA 4JC0A 4X62Q 4A3IH 3M3YH 3UDGA 1WI5A 4DR5Q 4BBRG 3I4MG 4A76A 1CSPA 2UXCL 1BBWA 4A75A 3WWVA 1PH2A 1S40A 3W1BA 3GTLH 3DLLA 4GOPC 3PIPA 2ZJRA 4J15A 2NZOA 3TS2A 2AKWB 3M4QA 3K80C 3NEMA 3T1YL 4Y52H 5GAGC 1UWVA 3J80i 1VQ7A 1VQ9A 4R4IA 1VCIA 4X6AH 4JBMA 4KI0A 1HJPA 1MKHA 1KAWA 4GN3B 3PF5A 3H3VI 5IE8A 1FJGL 4R4QA 2UUBL 2VUMH 4AYBE 4A3EG 2ZJQA 4YWKA 2R7DA 4HJ7A 1SR3A 4C3HH 1U5KA 4B3SL 4WJ4A 1IZ6A 2VUMG 1FGUA 2PMZE 5ELNA 2WP8J 4IFDI 1YBYA 3HOZH 3CAMA 4DV2L 1E1TA 2K4KA 3CW2C 1EYGA 4LNQA 4KHPL 1JJGA 5H1SE 1FVIA 3HOVG 4DR6Q 1N32L 2K5VA 4GLVB 5HGQA 2DGYA 1Y14B 3CP0A 4RG1A 4JI5Q 1VQ6A 1JJCB 5IYDG 1EIYB 3S1QH 1Q82C 3RR5A 3KDFA 3GTQH 5M5YH 2ZJPA 1EFWA 4JG2A 4QY7A 4LFAQ 1LUZA 1YIJA 3J7ZC 2JA7H 4B3RQ 1WYDA 4JI7Q 1X3FA 4JI3Q 1VQJA 2CWPA 1B8AA 1L1OC 1LTLA 4GLAC 4DPGA 1IBMQ 5GROA 5FLMG 4LF7Q 3CCVA 4K0KL 2WAQG 1Z47A 5IWAQ 4LF6Q 3F1ZA 1QZHA 2PQAA 2LXKA 1TWAH 4B3TQ 2R7ZG 2R93H 2Z6KC 5GADC 4A3BH 1Y1VH 1WJJA 2ALYB 1UE6A 1HZ9A 4YY3Q 1XMOL 4NXMQ 2R93G 2VQFL 4UPAA 2A8VA 4X66Q 2WB1E 4NXNL 4GNXC 1N33Q 1PV4A 4LFBQ 3M4PA 4DR2L 4A3GH 4HIOA 3PO2H 2HHHL 4UY8C 3K7UC 3S14H 3G6EA 3KJPA 2GVAA 2MO0A 1K8AC 5E7NA 4OWWB 4DUYQ 2AHOB 1YJ9A 3UDIA 3LGJA 3U4VA 1V1QA 1HNZL 2YTVA 1IXRA 1KRTA 4YWLA 3I4OA 3PV0A 3CPWA 4LFCQ 3HOWH 1HZAA 1HNXQ 2CQOA 2R7FA 4JI2Q 4NPSA 4DV5L 1N36Q 4POGA 1XNRL 4A3CH 2Q2IA 2VS1A 2I5LX 3Q8DA 4IJLA 1N33L 4HJ8A 2ZM6Q 4DK6C 4PZ6A 1IYJB 1VQGA 2VW9A 3S2DH 4LUZA 2OQ0A 3STBD 4DR4Q 4A93H 1VQEA 2NVXH 3H15A 4R4CA 1CKNA 3ULLA 5HY6A 1S3OA 2CFMA 1I3QH 4UP8A 2Q2HA 4HIKA 1NJIC 2NZHA 3GTJH 1P16A 1N36L 4JI0Q 1Q86C 1K3RA 2LXJA 2PNHA 1I94Q 2BA1A 2AWNA 3RN2A 2UU9Q 4JI6Q 2JA6H 1KHIA 3VDYA 2C35B 4OXPA 4A3KG 1Y1WH 2YYZA 2ZM6L 1VQ5A 2V1CC 1PVOA 2JA6G 2AWOA 3CQZH 1Y1WG 4MTNA 5AJ3L 4JYAL 1M90C 3HOYH 1E1OA 1G51A 1C9OA 5C0XI 2QEXA 1K9MC 1PH8A 3F2DA 1OTCA 4DUZQ 4HIDA 3I4NH 3OYYA 3E9IA 1I94L 3GD7A 2UUAL 1L1OA 3CCSA 3D31A 1BKBA 5LMNL 2K50A 1VQCA 4PZ7A 2N3SA 4A4IA 3KF6B 4DV6L 3I4NG 2UXCQ 3CCJA 2VY3A 3PUXA 5IY0A 1EOVA 1Z9FA 3S16H 5EAYA 3ULPA 1SMXA 4PMWA 1CSQA 1HZCA 3L7ZC 4OONA 4DK3C 3T1YQ 2Z6KA 1FL0A 1B7YB 4GS3A 2EIFA 3S1RH 3I4MH 4BBRH 4JV5L 3T1HL 4LF5L 4AH6A 1JT8A 4GNXA 3PUWA 5M3MG 5IT9c 2Y0SG 3UE0A 1FJGQ 2ASBA 4WJ3M 2NVYH 3KOJA 1NE3A 2UUBQ 5K36G 2A1AA 4A3LH 1X55A 3PO3G 2ID0A 4BA1I 3CMAA 4GOPB 1JMCA 4B3SQ 1K8GA 4A3LG 1TWCH 2WFWA 1KC8C 1GM5A 2BA0A 3K8AA 4GN5A 1SFOH 2RHQB 3SGIA 2WAQE 4DV2Q 4JOIC 2HIVA 4BY1G 3M4OH 2ATWA 4KHPQ 1KL9A 1YI2A 1N32Q 2GVBA 1EUJA 5J3BA 3CC2A 4DR3L 3GTKH 4A3EH 1T9HA 2BH2A 4IOAA 4RMFA 5C3EH 1GD7A 3HKSA 5C4XG 4R4OA 3GTPH 1P8LA 1JE5A 3KFUA 3G48A 5C3EG 3UDXA 1YNXA 1LYLA 1MIUA 3CMEA 3U58A 2JA5G 3HOVH 4DV7Q 3K7AH 2KENA 1KQSA 2JK8A 1Q46A 3J80c 3TS0A 2K5NA 5IYDH 3HKZG 4K0KQ 4P73A 4HJ9A 4BXXG 3HOXH 2JA9A 3CPFA 1QVFA 4MZ9A 2VQEL 5IP7G 3AFQA 5BR8L 4A3JH 1X65A 3F8TA 3CCQA 5JJLA 3HOXG 2D62A 1XMOQ 3H0GH 3PCOB 2KHJA 2VQFQ 4A3JG 4NXNQ 1WFQA 1NY4A 4APVA 3H0GG 5FLMH 4DV7L 4DR2Q 2OTLA 3U50C 3CCEA 1E24A 2HHHQ 4BBSH 3ER0A 4DV4L 1YZ6A 2F52A 2Z0SA 3OTOL 3A5UA 4HJAA 1A62A 4POFA 5GAEC 1EQQA 4TQUS 2MQHA 4X64L 1IBKL 1HNZQ 2GN5A 4R4TA 1PH5A 2YTXA 3PO2G 2MNAA 4DV5Q 1XNRQ 2UXDL 1WCMH 4JI1L 4XIGS 2E2HH 1C0AA 3I7FA 1RIPA 2HQLA 4L5TA 5M3FG 1YHBA 4HIMA 1WCMG 2OCEA 4B3ML 1N9WA 2H5XA 5M5WH 2QA4A 5C0XG 1LM0A
chains in the Genus database with same CATH superfamily
1WTHA 1GVPA 2AMCB 3DUZA 2B63G 2JA6B 1QUQA 1SNOA 2KCMA 2RHSB 2B2YC 2NVTB 2IT1A 4XT1B 2J7ZA 3TSSA 5G3LF 2VZAA 1XMQL 1OXUA 4K5VA 1E22A 1AE2A 1YITA 3AFPA 1GKHA 3CU7A 2JSOA 1ONLA 2Y0SE 1OXTA 1J5EL 2JE6I 3NQIA 2TMPA 1PFBA 1PMRA 1UEAB 4DV1L 1VQ4A 5GQOA 4PV1C 1JR0D 4DKAC 5M3MB 5KNBA 3J81i 4AQYL 1XPUA 4DAMA 3L9AX 1LV9A 2Q2UA 3BU2A 4MN3A 2SDFA 4C3IG 5M5XB 3TEHB 2QKIC 1JOQA 4P72A 2XRQD 4BY1B 2UUCL 1SMYC 3EN2A 4LF5Q 1B70B 4KTAA 3SHLA 4IFDG 4DAYB 1STAA 5LMUL 4WORA 2JJQA 3HKZE 1EIGA 2EY6A 1PRTF 1XTDA 3KK7A 4R9WA 3CD6A 3U9SA 1QNKA 3CCLA 1N34L 3S17H 2K14A 3PSIA 1S72A 4IUNA 4C3JB 2B2YA 2EYFA 2EYLA 1C7YA 3TREA 2R92H 1CFMA 4A3JB 4JI4L 1ET6A 3TN2A 4DV0L 1EU4A 4V0BA 4JI8L 1QOHA 4K2KA 1I5FA 1Q90A 5KYIA 5C4XH 1PFSA 5COYA 2EYPA 1F9RA 4GN4B 2JA5H 3BJUA 1NMGA 1DGSA 1VQHA 5M3FB 4LF4L 3K58A 2KVMA 2NTTA 1UE7A 4BXXH 2D0PA 2BE5C 1JC7A 4DV4Q 1HR0W 1H9JA 5JEAG 3K5NA 3D0FA 4X64Q 1DONA 3S24A 3CCRA 4DR5L 5AFWA 3DEPA 4PZ8A 3AYHB 4IZ8A 4FXKC 3VA7A 5IP9H 1E2VA 3I2ZA 1EY9A 3HOUH 1MJCA 1SYFA 4L8JA 4A3FG 1TS4A 3QOLA 3MA2B 1MSGA 3IFTA 2UXBQ 3HOZG 1HR0Q 4ZCKA 2LKVA 2PMZB 1PRTC 1RL2A 1TWGH 4FYDA 4G7ZC 4X3TA 3GTOB 2IX1A 2IHEA 4DV3Q 5C0XH 3N52A 4IPHA 2YTYA 4GNXB 4KD3A 1A0IA 2LSSA 4M8AA 3FPPA 2F3IA 3E9HA 4DR6L 1PH3A 5CYUA 4G7OC 2EXDA 1HA6A 1FR3A 1TS2A 3KF6A 2HDMA 3K81C 1R9TH 2Q8RE 5FO7B 3GTMH 1PH6A 5DLQE 4LFAL 1B1ZA 5J39A 3KJOA 4AYBG 4JI7L 1EQRA 1RJTA 1Y1VG 1HA5A 4A3BG 2DUDA 2K32A 4U68A 1Q12A 1IBML 2A19A 3KUPA 1K83H 2WB1B 3P7JA 5IGBA 1XNQQ 5GAHC 4B3TL 4BS9A 1UE5A 1A8VA 1ASZA 1C48A 3A5ZB 4A3MB 4NXML 5C44B 1BCPF 4X66L 1Q7YC 2MGSA 4NDXA 5I6YA 1SYGA 4IPCA 1C4QA 3A56A 3P1HA 2KHIA 5EJWA 1XTCD 2EJMA 5FJ8G 4KLKA 1DD2A 3KF8B 2JEBI 4DXGA 3OPOA 3LNNA 1TWFH 4ALPA 3MXNB 4ZLTF 5CV6A 4JBKA 4LK1C 4PQXA 2WKCA 3ICEA 2X6LA 3EBEA 5JJIA 4XQJA 2WB1G 3PIP3 1W6JA 4KN7C 1F9QA 3F2BA 3WOEA 1QE6A 3CC4A 3JAML 5C44G 1E2WA 3HP3A 3J81j 2JYOA 1A15A 4XXEA 5ELCA 2MFIA 1YVCA 2NTSA 4H44C 1EY8A 4GKJQ 2VB3X 1KAAA 2F0GA 2VUMB 5EGTA 1BR9A 1Q8KA 2EY2A 3AMUA 4DNIA 3MEHA 4IO9A 3ULJA 1ICWA 1XJVA 3MZ5A 3VYUA 3K0XA 4X62Q 3M3YH 1CSPA 3HS0C 1BBWA 1PH2A 3GTLH 1SXTA 4IALA 1TWGB 4G57A 3QJYA 1NR2A 1BCPC 3K80C 3NEMA 2A73B 3NWTA 5GAGC 1UWVA 3GTQB 4JBMA 2NYZD 2SOBA 1HJPA 3PF5A 3H3VI 1FJGL 3BDCA 1JOKA 2KECA 4YWKA 2R7DA 4HJ7A 1SR3A 4C3HH 3D8GA 3NBIA 1WTRA 1U5KA 1R9TB 4WJ4A 2FFKB 2VUMG 1EY7A 2XNAC 1FGUA 1NUCA 2WP8J 4IFDI 2R93B 3URYA 4HEDA 5H1SE 3HOVG 3NSWA 4KKUA 4GLVB 5HGQA 3CP0A 1Y14B 2PZUA 4A3GB 1VQ6A 1JJCB 4KJNA 2A69C 3S1QH 3KDFA 2ZJPA 1YIJA 1LUZA 4WFN3 1ILQA 2A6HD 2QDBA 4FO2A 1B8AA 4GLAC 1LTLA 1U4LA 1JORA 3CRLC 4MTKA 3ERQA 1K3BC 2WAQG 3MTSA 4RGTA 3BZDB 2Z6KC 4V190 1HZ9A 4YY3Q 2R93G 1EYDA 2A8VA 1TWFB 4LFBQ 3M4PA 1LT4D 3PIO3 1B4OA 1K8AC 1RODA 4DUYQ 1YJ9A 1HNZL 1IXRA 3R3OA 5JJZA 4KKSA 3PV0A 4LFCQ 2R7ZG 1HZAA 2VNUD 3OOCA 1EZ8A 2F3WA 1N36Q 4POGA 3Q23A 5EPKA 2I5LX 4RKBA 5ELDA 1LABA 4LUZA 1XX8A 5CV7A 4A93H 1QCBD 2NVXH 2J0TD 4JPBW 3ZYYX 2N55A 1S3OA 3MXUA 1EY0A 4UP8A 2IPKD 2AQ3B 2NZHA 2NBFA 4HMJA 1I94Q 2F03A 2CW0C 4A3KG 2C35B 2QILA 3I4MB 1Y1WH 2RSNA 2EJGC 1DM0B 5DM73 4HR7B 2AWOA 4MTNA 1M90C 3JAME 1Q8IA 2F0DA 1EQVA 1G51A 2K01A 1K9MC 1TWCB 1I4PA 4HIDA 1B3AA 1NNXA 1BBXC 3FRPB 1VQCA 1ZYRC 3GQBA 3OIPA 4A4IA 4X3UA 1KNAA 3CCJA 2EDGA 2VY3A 1QJOA 1S5CD 3OIQA 3L7ZC 2Z6KA 1U4RA 4DNRB 5C5MA 1B7YB 2M9VA 4GS3A 3BG3A 3I73A 1NCVA 4LF5L 3PUWA 3K7AB 2Y0SG 5IT9c 1VMPA 2ASBA 3KOJA 5K36G 2X6GA 4RCNA 1X55A 1O7LA 3CMAA 1JMCA 4A3LG 2QF7A 1GM5A 2BA0A 3IKJA 3K8AA 4GN5A 4CKCA 1FYCA 4JOIC 3ND8A 3A8JE 1KL9A 2KEEA 1N32Q 3CC2A 3GTKH 4DNTB 1PYWD 2A74C 3R93A 1GUNA 4IOAA 1LLRD 2BCOA 2F3VA 3PMFA 3J80L 4R4OA 3GTPH 3KFUA 1JE5A 1B2TA 1LYLA 4R8NA 3Q6SA 1KQSA 3TS0A 3DWAA 4DAVA 2XSCA 3HKZG 4K0KQ 5BN5A 4CDFC 3CPFA 1HQRD 4K8JA 4MZ9A 3NBHA 1X65A 4RFBA 5JJLA 2B2WC 3HOXG 1RHPA 2D62A 4EQOA 5E4XA 2EYOA 3RD4A 5FLMH 5IIFA 4BBSH 4DV4L 1YZ6A 3M4YA 4HJAA 1AZPA 1EY6A 3D3RA 4POFA 5GAEC 2F0HA 3BVMA 5EKLA 4X64L 2E76C 4R4TA 1SJHD 4I7ZC 2G9HD 1WCMH 2HD3A 1WD0A 4OIJA 2E2HH 3I7FA 2XWBB 2K33A 5EBDA 5FKAC 5M5WH 3T53B 4HN7A 3GTGH 1CKOA 1LTRD 3IRBA 5I2XA 2SEBD 3IL8A 4G4KA 5KGUA 1W2BA 1Y1WB 2UXBL 1SLJA 4IUVA 1HR0L 1YNNC 1FD7D 3D4RA 5LMNW 2QGQA 1WOCA 4U673 3NTHA 4JOIA 4DV3L 3VR4A 3FP9A 3AB9A 1X3EA 3NHHA 2HQEA 1DOLA 2E75C 4YCWA 4O0AA 5AJ3Q 3F2UA 4JBWA 1VQMA 5C0XJ 1SAPA 4X65L 3DWQA 1QNUA 3V2TA 1O7YA 1SBBB 1VQAA 3PUVA 2YV5A 3R2TA 1UUPA 5LMNQ 2NWGA 3TP6A 2RDFA 4QIWB 3TQYA 4L5SA 4FXDA 2NVTH 4RH6A 1E2ZA 3H3VH 3PO3B 1T5EA 3NK9A 2F0TA 3DM3A 2OTJA 2Z1CA 2K5HA 1HH2P 2B2WA 1PH7A 1Q1EA 3JC66 4O1NA 3SK6A 4JV5Q 3TZDA 4QQBX 4IFDH 1SROA 2I5HA 4KHZA 3D6CA 1D7QA 1X6OA 1IYVA 1CHPD 4NKLA 2F1MA 3K5OA 3JAMi 3J81c 4K2LA 2B29A 3NENA 5C4JB 4DU9A 5KIXA 3GTPB 5M3MH 4DR3Q 4FDBA 2A6HC 1IW7C 4EQNA 2B3GA 3M85A 2K5DA 5M5XH 1VQKA 1VDZA 1STNA 2N78A 4BY1H 1PTOB 1MSHA 3QG1A 2F4IA 2NN6I 3RLOA 2XVSA 3KYHC 1KIXA 3H94A 5IGDA 5EPJA 2BDNA 3A74A 3FEWX 1QVCA 4BBSB 1PYSB 1TXYA 4I7AA 1SJED 2IHFA 1H9SB 1CKMA 1X56A 1YJNA 4A3IG 4GKJL 4RCOA 2N49A 4XT3B 2CHBD 4QB4A 2Z6BA 5T1IA 4UP9A 1WCMB 2PO4A 1D1IA 1EYAA 4YCVA 1VQNA 4C3JH 2B63B 4JVZA 1G2TA 4X62L 2A6ED 1VQLA 1JJ2A 3W1GA 1EIFA 3GTGB 3CXCA 1MI2A 3QB3A 4K6LA 2UXDQ 4DR7L 1I6HB 1VQ8A 4A3FH 4ME5A 1JE4A 3B6YA 2LY7A 1L1OB 3NELA 2HUGA 3BYTB 4F7XA 4Y7NB 1S5BD 1CK1A 1AP0A 1HNWQ 1K0RA 2ZXPA 4RA8A 5M3FH 4OO1G 1Y8PB 1NTGA 1UE1A 2K5WA 1GUWA 2IWHA 1QG7A 1D2BA 4OWTB 5JVG3 3MXPA 3DXJC 4Z9CB 3BZCA 2JA7G 4LW1A 5TSSA 2J4XA 5IYCG 4C3IB 3MHBA 3S2HB 1JWSD 1BNZA 1X3GA 3D4DA 4L5RC 2ES2A 1UEBA 3MVVA 5F2DA 