4C3HH

Structure of 14-subunit rna polymerase i at 3.27 a resolution, crystal form c2-93
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
144
structure length
134
Chain Sequence
NTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLNATRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-DIRECTED RNA POLYMERASE I SUBUNIT RPA190
publication title Crystal Structure of the 14-Subunit RNA Polymerase I
pubmed doi rcsb
molecule tags Transcription
total genus 22
structure length 134
sequence length 144
ec nomenclature
pdb deposition date 2013-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4c3hH00
3S1QH 3PV0A 3OYYA 4UP7A 2UXBL 1O7IA 1SE8A 2F3IA 2A19A 2YU9H 2A8VA 3PO3H 4KHPQ 1D8LA 2V1CC 4BA1I 5LMNW 1HZCA 2NZOA 1XJVA 2MO1A 2UU9Q 2JEAI 4AQYQ 3GTGH 3PSIA 4JI3Q 1XNQL 1NTGA 5M3MH 4Y52H 1NBWA 2PI2A 4A3CH 4R4OA 4HJ5A 1FJGL 4H02A 4A3EH 3CPWA 4OO1I 1GVPA 4BY7G 1IXRA 5FJ8H 4PZ6A 3KYHC 3VDYA 1XMOL 4IO9A 1PH4A 4YCWA 4X65L 3S24A 4DV0L 4HJ8A 2VS1A 3H15A 4RG1A 1J5EL 4NXML 4B3TQ 4R4CA 4DUYQ 1SROA 1AH9A 1PH6A 4UP8A 4LFCL 1P16A 3CCSA 3I4OA 3F8TA 1YITA 2HIVA 1EYGA 2LXJA 4DR1Q 3A74A 4LF6L 4GKKL 2AHOB 4A3GG 1M1KC 2LXKA 4JC0A 1JB7A 1CKMA 1IZ6A 4LF4Q 3STBD 3PO2H 4GKJL 1Y1WH 3HOYH 1JT8A 3M9BA 1PH5A 2KBNA 4IPDA 5IYBH 1VQNA 3K7AH 1E7ZA 5M3FG 4A93H 1CKOA 4DV4L 3CW2C 4IOCA 2ES2A 1WCMG 1TWCH 4O0AA 5M3MG 3DLLA 4DR7L 4GS3A 4BBSH 1G6PA 2ZM6Q 1XNQQ 4LF7Q 4HIMA 4LF8L 5IE8A 2HQLA 1QZHA 2RF4A 1KQSA 4PG3A 1UE1A 3AYHB 4MTNA 4IPHA 4YWLA 4HIKA 3J7A5 3KF6A 4OONA 4JI2L 1KD1C 1PH1A 1GM5A 5IYCH 2UUBL 2F52A 5LMUL 4TQUS 4X65Q 1KIXA 4NXMQ 5C44H 2Z6KC 1Y14B 3CC7A 1UWVA 1YNXA 2PI2E 3HOVH 2K75A 1N32L 4JI5L 2R92H 4C3IH 4L5QA 1YEZA 4BBRG 4APVA 4DR2L 3GTQH 2F4VQ 2ZJRA 1VQOA 1HH2P 4GKKQ 1Q1BA 3S2DH 4A3MG 2UUAQ 4AIMA 4DR3Q 3I4NH 1E1OA 4P71A 2JEBI 4YCVA 2I5HA 3CMEA 3A0JA 3ULJA 1MJCA 4P72A 3NELA 1VQJA 3HKZG 5GADC 2R93G 1VQPA 1VQLA 4OWXB 1E3PA 3E9HA 2DGYA 4LF8Q 1I94Q 1Q81C 4JI6L 2B63G 1KRSA 3GO5A 5FLMG 3T1YL 1LTLA 3U58A 1VQFA 2N78A 4JI2Q 3S16H 5C44G 1S40A 4LNQA 4MNOA 3KJOA 2UUBQ 5LMUQ 1X3GA 2EIFA 3K81C 4A3FH 4X62Q 4XTCS 1KRTA 3STBC 1PH3A 4ALPA 3CPFA 1C0AA 1N32Q 2R7DA 4IJHA 2NVTH 1X3FA 4DR2Q 2Q2UA 4PZ7A 1A62A 4LUVA 1B8AA 3UDGA 1MIUA 4KLKA 4YY3L 2Q2TA 5IP7H 3ER0A 3CCRA 2ATWA 3S2HH 2HIXA 1UE6A 2K5NA 1U0LA 1VQEA 4GNXA 4AH6A 4A76A 3TS0A 5JJIA 1TXYA 1A8VA 3RNUA 4YWKA 4FDBA 2HT1A 1VQBA 4KHPL 4BA2I 1VQKA 2UU9L 4IJLA 4AQYL 4JI3L 4A3KH 4LF9Q 4JCVE 5AJ3Q 3M4OH 4A4IA 1L1OA 2VW9A 3CF5A 3CCLA 4B3SQ 1TWFH 2KHJA 1X9NA 1CKNB 4QY7A 1BBWA 1B70B 1VQIA 3GTPH 1AE2A 3MXNB 3PGZA 4EX5A 1ASZA 2NN6I 2UXDL 4A3DG 4LUOA 3FKIH 1IBLQ 3HOXG 4B3TL 2E8GA 4DUYL 2Q2IA 3NBHB 4RMFA 3RLFA 2JQOA 3KF8B 4DR1L 4UY8C 3KFUA 1PFSA 2ZJPA 5C3EH 2ZTEA 4DNIA 1N9WA 1L1OC 2AWOA 1N8RC 4JI7Q 1Q46A 4X64Q 1HR0Q 2PQAB 3CCQA 2JA7G 2IHFA 2VZAA 5JEAG 4DAMA 1N34Q 4GN3B 3I4MG 3M3YH 4DR6Q 3TQYA 4UPAA 4A3BG 3PF5A 4LFAL 2L15A 3CD6A 4DV1L 5GQOA 1RIPA 4R4IA 1XPRA 3TRZA 1UEBA 2R7FA 3H0GH 2ZM6L 3RN2A 4LF7L 4O2DA 2WAQE 3CMAA 3RZDH 3ERSX 2JA6G 2XTIA 1JE5A 1VQCA 1PH2A 2CKZB 4LW1A 2JA8G 3K7UC 3GTLH 2R7ZG 5GAHC 2OTLA 2MQHA 1SN8A 2JA9A 4K0KQ 3KLWA 1VQ4A 4JBKA 4DV5Q 4HIDA 3KDFB 1W3SA 5DLQE 1H95A 5GROA 1YHAA 3OTOL 3GTMH 2YYZA 2IY5B 2UXDQ 4A3LH 3M4QA 3RLOA 4GN4B 1EIFA 3FHWA 3HOZH 2FXQA 5FLXc 5C4XG 4POFA 5JJKA 3NENA 1Z47A 5IYDG 4B3MQ 3HOUH 2F4VL 1PH7A 1Q7YC 2Y0SE 1PV4A 1IL2A 1QVFA 1CUKA 1TWGH 4QL5A 2UUAL 5J3BA 4DR3L 2DUDA 3JC66 2HHHL 3GD7A 1V43A 2IHEA 2Z6KA 2D0OA 3PO3G 4QGUA 2EXDA 5ELNA 2YTVA 2WB1E 1WOCA 1KHIA 2RCNA 1XTDA 4ME3A 4LFAQ 4IFDI 4A3CG 4DV1Q 1WJJA 3G71A 4DPGA 3E9IA 4LWCA 4A3EG 4DKAC 1EIYB 1I94L 5FJ8G 3CQZH 1YVCA 2D0PA 3ULLA 4JI1Q 4J15A 1NMGA 3AFQA 4HJ9A 2E5LQ 3DM3A 5M5XH 3G4SA 2Q2HA 2N49A 3OTOQ 1KC8C 4LUZA 1L2FA 2K5HA 4X62L 2OWOA 3BZCA 5IWAQ 4IFDJ 3CAMA 1G51A 2I0QA 1N33Q 1VQ5A 3BJUA 2E2JH 3HFZB 3PO2G 3W1GA 4JI4Q 1TWHH 1Q8KA 1Y1WG 3CCMA 3HOYG 3J81i 4NPSA 1VQGA 1K8AC 3PUZA 1UE7A 4TVAB 5IYBG 1VS0A 2KHIA 4A93G 3J7ZC 3S14H 4KI0A 4DUZQ 1VQ6A 1GD7A 2HHHQ 4A75A 3TEHB 2K50A 1EQRA 3GDEA 1PH9A 4QJFA 3PIPA 3M85A 3G48A 4BBSG 3NEMA 1I5FA 4DR5Q 2UUCQ 1QUQB 4LF9L 1QZGA 5AJ3L 1OXTA 4OXPA 4GLVB 3U4VA 1GKHA 1JJ2A 3I2ZA 4B3SL 3M7NA 1HNWQ 3RN5A 4DR4Q 3U50C 4BXXH 4B3RL 1YHQA 2OCEA 1JMCA 1KL9A 4DAYB 5IYCG 2GVBA 2CWAA 2PQAA 4GN5A 3S15H 1IBLL 2JA5H 2NVXH 3BU2A 1X65A 1I3QH 2ASBA 3UDFA 3HOVG 2R92G 2VQFQ 1Q82C 4X6AH 4NXNQ 1BKBA 4HJAA 1K8GA 1X3EA 1VQ9A 2K4KA 3CC2A 2C35B 1IYJB 2YV5A 4DK6C 3PF4A 3EBEA 3ULPA 3I4NG 4JI7L 1HJPA 4X64L 1HR0L 1PH8A 2VNUD 2VY3A 1VQHA 1N34L 4C3HH 4DR6L 2RHQB 2MFIA 4DV3Q 3HKSA 2N8NA 4JOIC 3ICEA 1A0IA 1B7YB 2IX1A 2E2IH 4XIGS 3AFPA 2OQ0A 3T1HQ 4A3JH 4KHZA 5BR8L 3PUWA 5C0XI 5LMNQ 3HKZE 1C7YA 4YCUA 3S1MH 4B3RQ 1Q1EA 1QVCA 3L7ZC 4DV6L 4K0KL 3F1ZA 2PNHA 4DV5L 1X6OA 4QQBX 1N36Q 3WWVA 3A5ZB 4A3FG 2BA0A 4AYBE 3KJPA 2GN5A 4P75A 4R4TA 1WFQA 1M90C 1YHBA 4YWMA 4OX9L 1OXUA 1IBMQ 3J81c 2OTJA 4DV7Q 3J81j 2PMZE 2RHSB 4B3ML 1I50H 2WAQG 3I56A 5IP7G 2H5XA 5IP9H 3CXCA 1FVIA 5C0XJ 1YJNA 4IOAA 1VQ7A 5IT9c 1NMFA 1V9PA 2KCMA 1DGSA 3UE0A 4JV5L 3PUXA 3RZOH 1S3OA 2Z0SA 1BBUA 1NE3A 4NB3A 4A3KG 2VL6A 4BY1H 1NJIC 2JE6I 2B29A 4HIOA 2CCZA 1PYSB 1XMQL 2NN6G 2K5VA 3I55A 3K8AA 5BR8Q 4JI1L 1BVSA 2Y0SG 3HOWH 4EQ5A 4DV6Q 1J6QA 3FKIG 2BH2A 3TREA 2E5LL 1K83H 1Z9FA 1LM0A 2NVQH 1K3RA 2UXCL 2K52A 4PMWA 5IWAL 4A3GH 2VUMH 4LF5Q 4OX9Q 1E22A 1C9OA 1OXXK 1CSPA 3RLNA 1N33L 5K36G 1QVGA 2KCTA 1W2BA 5IP9G 3H3VH 1QUQA 5C3EG 4JI4L 3PUVA 5M3FH 3D31A 1L0WA 3KOJA 1HZAA 2YTXA 1I6HH 3H3VI 3CCJA 1HZ9A 2BH8A 4MZ9A 1HNZQ 1YJWA 3UE1A 1EQQA 1X55A 4JI0Q 1WCMH 3MEFA 4DUZL 5JJLA 3S1RH 4L5RC 1JJCB 3E0EA 1Y1VH 1XNRQ 3W5OA 1YJ9A 4BY1G 3F2CA 2I5MX 1PHJA 4JV5Q 3G6EA 4GNXB 3H0GG 3B6YA 4DR5L 4JBWA 2UUCL 2D62A 4X66L 4OO1G 2CFMA 1WI5A 4GOPB 3HOWG 3Q8DA 1A63A 1HNWL 4DR4L 3U4ZA 1XMQQ 3M4PA 2ZJQA 4JYAQ 2WP8J 1RL2A 1VQDA 1L1OB 4A3IH 4LFBL 4YHHL 1YBYA 2YTYA 1NY4A 3UDXA 3CCEA 1HR0W 4A3LG 3BZKA 3EN2A 4C3JH 1EFWA 2VUMG 2UXCQ 4BBRH 1IBKQ 2VQEL 1D7QA 4QIWE 3HOZG 4L5TA 2VQFL 4JI8L 3PUYA 3RR5A 5M5YH 1LUZA 4NXNL 4A3MH 3HOUG 5M5WH 2UXBQ 5HY6A 3CCUA 4C2MH 2OQKA 4GLAC 4IPCA 1EUJA 1EWIA 1CKNA 2JJQA 3JAMi 1Y1VG 1SFOH 2NZHA 4POGA 4IFDG 2R93H 3UDIA 1VQAA 1SLJA 1FJGQ 4DV3L 4IPGA 2QEXA 3S17H 2LSSA 1CSQA 1FGUA 4DK3C 5FLMH 1XMOQ 1ASYA 2B63H 4X66Q 2CQOA 5H1SE 3T1HL 3AQQA 4DV0Q 1J5EQ 3J80i 4A3IG 5LMNL 2BA1A 4DV2L 4OWWB 4Y7NH 1VQ8A 2NVYH 4LFCQ 1PA6A 1XPUA 2XGTA 4LFBQ 3PIOA 4YHHQ 3L0OA 4JOIA 4OWTB 3L2PA 1N36L 4LF6Q 4UP9A 3LGJA 4PZ8A 4L5SA 4GKJQ 3OW2A 2VQEQ 1IBML 4HJ7A 1PVOA 2ALYB 4JI8Q 4DV7L 1Q86C 2N3SA 2ZTDA 1JJGA 4DV4Q 2WFWA 1K0RA 1AE3A 1FL0A 2R6GA 1SMXA 2KENA 4JBMA 1MJEA 2I5LX 4DR7Q 1VQMA 2IX0A 4AYBG 3KDFA 1GO3E 4P73A 3IRBA 3GTJH 2AWNA 4WJ4A 1UE5A 2EQSA 3K80C 1VCIA 1WYDA 2ZTCA 3TS2A 3F2BA 4BXXG 2IT1A 1K73C 3SGIA 4A3DH 1SR3A 4DV2Q 3HOXH 3W1BA 2E2HH 2JK8A 1HNXL 1E1TA 2MNAA 1U5KA 4WJ3M 2JA5G 1LYLA 4JI5Q 1P8LA 1Q12A 5E7NA 2QA4A 1OXVA 4R1JA 1TWAH 1YIJA 2GVAA 3KF6B 4LF5L 1T9HA 1MKHA 5EAYA 3S1NH 1XPOA 3GTKH 3JAMc 3EIVA 2JA7H 4R4QA 1KXLA 1S72A 1G291 4GOPA 3I4MH 1E24A 2K14A 2QGQA 1HNZL 4A3BH 4JI0L 5ELOA 1EOVA 2MO0A 3PCOB 4JBJA 3ZJYC 5C4JH 3A5UA 1HZBA 1R9TH 1XNRL 1V1QA 2AKWB 5GAEC 1X54A 1OTCA 4JI6Q 4P74A 3D0FA 3J80c 2JA6H 3T1YQ 5IY0A 2JA8H 3CP0A 5C0XG 4BY7H 5GAGC 2R7ZH 3GTOH 1KAWA 3FP9A 1K9MC 4A3JG 5HGQA 1X56A 2B3GA 4GNXC 1SRUA 3K0XA 3I7FA 4JYAL 2A1AA 3F2DA 2CWPA 5JEAJ 4GOPC 1HNXQ 2AMCB 3CC4A 1PYBA 5C4XH 2ID0A 1YI2A 4LF4L 1YZ6A 4GLXA 1OXSC 1IBKL 3CCVA 4JG2A 5IYDH 4YY3Q 2WB1G 3AEVA
chains in the Genus database with same CATH superfamily
1I3QB 3OIPA 5ELDA 5LMNW 2K5DA 2NZOA 2UU9Q 2JEAI 4JI3Q 4Y52H 1NBWA 1FJGL 4A3EH 4OO1I 4BY7G 1PH4A 4IO9A 4EGVA 3T13A 4B3TQ 1CTMA 4R4CA 2PO4A 4LFCL 1PH6A 1LTRD 4XT3B 2HIVA 3F2UA 2LXJA 2F0WA 4FF4A 1EEFD 4LF4Q 2Q8RE 1LACA 3O13A 4KD3A 2L0CA 4IPDA 3FKIB 3K7AH 3VR5A 4DV4L 2Z4IA 2WB1B 4IOCA 1TWCH 5ISRA 3MEHA 1OO9B 3EROA 1XNQQ 3BDOA 4LAAA 3SE0A 2K01A 2RF4A 1KQSA 2KCNA 1UE1A 4MTNA 1B4OA 1KD1C 1K8OA 1GM5A 5EQ0A 3C3LA 1F9RA 4TQUS 4X65Q 4QIWB 1IKMA 1WTHA 1Y14B 1EYCA 4ODGA 4C3JG 1M8AA 2K75A 4ID6A 1SXTA 4JI5L 4C3IH 3VA5A 5C6AA 4NDXA 2PW7A 1HH2P 1Z7TA 1MSHA 1Q1BA 4A3MG 4DNRB 3BG3A 4DR3Q 5EBCA 4YCVA 1TR5A 3WOFA 4LMQD 4F8MA 4TKOB 2B8GA 2WIIB 1DOLA 3OWEB 1BO0A 1W6JA 3E9HA 1FD7D 1PTOB 2ZT9C 2TSSA 1A3VA 1Q81C 5FLMG 3U58A 1X32A 1VQFA 1T5XD 4ZKCB 3PIO3 5LMUQ 2R3ZA 1C8CA 4C3IG 2RCFA 5G3LD 3CPFA 2P5ZX 2R7DA 4IJHA 5AFWA 3QJYA 1RTOA 4YY3L 1O7YA 3R2IA 4C3JB 2HIXA 5CV9A 3P7JA 1XYIA 3RNUA 4YWKA 2HT1A 4A3MB 4KHPL 1G2SA 4M1UB 4MIUA 3WDNA 4JCVE 3M4OH 3CF5A 4ZCKA 2KHJA 2PZWA 4QY7A 1BBWA 5ELBA 1SFOB 1F9QA 3C1EA 1WTVA 3PGZA 3KLRA 4KY7A 1ASZA 2UXDL 4A3DG 4RCOA 2B2UC 4DK0A 2Q2IA 4RMFA 1PTOD 1PYWD 2Z4HA 4DU9A 2F0IA 1CK1A 1PFSA 2WKCA 2ZTEA 1I4XA 4JI7Q 1Q46A 4GZYC 2VZAA 5JEAG 3VR2A 1LABA 1EWCA 4A3BG 2A5HA 1Y8NB 5GQOA 4KTAA 1XPRA 2R7FA 3H0GH 3T56B 4LF7L 4OO1H 5FOBB 3CMAA 3ERSX 1VQCA 2JA8G 4LW1A 4IURA 5GAHC 2EJMA 4PMBA 1SN8A 4JBKA 3BS1A 4DV5Q 4HIDA 5GROA 2IY5B 2YYZA 3RD4A 1EU3A 5EPJA 3RLOA 1AZQA 2IL8A 4B9WA 5JJKA 1K0SA 4B3MQ 5IYDG 2F4VL 2NZ1D 2Y0SE 1CUKA 1TWGH 4KK7A 3D4DA 2UUAL 4RHSA 5J3BA 5I9PA 3GD7A 1EY4A 4IFDH 2EJGC 1SNQA 5BN4A 4QGUA 5ELNA 2YTVA 1SYBA 2RCNA 1DOKA 4LFAQ 4XYOA 4A3CG 4DV1Q 4DPGA 2L4NA 4A3BB 4DKAC 1I94L 5KRUA 2D0PA 1NMGA 2WKDA 1PTOC 2C5CA 5BN5A 3DM3A 1LTSD 2OWOA 1G51A 1MD2D 1F77A 2E2JH 3HFZB 5EGTA 4JVZA 5I9OA 3W1GA 3NTIA 1QCBD 4TVAB 4XQNA 2WV6D 4Q5VA 4KI0A 5CV6A 1VQ6A 2HHHQ 3T4AC 1EQRA 1CA5A 3S1QB 3M7GA 1FNUA 1PH9A 3PIPA 3G48A 3NBHA 5AJ3L 3N6RA 4GLVB 3U4VA 1GKHA 1JJ2A 3GTGB 4DR4Q 3U50C 5M3MB 4B3RL 