1I6VC 4ZKCB 1OO9B 2TSSA 1GOZA 2F4VL 3GTOH 3L3OC 1D5XC 5ISRA 4MHEA 1B50A 1HXYD 4UDUC 4B9WA 2XIWA 3G71A 4LF9Q 4HAEA 1AE3A 4KHVA 1F9PA 1SYDA 2G5DA 2K75A 4LWCA 1J9OA 1I50B 4ME3A 4F87A 1IBLQ 4YY3L 2HT1A 3HOWG 2WIIB 3KBXA 3OWFA 5FJ8H 1KD1C 4A3CG 4LFBL 3SE0A 1ML0D 4FP5D 2O2LD 2CCZA 4DR1Q 1VQFA 4DUYL 3BDLA 4C2MB 3E5SA 1F2ZA 4YHHQ 4LFCL 5IGCA 2PI2A 2IX0A 1NBWA 5JJKA 1IL2A 1L0WA 4DK1A 5CC4A 1Z6HA 2EJFC 4QL5A 4A3MH 2AUKA 4C1NK 5C44H 3HOYG 2FJ2A 1Q1BA 5IGGA 4LUVA 2SNMA 1QUQB 1YEZA 1I4HA 2VB2X 3C1EA 1TWHH 3C46A 3VR5A 3I8ZA 1PA6A 4LF8Q 4HJ5A 1QB5D 4GZYC 1QILA 5JPMC 3T56B 5IYBG 4A3FB 4EQ5A 3SVMA 1G291 4PG3A 1EIHA 1OXXK 2XGTA 1SE4A 2JXMB 3HOZB 3BVGA 3LWEA 4BBRG 3IFDA 5I9PA 4A76A 4IUQA 4A75A 1IKMA 1S40A 4IUTA 4XDXA 2KA7A 3DLLA 3PIPA 5NUCA 3TS2A 3M4QA 5EQ0A 1SNQA 3J80i 3I3CA 3V05A 5FO9B 3R2IA 4FVMA 1II3A 2VUMH 4A3EG 2ZJQA 2A68D 2P5ZX 4S3SA 3CAMA 3CW2C 4A3BB 4AYBB 1Y1VB 2I07B 4RWSC 2KEDA 1B9MA 1D1KA 1N32L 1LT6D 1LTAD 4QF4A 4XYQA 4JI5Q 5IYDG 1S5DD 1LTBD 1EIYB 3GTQH 2ZXOA 1L0XB 2X69A 4K0KL 2L55A 2R93H 3QWNA 3S2DB 3N6RA 4C1NI 3K59A 4UPAA 3KLRA 1I3QB 1N33Q 1PV4A 4A3GH 3K7UC 1X3QA 1EWHA 3G6EA 3KJPA 2K6AA 1BDOA 2MO0A 4OWWB 2AHOB 3UDIA 4C56C 1V1QA 3HEJA 1SYCA 2NN6H 3I4OA 1PTOD 2WACA 1X3PA 3CQZB 1KNEA 3CPWA 2CQOA 4JI2Q 4NPSA 5BN4A 2Q2IA 1R4PB 3NQTA 4IJLA 1HPCA 5FO8B 5CV5A 2ZM6Q 4PZ6A 1WTXA 1TWHB 1CKNA 5HY6A 2CFMA 4OHJA 3S16B 1AFPA 2Q2HA 4HIKA 4Q0FA 2ZXRA 1Q86C 4JI0Q 5DM63 2F0EA 3RN2A 2UU9Q 4JI6Q 1RDPD 3VDYA 3S1RB 4IN3A 2YYZA 1D5MC 1TY0A 2V1CC 3FMCA 2PYKA 2A6EC 1EFID 1TY2A 1AW7A 5AJ3L 2NVYB 3D6WA 1C9OA 4OGQC 2QEXA 1PH8A 1ZXTA 3F2DA 1OTCA 2ICEC 4G7HC 3OYYA 3E9IA 1A3UA 3GD7A 1SE3A 2PPBC 3CCSA 5LMNL 3OW7A 2K50A 3KF6B 3I4NG 1TT2A 5IY0A 5C4HA 1Z9FA 1SMXA 4PMWA 4OONA 4DK3C 3T1YQ 4CKEA 5IT9L 4CGYB 2FMMA 5C3EB 3I4MH 2M2LA 4JV5L 3HOVB 1H9MA 1EU3A 4M1UB 1Q3LA 3NPPA 2UUBQ 1NE3A 2A1AA 4A3LH 3TMEA 2NZ1D 4B3SQ 3P20A 1TWCH 3LWUA 2EPBA 4DV2Q 4QCLA 3M4OH 5I4DA 3V96A 4KHPQ 2OEOA 5LHY1 5D3DA 1EUJA 2IX3A 1KLGD 1XYIA 4DR3L 2HCIA 1G8ZD 1HTPA 3EA6A 2WAQB 3SDZA 2BH2A 1JWMD 1ENAA 3HKSA 5C4XG 2I46A 5C3EG 1Y8NB 3UDXA 3CMEA 3SEBA 2JA5G 4ZUJA 3K7AH 3U9OA 2ZT9C 1Q46A 1PRTB 4ODGA 2KCNA 2PNRC 3HOXH 4BXXG 4RAUC 3TBIB 3EFXD 1K0SA 4X3SA 3AFQA 2DJGC 1A6XA 3F8TA 3CCQA 3E3XA 2R7ZB 2KHJA 1NY4A 4KKTA 4DV7L 3QIAA 3U50C 1B53A 2HHHQ 1B9NA 3ER0A 2QEJC 2YTXA 3PO2G 1HUNA 2UXDL 2PCFB 1JCKB 4XIGS 4CJ2C 5C5LA 1RIPA 4A3KB 2QA4A 5C0XG 1AZQA 4KV6A 3HFZB 1E0BA 1GHJA 3CKIB 1VQOA 1HNWL 3QR8A 3RZDB 2CVRA 4LAAA 2CWAA 3VYSA 1DYQA 1L0YB 3CRKC 2XRSD 3SK5A 3FKIB 5I9OA 3J7A5 5CORA 3S1NH 2PQEA 4DAPA 4JYAQ 2O5JC 4ZQ3A 3W3AA 2HCCA 2OWOA 5CMDA 1DZ1A 1PYBA 1BBUA 1EEFD 4CBVA 2L9HA 2RDGA 4OEMB 2Y0SB 4KMUC 4ZK9B 4P75A 5EKIA 4IURA 3RZOB 2EZVA 4LUOA 1KTKA 2JN4A 3KDFB 3J7AV 1EOTA 1A2UA 4CJ1B 1SE2A 1C8CA 3UDFA 4K5WA 4LF9L 5E1FA 3T1HQ 2A68C 1G6PA 3M4OB 1YNJD 1STHA 3FKIG 4F8MA 1IBLL 1DJRD 1M8AA 1VMCA 2E2DC 3I56A 1YJWA 2RQXA 5IT9E 3GV3A 3EIVA 4GLXA 1LTTD 2L12A 5E4WC 5EBCA 4DR1L 2F0UA 5ELFA 2F0JA 2L5TA 4UAIA 3Q22A 4YHHL 4F88A 1TS3A 2EYMA 4K14A 3HKZB 3PO3H 5DAUA 1J6QA 4CKBA 4A3DG 1QVGA 1SDFA 2GA4B 2IW3A 3HOXB 1A3VA 1JWUD 1BCPB 5FLXE 2ICIA 4FNFA 1VS0A 1GUOA 4BA2I 2B39A 3BYYB 2RVLA 1LT3D 3OSOA 4PMBA 4EVOA 2PI2E 4N9TA 3PUYA 3GDEA 2VQEQ 2OT2A 1S4ZA 5C4JH 2EE1A 1SN8A 5FLXc 4LF8L 1TIID 4HCEA 2K1BA 1LTGD 2PZWA 4Q5VA 3EROA 1K28A 3A0JA 4UHVA 3L2PA 1A63A 5IP7H 2RCFA 1DXMA 1WTOA 3TP5A 1PTOH 2Q8TA 4QGUA 3M9BA 1SYEA 3TP8A 4FF1A 4CDDC 1X32A 2MP1A 3D4WA 3WOFA 5A2QE 1OXVA 1XPRA 2FINB 3T16A 3RN5A 1SMYD 1PZKD 2N8NA 2RBMA 4C3HG 4AIMA 2NVQB 1RD9D 1GUSA 4NB3A 2JA8B 1BO0A 1M4VA 2Q2TA 1IYUA 1I4GA 4XYOA 3S1NB 4NMZA 1GO3E 4TVAB 5FOBB 1PHJA 4GKKQ 3HZXA 4EX5A 2B63H 5CV8A 1QZGA 5IYCH 2XN9C 3CCMA 1VQPA 1KDBA 1I6HH 1O78A 1PFNA 5G3LD 2L15A 4JI5L 4Y7NH 3W2DA 4WJWA 3E6ZX 1HZBA 1FNVA 1LTSD 5IGFA 4K6DA 3NP8A 1CTMA 2EY1A 1CA5A 3PF4A 2JA8G 3VYTA 4P2CB 3W5OA 1AEXA 5FK9C 4P71A 2BOSA 2KJXA 2EY5A 4YCUA 4GOPA 3G6JB 4O2DA 3M7GA 2BE5D 1WTPA 3C1FA 4C3IH 1I4RA 4OWXB 3S2HH 2I5MX 3NBHB 2ZTDA 4N8FA 1L2FA 1NAPA 3J81E 1DCZA 1OXSC 1SNPA 1Z7TA 1X9NA 1XNQL 3TRZA 4TRDA 1MJEA 4A93G 3T51B 1O7ZA 5ELOA 4JCVE 4EGVA 4JI2L 3F2CA 1HCZA 3S1MB 4XTCS 2D9UA 1XXGA 2PQAB 4H02A 2QCPX 1GUTA 1PRTD 4A3IB 1Y69U 2EYJA 2B8FA 1I50H 2MO1A 4IOCA 1IKLA 3S15H 4MNOA 1RKNA 2E5LQ 1EY5A 1O7IA 5JAVA 4JI0L 3C2PA 4IPGA 4BY7G 2UU9L 4JI6L 1S5ED 3UE1A 1STGA 3NTKA 4DGZA 4QJFA 4XQQA 4C2MH 5IYBH 1ASYA 2YU9H 2A5HA 1R4QB 3O13A 2F0MA 1STEA 1O80A 3GO5A 4OX9Q 4P74A 3Q24A 3SK8A 1G2SA 3MWYW 1VQIA 2DNCA 4JC0A 3UDGA 1B44D 1WI5A 4QUCA 4K8IA 1CA6A 3WWVA 2F0PA 3NWSA 3W1BA 3QOJA 4L6TB 2ZJRA 3RMHA 3T1YL 5JEAH 1VQ9A 1VCIA 4X6AH 2JA7B 1CQFA 1RCVD 1KAWA 3HG9A 5IE8A 1JQYD 2R3ZA 2UUBL 4HSVA 4B3SL 3KLSX 1IZ6A 1ENCA 4RGNA 5ELBA 1YBYA 3HOZH 4DV2L 1EL0A 1E1TA 1BF4A 4KHPL 1FVIA 3TZUA 1U9RA 2K5VA 1WTQA 2DGYA 1CT1D 1V1OA 3VR3A 3S14B 4QMGA 1Q82C 3RR5A 5M5YH 5C6AA 4B3RQ 1X3FA 3SXHA 4JI3Q 3HOWB 2Z9HA 1ICFB 2SNSA 3DMUA 5GROA 5FLMG 4LF7Q 3MXGA 5I6WA 5IWAQ 4LF6Q 1QZHA 4DAYA 1TWAH 1LACA 2BDOA 1HTLD 1TU2B 5IODA 4A3BH 1Y1VH 2ALYB 1UE6A 2B8GA 3DEOA 4GNXC 2NUCA 2HHHL 2DY7A 1TKWB 2GVAA 3FPUB 3DHQA 5E7NA 5CR3A 4R8IA 1EWCA 4ILWA 1KDAA 3U4VA 1KRTA 5C3WA 5M9OA 1HNXQ 1BCPD 1V1PB 3HOYB 2LMCB 3S15B 2VS1A 2H1EA 4HJ8A 4DK6C 1WVLA 2O5IC 3DWPA 3S2DH 2OQ0A 3STBD 1SSOA 4DR4Q 5D14A 3LX0A 5IOCA 1DOMA 5C4ZA 1I3QH 2PZTA 2YU9B 1NJIC 3HGBA 3GTJH 1P16A 4YIJA 1N36L 2PNHA 2LXJA 2LS01 1WTWA 4ABNA 1NSNS 2B2TC 3BVZA 4OXPA 4BBRB 4JK1C 1VQ5A 2JA6G 3CQZH 2A69D 4JYAL 4KN4C 1E1OA 3OMGA 2EVBA 2KQ3A 4DUZQ 4PNYA 5DEHA 3I4NH 1SFOB 1I94L 1TVXA 1EZ6A 3D31A 1BKBA 3NXWA 2UXCQ 3E0JA 4DA2A 1S5FD 4A3EB 3S16H 3K6OA 1STYA 5EAYA 3ULPA 1CSQA 3A55A 2KCCA 4H13C 3S1RH 2EIFA 3T1HL 1NR4A 1T5XD 2PW7A 3AU7A 3NUCA 4GNXA 5M3MG 1JT8A 4WJ3M 2NVYH 1A3TA 1EYCA 2XWJB 1CHQD 2ID0A 4BA1I 2L11A 1K8GA 1CZWA 1ESFA 2WFWA 3BS1A 4B08A 2KHSA 4BY1G 2HIVA 5M5YB 2ATWA 1UAPA 3H0GB 4I65A 2D2CC 5J3BA 4H0LC 5JPNC 1T9HA 4CHTB 1ZKOA 5C3EH 3VR6A 1I4XA 3TP7A 1TWAB 3HOVH 4DK0A 1SYBA 2CW0D 2B2TA 2K5NA 4P73A 4HJ9A 2JA9A 5EPLA 2VQEL 1GXDC 1LTID 5HGTA 4KY5A 4C3JG 1HHVA 2F0SA 5DNFA 1D5ZC 4XQNA 1XMOQ 3PCOB 2VQFQ 4A3JG 4BWGB 3KF8A 4N8X1 4NXNQ 2OTLA 3H0GG 4DR2Q 1V8QA 3CCEA 3MXNA 1BQQT 1ZYRD 1SNCA 2F52A 2Z0SA 4J1MA 3A5UA 5D65A 1A62A 5D3IB 1EQQA 1QVFA 3PO2H 2GN5A 3MAQA 4DV5Q 1XNRQ 3GP7A 1HFNA 3MFGA 2RSOA 1C0AA 2FMCA 4L5TA 5M3FG 2HQLA 3GTJB 1JICA 1HUMA 3FVQA 2OXPA 1RF2D 2QDLA 1GHKA 3K5LA 2R7ZH 2B2UC 1EQTA 4X65Q 1E3PA 3U4ZA 3MC0B 4GKKL 4R1JA 1AH9A 2CH4W 3I4NB 2ZTEA 5KNDA 1PH1A 2O4XA 3E0EA 1YHQA 2KUMA 1G6ZA 1EWIA 4QIWE 1LO5D 3RNUA 4A3KH 1SNMA 1PH9A 1DOKA 1NMFA 2BH8A 3AQQA 4OELB 2UUAQ 2NB0A 2F0LA 4JBJA 4DV6Q 3MEFA 5LL6S 4DXFA 2E2IH 2RF4A 3PIOA 4OO1I 2Z8LA 2D5DA 1XWEA 1SE8A 2RCNA 3RZDH 5J1ZA 3S17B 1N8RC 2F0WA 1VF5C 5E3FA 1M1KC 5ELEA 3FKIH 2HIXA 4YWMA 2R92B 4ZYSA 3G7LA 4ID6A 4HCSA 2L1BA 1HQMC 2FXQA 3OMCA 2D0OA 1V9PA 2JQOA 3H91A 2F0IA 3KLWA 5C4XB 3I4LA 1JB7A 1FGBD 2C5CA 2JA5B 2F0FA 4NW2A 3M7NA 1D8LA 3RZOH 5K36H 3ND9A 5JOBA 4A3MG 2JP1A 4HSPA 4A3DH 4KY7A 4TKOB 5LL6X 2KOLA 2B2UA 4IFDJ 3BDOA 1BVSA 1YNND 2F0KA 2E8GA 3CCUA 5KEEA 1PH4A 2R6GA 4JW0A 3G4SA 1CUKA 1W3SA 2R92G 1XPOA 5FLXL 3HOUB 5BN3A 5L37A 1GJXA 5A35A 2E5LL 3RLNA 1I4QA 3NTIA 1CKNB 1E7ZA 1Y8OB 5BR8Q 5CGKA 3CC7A 3PO2B 2I0QA 4DR7Q 2OF1A 1MBYA 3MFYA 1JOOA 1BXTA 3L0OA 5T1GA 2AQ1B 3X3NA 2K5QA 4OX9L 1TR5A 4UP7A 1VQDA 3SR1A 3OTOQ 1IBKQ 5KYLA 4X3KA 3RLFA 1W6KA 3STBC 1H95A 4JI1Q 5CV9A 5IP9G 4B3MQ 4KK7A 1JB3A 1VF7A 3BZKA 5A2QL 3HOUG 4IPDA 3VA5A 3FHWA 1MHWC 3GTMB 4H7BA 4RHSA 2E2JH 3IAYA 3ZJYC 1PXUA 1K73C 4FF3A 1VQBA 1F2LA 5JEAJ 1XMQQ 2MHVA 1K83B 1HFGA 3AEVA 2ZTCA 4ULLA 1Q81C 1IW7D 2F4VQ 2E2IB 2K52A 4DN4M 3PGZA 3H6MA 5C3XA 5KNCA 4DF7A 4L5QA 1J5EQ 3OHXC 4IJHA 1V43A 4DV1Q 4O42A 2NVQH 2C9OA 4KY6A 2B2VC 1ESRA 1MGSA 4B3RL 2CH4A 4AQYQ 2JA8H 1F9SA 4JI3L 1U0LA 3ERSX 3I70A 2VL6A 2Q8IB 2KBNA 2KCTA 1U4PA 2K05A 1YHAA 4LF7L 4A3GG 1WD1A 5IWAL 4LF6L 4FF2A 3K57A 2UUCQ 4B9XA 2CKZB 4L63B 1SRUA 1RTOA 2EYHA 3KBGA 2IJ0A 4RKLA 1PTOF 2NN6G 2HDLA 2MUYA 4LJZC 5LMUQ 1BOSA 4A3DB 2OQKA 3PUZA 3PQIA 3X3MA 3J81L 5CBEE 4ZRZA 4E6IA 1HNXL 3I55A 3P75A 2ENBA 1F77A 1A2TA 4TSSA 1N34Q 1K8OA 2EQSA 3OW2A 2DY8A 2H4OA 1ILPA 1RTNA 4OL7A 3M3YB 4IUPA 5EKKA 4DR4L 3GV6A 4JI4Q 2JEAI 2DNEA 1FNWA 4DV0Q 4JI8Q 1U4MA 3GTLB 2R61A 3J7AF 4BY7H 2IY5B 1KRSA 3C3LA 4RGMA 1ZEQX 4KD4A 1KXLA 3K5MA 3H09A 3A54A 2XTIA 1UNSA 3JAMc 2DN8A 3Q0AA 4NP5A 4LF4Q 1SNDA 3CF5A 1PZID 3S1MH 4C3HB 2DJFC 1X54A 2B2VA 5J22A 4OIKA 4DUZL 4A3IH 4DR5Q 3I4MG 3EQLC 2E2JB 3HRZC 4HTHA 2UXCL 4GOPC 1ENFA 1PTOC 4J15A 2NZOA 2RA4A 2AKWB 4Y52H 1B3QA 2MPMA 3S1QB 2F0NA 4FF4A 4RHRA 1VQ7A 5CV4A 4R4IA 4KI0A 1HRJA 1MKHA 4GN3B 3A8KE 4R4QA 5I2YA 4AYBE 4PMCA 1CZGA 2PMZE 5ELNA 2G9DA 3FDTA 1F2MA 1K8MA 2K4KA 1EYGA 4LNQA 1JJGA 4DR6Q 1G91A 4OO1H 3I91A 4RG1A 1KLUD 2K03A 3A8IE 4IUUA 3CHBD 1EFWA 