5IYCG 2DJFC 2PQAA 3S15H 2JA5H 2NVXH 1MI2A 4EQPA 2RQXA 1Z6HA 3C2PA 2ICIA 1Q82C 4NXNQ 1BKBA 1X3EA 1VQ9A 1D5XC 1Y8PB 1IYJB 3ULPA 3MAQA 2VB3X 1KTKA 1HR0L 1PH8A 3NE5B 3MA2B 3Q24A 2VXWA 1KAAA 4C3HH 2A6HD 2MFIA 4DV3Q 1RCVD 2K33A 2EYJA 2N8NA 3HKSA 1A0IA 2E2IH 1GUSA 1F2ZA 4XIGS 1BOSA 3AFPA 5IODA 1HHVA 5T1IA 4KHZA 5BR8L 5I6YA 5IGGA 3Q23A 5LMNQ 1WTOA 1QVCA 4K0KL 3F1ZA 3BYYB 1X6OA 2DNCA 3A5ZB 5E4WC 2BA0A 1G91A 1M90C 1BUVT 4QF4A 5I4DA 1OXUA 1TKWB 1JOQA 3W2DA 1C4QA 1D1KA 2PMZE 1I50H 1SJED 3I90A 4OGQC 1ML0D 3K58A 4JV5L 1K3BC 1EFID 4BY1H 3DWQA 3TMEA 4H7BA 1DOMA 2CCZA 2K5VA 3K8AA 1BVSA 1KDCA 4DV6Q 4KMUC 2BH2A 3TREA 2E5LL 1Z9FA 2NVQH 3D6CA 4HSPA 2K52A 1STEA 4K5VA 5IWAL 4LF5Q 1UAPA 4OX9Q 1OXXK 5C5MA 2AQ2B 2X6GA 2F1MA 2KCTA 2PZTA 1GUNA 3KOJA 3H3VI 3BDCA 3VYSA 4JI0Q 1EQQA 1X55A 4XQQA 1WCMH 3CU7A 4DUZL 5JJLA 2G5DA 4CJ1B 2E2DC 5IT9E 1XNRQ 1CHPD 4BY1G 3F2CA 1PHJA 3G6EA 2M2LA 1DYQA 2EY2A 2UUCL 2EDGA 1NR4A 5CYUA 5I2YA 2JYOA 4JYAQ 1RL2A 4A3IH 1WTXA 3D6WA 1YBYA 2YTYA 3UDXA 4KN4C 1E2ZA 3BVGA 4QIWE 2WINB 1HQMC 1BQQT 1PTOF 2VQFL 3MXPA 3HOUG 5DAUA 1W6KA 4K8JA 4DXFA 4C2MH 4IPCA 1UEAB 3JAMi 4BS9A 2R93H 4QMGA 3MXNA 2O5IC 1ICWA 2AQ3B 3M3YB 3G7LA 1V8QA 3I70A 4DK3C 1XMOQ 1H9KA 1HFGA 4HMIA 1AEXA 3AB9A 1F2LA 1J5EQ 4A3IG 5CV8A 1FNWA 2NVYH 1VQ8A 1JWSD 5JVH3 4OWTB 3A7AB 1N36L 4MHEA 1PFNA 3LGJA 3H6MA 1ZYRD 3OW2A 1PVOA 4JI8Q 3TP7A 4DV7L 1Q86C 1TQOA 2EYLA 3D4RA 1X3PA 2NTSA 1CI3M 3DWAA 1U4LA 4RAUC 3K0YA 2KENA 5CV7A 3HOUB 3MWYW 1TS4A 1Y1WB 4P73A 3IRBA 1WTWA 3GTJH 5EPKA 3MHBA 3VR6A 2F0GA 2XNAC 2MNAA 1FGBD 3IKJA 1P8LA 1GUGA 3NQIA 5JPNC 3K5MA 1TWAH 2SEBD 3KF6B 1T9HA 1MKHA 1ILQA 2B2WA 3I73A 3CRLC 3EIVA 5IGFA 4C1NI 1S72A 4GOPA 2J0TD 1E24A 4ZKBB 2K14A 2O4XA 3P1HA 5C4JH 5L37A 1RDPD 2BE5D 1Y8OB 2EYFA 1V1QA 4J1MA 1FNVA 1ZXTA 1XWEA 2R7ZH 3IAYA 4A3JG 5J39A 2EYHA 5HGQA 1ILPA 2F0JA 2KOLA 1VF5C 4LF4L 1B3QA 3RUZA 2HUGA 3NSWA 3V05A 1PDQA 1Q3LA 3OYYA 1CQVA 1O7IA 3P75A 4MTKA 4LK1C 4DN4M 3JAME 3KBXA 1JCKB 4L6TB 1XNQL 1NTGA 1HA6A 4R4OA 4H02A 2AUJD 3I4LA 3T51B 5FJ8H 4PZ6A 3HGBA 4YCWA 4X65L 2I46A 3S24A 4DV0L 3H15A 4RG1A 1RF2D 4DNTB 4ZAIA 4A3KB 4UP8A 1AH9A 1P16A 1SE2A 3I4OA 3F8TA 4A3JB 1EYGA 3S1MB 2EJFC 4DR1Q 4LF6L 1BDOA 2AHOB 3PO2H 1CKMA 1IZ6A 2B2VA 2Y0SB 4GKJL 1JT8A 1CA6A 3EFXD 2MPMA 1E7ZA 5M3FG 4A93H 3GV6A 1B50A 1L0YB 5E4XA 3SK5A 5KNBA 4DR7L 2F0TA 5IT9L 4BBSH 2O5JC 2K32A 2ZM6Q 1G6PA 4HIMA 5IE8A 2R61A 4PG3A 1B53A 1LV9A 2B2YA 4X3UA 3BZDB 1SNCA 2F52A 5LMUL 1KIXA 1ENFA 2KA7A 5ELFA 1S5BD 4OIKA 1EY7A 1UWVA 3SDZA 3HOVH 2NB0A 1YEZA 4BBRG 4APVA 3FVQA 4GKKQ 1VQOA 1R4QB 3C46A 2IW3A 4X3KA 3S2DH 1K83B 4KV6A 1EYDA 5D65A 4HEDA 2JEBI 2VUMB 4WJWA 3ULJA 4P72A 3NELA 5GADC 5M3FB 4OWXB 1I6HB 2FHTA 4RKLA 1GHKA 1NAPA 4LF8Q 2F0EA 2LY7A 2B63G 1STGA 3T1YL 2X6LA 4JI2Q 3S16H 1G8ZD 2UUBQ 2F03A 1X3GA 1SSOA 4X62Q 2L9HA 4IALA 2OEOA 4KHVA 1PH3A 4ALPA 4IQZA 1N32Q 3D8GA 5CC4A 4CKCA 2NVTH 2Q2UA 1BNZA 4PZ7A 4DFAA 3UDGA 4QCLA 4BBRB 2K5NA 1V1PA 1U0LA 3DHQA 4GNXA 1ZEQX 4AH6A 3TS0A 1TXYA 4FDBA 5M5WB 1HRJA 1XTCD 4AQYL 4LF9Q 3LNNA 1EIHA 1B9MA 1L1OA 4B3SQ 1TWFH 1X9NA 1B70B 2F0OA 1AE2A 3MXNB 5JAVA 4IZ8A 2EE1A 1DONA 1LTGD 3S17B 4LUOA 1NNXA 3FKIH 3HEJA 3NK9A 3HOXG 1IBLQ 2B63B 4DUYL 5DNFA 1PRTF 3KBGA 2BDNA 4Y7NB 5K36H 3KFUA 5C3EH 4HCSA 3MVVA 4X64Q 1EY6A 3CCQA 1TU2B 1WD1A 2IHFA 3I4MG 2K04A 4DR6Q 4UPAA 2C9OA 4LFAL 5D3DA 3CD6A 3U9OA 4DV1L 1D2BA 1II3A 2H1EA 1LTTD 2A69D 2KUMA 1PMRA 3RZDH 2JA6G 1JE5A 2CKZB 4K14A 4RGNA 1MBYA 2JA9A 1VQ4A 3DWPA 1H95A 3ND8A 5DLQE 3SVMA 4JPBW 4A3LH 1D6EC 2PCFB 4GN4B 2ZXPA 3FHWA 2FXQA 5FLXc 4POFA 3HOXB 1EY8A 4DXGA 1PH7A 1Q7YC 1PV4A 2HHHL 3JC66 1V43A 2EY1A 3JAML 3K5LA 2EXDA 1WOCA 4IFDI 4ME3A 5A35A 4KY6A 4CKEA 1WJJA 3OMGA 3I4MB 4A3EG 3VYRA 1G2TA 4RCNA 3CQZH 1YNJC 4J15A 1TS2A 3RZOB 2JA6B 2Q2HA 5ELEA 4BY7B 4LUZA 1L2FA 4N8X1 4IFDJ 2ZXRA 4H13C 4IN3A 3BJUA 2F0LA 4JI4Q 2A73B 2EY5A 2MUYA 2B8FA 3PUZA 1VS0A 3J7ZC 3S14H 1SE4A 3QOLA 2A69C 3TEHB 3A8IE 1STNA 2OT2A 3QIAA 1QUQB 1TS5A 1D5MC 1UUPA 5IGDA 2J4XA 3MTSA 1VF7A 4OXPA 3M7NA 3I2ZA 1H9MA 1IYUA 2F4IA 1HNWQ 5I2XA 4BXXH 1YHQA 1GHJA 3N52A 5IIFA 1RHPA 4XQJA 3S9WA 5ELCA 1S5DD 5E1FA 1B1ZA 3EJIA 4HCEA 3OMCA 4DGZA 4HJAA 2EY6A 3CC2A 2C35B 2CQAA 2YV5A 4DK6C 3PF4A 3EBEA 5NUCA 2PW5A 3FEWX 1ICFB 4FVMA 2VY3A 1VQHA 1N34L 2RHQB 4PMCA 3K7AB 4CHTB 2IWHA 3NTHA 1B7YB 2D2CC 1EIGA 1BR9A 4V0BA 2RVLA 3W3AA 4YCUA 2K5QA 4DV6L 3PMFA 1BBXC 2PNHA 2F0SA 3MFGA 5IGCA 1I4GA 4QQBX 1EL0A 4OX9L 1KABA 1IBMQ 4ME5A 3J81c 2EYPA 1IW7D 1S4ZA 1S5CD 1FVIA 4C3IB 1STBA 2L5TA 2KCMA 3PQIA 3UE0A 3Q0AA 4Z9CB 1EZ6A 2VL6A 3HP3A 1NJIC 1PYSB 1AP0A 3L3OC 3I55A 3GV3A 2B2WC 4JI1L 4RFBA 5JJZA 1A2UA 4FYDA 3K57A 1J6QA 2DN8A 1LM0A 4CDEC 4A3GH 1E22A 2J7ZA 5KYIA 5J22A 3RLNA 4ZUIA 1N33L 4ABNA 1EZ8A 4A3DB 3I91A 1FYCA 3D31A 1HZAA 1WTRA 4HTHA 3CCJA 2BH8A 1HNZQ 1LT6D 1IKLA 1QILA 1J8IA 3S1RH 1JJCB 3E0EA 1Y1VH 3W5OA 1YJ9A 1EOTA 4K8IA 1V1PB 4GNXB 2F0DA 1A6XA 3H0GG 4DR5L 4JBWA 4OO1G 2CFMA 1WI5A 3J80E 1AW7A 2K7VA 1V1OA 2ZJQA 1XMQQ 1DM0B 3D3RA 3M4OB 1VQDA 2F0FA 1L1OB 2XWBB 3H94A 3MC0B 2K03A 1HR0W 1IW7C 3EN2A 1H9SA 1EFWA 2JA8B 5C3WA 3KLSX 1RKNA 4JI8L 3PUYA 5M5YH 2JSOA 4FNFA 5D3IB 1AZPA 1EWIA 4IFDG 1Y1VG 1VQAA 5KGUA 1FJGQ 2PQEA 4IPGA 4KY5A 1VMPA 1CSQA 1FGUA 2L11A 4FXDA 3UI2A 4X66Q 3T1HL 4IUNA 3KF8A 2N88A 3KK7A 1O7LA 3H0GB 2M9VA 4LFCQ 1PA6A 3BYTB 1QB5D 4M8AA 1DD2A 1I4RA 4YHHQ 3U9SA 1LT3D 2RDFA 2EYOA 2QILA 2VQEQ 1JC7A 1F9PA 1JJGA 5IOCA 4DV4Q 1BCPB 2WFWA 1K0RA 2R6GA 1SMXA 4QB4A 3NXWA 5C5LA 1MJEA 1QNKA 2SOBA 1NCVA 4KN7C 1TWGB 1ENAA 2DY7A 4AYBG 1I4HA 3TZDA 2EPBA 2EQSA 3TS2A 2IT1A 1K73C 1SR3A 3CRKC 2E2HH 4FO2A 1JOKA 2JA5G 2XIWA 4JI5Q 1Q12A 2QA4A 4I7AA 1OXVA 4B08A 4KD4A 3LX0A 5JPMC 3S1NH 3GTKH 2JA7H 2L12A 1EWHA 1TVXA 3A8JE 2EZVA 1YNND 3IL8A 2E2JB 4C3HG 2K6AA 1HZBA 2K1BA 4I65A 2Z1CA 1K28A 3J80c 4HR7B 3K5NA 1NSNS 1BCPD 3GTOH 1KAWA 4AYBB 3T16A 4I7ZC 2B3GA 4GNXC 1SRUA 3I7FA 4S3SA 2AMCB 3CC4A 5C4XH 3HS0C 1YZ6A 4GLXA 1IBKL 4JG2A 1HCZA 4RHRA 4YY3Q 3S15B 2JA5B 2NVXB 5G3LF 3PV0A 1QG7A 2UXBL 2XRSD 1FR3A 2YU9H 2A6HC 2A8VA 3PO3H 4F7XA 5BN3A 4KHPQ 2V1CC 4ZUJA 1XJVA 3X3MA 3PSIA 4IUUA 2PI2A 4HJ5A 3CPWA 1GVPA 1IXRA 1I6VC 1LTID 3VDYA 1KLGD 2VS1A 4HN7A 2E2IB 1SROA 1LO5D 2MGSA 2XN9C 3CKIB 4GKKL 3A74A 3VYTA 2LXKA 2G9DA 3STBD 2XWJB 1Y1WH 1YNNC 3HOYH 2MHVA 3NPPA 3M9BA 1PH5A 3MXGA 1QOHA 4KKUA 5IYBH 4TSSA 3X3NA 3Q22A 2ES2A 1WCMG 4O0AA 3DLLA 1DZ1A 1I50B 2MP1A 4GS3A 2BOSA 1BCPC 3LWEA 4LF7Q 4LF8L 5EKIA 3OOCA 3AYHB 1CZWA 3QB3A 4IPHA 4YWLA 1L0XB 3SXHA 4JI2L 3BVMA 1PH1A 2UUBL 4BY1B 4K2KA 2CW0D 4NXMQ 5C44H 1YNXA 1N32L 2R92H 3SK6A 3GTQH 2F4VQ 4PNYA 5C4HA 2NVQB 2Z9HA 2F0UA 3HG9A 2UUAQ 3QG1A 4AIMA 3I4NH 2CH4A 2QDLA 4P71A 2PYKA 2I5HA 3CMEA 4CDCC 2KVMA 1DCZA 1AFPA 4IUTA 1MJCA 1EYAA 2R93G 1VQPA 2CH4W 3PIP3 5CR3A 1I94Q 1DJRD 1WCMB 4JI6L 1QWYA 1KRSA 1LTLA 5C44G 4MNOA 3KJOA 2KQ3A 3R3OA 2EIFA 4A3FH 5EJWA 3TN2A 1KLUD 1KRTA 3STBC 4FP5D 1X3FA 4DR2Q 4A3IB 4G7ZC 1A62A 3FPPA 1B8AA 1MIUA 4KLKA 2Q2TA 2ATWA 5IP7H 1SYCA 3CCRA 3S2HH 5M5XB 5JVG3 2JN4A 3H91A 3SK8A 5KNCA 2EXZA 4A76A 4N9PA 5A2QE 1EEID 2NTTA 2F0MA 1VQKA 2UU9L 4JI3L 4C2MB 4A3KH 1NR2A 5AJ3Q 4A4IA 2VW9A 3J7AF 4MN3A 1RJTA 2NN6H 3GTPH 4G7OC 1WTQA 4B3TL 3NBHB 1ZYRC 1B44D 2JQOA 3KF8B 2NVYB 4C56C 1SEBD 4UY8C 2HCCA 4DNIA 1XX8A 2K5WA 2AWOA 1HR0Q 2PQAB 5CGKA 4DA2A 4DAMA 4GN3B 3PF5A 4EVOA 2L15A 4DAPA 3TRZA 5CBAE 3RN2A 1PZJD 4O2DA 3HOWH 2XTIA 1PH2A 3GTLH 5I6WA 3K7UC 2R7ZG 1GOZA 3WOEA 2MQHA 4K0KQ 3KLWA 3L9AX 3GTMH 3GTJB 3M4QA 4K6DA 3R8BA 3HOZH 3NENA 2QDBA 3K59A 1QVFA 4O1NA 4DR3L 2E76C 2IHEA 2Z6KA 1LT5D 2D0OA 4ZQ3A 2FFKB 3C1FA 2BE5C 1KHIA 1XTDA 1CQFA 1RD9D 1QJOA 4LWCA 5FJ8G 1YVCA 3ULLA 5C4JB 2BCOA 3DMUA 2F0QA 2E5LQ 3G4SA 2N49A 3OTOQ 2R7ZB 2A6ED 4CDDC 2RKSA 5IWAQ 1PLFA 4EQOA 3CAMA 3PO2G 1U9RA 5FKAC 1TWHH 5HGTA 1F9SA 4FF1A 3J81i 5FLXE 1K8AC 2KHIA 4A93G 4DUZQ 3R2TA 1GD7A 1H9JA 4A75A 2CVRA 2K50A 5D14A 1PFMA 3M85A 4BBSG 2UUCQ 3ONAB 1OXTA 1CM9A 4PV1C 4U673 3RN5A 2IJ0A 2MJ8A 2RDGA 4L8JA 2CWAA 4GN5A 1HUNA 1X65A 1I3QH 1JOOA 2ASBA 3HOVG 1S5ED 1STAA 2VQFQ 4X6AH 3RMHA 2G9HD 3LWUA 2EOTA 1K8GA 4F87A 2D5DA 2N55A 3OPOA 4JI7L 1HJPA 1X3QA 3PO2B 2VNUD 4L63B 2KECA 3ICEA 4A93B 4F88A 3DUZA 3NUCA 2IX1A 5C0XH 2JXMB 1MGSA 3HKZE 2QF7A 2A6EC 4IUQA 2QW7A 1Q1EA 2KJXA 4E6IA 1SBBB 4DV5L 1N36Q 3WWVA 4AYBE 4P75A 1U4RA 1YHBA 4YWMA 2WACA 4QUCA 2OTJA 4DV7Q 2RHSB 1U4MA 1JORA 4B3ML 2WAQG 3I56A 4O42A 3CXCA 3HOVB 3M4YA 4XXEA 1YJNA 1SYGA 2XSCA 2OXPA 3QR8A 1V9PA 5A2QL 1DGSA 1B9NA 5T1GA 3S2DB 4R8NA 3RZOH 5KEEA 1BBUA 4NB3A 2JE6I 5DM73 1LTBD 1MHWC 1XMQL 2NYZD 4CBVA 4EQ5A 1ESRA 1K8MA 3FKIG 1O80A 4NW2A 1K3RA 3OHXC 4PMWA 4JW0A 3S16B 1C9OA 2HQEA 5K36G 1QVGA 1EY5A 1W2BA 2LKVA 5C3EG 3PUVA 2A68D 3J81E 2RBMA 4CKBA 4WRDA 1HZ9A 1PTOH 4MZ9A 2NVTB 2F3WA 3UE1A 3MEFA 2WAQB 4EQNA 1M4VA 4L5RC 4KJOA 2JP1A 5DM63 2B2TA 1EQTA 3DM1A 4X66L 1PZKD 2FMMA 4GOPB 3A56A 2F3VA 4HMJA 1SNMA 4DR4L 1F2YA 1HPCA 3H3VC 1R9TB 2WP8J 4CDFC 1TWFB 4YHHL 4OELB 1NY4A 2IPKD 3CCEA 4A3LG 3BZKA 4C3JH 2UXCQ 2VQEL 1D7QA 2L55A 1HQRD 1GUWA 1LUZA 4NXNL 4A3MH 1SAPA 3AU7A 3CCUA 1SMYD 5IGEA 4GLAC 4DK1A 1HTPA 1A15A 1CKNA 1SFOH 2NZHA 5C3EB 3UDIA 1SLJA 1HXYD 4DV3L 4RKBA 2QEXA 2KCCA 5FLMH 1KNAA 2CQOA 3HZXA 4DV0Q 4OL7A 3J80i 1D1IA 2EVBA 5LMNL 4OWWB 3SR1A 3FRPB 3RZDB 4LFBQ 4A3EB 4U68A 4JOIA 3L2PA 4LF6Q 4UP9A 4PZ8A 4L5SA 2A68C 4GKJQ 4Q0FA 4HJ7A 2QEJC 2ALYB 2ZXOA 4G4KA 5FLXL 2N3SA 1ET6A 3GQBA 3VYUA 1VMCA 1FL0A 4KKTA 3TZUA 4DR7Q 2I5LX 3TP6A 1VQMA 1HTLD 4G7HC 1DXMA 1ET9A 3KDFA 3TSSA 1GJXA 1EY0A 1G6ZA 1Q8IA 2LFNA 2AWNA 2M00A 1UE5A 1SYEA 3K80C 1VCIA 2ZTCA 5M9OA 1TWCB 4BXXG 4A3DH 4DV2Q 2EYMA 3W1BA 4WJ3M 3CQZB 1GUOA 