4JG2A 3J7YW 4QY7A 4LFAQ 2JA7H 3J7ZC 1WYDA 4JI7Q 1KDCA 1IHZA 1VQJA 2CWPA 4ZAIA 1L1OC 4LMQD 5K5PA 2IL8A 1TS5A 4DPGA 4HMIA 1IBMQ 3CCVA 1Z47A 3F1ZA 2WKDA 2PQAA 2LXKA 4J8QA 4B3TQ 2AUJD 4ZUIA 5GADC 4A93B 2NVXB 1WJJA 1XMOL 4CDCC 4NXMQ 1TQOA 2VQFL 4X66Q 2WB1E 4NXNL 2PW5A 2QW7A 2EXZA 4DR2L 4HIOA 4UY8C 3S14H 4ZKBB 2RKSA 2VXWA 5IGEA 3LGJA 2Z4HA 2YTVA 3K0YA 4YWLA 3H3VC 2Z4IA 3HOWH 2R7FA 4DV5L 1XNRL 4A3CH 1PFMA 3I72A 1PLFA 3Q8DA 4BY7B 1N33L 1SEBD 4J6HA 4FXGC 1IYJB 1VQGA 2VW9A 1VQEA 5HURA 3H15A 4R4CA 3ULLA 1H9SA 2WINB 1K3RA 3A7LA 2BA1A 2AWNA 1CI3M 2JA6H 1KHIA 1H9KA 2ZM6L 1PDQA 1PVOA 1Y1WG 1D6EC 1KABA 3HOYH 1FNUA 4MIUA 1WTVA 1F2YA 3QO2A 1CM9A 5C0XI 1IL8A 5JVH3 2UUAL 1L1OA 3R8BA 4PZ7A 2N3SA 4DV6L 3SK4A 3PUXA 3GTKB 1EOVA 1AN8A 1HZCA 1CQVA 3ONAB 1FL0A 2K04A 4BBRH 2M00A 2N88A 4AH6A 3EJIA 1MD2D 3UE0A 1FJGQ 3UI2A 3PO3G 1PZJD 3EVQA 4GOPB 1H9RA 1GUGA 1KC8C 2AQ2B 1SFOH 2F0QA 2RHQB 2WAQE 3SGIA 3T4AC 4IQZA 1YI2A 2FHTA 2GVBA 4A3EH 2F0VA 2CQAA 3J80E 2F0OA 3T13A 4RMFA 1GD7A 3A7AB 1P8LA 3G48A 3KLSA 1YNXA 1MIUA 3U58A 5CBAE 4K5XA 4DV7Q 2K7VA 2KENA 3S9WA 2EOTA 2JK8A 2E2HB 3J80c 1V1PA 2K28A 5IYDH 1LT5D 2RDHA 2MJ8A 4DFAA 5KRUA 1QWYA 3WDNA 2WV6D 4WRDA 2E74C 4N9PA 5M5WB 1STBA 5IP7G 3NE5B 5BR8L 4A3JH 1BUVT 3DM1A 3I90A 3VYRA 4QUFA 3H0GH 2LFNA 2L0CA 3ITPA 1WFQA 4APVA 3OWEB 1E24A 1YNJC 3OTOL 1IBKL 4BBSG 1HNZQ 4TQUS 2MQHA 1PH5A 2L4NA 1EY4A 4RGOS 2MNAA 1J8IA 3TDQA 3VR2A 2V4DA 1ET9A 4CDEC 4JI1L 3RUZA 4CJ0B 1YHBA 4KJOA 4HIMA 1WCMG 2OCEA 4B3ML 1N9WA 1EEID 2H5XA 4EQPA 1LM0A
chains in the Genus database with same CATH topology
1GVPA 3HFZB 2AMCB 3GTGH 2B63G 1CKOA 1QUQA 3IRBA 2KCMA 2R7ZH 1VQOA 1W2BA 2UXBL 1SLJA 2RHSB 1HR0L 1HNWL 4X65Q 2IT1A 5LMNW 2QGQA 1E3PA 1WOCA 3U4ZA 2CWAA 2VZAA 1XMQL 4GKKL 1OXUA 4JOIA 4DV3L 4R1JA 1AH9A 3FP9A 1X3EA 3J7A5 1E22A 2ZTEA 4YCWA 2VNUD 1AE2A 1PH1A 4O0AA 1YITA 3AFPA 3S1NH 5AJ3Q 4JYAQ 3E0EA 4JBWA 1GKHA 1YHQA 1VQMA 5C0XJ 4X65L 1EWIA 2Y0SE 4QIWE 1OXTA 2OWOA 1J5EL 2JE6I 3RNUA 4A3KH 1PYBA 1BBUA 1PH9A 1VQAA 1NMFA 2BH8A 2YV5A 3AQQA 3PUVA 5GQOA 4DV1L 1VQ4A 5LMNQ 2UUAQ 4DKAC 4JBJA 4DV6Q 3MEFA 3TQYA 3J81i 2RF4A 4P75A 2E2IH 4L5SA 3PIOA 4AQYL 4DAMA 1XPUA 2NVTH 4OO1I 3H3VH 4LUOA 2Q2UA 3BU2A 1SE8A 2RCNA 3RZDH 3KDFB 3DM3A 1N8RC 2OTJA 2K5HA 1HH2P 1PH7A 1Q1EA 3JC66 3TEHB 4P72A 3UDFA 1M1KC 4LF9L 4JV5Q 4QQBX 3FKIH 3EN2A 1SROA 2HIXA 4YWMA 3T1HQ 2UUCL 4LF5Q 2I5HA 1G6PA 1B70B 4KHZA 4IFDG 3FKIG 1IBLL 2FXQA 1D7QA 1X6OA 3I56A 2D0OA 4DAYB 1V9PA 2JQOA 1YJWA 3EIVA 3JAMi 3J81c 3KLWA 5LMUL 4GLXA 2B29A 2JJQA 1JB7A 3HKZE 3NENA 4DR1L 1XTDA 5M3MH 3M7NA 1D8LA 3CD6A 3RZOH 4DR3Q 4YHHL 4FDBA 3PO3H 4A3MG 3CCLA 4A3DH 1N34L 3S17H 3M85A 2B3GA 2K14A 1J6QA 3PSIA 5M5XH 1S72A 1VQKA 2N78A 1QVGA 4A3DG 4IFDJ 4BY1H 1BVSA 1C7YA 3TREA 2E8GA 3CCUA 2R92H 1PH4A 2R6GA 2NN6I 3RLOA 3KYHC 4JI4L 3G4SA 1CUKA 1VS0A 1W3SA 1KIXA 2R92G 4BA2I 1XPOA 4DV0L 4JI8L 3A74A 1I5FA 2E5LL 3RLNA 2PI2E 5C4XH 3PUYA 1QVCA 1PFSA 3GDEA 2VQEQ 1CKNB 1E7ZA 1PYSB 5BR8Q 1TXYA 5C4JH 2IHFA 4GN4B 1SN8A 1X56A 1CKMA 3BJUA 5FLXc 3CC7A 1YJNA 4A3IG 2JA5H 1NMGA 4LF8L 4GKJL 2I0QA 4DR7Q 2N49A 1DGSA 1VQHA 4LF4L 3A0JA 3L0OA 4UP9A 4OX9L 3L2PA 1UE7A 4BXXH 2D0PA 1A63A 4DV4Q 4UP7A 4YCVA 1VQDA 5IP7H 3OTOQ 1HR0W 1VQNA 4C3JH 5JEAG 1IBKQ 3D0FA 4X64Q 4X62L 1VQLA 3S24A 1JJ2A 4QGUA 3W1GA 1EIFA 3M9BA 3CCRA 3RLFA 4PZ8A 4DR5L 3CXCA 3AYHB 3STBC 5IP9H 2UXDQ 1H95A 4JI1Q 3I2ZA 4DR7L 1VQ8A 4A3FH 3HOUH 1OXVA 1XPRA 1MJCA 3RN5A 3B6YA 5IP9G 4B3MQ 2N8NA 1L1OB 3NELA 3BZKA 4A3FG 3HOUG 4IPDA 4AIMA 3FHWA 2E2JH 2UXBQ 3ZJYC 3HOZG 4NB3A 1HR0Q 1K73C 1HNWQ 1K0RA 2Q2TA 5M3FH 1VQBA 1GO3E 1RL2A 1TWGH 5JEAJ 1NTGA 4OO1G 1UE1A 4TVAB 2IX1A 1PHJA 1XMQQ 4GKKQ 2IHEA 4DV3Q 4IPHA 2YTYA 4OWTB 4EX5A 3AEVA 4GNXB 2ZTCA 2B63H 1A0IA 2LSSA 1Q81C 3BZCA 1QZGA 5IYCH 2JA7G 2F3IA 3E9HA 4LW1A 3CCMA 1VQPA 1PH3A 2F4VQ 4DR6L 2EXDA 2K52A 1I6HH 3PGZA 5IYCG 2L15A 3KF6A 3K81C 4L5QA 4JI5L 1R9TH 1J5EQ 4BBSG 4IJHA 1V43A 4DV1Q 1X3GA 4Y7NH 2NVQH 1HZBA 3GTMH 4L5RC 1PH6A 5DLQE 2ES2A 1UEBA 4LFAL 4B3RL 4JI7L 3KJOA 4AQYQ 4AYBG 2JA8H 1EQRA 1Y1VG 4JI3L 4A3BG 1U0LA 3ERSX 2DUDA 2VL6A 2F4VL 3PF4A 2KBNA 2JA8G 2KCTA 1Q12A 3GTOH 1IBML 1YHAA 4LF7L 2A19A 3W5OA 4A3GG 1K83H 5IWAL 4LF6L 4LF9Q 3G71A 4P71A 2UUCQ 1XNQQ 1AE3A 2CKZB 4YCUA 5GAHC 4GOPA 2K75A 1SRUA 4B3TL 1UE5A 4LWCA 1A8VA 4O2DA 1ASZA 3A5ZB 4ME3A 1IBLQ 4YY3L 2NN6G 4NXML 2HT1A 3HOWG 4X66L 1Q7YC 4C3IH 5FJ8H 1KD1C 4OWXB 3S2HH 2I5MX 3NBHB 2ZTDA 4IPCA 5LMUQ 4A3CG 4LFBL 1L2FA 2OQKA 2KHIA 5FJ8G 3PUZA 4DR1Q 2CCZA 1OXSC 1VQFA 4KLKA 3KF8B 4DUYL 2JEBI 1X9NA 1XNQL 3TRZA 1MJEA 4A93G 4ALPA 1TWFH 4YHHQ 3MXNB 4LFCL 5ELOA 1HNXL 4JCVE 4JI2L 2PI2A 3I55A 3F2CA 4XTCS 1N34Q 2EQSA 3OW2A 4JBKA 2PQAB 2IX0A 1NBWA 4H02A 3ICEA 5JJKA 3EBEA 1IL2A 1L0WA 5JJIA 4DR4L 2WB1G 4QL5A 4JI4Q 2JEAI 1I50H 2MO1A 4IOCA 4A3MH 3S15H 5C44H 4DV0Q 3F2BA 4JI8Q 4MNOA 3HOYG 2E5LQ 3CC4A 1Q1BA 1O7IA 4BY7H 2IY5B 5C44G 1KRSA 3J81j 4LUVA 4JI0L 1QUQB 1YEZA 4IPGA 4BY7G 2UU9L 4JI6L 3UE1A 1KXLA 1TWHH 2MFIA 1YVCA 1PA6A 4LF8Q 4GKJQ 4QJFA 4HJ5A 4C2MH 2XTIA 3JAMc 5IYBH 1ASYA 2YU9H 4LF4Q 3CF5A 3GO5A 4OX9Q 4P74A 3S1MH 5IYBG 1Q8KA 4DNIA 4EQ5A 4IO9A 1G291 3ULJA 1X54A 1XJVA 1VQIA 4PG3A 4DUZL 1OXXK 2XGTA 3K0XA 4JC0A 4X62Q 4A3IH 3M3YH 3UDGA 1WI5A 4DR5Q 4BBRG 3I4MG 4A76A 1CSPA 2UXCL 1BBWA 4A75A 3WWVA 1PH2A 1S40A 3W1BA 3GTLH 3DLLA 4GOPC 3PIPA 2ZJRA 4J15A 2NZOA 3TS2A 2AKWB 3M4QA 3K80C 3NEMA 3T1YL 4Y52H 5GAGC 1UWVA 3J80i 1VQ7A 1VQ9A 4R4IA 1VCIA 4X6AH 4JBMA 4KI0A 1HJPA 1MKHA 1KAWA 4GN3B 3PF5A 3H3VI 5IE8A 1FJGL 4R4QA 2UUBL 2VUMH 4AYBE 4A3EG 2ZJQA 4YWKA 2R7DA 4HJ7A 1SR3A 4C3HH 1U5KA 4B3SL 4WJ4A 1IZ6A 2VUMG 1FGUA 2PMZE 5ELNA 2WP8J 4IFDI 1YBYA 3HOZH 3CAMA 4DV2L 1E1TA 2K4KA 3CW2C 1EYGA 4LNQA 4KHPL 1JJGA 5H1SE 1FVIA 3HOVG 4DR6Q 1N32L 2K5VA 4GLVB 5HGQA 2DGYA 1Y14B 3CP0A 4RG1A 4JI5Q 1VQ6A 1JJCB 5IYDG 1EIYB 3S1QH 1Q82C 3RR5A 3KDFA 3GTQH 5M5YH 2ZJPA 1EFWA 4JG2A 4QY7A 4LFAQ 1LUZA 1YIJA 3J7ZC 2JA7H 4B3RQ 1WYDA 4JI7Q 1X3FA 4JI3Q 1VQJA 2CWPA 1B8AA 1L1OC 1LTLA 4GLAC 4DPGA 1IBMQ 5GROA 5FLMG 4LF7Q 3CCVA 4K0KL 2WAQG 1Z47A 5IWAQ 4LF6Q 3F1ZA 1QZHA 2PQAA 2LXKA 1TWAH 4B3TQ 2R7ZG 2R93H 2Z6KC 5GADC 4A3BH 1Y1VH 1WJJA 2ALYB 1UE6A 1HZ9A 4YY3Q 1XMOL 4NXMQ 2R93G 2VQFL 4UPAA 2A8VA 4X66Q 2WB1E 4NXNL 4GNXC 1N33Q 1PV4A 4LFBQ 3M4PA 4DR2L 4A3GH 4HIOA 3PO2H 2HHHL 4UY8C 3K7UC 3S14H 3G6EA 3KJPA 2GVAA 2MO0A 1K8AC 5E7NA 4OWWB 4DUYQ 2AHOB 1YJ9A 3UDIA 3LGJA 3U4VA 1V1QA 1HNZL 2YTVA 1IXRA 1KRTA 4YWLA 3I4OA 3PV0A 3CPWA 4LFCQ 3HOWH 1HZAA 1HNXQ 2CQOA 2R7FA 4JI2Q 4NPSA 4DV5L 1N36Q 4POGA 1XNRL 4A3CH 2Q2IA 2VS1A 2I5LX 3Q8DA 4IJLA 1N33L 4HJ8A 2ZM6Q 4DK6C 4PZ6A 1IYJB 1VQGA 2VW9A 3S2DH 4LUZA 2OQ0A 3STBD 4DR4Q 4A93H 1VQEA 2NVXH 3H15A 4R4CA 1CKNA 3ULLA 5HY6A 1S3OA 2CFMA 1I3QH 4UP8A 2Q2HA 4HIKA 1NJIC 2NZHA 3GTJH 1P16A 1N36L 4JI0Q 1Q86C 1K3RA 2LXJA 2PNHA 1I94Q 2BA1A 2AWNA 3RN2A 2UU9Q 4JI6Q 2JA6H 1KHIA 3VDYA 2C35B 4OXPA 4A3KG 1Y1WH 2YYZA 2ZM6L 1VQ5A 2V1CC 1PVOA 2JA6G 2AWOA 3CQZH 1Y1WG 4MTNA 5AJ3L 4JYAL 1M90C 3HOYH 1E1OA 1G51A 1C9OA 5C0XI 2QEXA 1K9MC 1PH8A 3F2DA 1OTCA 4DUZQ 4HIDA 3I4NH 3OYYA 3E9IA 1I94L 3GD7A 2UUAL 1L1OA 3CCSA 3D31A 1BKBA 5LMNL 2K50A 1VQCA 4PZ7A 2N3SA 4A4IA 3KF6B 4DV6L 3I4NG 2UXCQ 3CCJA 2VY3A 3PUXA 5IY0A 1EOVA 1Z9FA 3S16H 5EAYA 3ULPA 1SMXA 4PMWA 1CSQA 1HZCA 3L7ZC 4OONA 4DK3C 3T1YQ 2Z6KA 1FL0A 1B7YB 4GS3A 2EIFA 3S1RH 3I4MH 4BBRH 4JV5L 3T1HL 4LF5L 4AH6A 1JT8A 4GNXA 3PUWA 5M3MG 5IT9c 2Y0SG 3UE0A 1FJGQ 2ASBA 4WJ3M 2NVYH 3KOJA 1NE3A 2UUBQ 5K36G 2A1AA 4A3LH 1X55A 3PO3G 2ID0A 4BA1I 3CMAA 4GOPB 1JMCA 4B3SQ 1K8GA 4A3LG 1TWCH 2WFWA 1KC8C 1GM5A 2BA0A 3K8AA 4GN5A 1SFOH 2RHQB 3SGIA 2WAQE 4DV2Q 4JOIC 2HIVA 4BY1G 3M4OH 2ATWA 4KHPQ 1KL9A 1YI2A 1N32Q 2GVBA 1EUJA 5J3BA 3CC2A 4DR3L 3GTKH 4A3EH 1T9HA 2BH2A 4IOAA 4RMFA 5C3EH 1GD7A 3HKSA 5C4XG 4R4OA 3GTPH 1P8LA 1JE5A 3KFUA 3G48A 5C3EG 3UDXA 1YNXA 1LYLA 1MIUA 3CMEA 3U58A 2JA5G 3HOVH 4DV7Q 3K7AH 2KENA 1KQSA 2JK8A 1Q46A 3J80c 3TS0A 2K5NA 5IYDH 3HKZG 4K0KQ 4P73A 4HJ9A 4BXXG 3HOXH 2JA9A 3CPFA 1QVFA 4MZ9A 2VQEL 5IP7G 3AFQA 5BR8L 4A3JH 1X65A 3F8TA 3CCQA 5JJLA 3HOXG 2D62A 1XMOQ 3H0GH 3PCOB 2KHJA 2VQFQ 4A3JG 4NXNQ 1WFQA 1NY4A 4APVA 3H0GG 5FLMH 4DV7L 4DR2Q 2OTLA 3U50C 3CCEA 1E24A 2HHHQ 4BBSH 3ER0A 4DV4L 1YZ6A 2F52A 2Z0SA 3OTOL 3A5UA 4HJAA 1A62A 4POFA 5GAEC 1EQQA 4TQUS 2MQHA 4X64L 1IBKL 1HNZQ 2GN5A 4R4TA 1PH5A 2YTXA 3PO2G 2MNAA 4DV5Q 1XNRQ 2UXDL 1WCMH 4JI1L 4XIGS 2E2HH 1C0AA 3I7FA 1RIPA 2HQLA 4L5TA 5M3FG 1YHBA 4HIMA 1WCMG 2OCEA 4B3ML 1N9WA 2H5XA 5M5WH 2QA4A 5C0XG 1LM0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GVP A;  3HFZ B;  2AMC B;  3GTG H;  2B63 G;  1CKO A;  1QUQ A;  3IRB A;  2KCM A;  2R7Z H;  1VQO A;  1W2B A;  2UXB L;  1SLJ A;  2RHS B;  1HR0 L;  1HNW L;  4X65 Q;  2IT1 A;  5LMN W;  2QGQ A;  1E3P A;  1WOC A;  3U4Z A;  2CWA A;  2VZA A;  1XMQ L;  4GKK L;  1OXU A;  4JOI A;  4DV3 L;  4R1J A;  1AH9 A;  3FP9 A;  1X3E A;  3J7A 5;  