3NHHA 4HSVA 5J1ZA 5FO7B 2FJ2A 4R1JA 1D5ZC 2AQ1B 1SMYC 2GVAA 4LF5L 4H44C 3SK4A 1XPOA 1KXLA 5JEAH 1G291 1STHA 1B3AA 1QE6A 3DEPA 4A3BH 3QO2A 4JI0L 4UHVA 1EOVA 2MO0A 3PCOB 3A5UA 1O78A 1XNRL 3IFDA 3S14B 1X54A 1AN8A 3D0FA 3T1YQ 2A74C 5KIXA 2JA8H 3CP0A 5GAGC 2PPBC 3FP9A 3NWTA 1K9MC 3DXJC 5LHY1 4NP5A 3K0XA 4JYAL 2A1AA 3F2DA 4YIJA 4GOPC 1HNXQ 3OWFA 2D9UA 1YI2A 1OXSC 3CCVA 5IYDH 5IGBA 1EQVA 3S1QH 5KNDA 4UP7A 1SE8A 1IYVA 2F3IA 2A19A 4G57A 1D8LA 3ITPA 4BA1I 1HZCA 1ONLA 2MO1A 4AQYQ 3GTGH 5M3MH 3E0JA 4A3CH 4CGYB 4ZRZA 4DAYA 1U4PA 3KYHC 2F0HA 1XMOL 3FDTA 2DY8A 4HJ8A 4NXML 1J5EL 4DUYQ 4P2CB 3CCSA 4RGTA 2K05A 1YITA 2NBFA 4A3GG 1M1KC 4JC0A 1JB7A 3R93A 3J81L 2KBNA 1VQNA 3I3CA 1CKOA 3CW2C 4B9XA 5M3MG 1SNOA 4RWSC 4ILWA 1CT1D 2HQLA 5EKKA 4K5WA 1QZHA 2V4DA 3FMCA 4HIKA 4J6HA 3J7A5 3KF6A 4OONA 2B2VC 4KJNA 1LTAD 4K2LA 5IYCH 3MXUA 2Z6KC 3IFTA 3CC7A 2Z6BA 2PI2E 2Q8IB 1TT2A 4R8IA 4IUVA 2F0PA 4L5QA 4DR2L 5C3XA 2ZJRA 4XYQA 2VB2X 1E1OA 3EA6A 4A3GB 1PFBA 2B2YC 3A0JA 4PQXA 1VQJA 3HKZG 1VQLA 4RGMA 5CMDA 1E3PA 2X69A 2DGYA 1SYFA 3DEOA 3H09A 3A55A 5CV4A 4RGOS 3S1RB 3GO5A 3I8ZA 2RDHA 1Y1VB 1CZGA 2N78A 2B39A 1S40A 4LNQA 3K81C 5JOBA 2F0VA 4XTCS 1C0AA 4NMZA 1JWUD 4UDUC 4LUVA 3ER0A 1Y69U 1UE6A 2LS01 1VQEA 3SEBA 3FPUB 1VDZA 5JJIA 1A8VA 1E2WA 5K5PA 5KYLA 5M5YB 1VQBA 4BA2I 2KHSA 4IJLA 3CCLA 1CKNB 2E74C 1VQIA 3HKZB 1ENCA 1SE3A 3NBIA 2XRQD 3I72A 4EX5A 1CFMA 4ZLTF 2NN6I 4X3SA 1I4QA 2Q8TA 4ZK9B 1A2TA 2E8GA 2GA4B 2SNSA 3RLFA 4DR1L 4JK1C 1S5FD 2RSOA 2ZJPA 4DAVA 3G6JB 1N9WA 1L1OC 1N8RC 1WTPA 2JA7G 4UAIA 1N34Q 3M3YH 3TQYA 2CHBD 3GP7A 4H0LC 1RIPA 4R4IA 1B2TA 1UEBA 2ZM6L 2WAQE 2OTLA 4C3HB 3BDLA 2BDOA 5DEHA 3KDFB 1W3SA 1YHAA 3OTOL 2UXDQ 4BWGB 1LT4D 3D4WA 1EIFA 5EBDA 5C4XG 3HOUH 1Z47A 2E2HB 3K5OA 1IL2A 2SDFA 4OIJA 3P20A 2QCPX 4QL5A 2DUDA 3V2TA 1PRTB 3TDQA 3PO3G 2WB1E 3S1NB 3GTKB 2JA7B 1BXTA 3G71A 4K6LA 3E9IA 1H9RA 3VR4A 1RTNA 4RA8A 1EIYB 1JWMD 4JI1Q 3NTKA 4C1NK 3J80L 1GXDC 2HDMA 3AFQA 4HJ9A 1SJHD 3NP8A 5M5XH 1LLRD 3NQTA 5TSSA 1KC8C 3GTOB 5COYA 2K5HA 4X62L 3BZCA 2B2TC 2I0QA 1N33Q 1VQ5A 4N9TA 3KLSA 1CHQD 1IHZA 1PXUA 1KDAA 1Q8KA 2PNRC 3CCMA 4NPSA 1Y1WG 3HOYG 1VQGA 4J8QA 1UE7A 5IYBG 5C4XB 1NUCA 2OF1A 1WVLA 5C4ZA 3GDEA 4QJFA 2H4OA 3NEMA 1I5FA 5EKLA 4DR5Q 4LF9L 1QZGA 2YU9B 2O2LD 3PO3B 4FF2A 4B3SL 4TRDA 1E2VA 1BF4A 3ZYYX 2OCEA 2RSNA 1PRTD 4FXKC 3SHLA 1JMCA 1KL9A 1KNEA 4DAYB 2GVBA 4XDXA 1IBLL 1HUMA 3BU2A 5CV5A 1SYDA 3MFYA 3UDFA 2R92G 1T5EA 2I07B 2K4KA 3I4NG 4X64L 2PZUA 2KEDA 1H9SB 2B2UA 2F0NA 4DR6L 3HOYB 2ENBA 2Z8LA 2NWGA 3A7LA 2FINB 4JOIC 5CBEE 1JB3A 1EY9A 3URYA 2OQ0A 1RODA 3T1HQ 4A3JH 1Q90A 3PUWA 2RA4A 5C0XI 4CJ2C 1C7YA 3S1MH 2R93B 1JR0D 2CW0C 5LL6X 4B3RQ 3E6ZX 3L7ZC 3TBIB 2E75C 3EVQA 4A3FG 3KJPA 2GN5A 4R4TA 1WFQA 5LL6S 3E5SA 1HFNA 3J81j 5C44B 3T53B 1C48A 5IP7G 2H5XA 5IP9H 2R92B 5C0XJ 4FF3A 1I4PA 2NUCA 1A3UA 4IOAA 3J7YW 5IT9c 1NMFA 1XXGA 1VQ7A 3GTQB 1TY0A 3ERQA 3PUXA 3I4NB 1S3OA 2Z0SA 1NE3A 4A3KG 2SNMA 1PRTC 2B29A 2DNEA 3EQLC 4HIOA 1TS3A 2NN6G 5BR8Q 2Y0SG 3A8KE 4NKLA 1K83H 2UXCL 1EU4A 4XT1B 2VUMH 1JE4A 5EPLA 1CSPA 1IL8A 4A3FB 5IP9G 3H3VH 1QUQA 1ZKOA 4JI4L 5M3FH 1L0WA 1I6HH 2YTXA 1YJWA 4ULLA 2XVSA 2ICEC 4OEMB 1TWAB 4V190 3S2HB 3BVZA 2I5MX 4JV5Q 3B6YA 2D62A 3QWNA 3HOWG 3Q8DA 1A63A 1HNWL 4OHJA 3U4ZA 3M4PA 1WD0A 4LFBL 3K6OA 1BCPF 4IUPA 3HRZC 3ND9A 4FXGC 2VUMG 3GTPB 4LJZC 4BBRH 1IBKQ 3HOZG 4L5TA 1J9OA 1E0BA 1PZID 3RR5A 1GUTA 3NWSA 5FK9C 5M5WH 2UXBQ 5HY6A 4CJ0B 2OQKA 1TIID 5FO8B 1EUJA 4POGA 2JJQA 2TMPA 5FO9B 1SNPA 5CORA 3S17H 4N8FA 3Q6SA 3OW7A 2LSSA 2B63H 1KDBA 1ASYA 5H1SE 3AQQA 3A54A 3TP8A 4DV2L 2BA1A 1MSGA 4Y7NH 3J7AV 1XPUA 1TY2A 3AMUA 2XGTA 3HOWB 3PIOA 3GTLB 4R9WA 3L0OA 3OIQA 4K5XA 1ESFA 3V96A 1SNDA 1IBML 2KEEA 3GTMB 2HDLA 3TP5A 2ZTDA 2F0KA 1JQYD 3HOZB 1AE3A 2FMCA 3OSOA 4JBMA 4RH6A 2IX0A 1O7ZA 2HCIA 2DJGC 3QOJA 1GO3E 5HURA 4WJ4A 1WYDA 1F2MA 3F2BA 3SGIA 1STYA 4BBSB 3HOXH 2HD3A 2JK8A 1HNXL 1E1TA 1U5KA 4X3TA 1LYLA 5E7NA 1R4PB 1YIJA 4DF7A 2LMCB 2IX3A 4WFN3 3E3XA 5EAYA 4ZYSA 3JAMc 4R4QA 3VR3A 2QKIC 3I4MH 3MZ5A 4HAEA 5F2DA 2L1BA 2QGQA 1HNZL 1TWHB 5ELOA 3ZJYC 4JBJA 1R9TH 2AKWB 5GAEC 4JI6Q 1OTCA 1SDFA 4P74A 2JA6H 5IY0A 5C0XG 4BY7H 1A3TA 4WORA 1YNJD 3VA7A 5E3FA 1X56A 2K28A 1JICA 2CWPA 5JEAJ 2PMZB 4QUFA 2AUKA 1PYBA 2ID0A 1HA5A 3KUPA 3CHBD 1QNUA 2WB1G 1UNSA 4KKSA 3AEVA
chains in the Genus database with same CATH topology