1E22 A;  2ZTE A;  4YCW A;  2VNU D;  1AE2 A;  1PH1 A;  4O0A A;  1YIT A;  3AFP A;  3S1N H;  5AJ3 Q;  4JYA Q;  3E0E A;  4JBW A;  1GKH A;  1YHQ A;  1VQM A;  5C0X J;  4X65 L;  1EWI A;  2Y0S E;  4QIW E;  1OXT A;  2OWO A;  1J5E L;  2JE6 I;  3RNU A;  4A3K H;  1PYB A;  1BBU A;  1PH9 A;  1VQA A;  1NMF A;  2BH8 A;  2YV5 A;  3AQQ A;  3PUV A;  5GQO A;  4DV1 L;  1VQ4 A;  5LMN Q;  2UUA Q;  4DKA C;  4JBJ A;  4DV6 Q;  3MEF A;  3TQY A;  3J81 i;  2RF4 A;  4P75 A;  2E2I H;  4L5S A;  3PIO A;  4AQY L;  4DAM A;  1XPU A;  2NVT H;  4OO1 I;  3H3V H;  4LUO A;  2Q2U A;  3BU2 A;  1SE8 A;  2RCN A;  3RZD H;  3KDF B;  3DM3 A;  1N8R C;  2OTJ A;  2K5H A;  1HH2 P;  1PH7 A;  1Q1E A;  3JC6 6;  3TEH B;  4P72 A;  3UDF A;  1M1K C;  4LF9 L;  4JV5 Q;  4QQB X;  3FKI H;  3EN2 A;  1SRO A;  2HIX A;  4YWM A;  3T1H Q;  2UUC L;  4LF5 Q;  2I5H A;  1G6P A;  1B70 B;  4KHZ A;  4IFD G;  3FKI G;  1IBL L;  2FXQ A;  1D7Q A;  1X6O A;  3I56 A;  2D0O A;  4DAY B;  1V9P A;  2JQO A;  1YJW A;  3EIV A;  3JAM i;  3J81 c;  3KLW A;  5LMU L;  4GLX A;  2B29 A;  2JJQ A;  1JB7 A;  3HKZ E;  3NEN A;  4DR1 L;  1XTD A;  5M3M H;  3M7N A;  1D8L A;  3CD6 A;  3RZO H;  4DR3 Q;  4YHH L;  4FDB A;  3PO3 H;  4A3M G;  3CCL A;  4A3D H;  1N34 L;  3S17 H;  3M85 A;  2B3G A;  2K14 A;  1J6Q A;  3PSI A;  5M5X H;  1S72 A;  1VQK A;  2N78 A;  1QVG A;  4A3D G;  4IFD J;  4BY1 H;  1BVS A;  1C7Y A;  3TRE A;  2E8G A;  3CCU A;  2R92 H;  1PH4 A;  2R6G A;  2NN6 I;  3RLO A;  3KYH C;  4JI4 L;  3G4S A;  1CUK A;  1VS0 A;  1W3S A;  1KIX A;  2R92 G;  4BA2 I;  1XPO A;  4DV0 L;  4JI8 L;  3A74 A;  1I5F A;  2E5L L;  3RLN A;  2PI2 E;  5C4X H;  3PUY A;  1QVC A;  1PFS A;  3GDE A;  2VQE Q;  1CKN B;  1E7Z A;  1PYS B;  5BR8 Q;  1TXY A;  5C4J H;  2IHF A;  4GN4 B;  1SN8 A;  1X56 A;  1CKM A;  3BJU A;  5FLX c;  3CC7 A;  1YJN A;  4A3I G;  2JA5 H;  1NMG A;  4LF8 L;  4GKJ L;  2I0Q A;  4DR7 Q;  2N49 A;  1DGS A;  1VQH A;  4LF4 L;  3A0J A;  3L0O A;  4UP9 A;  4OX9 L;  3L2P A;  1UE7 A;  4BXX H;  2D0P A;  1A63 A;  4DV4 Q;  4UP7 A;  4YCV A;  1VQD A;  5IP7 H;  3OTO Q;  1HR0 W;  1VQN A;  4C3J H;  5JEA G;  1IBK Q;  3D0F A;  4X64 Q;  4X62 L;  1VQL A;  3S24 A;  1JJ2 A;  4QGU A;  3W1G A;  1EIF A;  3M9B A;  3CCR A;  3RLF A;  4PZ8 A;  4DR5 L;  3CXC A;  3AYH B;  3STB C;  5IP9 H;  2UXD Q;  1H95 A;  4JI1 Q;  3I2Z A;  4DR7 L;  1VQ8 A;  4A3F H;  3HOU H;  1OXV A;  1XPR A;  1MJC A;  3RN5 A;  3B6Y A;  5IP9 G;  4B3M Q;  2N8N A;  1L1O B;  3NEL A;  3BZK A;  4A3F G;  3HOU G;  4IPD A;  4AIM A;  3FHW A;  2E2J H;  2UXB Q;  3ZJY C;  3HOZ G;  4NB3 A;  1HR0 Q;  1K73 C;  1HNW Q;  1K0R A;  2Q2T A;  5M3F H;  1VQB A;  1GO3 E;  1RL2 A;  1TWG H;  5JEA J;  1NTG A;  4OO1 G;  1UE1 A;  4TVA B;  2IX1 A;  1PHJ A;  1XMQ Q;  4GKK Q;  2IHE A;  4DV3 Q;  4IPH A;  2YTY A;  4OWT B;  4EX5 A;  3AEV A;  4GNX B;  2ZTC A;  2B63 H;  1A0I A;  2LSS A;  1Q81 C;  3BZC A;  1QZG A;  5IYC H;  2JA7 G;  2F3I A;  3E9H A;  4LW1 A;  3CCM A;  1VQP A;  1PH3 A;  2F4V Q;  4DR6 L;  2EXD A;  2K52 A;  1I6H H;  3PGZ A;  5IYC G;  2L15 A;  3KF6 A;  3K81 C;  4L5Q A;  4JI5 L;  1R9T H;  1J5E Q;  4BBS G;  4IJH A;  1V43 A;  4DV1 Q;  1X3G A;  4Y7N H;  2NVQ H;  1HZB A;  3GTM H;  4L5R C;  1PH6 A;  5DLQ E;  2ES2 A;  1UEB A;  4LFA L;  4B3R L;  4JI7 L;  3KJO A;  4AQY Q;  4AYB G;  2JA8 H;  1EQR A;  1Y1V G;  4JI3 L;  4A3B G;  1U0L A;  3ERS X;  2DUD A;  2VL6 A;  2F4V L;  3PF4 A;  2KBN A;  2JA8 G;  2KCT A;  1Q12 A;  3GTO H;  1IBM L;  1YHA A;  4LF7 L;  2A19 A;  3W5O A;  4A3G G;  1K83 H;  5IWA L;  4LF6 L;  4LF9 Q;  3G71 A;  4P71 A;  2UUC Q;  1XNQ Q;  1AE3 A;  2CKZ B;  4YCU A;  5GAH C;  4GOP A;  2K75 A;  1SRU A;  4B3T L;  1UE5 A;  4LWC A;  1A8V A;  4O2D A;  1ASZ A;  3A5Z B;  4ME3 A;  1IBL Q;  4YY3 L;  2NN6 G;  4NXM L;  2HT1 A;  3HOW G;  4X66 L;  1Q7Y C;  4C3I H;  5FJ8 H;  1KD1 C;  4OWX B;  3S2H H;  2I5M X;  3NBH B;  2ZTD A;  4IPC A;  5LMU Q;  4A3C G;  4LFB L;  1L2F A;  2OQK A;  2KHI A;  5FJ8 G;  3PUZ A;  4DR1 Q;  2CCZ A;  1OXS C;  1VQF A;  4KLK A;  3KF8 B;  4DUY L;  2JEB I;  1X9N A;  1XNQ L;  3TRZ A;  1MJE A;  4A93 G;  4ALP A;  1TWF H;  4YHH Q;  3MXN B;  4LFC L;  5ELO A;  1HNX L;  4JCV E;  4JI2 L;  2PI2 A;  3I55 A;  3F2C A;  4XTC S;  1N34 Q;  2EQS A;  3OW2 A;  4JBK A;  2PQA B;  2IX0 A;  1NBW A;  4H02 A;  3ICE A;  5JJK A;  3EBE A;  1IL2 A;  1L0W A;  5JJI A;  4DR4 L;  2WB1 G;  4QL5 A;  4JI4 Q;  2JEA I;  1I50 H;  2MO1 A;  4IOC A;  4A3M H;  3S15 H;  5C44 H;  4DV0 Q;  3F2B A;  4JI8 Q;  4MNO A;  3HOY G;  2E5L Q;  3CC4 A;  1Q1B A;  1O7I A;  4BY7 H;  2IY5 B;  5C44 G;  1KRS A;  3J81 j;  4LUV A;  4JI0 L;  1QUQ B;  1YEZ A;  4IPG A;  4BY7 G;  2UU9 L;  4JI6 L;  3UE1 A;  1KXL A;  1TWH H;  2MFI A;  1YVC A;  1PA6 A;  4LF8 Q;  4GKJ Q;  4QJF A;  4HJ5 A;  4C2M H;  2XTI A;  3JAM c;  5IYB H;  1ASY A;  2YU9 H;  4LF4 Q;  3CF5 A;  3GO5 A;  4OX9 Q;  4P74 A;  3S1M H;  5IYB G;  1Q8K A;  4DNI A;  4EQ5 A;  4IO9 A;  1G29 1;  3ULJ A;  1X54 A;  1XJV A;  1VQI A;  4PG3 A;  4DUZ L;  1OXX K;  2XGT A;  3K0X A;  4JC0 A;  4X62 Q;  4A3I H;  3M3Y H;  3UDG A;  1WI5 A;  4DR5 Q;  4BBR G;  3I4M G;  4A76 A;  1CSP A;  2UXC L;  1BBW A;  4A75 A;  3WWV A;  1PH2 A;  1S40 A;  3W1B A;  3GTL H;  3DLL A;  4GOP C;  3PIP A;  2ZJR A;  4J15 A;  2NZO A;  3TS2 A;  2AKW B;  3M4Q A;  3K80 C;  3NEM A;  3T1Y L;  4Y52 H;  5GAG C;  1UWV A;  3J80 i;  1VQ7 A;  1VQ9 A;  4R4I A;  1VCI A;  4X6A H;  4JBM A;  4KI0 A;  1HJP A;  1MKH A;  1KAW A;  4GN3 B;  3PF5 A;  3H3V I;  5IE8 A;  1FJG L;  4R4Q A;  2UUB L;  2VUM H;  4AYB E;  4A3E G;  2ZJQ A;  4YWK A;  2R7D A;  4HJ7 A;  1SR3 A;  4C3H H;  1U5K A;  4B3S L;  4WJ4 A;  1IZ6 A;  2VUM G;  1FGU A;  2PMZ E;  5ELN A;  2WP8 J;  4IFD I;  1YBY A;  3HOZ H;  3CAM A;  4DV2 L;  1E1T A;  2K4K A;  3CW2 C;  1EYG A;  4LNQ A;  4KHP L;  1JJG A;  5H1S E;  1FVI A;  3HOV G;  4DR6 Q;  1N32 L;  2K5V A;  4GLV B;  5HGQ A;  2DGY A;  1Y14 B;  3CP0 A;  4RG1 A;  4JI5 Q;  1VQ6 A;  1JJC B;  5IYD G;  1EIY B;  3S1Q H;  1Q82 C;  3RR5 A;  3KDF A;  3GTQ H;  5M5Y H;  2ZJP A;  1EFW A;  4JG2 A;  4QY7 A;  4LFA Q;  1LUZ A;  1YIJ A;  3J7Z C;  2JA7 H;  4B3R Q;  1WYD A;  4JI7 Q;  1X3F A;  4JI3 Q;  1VQJ A;  2CWP A;  1B8A A;  1L1O C;  1LTL A;  4GLA C;  4DPG A;  1IBM Q;  5GRO A;  5FLM G;  4LF7 Q;  3CCV A;  4K0K L;  2WAQ G;  1Z47 A;  5IWA Q;  4LF6 Q;  3F1Z A;  1QZH A;  2PQA A;  2LXK A;  1TWA H;  4B3T Q;  2R7Z G;  2R93 H;  2Z6K C;  5GAD C;  4A3B H;  1Y1V H;  1WJJ A;  2ALY B;  1UE6 A;  1HZ9 A;  4YY3 Q;  1XMO L;  4NXM Q;  2R93 G;  2VQF L;  4UPA A;  2A8V A;  4X66 Q;  2WB1 E;  4NXN L;  4GNX C;  1N33 Q;  1PV4 A;  4LFB Q;  3M4P A;  4DR2 L;  4A3G H;  4HIO A;  3PO2 H;  2HHH L;  4UY8 C;  3K7U C;  3S14 H;  3G6E A;  3KJP A;  2GVA A;  2MO0 A;  1K8A C;  5E7N A;  4OWW B;  4DUY Q;  2AHO B;  1YJ9 A;  3UDI A;  3LGJ A;  3U4V A;  1V1Q A;  1HNZ L;  2YTV A;  1IXR A;  1KRT A;  4YWL A;  3I4O A;  3PV0 A;  3CPW A;  4LFC Q;  3HOW H;  1HZA A;  1HNX Q;  2CQO A;  2R7F A;  4JI2 Q;  4NPS A;  4DV5 L;  1N36 Q;  4POG A;  1XNR L;  4A3C H;  2Q2I A;  2VS1 A;  2I5L X;  3Q8D A;  4IJL A;  1N33 L;  4HJ8 A;  2ZM6 Q;  4DK6 C;  4PZ6 A;  1IYJ B;  1VQG A;  2VW9 A;  3S2D H;  4LUZ A;  2OQ0 A;  3STB D;  4DR4 Q;  4A93 H;  1VQE A;  2NVX H;  3H15 A;  4R4C A;  1CKN A;  3ULL A;  5HY6 A;  1S3O A;  2CFM A;  1I3Q H;  4UP8 A;  2Q2H A;  4HIK A;  1NJI C;  2NZH A;  3GTJ H;  1P16 A;  1N36 L;  4JI0 Q;  1Q86 C;  1K3R A;  2LXJ A;  2PNH A;  1I94 Q;  2BA1 A;  2AWN A;  3RN2 A;  2UU9 Q;  4JI6 Q;  2JA6 H;  1KHI A;  3VDY A;  2C35 B;  4OXP A;  4A3K G;  1Y1W H;  2YYZ A;  2ZM6 L;  1VQ5 A;  2V1C C;  1PVO A;  2JA6 G;  2AWO A;  3CQZ H;  1Y1W G;  4MTN A;  5AJ3 L;  4JYA L;  1M90 C;  3HOY H;  1E1O A;  1G51 A;  1C9O A;  5C0X I;  2QEX A;  1K9M C;  1PH8 A;  3F2D A;  1OTC A;  4DUZ Q;  4HID A;  3I4N H;  3OYY A;  3E9I A;  1I94 L;  3GD7 A;  2UUA L;  1L1O A;  3CCS A;  3D31 A;  1BKB A;  5LMN L;  2K50 A;  1VQC A;  4PZ7 A;  2N3S A;  4A4I A;  3KF6 B;  4DV6 L;  3I4N G;  2UXC Q;  3CCJ A;  2VY3 A;  3PUX A;  5IY0 A;  1EOV A;  1Z9F A;  3S16 H;  5EAY A;  3ULP A;  1SMX A;  4PMW A;  1CSQ A;  1HZC A;  3L7Z C;  4OON A;  4DK3 C;  3T1Y Q;  2Z6K A;  1FL0 A;  1B7Y B;  4GS3 A;  2EIF A;  3S1R H;  3I4M H;  4BBR H;  4JV5 L;  3T1H L;  4LF5 L;  4AH6 A;  1JT8 A;  4GNX A;  3PUW A;  5M3M G;  5IT9 c;  2Y0S G;  3UE0 A;  1FJG Q;  2ASB A;  4WJ3 M;  2NVY H;  3KOJ A;  1NE3 A;  2UUB Q;  5K36 G;  2A1A A;  4A3L H;  1X55 A;  3PO3 G;  2ID0 A;  4BA1 I;  3CMA A;  4GOP B;  1JMC A;  4B3S Q;  1K8G A;  4A3L G;  1TWC H;  2WFW A;  1KC8 C;  1GM5 A;  2BA0 A;  3K8A A;  4GN5 A;  1SFO H;  2RHQ B;  3SGI A;  2WAQ E;  4DV2 Q;  4JOI C;  2HIV A;  4BY1 G;  3M4O H;  2ATW A;  4KHP Q;  1KL9 A;  1YI2 A;  1N32 Q;  2GVB A;  1EUJ A;  5J3B A;  3CC2 A;  4DR3 L;  3GTK H;  4A3E H;  1T9H A;  2BH2 A;  4IOA A;  4RMF A;  5C3E H;  1GD7 A;  3HKS A;  5C4X G;  4R4O A;  3GTP H;  1P8L A;  1JE5 A;  3KFU A;  3G48 A;  5C3E G;  3UDX A;  1YNX A;  1LYL A;  1MIU A;  3CME A;  3U58 A;  2JA5 G;  3HOV H;  4DV7 Q;  3K7A H;  2KEN A;  1KQS A;  2JK8 A;  1Q46 A;  3J80 c;  3TS0 A;  2K5N A;  5IYD H;  3HKZ G;  4K0K Q;  4P73 A;  4HJ9 A;  4BXX G;  3HOX H;  2JA9 A;  3CPF A;  1QVF A;  4MZ9 A;  2VQE L;  5IP7 G;  3AFQ A;  5BR8 L;  4A3J H;  1X65 A;  3F8T A;  3CCQ A;  5JJL A;  3HOX G;  2D62 A;  1XMO Q;  3H0G H;  3PCO B;  2KHJ A;  2VQF Q;  4A3J G;  4NXN Q;  1WFQ A;  1NY4 A;  4APV A;  3H0G G;  5FLM H;  4DV7 L;  4DR2 Q;  2OTL A;  3U50 C;  3CCE A;  1E24 A;  2HHH Q;  4BBS H;  3ER0 A;  4DV4 L;  1YZ6 A;  2F52 A;  2Z0S A;  3OTO L;  3A5U A;  4HJA A;  1A62 A;  4POF A;  5GAE C;  1EQQ A;  4TQU S;  2MQH A;  4X64 L;  1IBK L;  1HNZ Q;  2GN5 A;  4R4T A;  1PH5 A;  2YTX A;  3PO2 G;  2MNA A;  4DV5 Q;  1XNR Q;  2UXD L;  1WCM H;  4JI1 L;  4XIG S;  2E2H H;  1C0A A;  3I7F A;  1RIP A;  2HQL A;  4L5T A;  5M3F G;  1YHB A;  4HIM A;  1WCM G;  2OCE A;  4B3M L;  1N9W A;  2H5X A;  5M5W H;  2QA4 A;  5C0X G;  1LM0 A; 
#chains in the Genus database with same CATH topology
 1WTH A;  1GVP A;  2AMC B;  3DUZ A;  2B63 G;  2JA6 B;  1QUQ A;  1SNO A;  2KCM A;  2RHS B;  2B2Y C;  2NVT B;  2IT1 A;  4XT1 B;  2J7Z A;  3TSS A;  5G3L F;  2VZA A;  1XMQ L;  1OXU A;  4K5V A;  1E22 A;  1AE2 A;  1YIT A;  3AFP A;  1GKH A;  3CU7 A;  2JSO A;  1ONL A;  2Y0S E;  1OXT A;  1J5E L;  2JE6 I;  3NQI A;  2TMP A;  1PFB A;  1PMR A;  1UEA B;  4DV1 L;  1VQ4 A;  5GQO A;  4PV1 C;  1JR0 D;  4DKA C;  5M3M B;  5KNB A;  3J81 i;  4AQY L;  1XPU A;  4DAM A;  3L9A X;  1LV9 A;  2Q2U A;  3BU2 A;  4MN3 A;  2SDF A;  4C3I G;  5M5X B;  3TEH B;  2QKI C;  1JOQ A;  4P72 A;  2XRQ D;  4BY1 B;  2UUC L;  1SMY C;  3EN2 A;  4LF5 Q;  1B70 B;  4KTA A;  3SHL A;  4IFD G;  4DAY B;  1STA A;  5LMU L;  4WOR A;  2JJQ A;  3HKZ E;  1EIG A;  2EY6 A;  1PRT F;  1XTD A;  3KK7 A;  4R9W A;  3CD6 A;  3U9S A;  1QNK A;  3CCL A;  1N34 L;  3S17 H;  2K14 A;  3PSI A;  1S72 A;  4IUN A;  4C3J B;  2B2Y A;  2EYF A;  2EYL A;  1C7Y A;  3TRE A;  2R92 H;  1CFM A;  4A3J B;  4JI4 L;  1ET6 A;  3TN2 A;  4DV0 L;  1EU4 A;  4V0B A;  4JI8 L;  1QOH A;  4K2K A;  1I5F A;  1Q90 A;  5KYI A;  5C4X H;  1PFS A;  5COY A;  2EYP A;  1F9R A;  4GN4 B;  2JA5 H;  3BJU A;  1NMG A;  1DGS A;  1VQH A;  5M3F B;  4LF4 L;  3K58 A;  2KVM A;  2NTT A;  1UE7 A;  4BXX H;  2D0P A;  2BE5 C;  1JC7 A;  4DV4 Q;  1HR0 W;  1H9J A;  5JEA G;  3K5N A;  3D0F A;  4X64 Q;  1DON A;  3S24 A;  3CCR A;  4DR5 L;  5AFW A;  3DEP A;  4PZ8 A;  3AYH B;  4IZ8 A;  4FXK C;  3VA7 A;  5IP9 H;  1E2V A;  3I2Z A;  1EY9 A;  3HOU H;  1MJC A;  1SYF A;  4L8J A;  4A3F G;  1TS4 A;  3QOL A;  3MA2 B;  1MSG A;  3IFT A;  2UXB Q;  3HOZ G;  1HR0 Q;  4ZCK A;  2LKV A;  2PMZ B;  1PRT C;  1RL2 A;  1TWG H;  4FYD A;  4G7Z C;  4X3T A;  3GTO B;  2IX1 A;  2IHE A;  4DV3 Q;  5C0X H;  3N52 A;  4IPH A;  2YTY A;  4GNX B;  4KD3 A;  1A0I A;  2LSS A;  4M8A A;  3FPP A;  2F3I A;  3E9H A;  4DR6 L;  1PH3 A;  5CYU A;  4G7O C;  2EXD A;  1HA6 A;  1FR3 A;  1TS2 A;  3KF6 A;  2HDM A;  3K81 C;  1R9T H;  2Q8R E;  5FO7 B;  3GTM H;  1PH6 A;  5DLQ E;  4LFA L;  1B1Z A;  5J39 A;  3KJO A;  4AYB G;  4JI7 L;  1EQR A;  1RJT A;  1Y1V G;  1HA5 A;  4A3B G;  2DUD A;  2K32 A;  4U68 A;  1Q12 A;  1IBM L;  2A19 A;  3KUP A;  1K83 H;  2WB1 B;  3P7J A;  5IGB A;  1XNQ Q;  5GAH C;  4B3T L;  4BS9 A;  1UE5 A;  1A8V A;  1ASZ A;  1C48 A;  3A5Z B;  4A3M B;  4NXM L;  5C44 B;  1BCP F;  4X66 L;  1Q7Y C;  2MGS A;  4NDX A;  5I6Y A;  1SYG A;  4IPC A;  1C4Q A;  3A56 A;  3P1H A;  2KHI A;  5EJW A;  1XTC D;  2EJM A;  5FJ8 G;  4KLK A;  1DD2 A;  3KF8 B;  2JEB I;  4DXG A;  3OPO A;  3LNN A;  1TWF H;  4ALP A;  3MXN B;  4ZLT F;  5CV6 A;  4JBK A;  4LK1 C;  4PQX A;  2WKC A;  3ICE A;  2X6L A;  3EBE A;  5JJI A;  4XQJ A;  2WB1 G;  3PIP 3;  1W6J A;  4KN7 C;  1F9Q A;  3F2B A;  3WOE A;  1QE6 A;  3CC4 A;  3JAM L;  5C44 G;  1E2W A;  3HP3 A;  3J81 j;  2JYO A;  1A15 A;  4XXE A;  5ELC A;  2MFI A;  1YVC A;  2NTS A;  4H44 C;  1EY8 A;  4GKJ Q;  2VB3 X;  1KAA A;  2F0G A;  2VUM B;  5EGT A;  1BR9 A;  1Q8K A;  2EY2 A;  3AMU A;  4DNI A;  3MEH A;  4IO9 A;  3ULJ A;  1ICW A;  1XJV A;  3MZ5 A;  3VYU A;  3K0X A;  4X62 Q;  3M3Y H;  1CSP A;  3HS0 C;  1BBW A;  1PH2 A;  3GTL H;  1SXT A;  4IAL A;  1TWG B;  4G57 A;  3QJY A;  1NR2 A;  1BCP C;  3K80 C;  3NEM A;  2A73 B;  3NWT A;  5GAG C;  1UWV A;  3GTQ B;  4JBM A;  2NYZ D;  2SOB A;  1HJP A;  3PF5 A;  3H3V I;  1FJG L;  3BDC A;  1JOK A;  2KEC A;  4YWK A;  2R7D A;  4HJ7 A;  1SR3 A;  4C3H H;  3D8G A;  3NBI A;  1WTR A;  1U5K A;  1R9T B;  4WJ4 A;  2FFK B;  2VUM G;  1EY7 A;  2XNA C;  1FGU A;  1NUC A;  2WP8 J;  4IFD I;  2R93 B;  3URY A;  4HED A;  5H1S E;  3HOV G;  3NSW A;  4KKU A;  4GLV B;  5HGQ A;  3CP0 A;  1Y14 B;  2PZU A;  4A3G B;  1VQ6 A;  1JJC B;  4KJN A;  2A69 C;  3S1Q H;  3KDF A;  2ZJP A;  1YIJ A;  1LUZ A;  4WFN 3;  1ILQ A;  2A6H D;  2QDB A;  4FO2 A;  1B8A A;  4GLA C;  1LTL A;  1U4L A;  1JOR A;  3CRL C;  4MTK A;  3ERQ A;  1K3B C;  2WAQ G;  3MTS A;  4RGT A;  3BZD B;  2Z6K C;  4V19 0;  1HZ9 A;  4YY3 Q;  2R93 G;  1EYD A;  2A8V A;  1TWF B;  4LFB Q;  3M4P A;  1LT4 D;  3PIO 3;  1B4O A;  1K8A C;  1ROD A;  4DUY Q;  1YJ9 A;  1HNZ L;  1IXR A;  3R3O A;  5JJZ A;  4KKS A;  3PV0 A;  4LFC Q;  2R7Z G;  1HZA A;  2VNU D;  3OOC A;  1EZ8 A;  2F3W A;  1N36 Q;  4POG A;  3Q23 A;  5EPK A;  2I5L X;  4RKB A;  5ELD A;  1LAB A;  4LUZ A;  1XX8 A;  5CV7 A;  4A93 H;  1QCB D;  2NVX H;  2J0T D;  4JPB W;  3ZYY X;  2N55 A;  1S3O A;  3MXU A;  1EY0 A;  4UP8 A;  2IPK D;  2AQ3 B;  2NZH A;  2NBF A;  4HMJ A;  1I94 Q;  2F03 A;  2CW0 C;  4A3K G;  2C35 B;  2QIL A;  3I4M B;  1Y1W H;  2RSN A;  2EJG C;  1DM0 B;  5DM7 3;  4HR7 B;  2AWO A;  4MTN A;  1M90 C;  3JAM E;  1Q8I A;  2F0D A;  1EQV A;  1G51 A;  2K01 A;  1K9M C;  1TWC B;  1I4P A;  4HID A;  1B3A A;  1NNX A;  1BBX C;  3FRP B;  1VQC A;  1ZYR C;  3GQB A;  3OIP A;  4A4I A;  4X3U A;  1KNA A;  3CCJ A;  2EDG A;  2VY3 A;  1QJO A;  1S5C D;  3OIQ A;  3L7Z C;  2Z6K A;  1U4R A;  4DNR B;  5C5M A;  1B7Y B;  2M9V A;  4GS3 A;  3BG3 A;  3I73 A;  1NCV A;  4LF5 L;  3PUW A;  3K7A B;  2Y0S G;  5IT9 c;  1VMP A;  2ASB A;  3KOJ A;  5K36 G;  2X6G A;  4RCN A;  1X55 A;  1O7L A;  3CMA A;  1JMC A;  4A3L G;  2QF7 A;  1GM5 A;  2BA0 A;  3IKJ A;  3K8A A;  4GN5 A;  4CKC A;  1FYC A;  4JOI C;  3ND8 A;  3A8J E;  1KL9 A;  2KEE A;  1N32 Q;  3CC2 A;  3GTK H;  4DNT B;  1PYW D;  2A74 C;  3R93 A;  1GUN A;  4IOA A;  1LLR D;  2BCO A;  2F3V A;  3PMF A;  3J80 L;  4R4O A;  3GTP H;  3KFU A;  1JE5 A;  1B2T A;  1LYL A;  4R8N A;  3Q6S A;  1KQS A;  3TS0 A;  3DWA A;  4DAV A;  2XSC A;  3HKZ G;  4K0K Q;  5BN5 A;  4CDF C;  3CPF A;  1HQR D;  4K8J A;  4MZ9 A;  3NBH A;  1X65 A;  4RFB A;  5JJL A;  2B2W C;  3HOX G;  1RHP A;  2D62 A;  4EQO A;  5E4X A;  2EYO A;  3RD4 A;  5FLM H;  5IIF A;  4BBS H;  4DV4 L;  1YZ6 A;  3M4Y A;  4HJA A;  1AZP A;  1EY6 A;  3D3R A;  4POF A;  5GAE C;  2F0H A;  3BVM A;  5EKL A;  4X64 L;  2E76 C;  4R4T A;  1SJH D;  4I7Z C;  2G9H D;  1WCM H;  2HD3 A;  1WD0 A;  4OIJ A;  2E2H H;  3I7F A;  2XWB B;  2K33 A;  5EBD A;  5FKA C;  5M5W H;  3T53 B;  4HN7 A;  3GTG H;  1CKO A;  1LTR D;  3IRB A;  5I2X A;  2SEB D;  3IL8 A;  4G4K A;  5KGU A;  1W2B A;  1Y1W B;  2UXB L;  1SLJ A;  4IUV A;  1HR0 L;  1YNN C;  1FD7 D;  3D4R A;  5LMN W;  2QGQ A;  1WOC A;  4U67 3;  3NTH A;  4JOI A;  4DV3 L;  3VR4 A;  3FP9 A;  3AB9 A;  1X3E A;  3NHH A;  2HQE A;  1DOL A;  2E75 C;  4YCW A;  4O0A A;  5AJ3 Q;  3F2U A;  4JBW A;  1VQM A;  5C0X J;  1SAP A;  4X65 L;  3DWQ A;  1QNU A;  3V2T A;  1O7Y A;  1SBB B;  1VQA A;  3PUV A;  2YV5 A;  3R2T A;  1UUP A;  5LMN Q;  2NWG A;  3TP6 A;  2RDF A;  4QIW B;  3TQY A;  4L5S A;  4FXD A;  2NVT H;  4RH6 A;  1E2Z A;  3H3V H;  3PO3 B;  1T5E A;  3NK9 A;  2F0T A;  3DM3 A;  2OTJ A;  2Z1C A;  2K5H A;  1HH2 P;  2B2W A;  1PH7 A;  1Q1E A;  3JC6 6;  4O1N A;  3SK6 A;  4JV5 Q;  3TZD A;  4QQB X;  4IFD H;  1SRO A;  2I5H A;  4KHZ A;  3D6C A;  1D7Q A;  1X6O A;  1IYV A;  1CHP D;  4NKL A;  2F1M A;  3K5O A;  3JAM i;  3J81 c;  4K2L A;  2B29 A;  3NEN A;  5C4J B;  4DU9 A;  5KIX A;  3GTP B;  5M3M H;  4DR3 Q;  4FDB A;  2A6H C;  1IW7 C;  4EQN A;  2B3G A;  3M85 A;  2K5D A;  5M5X H;  1VQK A;  1VDZ A;  1STN A;  2N78 A;  4BY1 H;  1PTO B;  1MSH A;  3QG1 A;  2F4I A;  2NN6 I;  3RLO A;  2XVS A;  3KYH C;  1KIX A;  3H94 A;  5IGD A;  5EPJ A;  2BDN A;  3A74 A;  3FEW X;  1QVC A;  4BBS B;  1PYS B;  1TXY A;  4I7A A;  1SJE D;  2IHF A;  1H9S B;  1CKM A;  1X56 A;  1YJN A;  4A3I G;  4GKJ L;  4RCO A;  2N49 A;  4XT3 B;  2CHB D;  4QB4 A;  2Z6B A;  5T1I A;  4UP9 A;  1WCM B;  2PO4 A;  1D1I A;  1EYA A;  4YCV A;  1VQN A;  4C3J H;  2B63 B;  4JVZ A;  1G2T A;  4X62 L;  2A6E D;  1VQL A;  1JJ2 A;  3W1G A;  1EIF A;  3GTG