3S1QH 3PV0A 3OYYA 4UP7A 2UXBL 1O7IA 1SE8A 2F3IA 2A19A 2YU9H 2A8VA 3PO3H 4KHPQ 1D8LA 2V1CC 4BA1I 5LMNW 1HZCA 2NZOA 1XJVA 2MO1A 2UU9Q 2JEAI 4AQYQ 3GTGH 3PSIA 4JI3Q 1XNQL 1NTGA 5M3MH 4Y52H 1NBWA 2PI2A 4A3CH 4R4OA 4HJ5A 1FJGL 4H02A 4A3EH 3CPWA 4OO1I 1GVPA 4BY7G 1IXRA 5FJ8H 4PZ6A 3KYHC 3VDYA 1XMOL 4IO9A 1PH4A 4YCWA 4X65L 3S24A 4DV0L 4HJ8A 2VS1A 3H15A 4RG1A 1J5EL 4NXML 4B3TQ 4R4CA 4DUYQ 1SROA 1AH9A 1PH6A 4UP8A 4LFCL 1P16A 3CCSA 3I4OA 3F8TA 1YITA 2HIVA 1EYGA 2LXJA 4DR1Q 3A74A 4LF6L 4GKKL 2AHOB 4A3GG 1M1KC 2LXKA 4JC0A 1JB7A 1CKMA 1IZ6A 4LF4Q 3STBD 3PO2H 4GKJL 1Y1WH 3HOYH 1JT8A 3M9BA 1PH5A 2KBNA 4IPDA 5IYBH 1VQNA 3K7AH 1E7ZA 5M3FG 4A93H 1CKOA 4DV4L 3CW2C 4IOCA 2ES2A 1WCMG 1TWCH 4O0AA 5M3MG 3DLLA 4DR7L 4GS3A 4BBSH 1G6PA 2ZM6Q 1XNQQ 4LF7Q 4HIMA 4LF8L 5IE8A 2HQLA 1QZHA 2RF4A 1KQSA 4PG3A 1UE1A 3AYHB 4MTNA 4IPHA 4YWLA 4HIKA 3J7A5 3KF6A 4OONA 4JI2L 1KD1C 1PH1A 1GM5A 5IYCH 2UUBL 2F52A 5LMUL 4TQUS 4X65Q 1KIXA 4NXMQ 5C44H 2Z6KC 1Y14B 3CC7A 1UWVA 1YNXA 2PI2E 3HOVH 2K75A 1N32L 4JI5L 2R92H 4C3IH 4L5QA 1YEZA 4BBRG 4APVA 4DR2L 3GTQH 2F4VQ 2ZJRA 1VQOA 1HH2P 4GKKQ 1Q1BA 3S2DH 4A3MG 2UUAQ 4AIMA 4DR3Q 3I4NH 1E1OA 4P71A 2JEBI 4YCVA 2I5HA 3CMEA 3A0JA 3ULJA 1MJCA 4P72A 3NELA 1VQJA 3HKZG 5GADC 2R93G 1VQPA 1VQLA 4OWXB 1E3PA 3E9HA 2DGYA 4LF8Q 1I94Q 1Q81C 4JI6L 2B63G 1KRSA 3GO5A 5FLMG 3T1YL 1LTLA 3U58A 1VQFA 2N78A 4JI2Q 3S16H 5C44G 1S40A 4LNQA 4MNOA 3KJOA 2UUBQ 5LMUQ 1X3GA 2EIFA 3K81C 4A3FH 4X62Q 4XTCS 1KRTA 3STBC 1PH3A 4ALPA 3CPFA 1C0AA 1N32Q 2R7DA 4IJHA 2NVTH 1X3FA 4DR2Q 2Q2UA 4PZ7A 1A62A 4LUVA 1B8AA 3UDGA 1MIUA 4KLKA 4YY3L 2Q2TA 5IP7H 3ER0A 3CCRA 2ATWA 3S2HH 2HIXA 1UE6A 2K5NA 1U0LA 1VQEA 4GNXA 4AH6A 4A76A 3TS0A 5JJIA 1TXYA 1A8VA 3RNUA 4YWKA 4FDBA 2HT1A 1VQBA 4KHPL 4BA2I 1VQKA 2UU9L 4IJLA 4AQYL 4JI3L 4A3KH 4LF9Q 4JCVE 5AJ3Q 3M4OH 4A4IA 1L1OA 2VW9A 3CF5A 3CCLA 4B3SQ 1TWFH 2KHJA 1X9NA 1CKNB 4QY7A 1BBWA 1B70B 1VQIA 3GTPH 1AE2A 3MXNB 3PGZA 4EX5A 1ASZA 2NN6I 2UXDL 4A3DG 4LUOA 3FKIH 1IBLQ 3HOXG 4B3TL 2E8GA 4DUYL 2Q2IA 3NBHB 4RMFA 3RLFA 2JQOA 3KF8B 4DR1L 4UY8C 3KFUA 1PFSA 2ZJPA 5C3EH 2ZTEA 4DNIA 1N9WA 1L1OC 2AWOA 1N8RC 4JI7Q 1Q46A 4X64Q 1HR0Q 2PQAB 3CCQA 2JA7G 2IHFA 2VZAA 5JEAG 4DAMA 1N34Q 4GN3B 3I4MG 3M3YH 4DR6Q 3TQYA 4UPAA 4A3BG 3PF5A 4LFAL 2L15A 3CD6A 4DV1L 5GQOA 1RIPA 4R4IA 1XPRA 3TRZA 1UEBA 2R7FA 3H0GH 2ZM6L 3RN2A 4LF7L 4O2DA 2WAQE 3CMAA 3RZDH 3ERSX 2JA6G 2XTIA 1JE5A 1VQCA 1PH2A 2CKZB 4LW1A 2JA8G 3K7UC 3GTLH 2R7ZG 5GAHC 2OTLA 2MQHA 1SN8A 2JA9A 4K0KQ 3KLWA 1VQ4A 4JBKA 4DV5Q 4HIDA 3KDFB 1W3SA 5DLQE 1H95A 5GROA 1YHAA 3OTOL 3GTMH 2YYZA 2IY5B 2UXDQ 4A3LH 3M4QA 3RLOA 4GN4B 1EIFA 3FHWA 3HOZH 2FXQA 5FLXc 5C4XG 4POFA 5JJKA 3NENA 1Z47A 5IYDG 4B3MQ 3HOUH 2F4VL 1PH7A 1Q7YC 2Y0SE 1PV4A 1IL2A 1QVFA 1CUKA 1TWGH 4QL5A 2UUAL 5J3BA 4DR3L 2DUDA 3JC66 2HHHL 3GD7A 1V43A 2IHEA 2Z6KA 2D0OA 3PO3G 4QGUA 2EXDA 5ELNA 2YTVA 2WB1E 1WOCA 1KHIA 2RCNA 1XTDA 4ME3A 4LFAQ 4IFDI 4A3CG 4DV1Q 1WJJA 3G71A 4DPGA 3E9IA 4LWCA 4A3EG 4DKAC 1EIYB 1I94L 5FJ8G 3CQZH 1YVCA 2D0PA 3ULLA 4JI1Q 4J15A 1NMGA 3AFQA 4HJ9A 2E5LQ 3DM3A 5M5XH 3G4SA 2Q2HA 2N49A 3OTOQ 1KC8C 4LUZA 1L2FA 2K5HA 4X62L 2OWOA 3BZCA 5IWAQ 4IFDJ 3CAMA 1G51A 2I0QA 1N33Q 1VQ5A 3BJUA 2E2JH 3HFZB 3PO2G 3W1GA 4JI4Q 1TWHH 1Q8KA 1Y1WG 3CCMA 3HOYG 3J81i 4NPSA 1VQGA 1K8AC 3PUZA 1UE7A 4TVAB 5IYBG 1VS0A 2KHIA 4A93G 3J7ZC 3S14H 4KI0A 4DUZQ 1VQ6A 1GD7A 2HHHQ 4A75A 3TEHB 2K50A 1EQRA 3GDEA 1PH9A 4QJFA 3PIPA 3M85A 3G48A 4BBSG 3NEMA 1I5FA 4DR5Q 2UUCQ 1QUQB 4LF9L 1QZGA 5AJ3L 1OXTA 4OXPA 4GLVB 3U4VA 1GKHA 1JJ2A 3I2ZA 4B3SL 3M7NA 1HNWQ 3RN5A 4DR4Q 3U50C 4BXXH 4B3RL 1YHQA 2OCEA 1JMCA 1KL9A 4DAYB 5IYCG 2GVBA 2CWAA 2PQAA 4GN5A 3S15H 1IBLL 2JA5H 2NVXH 3BU2A 1X65A 1I3QH 2ASBA 3UDFA 3HOVG 2R92G 2VQFQ 1Q82C 4X6AH 4NXNQ 1BKBA 4HJAA 1K8GA 1X3EA 1VQ9A 2K4KA 3CC2A 2C35B 1IYJB 2YV5A 4DK6C 3PF4A 3EBEA 3ULPA 3I4NG 4JI7L 1HJPA 4X64L 1HR0L 1PH8A 2VNUD 2VY3A 1VQHA 1N34L 4C3HH 4DR6L 2RHQB 2MFIA 4DV3Q 3HKSA 2N8NA 4JOIC 3ICEA 1A0IA 1B7YB 2IX1A 2E2IH 4XIGS 3AFPA 2OQ0A 3T1HQ 4A3JH 4KHZA 5BR8L 3PUWA 5C0XI 5LMNQ 3HKZE 1C7YA 4YCUA 3S1MH 4B3RQ 1Q1EA 1QVCA 3L7ZC 4DV6L 4K0KL 3F1ZA 2PNHA 4DV5L 1X6OA 4QQBX 1N36Q 3WWVA 3A5ZB 4A3FG 2BA0A 4AYBE 3KJPA 2GN5A 4P75A 4R4TA 1WFQA 1M90C 1YHBA 4YWMA 4OX9L 1OXUA 1IBMQ 3J81c 2OTJA 4DV7Q 3J81j 2PMZE 2RHSB 4B3ML 1I50H 2WAQG 3I56A 5IP7G 2H5XA 5IP9H 3CXCA 1FVIA 5C0XJ 1YJNA 4IOAA 1VQ7A 5IT9c 1NMFA 1V9PA 2KCMA 1DGSA 3UE0A 4JV5L 3PUXA 3RZOH 1S3OA 2Z0SA 1BBUA 1NE3A 4NB3A 4A3KG 2VL6A 4BY1H 1NJIC 2JE6I 2B29A 4HIOA 2CCZA 1PYSB 1XMQL 2NN6G 2K5VA 3I55A 3K8AA 5BR8Q 4JI1L 1BVSA 2Y0SG 3HOWH 4EQ5A 4DV6Q 1J6QA 3FKIG 2BH2A 3TREA 2E5LL 1K83H 1Z9FA 1LM0A 2NVQH 1K3RA 2UXCL 2K52A 4PMWA 5IWAL 4A3GH 2VUMH 4LF5Q 4OX9Q 1E22A 1C9OA 1OXXK 1CSPA 3RLNA 1N33L 5K36G 1QVGA 2KCTA 1W2BA 5IP9G 3H3VH 1QUQA 5C3EG 4JI4L 3PUVA 5M3FH 3D31A 1L0WA 3KOJA 1HZAA 2YTXA 1I6HH 3H3VI 3CCJA 1HZ9A 2BH8A 4MZ9A 1HNZQ 1YJWA 3UE1A 1EQQA 1X55A 4JI0Q 1WCMH 3MEFA 4DUZL 5JJLA 3S1RH 4L5RC 1JJCB 3E0EA 1Y1VH 1XNRQ 3W5OA 1YJ9A 4BY1G 3F2CA 2I5MX 1PHJA 4JV5Q 3G6EA 4GNXB 3H0GG 3B6YA 4DR5L 4JBWA 2UUCL 2D62A 4X66L 4OO1G 2CFMA 1WI5A 4GOPB 3HOWG 3Q8DA 1A63A 1HNWL 4DR4L 3U4ZA 1XMQQ 3M4PA 2ZJQA 4JYAQ 2WP8J 1RL2A 1VQDA 1L1OB 4A3IH 4LFBL 4YHHL 1YBYA 2YTYA 1NY4A 3UDXA 3CCEA 1HR0W 4A3LG 3BZKA 3EN2A 4C3JH 1EFWA 2VUMG 2UXCQ 4BBRH 1IBKQ 2VQEL 1D7QA 4QIWE 3HOZG 4L5TA 2VQFL 4JI8L 3PUYA 3RR5A 5M5YH 1LUZA 4NXNL 4A3MH 3HOUG 5M5WH 2UXBQ 5HY6A 3CCUA 4C2MH 2OQKA 4GLAC 4IPCA 1EUJA 1EWIA 1CKNA 2JJQA 3JAMi 1Y1VG 1SFOH 2NZHA 4POGA 4IFDG 2R93H 3UDIA 1VQAA 1SLJA 1FJGQ 4DV3L 4IPGA 2QEXA 3S17H 2LSSA 1CSQA 1FGUA 4DK3C 5FLMH 1XMOQ 1ASYA 2B63H 4X66Q 2CQOA 5H1SE 3T1HL 3AQQA 4DV0Q 1J5EQ 3J80i 4A3IG 5LMNL 2BA1A 4DV2L 4OWWB 4Y7NH 1VQ8A 2NVYH 4LFCQ 1PA6A 1XPUA 2XGTA 4LFBQ 3PIOA 4YHHQ 3L0OA 4JOIA 4OWTB 3L2PA 1N36L 4LF6Q 4UP9A 3LGJA 4PZ8A 4L5SA 4GKJQ 3OW2A 2VQEQ 1IBML 4HJ7A 1PVOA 2ALYB 4JI8Q 4DV7L 1Q86C 2N3SA 2ZTDA 1JJGA 4DV4Q 2WFWA 1K0RA 1AE3A 1FL0A 2R6GA 1SMXA 2KENA 4JBMA 1MJEA 2I5LX 4DR7Q 1VQMA 2IX0A 4AYBG 3KDFA 1GO3E 4P73A 3IRBA 3GTJH 2AWNA 4WJ4A 1UE5A 2EQSA 3K80C 1VCIA 1WYDA 2ZTCA 3TS2A 3F2BA 4BXXG 2IT1A 1K73C 3SGIA 4A3DH 1SR3A 4DV2Q 3HOXH 3W1BA 2E2HH 2JK8A 1HNXL 1E1TA 2MNAA 1U5KA 4WJ3M 2JA5G 1LYLA 4JI5Q 1P8LA 1Q12A 5E7NA 2QA4A 1OXVA 4R1JA 1TWAH 1YIJA 2GVAA 3KF6B 4LF5L 1T9HA 1MKHA 5EAYA 3S1NH 1XPOA 3GTKH 3JAMc 3EIVA 2JA7H 4R4QA 1KXLA 1S72A 1G291 4GOPA 3I4MH 1E24A 2K14A 2QGQA 1HNZL 4A3BH 4JI0L 5ELOA 1EOVA 2MO0A 3PCOB 4JBJA 3ZJYC 5C4JH 3A5UA 1HZBA 1R9TH 1XNRL 1V1QA 2AKWB 5GAEC 1X54A 1OTCA 4JI6Q 4P74A 3D0FA 3J80c 2JA6H 3T1YQ 5IY0A 2JA8H 3CP0A 5C0XG 4BY7H 5GAGC 2R7ZH 3GTOH 1KAWA 3FP9A 1K9MC 4A3JG 5HGQA 1X56A 2B3GA 4GNXC 1SRUA 3K0XA 3I7FA 4JYAL 2A1AA 3F2DA 2CWPA 5JEAJ 4GOPC 1HNXQ 2AMCB 3CC4A 1PYBA 5C4XH 2ID0A 1YI2A 4LF4L 1YZ6A 4GLXA 1OXSC 1IBKL 3CCVA 4JG2A 5IYDH 4YY3Q 2WB1G 3AEVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3S1Q H;  3PV0 A;  3OYY A;  4UP7 A;  2UXB L;  1O7I A;  1SE8 A;  2F3I A;  2A19 A;  2YU9 H;  2A8V A;  3PO3 H;  4KHP Q;  1D8L A;  2V1C C;  4BA1 I;  5LMN W;  1HZC A;  2NZO A;  1XJV A;  2MO1 A;  2UU9 Q;  2JEA I;  4AQY Q;  3GTG H;  3PSI A;  4JI3 Q;  1XNQ L;  1NTG A;  5M3M H;  4Y52 H;  1NBW A;  2PI2 A;  4A3C H;  4R4O A;  4HJ5 A;  1FJG L;  4H02 A;  4A3E H;  3CPW A;  4OO1 I;  1GVP A;  4BY7 G;  1IXR A;  5FJ8 H;  4PZ6 A;  3KYH C;  3VDY A;  1XMO L;  4IO9 A;  1PH4 A;  4YCW A;  4X65 L;  3S24 A;  4DV0 L;  4HJ8 A;  2VS1 A;  3H15 A;  4RG1 A;  1J5E L;  4NXM L;  4B3T Q;  4R4C A;  4DUY Q;  1SRO A;  1AH9 A;  1PH6 A;  4UP8 A;  4LFC L;  1P16 A;  3CCS A;  3I4O A;  3F8T A;  1YIT A;  2HIV A;  1EYG A;  2LXJ A;  4DR1 Q;  3A74 A;  4LF6 L;  4GKK L;  2AHO B;  4A3G G;  1M1K C;  2LXK A;  4JC0 A;  1JB7 A;  1CKM A;  1IZ6 A;  4LF4 Q;  3STB D;  3PO2 H;  4GKJ L;  1Y1W H;  3HOY H;  1JT8 A;  3M9B A;  1PH5 A;  2KBN A;  4IPD A;  5IYB H;  1VQN A;  3K7A H;  1E7Z A;  5M3F G;  4A93 H;  1CKO A;  4DV4 L;  3CW2 C;  4IOC A;  2ES2 A;  1WCM G;  1TWC H;  4O0A A;  5M3M G;  3DLL A;  4DR7 L;  4GS3 A;  4BBS H;  1G6P A;  2ZM6 Q;  1XNQ Q;  4LF7 Q;  4HIM A;  4LF8 L;  5IE8 A;  2HQL A;  1QZH A;  2RF4 A;  1KQS A;  4PG3 A;  1UE1 A;  3AYH B;  4MTN A;  4IPH A;  4YWL A;  4HIK A;  3J7A 5;  3KF6 A;  4OON A;  4JI2 L;  1KD1 C;  1PH1 A;  1GM5 A;  5IYC H;  2UUB L;  2F52 A;  5LMU L;  4TQU S;  4X65 Q;  1KIX A;  4NXM Q;  5C44 H;  2Z6K C;  1Y14 B;  3CC7 A;  1UWV A;  1YNX A;  2PI2 E;  3HOV H;  2K75 A;  1N32 L;  4JI5 L;  2R92 H;  4C3I H;  4L5Q A;  1YEZ A;  4BBR G;  4APV A;  4DR2 L;  3GTQ H;  2F4V Q;  2ZJR A;  1VQO A;  1HH2 P;  4GKK Q;  1Q1B A;  3S2D H;  4A3M G;  2UUA Q;  4AIM A;  4DR3 Q;  3I4N H;  1E1O A;  4P71 A;  2JEB I;  4YCV A;  2I5H A;  3CME A;  3A0J A;  3ULJ A;  1MJC A;  4P72 A;  3NEL A;  1VQJ A;  3HKZ G;  5GAD C;  2R93 G;  1VQP A;  1VQL A;  4OWX B;  1E3P A;  3E9H A;  2DGY A;  4LF8 Q;  1I94 Q;  1Q81 C;  4JI6 L;  2B63 G;  1KRS A;  3GO5 A;  5FLM G;  3T1Y L;  1LTL A;  3U58 A;  1VQF A;  2N78 A;  4JI2 Q;  3S16 H;  5C44 G;  1S40 A;  4LNQ A;  4MNO A;  3KJO A;  2UUB Q;  5LMU Q;  1X3G A;  2EIF A;  3K81 C;  4A3F H;  4X62 Q;  4XTC S;  1KRT A;  3STB C;  1PH3 A;  4ALP A;  3CPF A;  1C0A A;  1N32 Q;  2R7D A;  4IJH A;  2NVT H;  1X3F A;  4DR2 Q;  2Q2U A;  4PZ7 A;  1A62 A;  4LUV A;  1B8A A;  3UDG A;  1MIU A;  4KLK A;  4YY3 L;  2Q2T A;  5IP7 H;  3ER0 A;  3CCR A;  2ATW A;  3S2H H;  2HIX A;  1UE6 A;  2K5N A;  1U0L A;  1VQE A;  4GNX A;  4AH6 A;  4A76 A;  3TS0 A;  5JJI A;  1TXY A;  1A8V A;  3RNU A;  4YWK A;  4FDB A;  2HT1 A;  1VQB A;  4KHP L;  4BA2 I;  1VQK A;  2UU9 L;  4IJL A;  4AQY L;  4JI3 L;  4A3K H;  4LF9 Q;  4JCV E;  5AJ3 Q;  3M4O H;  4A4I A;  1L1O A;  2VW9 A;  3CF5 A;  3CCL A;  4B3S Q;  1TWF H;  2KHJ A;  1X9N A;  1CKN B;  4QY7 A;  1BBW A;  1B70 B;  1VQI A;  3GTP H;  1AE2 A;  3MXN B;  3PGZ A;  4EX5 A;  1ASZ A;  2NN6 I;  2UXD L;  4A3D G;  4LUO A;  3FKI H;  1IBL Q;  3HOX G;  4B3T L;  2E8G A;  4DUY L;  2Q2I A;  3NBH B;  4RMF A;  3RLF A;  2JQO A;  3KF8 B;  