B;  3CXC A;  1MI2 A;  3QB3 A;  4K6L A;  2UXD Q;  4DR7 L;  1I6H B;  1VQ8 A;  4A3F H;  4ME5 A;  1JE4 A;  3B6Y A;  2LY7 A;  1L1O B;  3NEL A;  2HUG A;  3BYT B;  4F7X A;  4Y7N B;  1S5B D;  1CK1 A;  1AP0 A;  1HNW Q;  1K0R A;  2ZXP A;  4RA8 A;  5M3F H;  4OO1 G;  1Y8P B;  1NTG A;  1UE1 A;  2K5W A;  1GUW A;  2IWH A;  1QG7 A;  1D2B A;  4OWT B;  5JVG 3;  3MXP A;  3DXJ C;  4Z9C B;  3BZC A;  2JA7 G;  4LW1 A;  5TSS A;  2J4X A;  5IYC G;  4C3I B;  3MHB A;  3S2H B;  1JWS D;  1BNZ A;  1X3G A;  3D4D A;  4L5R C;  2ES2 A;  1UEB A;  3MVV A;  5F2D A;  1I6V C;  4ZKC B;  1OO9 B;  2TSS A;  1GOZ A;  2F4V L;  3GTO H;  3L3O C;  1D5X C;  5ISR A;  4MHE A;  1B50 A;  1HXY D;  4UDU C;  4B9W A;  2XIW A;  3G71 A;  4LF9 Q;  4HAE A;  1AE3 A;  4KHV A;  1F9P A;  1SYD A;  2G5D A;  2K75 A;  4LWC A;  1J9O A;  1I50 B;  4ME3 A;  4F87 A;  1IBL Q;  4YY3 L;  2HT1 A;  3HOW G;  2WII B;  3KBX A;  3OWF A;  5FJ8 H;  1KD1 C;  4A3C G;  4LFB L;  3SE0 A;  1ML0 D;  4FP5 D;  2O2L D;  2CCZ A;  4DR1 Q;  1VQF A;  4DUY L;  3BDL A;  4C2M B;  3E5S A;  1F2Z A;  4YHH Q;  4LFC L;  5IGC A;  2PI2 A;  2IX0 A;  1NBW A;  5JJK A;  1IL2 A;  1L0W A;  4DK1 A;  5CC4 A;  1Z6H A;  2EJF C;  4QL5 A;  4A3M H;  2AUK A;  4C1N K;  5C44 H;  3HOY G;  2FJ2 A;  1Q1B A;  5IGG A;  4LUV A;  2SNM A;  1QUQ B;  1YEZ A;  1I4H A;  2VB2 X;  3C1E A;  1TWH H;  3C46 A;  3VR5 A;  3I8Z A;  1PA6 A;  4LF8 Q;  4HJ5 A;  1QB5 D;  4GZY C;  1QIL A;  5JPM C;  3T56 B;  5IYB G;  4A3F B;  4EQ5 A;  3SVM A;  1G29 1;  4PG3 A;  1EIH A;  1OXX K;  2XGT A;  1SE4 A;  2JXM B;  3HOZ B;  3BVG A;  3LWE A;  4BBR G;  3IFD A;  5I9P A;  4A76 A;  4IUQ A;  4A75 A;  1IKM A;  1S40 A;  4IUT A;  4XDX A;  2KA7 A;  3DLL A;  3PIP A;  5NUC A;  3TS2 A;  3M4Q A;  5EQ0 A;  1SNQ A;  3J80 i;  3I3C A;  3V05 A;  5FO9 B;  3R2I A;  4FVM A;  1II3 A;  2VUM H;  4A3E G;  2ZJQ A;  2A68 D;  2P5Z X;  4S3S A;  3CAM A;  3CW2 C;  4A3B B;  4AYB B;  1Y1V B;  2I07 B;  4RWS C;  2KED A;  1B9M A;  1D1K A;  1N32 L;  1LT6 D;  1LTA D;  4QF4 A;  4XYQ A;  4JI5 Q;  5IYD G;  1S5D D;  1LTB D;  1EIY B;  3GTQ H;  2ZXO A;  1L0X B;  2X69 A;  4K0K L;  2L55 A;  2R93 H;  3QWN A;  3S2D B;  3N6R A;  4C1N I;  3K59 A;  4UPA A;  3KLR A;  1I3Q B;  1N33 Q;  1PV4 A;  4A3G H;  3K7U C;  1X3Q A;  1EWH A;  3G6E A;  3KJP A;  2K6A A;  1BDO A;  2MO0 A;  4OWW B;  2AHO B;  3UDI A;  4C56 C;  1V1Q A;  3HEJ A;  1SYC A;  2NN6 H;  3I4O A;  1PTO D;  2WAC A;  1X3P A;  3CQZ B;  1KNE A;  3CPW A;  2CQO A;  4JI2 Q;  4NPS A;  5BN4 A;  2Q2I A;  1R4P B;  3NQT A;  4IJL A;  1HPC A;  5FO8 B;  5CV5 A;  2ZM6 Q;  4PZ6 A;  1WTX A;  1TWH B;  1CKN A;  5HY6 A;  2CFM A;  4OHJ A;  3S16 B;  1AFP A;  2Q2H A;  4HIK A;  4Q0F A;  2ZXR A;  1Q86 C;  4JI0 Q;  5DM6 3;  2F0E A;  3RN2 A;  2UU9 Q;  4JI6 Q;  1RDP D;  3VDY A;  3S1R B;  4IN3 A;  2YYZ A;  1D5M C;  1TY0 A;  2V1C C;  3FMC A;  2PYK A;  2A6E C;  1EFI D;  1TY2 A;  1AW7 A;  5AJ3 L;  2NVY B;  3D6W A;  1C9O A;  4OGQ C;  2QEX A;  1PH8 A;  1ZXT A;  3F2D A;  1OTC A;  2ICE C;  4G7H C;  3OYY A;  3E9I A;  1A3U A;  3GD7 A;  1SE3 A;  2PPB C;  3CCS A;  5LMN L;  3OW7 A;  2K50 A;  3KF6 B;  3I4N G;  1TT2 A;  5IY0 A;  5C4H A;  1Z9F A;  1SMX A;  4PMW A;  4OON A;  4DK3 C;  3T1Y Q;  4CKE A;  5IT9 L;  4CGY B;  2FMM A;  5C3E B;  3I4M H;  2M2L A;  4JV5 L;  3HOV B;  1H9M A;  1EU3 A;  4M1U B;  1Q3L A;  3NPP A;  2UUB Q;  1NE3 A;  2A1A A;  4A3L H;  3TME A;  2NZ1 D;  4B3S Q;  3P20 A;  1TWC H;  3LWU A;  2EPB A;  4DV2 Q;  4QCL A;  3M4O H;  5I4D A;  3V96 A;  4KHP Q;  2OEO A;  5LHY 1;  5D3D A;  1EUJ A;  2IX3 A;  1KLG D;  1XYI A;  4DR3 L;  2HCI A;  1G8Z D;  1HTP A;  3EA6 A;  2WAQ B;  3SDZ A;  2BH2 A;  1JWM D;  1ENA A;  3HKS A;  5C4X G;  2I46 A;  5C3E G;  1Y8N B;  3UDX A;  3CME A;  3SEB A;  2JA5 G;  4ZUJ A;  3K7A H;  3U9O A;  2ZT9 C;  1Q46 A;  1PRT B;  4ODG A;  2KCN A;  2PNR C;  3HOX H;  4BXX G;  4RAU C;  3TBI B;  3EFX D;  1K0S A;  4X3S A;  3AFQ A;  2DJG C;  1A6X A;  3F8T A;  3CCQ A;  3E3X A;  2R7Z B;  2KHJ A;  1NY4 A;  4KKT A;  4DV7 L;  3QIA A;  3U50 C;  1B53 A;  2HHH Q;  1B9N A;  3ER0 A;  2QEJ C;  2YTX A;  3PO2 G;  1HUN A;  2UXD L;  2PCF B;  1JCK B;  4XIG S;  4CJ2 C;  5C5L A;  1RIP A;  4A3K B;  2QA4 A;  5C0X G;  1AZQ A;  4KV6 A;  3HFZ B;  1E0B A;  1GHJ A;  3CKI B;  1VQO A;  1HNW L;  3QR8 A;  3RZD B;  2CVR A;  4LAA A;  2CWA A;  3VYS A;  1DYQ A;  1L0Y B;  3CRK C;  2XRS D;  3SK5 A;  3FKI B;  5I9O A;  3J7A 5;  5COR A;  3S1N H;  2PQE A;  4DAP A;  4JYA Q;  2O5J C;  4ZQ3 A;  3W3A A;  2HCC A;  2OWO A;  5CMD A;  1DZ1 A;  1PYB A;  1BBU A;  1EEF D;  4CBV A;  2L9H A;  2RDG A;  4OEM B;  2Y0S B;  4KMU C;  4ZK9 B;  4P75 A;  5EKI A;  4IUR A;  3RZO B;  2EZV A;  4LUO A;  1KTK A;  2JN4 A;  3KDF B;  3J7A V;  1EOT A;  1A2U A;  4CJ1 B;  1SE2 A;  1C8C A;  3UDF A;  4K5W A;  4LF9 L;  5E1F A;  3T1H Q;  2A68 C;  1G6P A;  3M4O B;  1YNJ D;  1STH A;  3FKI G;  4F8M A;  1IBL L;  1DJR D;  1M8A A;  1VMC A;  2E2D C;  3I56 A;  1YJW A;  2RQX A;  5IT9 E;  3GV3 A;  3EIV A;  4GLX A;  1LTT D;  2L12 A;  5E4W C;  5EBC A;  4DR1 L;  2F0U A;  5ELF A;  2F0J A;  2L5T A;  4UAI A;  3Q22 A;  4YHH L;  4F88 A;  1TS3 A;  2EYM A;  4K14 A;  3HKZ B;  3PO3 H;  5DAU A;  1J6Q A;  4CKB A;  4A3D G;  1QVG A;  1SDF A;  2GA4 B;  2IW3 A;  3HOX B;  1A3V A;  1JWU D;  1BCP B;  5FLX E;  2ICI A;  4FNF A;  1VS0 A;  1GUO A;  4BA2 I;  2B39 A;  3BYY B;  2RVL A;  1LT3 D;  3OSO A;  4PMB A;  4EVO A;  2PI2 E;  4N9T A;  3PUY A;  3GDE A;  2VQE Q;  2OT2 A;  1S4Z A;  5C4J H;  2EE1 A;  1SN8 A;  5FLX c;  4LF8 L;  1TII D;  4HCE A;  2K1B A;  1LTG D;  2PZW A;  4Q5V A;  3ERO A;  1K28 A;  3A0J A;  4UHV A;  3L2P A;  1A63 A;  5IP7 H;  2RCF A;  1DXM A;  1WTO A;  3TP5 A;  1PTO H;  2Q8T A;  4QGU A;  3M9B A;  1SYE A;  3TP8 A;  4FF1 A;  4CDD C;  1X32 A;  2MP1 A;  3D4W A;  3WOF A;  5A2Q E;  1OXV A;  1XPR A;  2FIN B;  3T16 A;  3RN5 A;  1SMY D;  1PZK D;  2N8N A;  2RBM A;  4C3H G;  4AIM A;  2NVQ B;  1RD9 D;  1GUS A;  4NB3 A;  2JA8 B;  1BO0 A;  1M4V A;  2Q2T A;  1IYU A;  1I4G A;  4XYO A;  3S1N B;  4NMZ A;  1GO3 E;  4TVA B;  5FOB B;  1PHJ A;  4GKK Q;  3HZX A;  4EX5 A;  2B63 H;  5CV8 A;  1QZG A;  5IYC H;  2XN9 C;  3CCM A;  1VQP A;  1KDB A;  1I6H H;  1O78 A;  1PFN A;  5G3L D;  2L15 A;  4JI5 L;  4Y7N H;  3W2D A;  4WJW A;  3E6Z X;  1HZB A;  1FNV A;  1LTS D;  5IGF A;  4K6D A;  3NP8 A;  1CTM A;  2EY1 A;  1CA5 A;  3PF4 A;  2JA8 G;  3VYT A;  4P2C B;  3W5O A;  1AEX A;  5FK9 C;  4P71 A;  2BOS A;  2KJX A;  2EY5 A;  4YCU A;  4GOP A;  3G6J B;  4O2D A;  3M7G A;  2BE5 D;  1WTP A;  3C1F A;  4C3I H;  1I4R A;  4OWX B;  3S2H H;  2I5M X;  3NBH B;  2ZTD A;  4N8F A;  1L2F A;  1NAP A;  3J81 E;  1DCZ A;  1OXS C;  1SNP A;  1Z7T A;  1X9N A;  1XNQ L;  3TRZ A;  4TRD A;  1MJE A;  4A93 G;  3T51 B;  1O7Z A;  5ELO A;  4JCV E;  4EGV A;  4JI2 L;  3F2C A;  1HCZ A;  3S1M B;  4XTC S;  2D9U A;  1XXG A;  2PQA B;  4H02 A;  2QCP X;  1GUT A;  1PRT D;  4A3I B;  1Y69 U;  2EYJ A;  2B8F A;  1I50 H;  2MO1 A;  4IOC A;  1IKL A;  3S15 H;  4MNO A;  1RKN A;  2E5L Q;  1EY5 A;  1O7I A;  5JAV A;  4JI0 L;  3C2P A;  4IPG A;  4BY7 G;  2UU9 L;  4JI6 L;  1S5E D;  3UE1 A;  1STG A;  3NTK A;  4DGZ A;  4QJF A;  4XQQ A;  4C2M H;  5IYB H;  1ASY A;  2YU9 H;  2A5H A;  1R4Q B;  3O13 A;  2F0M A;  1STE A;  1O80 A;  3GO5 A;  4OX9 Q;  4P74 A;  3Q24 A;  3SK8 A;  1G2S A;  3MWY W;  1VQI A;  2DNC A;  4JC0 A;  3UDG A;  1B44 D;  1WI5 A;  4QUC A;  4K8I A;  1CA6 A;  3WWV A;  2F0P A;  3NWS A;  3W1B A;  3QOJ A;  4L6T B;  2ZJR A;  3RMH A;  3T1Y L;  5JEA H;  1VQ9 A;  1VCI A;  4X6A H;  2JA7 B;  1CQF A;  1RCV D;  1KAW A;  3HG9 A;  5IE8 A;  1JQY D;  2R3Z A;  2UUB L;  4HSV A;  4B3S L;  3KLS X;  1IZ6 A;  1ENC A;  4RGN A;  5ELB A;  1YBY A;  3HOZ H;  4DV2 L;  1EL0 A;  1E1T A;  1BF4 A;  4KHP L;  1FVI A;  3TZU A;  1U9R A;  2K5V A;  1WTQ A;  2DGY A;  1CT1 D;  1V1O A;  3VR3 A;  3S14 B;  4QMG A;  1Q82 C;  3RR5 A;  5M5Y H;  5C6A A;  4B3R Q;  1X3F A;  3SXH A;  4JI3 Q;  3HOW B;  2Z9H A;  1ICF B;  2SNS A;  3DMU A;  5GRO A;  5FLM G;  4LF7 Q;  3MXG A;  5I6W A;  5IWA Q;  4LF6 Q;  1QZH A;  4DAY A;  1TWA H;  1LAC A;  2BDO A;  1HTL D;  1TU2 B;  5IOD A;  4A3B H;  1Y1V H;  2ALY B;  1UE6 A;  2B8G A;  3DEO A;  4GNX C;  2NUC A;  2HHH L;  2DY7 A;  1TKW B;  2GVA A;  3FPU B;  3DHQ A;  5E7N A;  5CR3 A;  4R8I A;  1EWC A;  4ILW A;  1KDA A;  3U4V A;  1KRT A;  5C3W A;  5M9O A;  1HNX Q;  1BCP D;  1V1P B;  3HOY B;  2LMC B;  3S15 B;  2VS1 A;  2H1E A;  4HJ8 A;  4DK6 C;  1WVL A;  2O5I C;  3DWP A;  3S2D H;  2OQ0 A;  3STB D;  1SSO A;  4DR4 Q;  5D14 A;  3LX0 A;  5IOC A;  1DOM A;  5C4Z A;  1I3Q H;  2PZT A;  2YU9 B;  1NJI C;  3HGB A;  3GTJ H;  1P16 A;  4YIJ A;  1N36 L;  2PNH A;  2LXJ A;  2LS0 1;  1WTW A;  4ABN A;  1NSN S;  2B2T C;  3BVZ A;  4OXP A;  4BBR B;  4JK1 C;  1VQ5 A;  2JA6 G;  3CQZ H;  2A69 D;  4JYA L;  4KN4 C;  1E1O A;  3OMG A;  2EVB A;  2KQ3 A;  4DUZ Q;  4PNY A;  5DEH A;  3I4N H;  1SFO B;  1I94 L;  1TVX A;  1EZ6 A;  3D31 A;  1BKB A;  3NXW A;  2UXC Q;  3E0J A;  4DA2 A;  1S5F D;  4A3E B;  3S16 H;  3K6O A;  1STY A;  5EAY A;  3ULP A;  1CSQ A;  3A55 A;  2KCC A;  4H13 C;  3S1R H;  2EIF A;  3T1H L;  1NR4 A;  1T5X D;  2PW7 A;  3AU7 A;  3NUC A;  4GNX A;  5M3M G;  1JT8 A;  4WJ3 M;  2NVY H;  1A3T A;  1EYC A;  2XWJ B;  1CHQ D;  2ID0 A;  4BA1 I;  2L11 A;  1K8G A;  1CZW A;  1ESF A;  2WFW A;  3BS1 A;  4B08 A;  2KHS A;  4BY1 G;  2HIV A;  5M5Y B;  2ATW A;  1UAP A;  3H0G B;  4I65 A;  2D2C C;  5J3B A;  4H0L C;  5JPN C;  1T9H A;  4CHT B;  1ZKO A;  5C3E H;  3VR6 A;  1I4X A;  3TP7 A;  1TWA B;  3HOV H;  4DK0 A;  1SYB A;  2CW0 D;  2B2T A;  2K5N A;  4P73 A;  4HJ9 A;  2JA9 A;  5EPL A;  2VQE L;  1GXD C;  1LTI D;  5HGT A;  4KY5 A;  4C3J G;  1HHV A;  2F0S A;  5DNF A;  1D5Z C;  4XQN A;  1XMO Q;  3PCO B;  2VQF Q;  4A3J G;  4BWG B;  3KF8 A;  4N8X 1;  4NXN Q;  2OTL A;  3H0G G;  4DR2 Q;  1V8Q A;  3CCE A;  3MXN A;  1BQQ T;  1ZYR D;  1SNC A;  2F52 A;  2Z0S A;  4J1M A;  3A5U A;  5D65 A;  1A62 A;  5D3I B;  1EQQ A;  1QVF A;  3PO2 H;  2GN5 A;  3MAQ A;  4DV5 Q;  1XNR Q;  3GP7 A;  1HFN A;  3MFG A;  2RSO A;  1C0A A;  2FMC A;  4L5T A;  5M3F G;  2HQL A;  3GTJ B;  1JIC A;  1HUM A;  3FVQ A;  2OXP A;  1RF2 D;  2QDL A;  1GHK A;  3K5L A;  2R7Z H;  2B2U C;  1EQT A;  4X65 Q;  1E3P A;  3U4Z A;  3MC0 B;  4GKK L;  4R1J A;  1AH9 A;  2CH4 W;  3I4N B;  2ZTE A;  5KND A;  1PH1 A;  2O4X A;  3E0E A;  1YHQ A;  2KUM A;  1G6Z A;  1EWI A;  4QIW E;  1LO5 D;  3RNU A;  4A3K H;  1SNM A;  1PH9 A;  1DOK A;  1NMF A;  2BH8 A;  3AQQ A;  4OEL B;  2UUA Q;  2NB0 A;  2F0L A;  4JBJ A;  4DV6 Q;  3MEF A;  5LL6 S;  4DXF A;  2E2I H;  2RF4 A;  3PIO A;  4OO1 I;  2Z8L A;  2D5D A;  1XWE A;  1SE8 A;  2RCN A;  3RZD H;  5J1Z A;  3S17 B;  1N8R C;  2F0W A;  1VF5 C;  5E3F A;  1M1K C;  5ELE A;  3FKI H;  2HIX A;  4YWM A;  2R92 B;  4ZYS A;  3G7L A;  4ID6 A;  4HCS A;  2L1B A;  1HQM C;  2FXQ A;  3OMC A;  2D0O A;  1V9P A;  2JQO A;  3H91 A;  2F0I A;  3KLW A;  5C4X B;  3I4L A;  1JB7 A;  1FGB D;  2C5C A;  2JA5 B;  2F0F A;  4NW2 A;  3M7N A;  1D8L A;  3RZO H;  5K36 H;  3ND9 A;  5JOB A;  4A3M G;  2JP1 A;  4HSP A;  4A3D H;  4KY7 A;  4TKO B;  5LL6 X;  2KOL A;  2B2U A;  4IFD J;  3BDO A;  1BVS A;  1YNN D;  2F0K A;  2E8G A;  3CCU A;  5KEE A;  1PH4 A;  2R6G A;  4JW0 A;  3G4S A;  1CUK A;  1W3S A;  2R92 G;  1XPO A;  5FLX L;  3HOU B;  5BN3 A;  5L37 A;  1GJX A;  5A35 A;  2E5L L;  3RLN A;  1I4Q A;  3NTI A;  1CKN B;  1E7Z A;  1Y8O B;  5BR8 Q;  5CGK A;  3CC7 A;  3PO2 B;  2I0Q A;  4DR7 Q;  2OF1 A;  1MBY A;  3MFY A;  1JOO A;  1BXT A;  3L0O A;  5T1G A;  2AQ1 B;  3X3N A;  2K5Q A;  4OX9 L;  1TR5 A;  4UP7 A;  1VQD A;  3SR1 A;  3OTO Q;  1IBK Q;  5KYL A;  4X3K A;  3RLF A;  1W6K A;  3STB C;  1H95 A;  4JI1 Q;  5CV9 A;  5IP9 G;  4B3M Q;  4KK7 A;  1JB3 A;  1VF7 A;  3BZK A;  5A2Q L;  3HOU G;  4IPD A;  3VA5 A;  3FHW A;  1MHW C;  3GTM B;  4H7B A;  4RHS A;  2E2J H;  3IAY A;  3ZJY C;  1PXU A;  1K73 C;  4FF3 A;  1VQB A;  1F2L A;  5JEA J;  1XMQ Q;  2MHV A;  1K83 B;  1HFG A;  3AEV A;  2ZTC A;  4ULL A;  1Q81 C;  1IW7 D;  2F4V Q;  2E2I B;  2K52 A;  4DN4 M;  3PGZ A;  3H6M A;  5C3X A;  5KNC A;  4DF7 A;  4L5Q A;  1J5E Q;  3OHX C;  4IJH A;  1V43 A;  4DV1 Q;  4O42 A;  2NVQ H;  2C9O A;  4KY6 A;  2B2V C;  1ESR A;  1MGS A;  4B3R L;  2CH4 A;  4AQY Q;  2JA8 H;  1F9S A;  4JI3 L;  1U0L A;  3ERS X;  3I70 A;  2VL6 A;  2Q8I B;  2KBN A;  2KCT A;  1U4P A;  2K05 A;  1YHA A;  4LF7 L;  4A3G G;  1WD1 A;  5IWA L;  4LF6 L;  4FF2 A;  3K57 A;  2UUC Q;  4B9X A;  2CKZ B;  4L63 B;  1SRU A;  1RTO A;  2EYH A;  3KBG A;  2IJ0 A;  4RKL A;  1PTO F;  2NN6 G;  2HDL A;  2MUY A;  4LJZ C;  5LMU Q;  1BOS A;  4A3D B;  2OQK A;  3PUZ A;  3PQI A;  3X3M A;  3J81 L;  5CBE E;  4ZRZ A;  4E6I A;  1HNX L;  3I55 A;  3P75 A;  2ENB A;  1F77 A;  1A2T A;  4TSS A;  1N34 Q;  1K8O A;  2EQS A;  3OW2 A;  2DY8 A;  2H4O A;  1ILP A;  1RTN A;  4OL7 A;  3M3Y B;  4IUP A;  5EKK A;  4DR4 L;  3GV6 A;  4JI4 Q;  2JEA I;  2DNE A;  1FNW A;  4DV0 Q;  4JI8 Q;  1U4M A;  3GTL B;  2R61 A;  3J7A F;  4BY7 H;  2IY5 B;  1KRS A;  3C3L A;  4RGM A;  1ZEQ X;  4KD4 A;  1KXL A;  3K5M A;  3H09 A;  3A54 A;  2XTI A;  1UNS A;  3JAM c;  2DN8 A;  3Q0A A;  4NP5 A;  4LF4 Q;  1SND A;  3CF5 A;  1PZI D;  3S1M H;  4C3H B;  2DJF C;  1X54 A;  2B2V A;  5J22 A;  4OIK A;  4DUZ L;  4A3I H;  4DR5 Q;  3I4M G;  3EQL C;  2E2J B;  3HRZ C;  4HTH A;  2UXC L;  4GOP C;  1ENF A;  1PTO C;  4J15 A;  2NZO A;  2RA4 A;  2AKW B;  4Y52 H;  1B3Q A;  2MPM A;  3S1Q B;  2F0N A;  4FF4 A;  4RHR A;  1VQ7 A;  5CV4 A;  4R4I A;  4KI0 A;  1HRJ A;  1MKH A;  4GN3 B;  3A8K E;  4R4Q A;  5I2Y A;  4AYB E;  4PMC A;  1CZG A;  2PMZ E;  5ELN A;  2G9D A;  3FDT A;  1F2M A;  1K8M A;  2K4K A;  1EYG A;  4LNQ A;  1JJG A;  4DR6 Q;  1G91 A;  4OO1 H;  3I91 A;  4RG1 A;  1KLU D;  2K03 A;  3A8I E;  4IUU A;  3CHB D;  1EFW A;  4JG2 A;  3J7Y W;  4QY7 A;  4LFA Q;  2JA7 H;  3J7Z C;  1WYD A;  4JI7 Q;  1KDC A;  1IHZ A;  1VQJ A;  2CWP A;  4ZAI A;  1L1O C;  4LMQ D;  5K5P A;  2IL8 A;  1TS5 A;  4DPG A;  4HMI A;  1IBM Q;  3CCV A;  1Z47 A;  3F1Z A;  2WKD A;  2PQA A;  2LXK A;  4J8Q A;  4B3T Q;  2AUJ D;  4ZUI A;  5GAD C;  4A93 B;  2NVX B;  1WJJ A;  1XMO L;  4CDC C;  4NXM Q;  1TQO A;  2VQF L;  4X66 Q;  2WB1 E;  4NXN L;  2PW5 A;  2QW7 A;  2EXZ A;  4DR2 L;  4HIO A;  4UY8 C;  3S14 H;  4ZKB B;  2RKS A;  2VXW A;  5IGE A;  3LGJ A;  2Z4H A;  2YTV A;  3K0Y A;  4YWL A;  3H3V C;  2Z4I A;  3HOW H;  2R7F A;  4DV5 L;  1XNR L;  4A3C H;  1PFM A;  3I72 A;  1PLF A;  3Q8D A;  4BY7 B;  1N33 L;  1SEB D;  4J6H A;  4FXG C;  1IYJ B;  1VQG A;  2VW9 A;  1VQE A;  5HUR A;  3H15 A;  4R4C A;  3ULL A;  1H9S A;  2WIN B;  1K3R A;  3A7L A;  2BA1 A;  2AWN A;  1CI3 M;  2JA6 H;  1KHI A;  1H9K A;  2ZM6 L;  1PDQ A;  1PVO A;  1Y1W G;  1D6E C;  1KAB A;  3HOY H;  1FNU A;  4MIU A;  1WTV A;  1F2Y A;  3QO2 A;  1CM9 A;  5C0X I;  1IL8 A;  5JVH 3;  2UUA L;  1L1O A;  3R8B A;  4PZ7 A;  2N3S A;  4DV6 L;  3SK4 A;  3PUX A;  3GTK B;  1EOV A;  1AN8 A;  1HZC A;  1CQV A;  3ONA B;  1FL0 A;  2K04 A;  4BBR H;  2M00 A;  2N88 A;  4AH6 A;  3EJI A;  1MD2 D;  3UE0 A;  1FJG Q;  3UI2 A;  3PO3 G;  1PZJ D;  3EVQ A;  4GOP B;  1H9R A;  1GUG A;  1KC8 C;  2AQ2 B;  1SFO H;  2F0Q A;  2RHQ B;  2WAQ E;  3SGI A;  3T4A C;  4IQZ A;  1YI2 A;  2FHT A;  2GVB A;  4A3E H;  2F0V A;  2CQA A;  3J80 E;  2F0O A;  3T13 A;  4RMF A;  1GD7 A;  3A7A B;  1P8L A;  3G48 A;  3KLS A;  1YNX A;  1MIU A;  3U58 A;  5CBA E;  4K5X A;  4DV7 Q;  2K7V A;  2KEN A;  3S9W A;  2EOT A;  2JK8 A;  2E2H B;  3J80 c;  1V1P A;  2K28 A;  5IYD H;  1LT5 D;  2RDH A;  2MJ8 A;  4DFA A;  5KRU A;  1QWY A;  3WDN A;  2WV6 D;  4WRD A;  2E74 C;  4N9P A;  5M5W B;  1STB A;  5IP7 G;  3NE5 B;  5BR8 L;  4A3J H;  1BUV T;  3DM1 A;  3I90 A;  3VYR A;  4QUF A;  3H0G H;  2LFN A;  2L0C A;  3ITP A;  1WFQ A;  4APV A;  3OWE B;  1E24 A;  1YNJ C;  3OTO L;  1IBK L;  4BBS G;  1HNZ Q;  4TQU S;  2MQH A;  1PH5 A;  2L4N A;  1EY4 A;  4RGO S;  2MNA A;  1J8I A;  3TDQ A;  3VR2 A;  2V4D A;  1ET9 A;  4CDE C;  4JI1 L;  3RUZ A;  4CJ0 B;  1YHB A;  4KJO A;  4HIM A;  1WCM G;  2OCE A;  4B3M L;  1N9W A;  1EEI D;  2H5X A;  4EQP A;  1LM0 A; 
#chains in the Genus database with same CATH homology
 1GVP A;  3HFZ B;  2AMC B;  3GTG H;  2B63 G;  1CKO A;  1QUQ A;  3IRB A;  2KCM A;  2R7Z H;  1VQO A;  1W2B A;  2UXB L;  1SLJ A;  2RHS B;  1HR0 L;  1HNW L;  4X65 Q;  2IT1 A;  5LMN W;  2QGQ A;  1E3P A;  1WOC A;  3U4Z A;  2CWA A;  2VZA A;  1XMQ L;  4GKK L;  1OXU A;  4JOI A;  4DV3 L;  4R1J A;  1AH9 A;  3FP9 A;  1X3E A;  3J7A 5;  1E22 A;  2ZTE A;  4YCW A;  2VNU D;  1AE2 A;  1PH1 A;  4O0A A;  1YIT A;  3AFP A;  3S1N H;  5AJ3 Q;  4JYA Q;  3E0E A;  4JBW A;  1GKH A;  1YHQ A;  1VQM A;  5C0X J;  4X65 L;  1EWI A;  2Y0S E;  4QIW E;  1OXT A;  2OWO A;  1J5E L;  2JE6 I;  3RNU A;  4A3K H;  1PYB A;  1BBU A;  1PH9 A;  1VQA A;  1NMF A;  2BH8 A;  2YV5 A;  3AQQ A;  3PUV A;  5GQO A;  4DV1 L;  1VQ4 A;  5LMN Q;  2UUA Q;  4DKA C;  4JBJ A;  4DV6 Q;  3MEF A;  3TQY A;  3J81 i;  2RF4 A;  4P75 A;  2E2I H;  4L5S A;  3PIO A;  4AQY L;  4DAM A;  1XPU A;  2NVT H;  4OO1 I;  3H3V H;  4LUO A;  2Q2U A;  3BU2 A;  1SE8 A;  2RCN A;  3RZD H;  3KDF B;  3DM3 A;  1N8R C;  2OTJ A;  2K5H A;  1HH2 P;  1PH7 A;  1Q1E A;  3JC6 6;  3TEH B;  4P72 A;  3UDF A;  1M1K C;  4LF9 L;  4JV5 Q;  4QQB X;  3FKI H;  3EN2 A;  1SRO A;  2HIX A;  4YWM A;  3T1H Q;  2UUC L;  4LF5 Q;  2I5H A;  1G6P A;  1B70 B;  4KHZ A;  4IFD G;  3FKI G;  1IBL L;  2FXQ A;  1D7Q A;  1X6O A;  3I56 A;  2D0O A;  4DAY B;  1V9P A;  2JQO A;  1YJW A;  3EIV A;  3JAM i;  3J81 c;  3KLW A;  5LMU L;  4GLX A;  2B29 A;  2JJQ A;  1JB7 A;  3HKZ E;  3NEN A;  4DR1 L;  1XTD A;  5M3M H;  3M7N A;  1D8L A;  3CD6 A;  3RZO H;  4DR3 Q;  4YHH L;  4FDB A;  3PO3 H;  4A3M G;  3CCL A;  4A3D H;  1N34 L;  3S17 H;  3M85 A;  2B3G A;  2K14 A;  1J6Q A;  3PSI A;  5M5X H;  1S72 A;  1VQK A;  2N78 A;  1QVG A;  4A3D G;  4IFD J;  4BY1 H;  1BVS A;  1C7Y A;  3TRE A;  2E8G A;  3CCU A;  2R92 H;  1PH4 A;  2R6G A;  2NN6 I;  3RLO A;  3KYH C;  4JI4 L;  3G4S A;  1CUK A;  1VS0 A;  1W3S A;  1KIX A;  2R92 G;  4BA2 I;  1XPO A;  4DV0 L;  4JI8 L;  3A74 A;  1I5F A;  2E5L L;  3RLN A;  2PI2 E;  5C4X H;  3PUY A;  1QVC A;  1PFS A;  3GDE A;  2VQE Q;  1CKN B;  1E7Z A;  1PYS B;  5BR8 Q;  1TXY A;  5C4J H;  2IHF A;  4GN4 B;  1SN8 A;  1X56 A;  1CKM A;  3BJU A;  5FLX c;  3CC7 A;  1YJN A;  4A3I G;  2JA5 H;  1NMG A;  4LF8 L;  4GKJ L;  2I0Q A;  4DR7 Q;  2N49 A;  1DGS A;  1VQH A;  4LF4 L;  3A0J A;  3L0O A;  4UP9 A;  4OX9 L;  3L2P A;  1UE7 A;  4BXX H;  2D0P A;  1A63 A;  4DV4 Q;  4UP7 A;  4YCV A;  1VQD A;  5IP7 H;  3OTO Q;  1HR0 W;  1VQN A;  4C3J H;  5JEA G;  1IBK Q;  3D0F A;  4X64 Q;  4X62 L;  1VQL A;  3S24 A;  1JJ2 A;  4QGU A;  3W1G A;  1EIF A;  3M9B A;  3CCR A;  3RLF A;  4PZ8 A;  4DR5 L;  3CXC A;  3AYH B;  3STB C;  5IP9 H;  2UXD Q;  1H95 A;  4JI1 Q;  3I2Z A;  4DR7 L;  1VQ8 A;  4A3F H;  3HOU H;  1OXV A;  1XPR A;  1MJC A;  3RN5 A;  3B6Y A;  5IP9 G;  4B3M Q;  2N8N A;  1L1O B;  3NEL A;  3BZK A;  4A3F G;  3HOU G;  4IPD A;  4AIM A;  3FHW A;  2E2J H;  2UXB Q;  3ZJY C;  3HOZ G;  4NB3 A;  1HR0 Q;  1K73 C;  1HNW Q;  1K0R A;  2Q2T A;  5M3F H;  1VQB A;  1GO3 E;  1RL2 A;  1TWG H;  5JEA J;  1NTG A;  4OO1 G;  1UE1 A;  4TVA B;  2IX1 A;  1PHJ A;  1XMQ Q;  4GKK Q;  2IHE A;  4DV3 Q;  4IPH A;  2YTY A;  4OWT B;  4EX5 A;  3AEV A;  4GNX B;  2ZTC A;  2B63 H;  1A0I A;  2LSS A;  1Q81 C;  3BZC A;  1QZG A;  5IYC H;  2JA7 G;  2F3I A;  3E9H A;  4LW1 A;  3CCM A;  1VQP A;  1PH3 A;  2F4V Q;  4DR6 L;  2EXD A;  2K52 A;  1I6H H;  3PGZ A;  5IYC G;  2L15 A;  3KF6 A;  3K81 C;  4L5Q A;  4JI5 L;  1R9T H;  1J5E Q;  4BBS G;  4IJH A;  1V43 A;  4DV1 Q;  1X3G A;  4Y7N H;  2NVQ H;  1HZB A;  3GTM H;  4L5R C;  1PH6 A;  5DLQ E;  2ES2 A;  1UEB A;  4LFA L;  4B3R L;  4JI7 L;  3KJO A;  4AQY Q;  4AYB G;  2JA8 H;  1EQR A;  1Y1V G;  4JI3 L;  4A3B G;  1U0L A;  3ERS X;  2DUD A;  2VL6 A;  2F4V L;  3PF4 A;  2KBN A;  2JA8 G;  2KCT A;  1Q12 A;  3GTO H;  1IBM L;  1YHA A;  4LF7 L;  2A19 A;  3W5O A;  4A3G G;  1K83 H;  5IWA L;  4LF6 L;  4LF9 Q;  3G71 A;  4P71 A;  2UUC Q;  1XNQ Q;  1AE3 A;  2CKZ B;  4YCU A;  5GAH C;  4GOP A;  2K75 A;  1SRU A;  4B3T L;  1UE5 A;  4LWC A;  1A8V A;  4O2D A;  1ASZ A;  3A5Z B;  4ME3 A;  1IBL Q;  4YY3 L;  2NN6 G;  4NXM L;  2HT1 A;  3HOW G;  4X66 L;  1Q7Y C;  4C3I H;  5FJ8 H;  1KD1 C;  4OWX B;  3S2H H;  2I5M X;  3NBH B;  2ZTD A;  4IPC A;  5LMU Q;  4A3C G;  4LFB L;  1L2F A;  2OQK A;  2KHI A;  5FJ8 G;  3PUZ A;  4DR1 Q;  2CCZ A;  1OXS C;  1VQF A;  4KLK A;  3KF8 B;  4DUY L;  2JEB I;  1X9N A;  1XNQ L;  3TRZ A;  1MJE A;  4A93 G;  4ALP A;  1TWF H;  4YHH Q;  3MXN B;  4LFC L;  5ELO A;  1HNX L;  4JCV E;  4JI2 L;  2PI2 A;  3I55 A;  3F2C A;  4XTC S;  1N34 Q;  2EQS A;  3OW2 A;  4JBK A;  2PQA B;  2IX0 A;  1NBW A;  4H02 A;  3ICE A;  5JJK A;  3EBE A;  1IL2 A;  1L0W A;  5JJI A;  4DR4 L;  2WB1 G;  4QL5 A;  4JI4 Q;  2JEA I;  1I50 H;  2MO1 A;  4IOC A;  4A3M H;  3S15 H;  5C44 H;  4DV0 Q;  3F2B A;  4JI8 Q;  4MNO A;  3HOY G;  2E5L Q;  3CC4 A;  1Q1B A;  1O7I A;  4BY7 H;  2IY5 B;  5C44 G;  1KRS A;  3J81 j;  4LUV A;  4JI0 L;  1QUQ B;  1YEZ A;  4IPG A;  4BY7 G;  2UU9 L;  4JI6 L;  3UE1 A;  1KXL A;  1TWH H;  2MFI A;  1YVC A;  1PA6 A;  4LF8 Q;  4GKJ Q;  4QJF A;  4HJ5 A;  4C2M H;  2XTI A;  3JAM c;  5IYB H;  1ASY A;  2YU9 H;  4LF4 Q;  3CF5 A;  3GO5 A;  4OX9 Q;  4P74 A;  3S1M H;  5IYB G;  1Q8K A;  4DNI A;  4EQ5 A;  4IO9 A;  1G29 1;  3ULJ A;  1X54 A;  1XJV A;  1VQI A;  4PG3 A;  4DUZ L;  1OXX K;  2XGT A;  3K0X A;  4JC0 A;  4X62 Q;  4A3I H;  3M3Y H;  3UDG A;  1WI5 A;  4DR5 Q;  4BBR G;  3I4M G;  4A76 A;  1CSP A;  2UXC L;  1BBW A;  4A75 A;  3WWV A;  1PH2 A;  1S40 A;  3W1B A;  3GTL H;  3DLL A;  4GOP C;  3PIP A;  2ZJR A;  4J15 A;  2NZO A;  3TS2 A;  2AKW B;  3M4Q A;  3K80 C;  3NEM A;  3T1Y L;  4Y52 H;  5GAG C;  1UWV A;  3J80 i;  1VQ7 A;  1VQ9 A;  4R4I A;  1VCI A;  4X6A H;  4JBM A;  4KI0 A;  1HJP A;  1MKH A;  1KAW A;  4GN3 B;  3PF5 A;  3H3V I;  5IE8 A;  1FJG L;  4R4Q A;  2UUB L;  2VUM H;  4AYB E;  4A3E G;  2ZJQ A;  4YWK A;  2R7D A;  4HJ7 A;  1SR3 A;  4C3H H;  1U5K A;  4B3S L;  4WJ4 A;  1IZ6 A;  2VUM G;  1FGU A;  2PMZ E;  5ELN A;  2WP8 J;  4IFD I;  1YBY A;  3HOZ H;  3CAM A;  4DV2 L;  1E1T A;  2K4K A;  3CW2 C;  1EYG A;  4LNQ A;  4KHP L;  1JJG A;  5H1S E;  1FVI A;  3HOV G;  4DR6 Q;  1N32 L;  2K5V A;  4GLV B;  5HGQ A;  2DGY A;  1Y14 B;  3CP0 A;  4RG1 A;  4JI5 Q;  1VQ6 A;  1JJC B;  5IYD G;  1EIY B;  3S1Q H;  1Q82 C;  3RR5 A;  3KDF A;  3GTQ H;  5M5Y H;  2ZJP A;  1EFW A;  4JG2 A;  4QY7 A;  4LFA Q;  1LUZ A;  1YIJ A;  3J7Z C;  2JA7 H;  4B3R Q;  1WYD A;  4JI7 Q;  1X3F A;  4JI3 Q;  1VQJ A;  2CWP A;  1B8A A;  1L1O C;  1LTL A;  4GLA C;  4DPG A;  1IBM Q;  5GRO A;  5FLM G;  4LF7 Q;  3CCV A;  4K0K L;  2WAQ G;  1Z47 A;  5IWA Q;  4LF6 Q;  3F1Z A;  1QZH A;  2PQA A;  2LXK A;  1TWA H;  4B3T Q;  2R7Z G;  2R93 H;  2Z6K C;  5GAD C;  4A3B H;  1Y1V H;  1WJJ A;  2ALY B;  1UE6 A;  1HZ9 A;  4YY3 Q;  1XMO L;  4NXM Q;  2R93 G;  2VQF L;  4UPA A;  2A8V A;  4X66 Q;  2WB1 E;  4NXN L;  4GNX C;  1N33 Q;  1PV4 A;  4LFB Q;  3M4P A;  4DR2 L;  4A3G H;  4HIO A;  3PO2 H;  2HHH L;  4UY8 C;  3K7U C;  3S14 H;  3G6E A;  3KJP A;  2GVA A;  2MO0 A;  1K8A C;  5E7N A;  4OWW B;  4DUY Q;  2AHO B;  1YJ9 A;  3UDI A;  3LGJ A;  3U4V A;  1V1Q A;  1HNZ L;  2YTV A;  1IXR A;  1KRT A;  4YWL A;  3I4O A;  3PV0 A;  3CPW A;  4LFC Q;  3HOW H;  1HZA A;  1HNX Q;  2CQO A;  2R7F A;  4JI2 Q;  4NPS A;  4DV5 L;  1N36 Q;  4POG A;  1XNR L;  4A3C H;  2Q2I A;  2VS1 A;  2I5L X;  3Q8D A;  4IJL A;  1N33 L;  4HJ8 A;  2ZM6 Q;  4DK6 C;  4PZ6 A;  1IYJ B;  1VQG A;  2VW9 A;  3S2D H;  4LUZ A;  2OQ0 A;  3STB D;  4DR4 Q;  4A93 H;  1VQE A;  2NVX H;  3H15 A;  4R4C A;  1CKN A;  3ULL A;  5HY6 A;  1S3O A;  2CFM A;  1I3Q H;  4UP8 A;  2Q2H A;  4HIK A;  1NJI C;  2NZH A;  3GTJ H;  1P16 A;  1N36 L;  4JI0 Q;  1Q86 C;  1K3R A;  2LXJ A;  2PNH A;  1I94 Q;  2BA1 A;  2AWN A;  3RN2 A;  2UU9 Q;  4JI6 Q;  2JA6 H;  1KHI A;  3VDY A;  2C35 B;  4OXP A;  4A3K G;  1Y1W H;  2YYZ A;  2ZM6 L;  1VQ5 A;  2V1C C;  1PVO A;  2JA6 G;  2AWO A;  3CQZ H;  1Y1W G;  4MTN A;  5AJ3 L;  4JYA L;  1M90 C;  3HOY H;  1E1O A;  1G51 A;  1C9O A;  5C0X I;  2QEX A;  1K9M C;  1PH8 A;  3F2D A;  1OTC A;  4DUZ Q;  4HID A;  3I4N H;  3OYY A;  3E9I A;  1I94 L;  3GD7 A;  2UUA L;  1L1O A;  3CCS A;  3D31 A;  1BKB A;  5LMN L;  2K50 A;  1VQC A;  4PZ7 A;  2N3S A;  4A4I A;  3KF6 B;  4DV6 L;  3I4N G;  2UXC Q;  3CCJ A;  2VY3 A;  3PUX A;  5IY0 A;  1EOV A;  1Z9F A;  3S16 H;  5EAY A;  3ULP A;  1SMX A;  4PMW A;  1CSQ A;  1HZC A;  3L7Z C;  4OON A;  4DK3 C;  3T1Y Q;  2Z6K A;  1FL0 A;  1B7Y B;  4GS3 A;  2EIF A;  3S1R H;  3I4M H;  4BBR H;  4JV5 L;  3T1H L;  4LF5 L;  4AH6 A;  1JT8 A;  4GNX A;  3PUW A;  5M3M G;  5IT9 c;  2Y0S G;  3UE0 A;  1FJG Q;  2ASB A;  4WJ3 M;  2NVY H;  3KOJ A;  1NE3 A;  2UUB Q;  5K36 G;  2A1A A;  4A3L H;  1X55 A;  3PO3 G;  2ID0 A;  4BA1 I;  3CMA A;  4GOP B;  1JMC A;  4B3S Q;  1K8G A;  4A3L G;  1TWC H;  2WFW A;  1KC8 C;  1GM5 A;  2BA0 A;  3K8A A;  4GN5 A;  1SFO H;  2RHQ B;  3SGI A;  2WAQ E;  4DV2 Q;  4JOI C;  2HIV A;  4BY1 G;  3M4O H;  2ATW A;  4KHP Q;  1KL9 A;  1YI2 A;  1N32 Q;  2GVB A;  1EUJ A;  5J3B A;  3CC2 A;  4DR3 L;  3GTK H;  4A3E H;  1T9H A;  2BH2 A;  4IOA A;  4RMF A;  5C3E H;  1GD7 A;  3HKS A;  5C4X G;  4R4O A;  3GTP H;  1P8L A;  1JE5 A;  3KFU A;  3G48 A;  5C3E G;  3UDX A;  1YNX A;  1LYL A;  1MIU A;  3CME A;  3U58 A;  2JA5 G;  3HOV H;  4DV7 Q;  3K7A H;  2KEN A;  1KQS A;  2JK8 A;  1Q46 A;  3J80 c;  3TS0 A;  2K5N A;  5IYD H;  3HKZ G;  4K0K Q;  4P73 A;  4HJ9 A;  4BXX G;  3HOX H;  2JA9 A;  3CPF A;  1QVF A;  4MZ9 A;  2VQE L;  5IP7 G;  3AFQ A;  5BR8 L;  4A3J H;  1X65 A;  3F8T A;  3CCQ A;  5JJL A;  3HOX G;  2D62 A;  1XMO Q;  3H0G H;  3PCO B;  2KHJ A;  2VQF Q;  4A3J G;  4NXN Q;  1WFQ A;  1NY4 A;  4APV A;  3H0G G;  5FLM H;  4DV7 L;  4DR2 Q;  2OTL A;  3U50 C;  3CCE A;  1E24 A;  2HHH Q;  4BBS H;  3ER0 A;  4DV4 L;  1YZ6 A;  2F52 A;  2Z0S A;  3OTO L;  3A5U A;  4HJA A;  1A62 A;  4POF A;  5GAE C;  1EQQ A;  4TQU S;  2MQH A;  4X64 L;  1IBK L;  1HNZ Q;  2GN5 A;  4R4T A;  1PH5 A;  2YTX A;  3PO2 G;  2MNA A;  4DV5 Q;  1XNR Q;  2UXD L;  1WCM H;  4JI1 L;  4XIG S;  2E2H H;  1C0A A;  3I7F A;  1RIP A;  2HQL A;  4L5T A;  5M3F G;  1YHB A;  4HIM A;  1WCM G;  2OCE A;  4B3M L;  1N9W A;  2H5X A;  5M5W H;  2QA4 A;  5C0X G;  1LM0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...