4DR1 L;  4UY8 C;  3KFU A;  1PFS A;  2ZJP A;  5C3E H;  2ZTE A;  4DNI A;  1N9W A;  1L1O C;  2AWO A;  1N8R C;  4JI7 Q;  1Q46 A;  4X64 Q;  1HR0 Q;  2PQA B;  3CCQ A;  2JA7 G;  2IHF A;  2VZA A;  5JEA G;  4DAM A;  1N34 Q;  4GN3 B;  3I4M G;  3M3Y H;  4DR6 Q;  3TQY A;  4UPA A;  4A3B G;  3PF5 A;  4LFA L;  2L15 A;  3CD6 A;  4DV1 L;  5GQO A;  1RIP A;  4R4I A;  1XPR A;  3TRZ A;  1UEB A;  2R7F A;  3H0G H;  2ZM6 L;  3RN2 A;  4LF7 L;  4O2D A;  2WAQ E;  3CMA A;  3RZD H;  3ERS X;  2JA6 G;  2XTI A;  1JE5 A;  1VQC A;  1PH2 A;  2CKZ B;  4LW1 A;  2JA8 G;  3K7U C;  3GTL H;  2R7Z G;  5GAH C;  2OTL A;  2MQH A;  1SN8 A;  2JA9 A;  4K0K Q;  3KLW A;  1VQ4 A;  4JBK A;  4DV5 Q;  4HID A;  3KDF B;  1W3S A;  5DLQ E;  1H95 A;  5GRO A;  1YHA A;  3OTO L;  3GTM H;  2YYZ A;  2IY5 B;  2UXD Q;  4A3L H;  3M4Q A;  3RLO A;  4GN4 B;  1EIF A;  3FHW A;  3HOZ H;  2FXQ A;  5FLX c;  5C4X G;  4POF A;  5JJK A;  3NEN A;  1Z47 A;  5IYD G;  4B3M Q;  3HOU H;  2F4V L;  1PH7 A;  1Q7Y C;  2Y0S E;  1PV4 A;  1IL2 A;  1QVF A;  1CUK A;  1TWG H;  4QL5 A;  2UUA L;  5J3B A;  4DR3 L;  2DUD A;  3JC6 6;  2HHH L;  3GD7 A;  1V43 A;  2IHE A;  2Z6K A;  2D0O A;  3PO3 G;  4QGU A;  2EXD A;  5ELN A;  2YTV A;  2WB1 E;  1WOC A;  1KHI A;  2RCN A;  1XTD A;  4ME3 A;  4LFA Q;  4IFD I;  4A3C G;  4DV1 Q;  1WJJ A;  3G71 A;  4DPG A;  3E9I A;  4LWC A;  4A3E G;  4DKA C;  1EIY B;  1I94 L;  5FJ8 G;  3CQZ H;  1YVC A;  2D0P A;  3ULL A;  4JI1 Q;  4J15 A;  1NMG A;  3AFQ A;  4HJ9 A;  2E5L Q;  3DM3 A;  5M5X H;  3G4S A;  2Q2H A;  2N49 A;  3OTO Q;  1KC8 C;  4LUZ A;  1L2F A;  2K5H A;  4X62 L;  2OWO A;  3BZC A;  5IWA Q;  4IFD J;  3CAM A;  1G51 A;  2I0Q A;  1N33 Q;  1VQ5 A;  3BJU A;  2E2J H;  3HFZ B;  3PO2 G;  3W1G A;  4JI4 Q;  1TWH H;  1Q8K A;  1Y1W G;  3CCM A;  3HOY G;  3J81 i;  4NPS A;  1VQG A;  1K8A C;  3PUZ A;  1UE7 A;  4TVA B;  5IYB G;  1VS0 A;  2KHI A;  4A93 G;  3J7Z C;  3S14 H;  4KI0 A;  4DUZ Q;  1VQ6 A;  1GD7 A;  2HHH Q;  4A75 A;  3TEH B;  2K50 A;  1EQR A;  3GDE A;  1PH9 A;  4QJF A;  3PIP A;  3M85 A;  3G48 A;  4BBS G;  3NEM A;  1I5F A;  4DR5 Q;  2UUC Q;  1QUQ B;  4LF9 L;  1QZG A;  5AJ3 L;  1OXT A;  4OXP A;  4GLV B;  3U4V A;  1GKH A;  1JJ2 A;  3I2Z A;  4B3S L;  3M7N A;  1HNW Q;  3RN5 A;  4DR4 Q;  3U50 C;  4BXX H;  4B3R L;  1YHQ A;  2OCE A;  1JMC A;  1KL9 A;  4DAY B;  5IYC G;  2GVB A;  2CWA A;  2PQA A;  4GN5 A;  3S15 H;  1IBL L;  2JA5 H;  2NVX H;  3BU2 A;  1X65 A;  1I3Q H;  2ASB A;  3UDF A;  3HOV G;  2R92 G;  2VQF Q;  1Q82 C;  4X6A H;  4NXN Q;  1BKB A;  4HJA A;  1K8G A;  1X3E A;  1VQ9 A;  2K4K A;  3CC2 A;  2C35 B;  1IYJ B;  2YV5 A;  4DK6 C;  3PF4 A;  3EBE A;  3ULP A;  3I4N G;  4JI7 L;  1HJP A;  4X64 L;  1HR0 L;  1PH8 A;  2VNU D;  2VY3 A;  1VQH A;  1N34 L;  4C3H H;  4DR6 L;  2RHQ B;  2MFI A;  4DV3 Q;  3HKS A;  2N8N A;  4JOI C;  3ICE A;  1A0I A;  1B7Y B;  2IX1 A;  2E2I H;  4XIG S;  3AFP A;  2OQ0 A;  3T1H Q;  4A3J H;  4KHZ A;  5BR8 L;  3PUW A;  5C0X I;  5LMN Q;  3HKZ E;  1C7Y A;  4YCU A;  3S1M H;  4B3R Q;  1Q1E A;  1QVC A;  3L7Z C;  4DV6 L;  4K0K L;  3F1Z A;  2PNH A;  4DV5 L;  1X6O A;  4QQB X;  1N36 Q;  3WWV A;  3A5Z B;  4A3F G;  2BA0 A;  4AYB E;  3KJP A;  2GN5 A;  4P75 A;  4R4T A;  1WFQ A;  1M90 C;  1YHB A;  4YWM A;  4OX9 L;  1OXU A;  1IBM Q;  3J81 c;  2OTJ A;  4DV7 Q;  3J81 j;  2PMZ E;  2RHS B;  4B3M L;  1I50 H;  2WAQ G;  3I56 A;  5IP7 G;  2H5X A;  5IP9 H;  3CXC A;  1FVI A;  5C0X J;  1YJN A;  4IOA A;  1VQ7 A;  5IT9 c;  1NMF A;  1V9P A;  2KCM A;  1DGS A;  3UE0 A;  4JV5 L;  3PUX A;  3RZO H;  1S3O A;  2Z0S A;  1BBU A;  1NE3 A;  4NB3 A;  4A3K G;  2VL6 A;  4BY1 H;  1NJI C;  2JE6 I;  2B29 A;  4HIO A;  2CCZ A;  1PYS B;  1XMQ L;  2NN6 G;  2K5V A;  3I55 A;  3K8A A;  5BR8 Q;  4JI1 L;  1BVS A;  2Y0S G;  3HOW H;  4EQ5 A;  4DV6 Q;  1J6Q A;  3FKI G;  2BH2 A;  3TRE A;  2E5L L;  1K83 H;  1Z9F A;  1LM0 A;  2NVQ H;  1K3R A;  2UXC L;  2K52 A;  4PMW A;  5IWA L;  4A3G H;  2VUM H;  4LF5 Q;  4OX9 Q;  1E22 A;  1C9O A;  1OXX K;  1CSP A;  3RLN A;  1N33 L;  5K36 G;  1QVG A;  2KCT A;  1W2B A;  5IP9 G;  3H3V H;  1QUQ A;  5C3E G;  4JI4 L;  3PUV A;  5M3F H;  3D31 A;  1L0W A;  3KOJ A;  1HZA A;  2YTX A;  1I6H H;  3H3V I;  3CCJ A;  1HZ9 A;  2BH8 A;  4MZ9 A;  1HNZ Q;  1YJW A;  3UE1 A;  1EQQ A;  1X55 A;  4JI0 Q;  1WCM H;  3MEF A;  4DUZ L;  5JJL A;  3S1R H;  4L5R C;  1JJC B;  3E0E A;  1Y1V H;  1XNR Q;  3W5O A;  1YJ9 A;  4BY1 G;  3F2C A;  2I5M X;  1PHJ A;  4JV5 Q;  3G6E A;  4GNX B;  3H0G G;  3B6Y A;  4DR5 L;  4JBW A;  2UUC L;  2D62 A;  4X66 L;  4OO1 G;  2CFM A;  1WI5 A;  4GOP B;  3HOW G;  3Q8D A;  1A63 A;  1HNW L;  4DR4 L;  3U4Z A;  1XMQ Q;  3M4P A;  2ZJQ A;  4JYA Q;  2WP8 J;  1RL2 A;  1VQD A;  1L1O B;  4A3I H;  4LFB L;  4YHH L;  1YBY A;  2YTY A;  1NY4 A;  3UDX A;  3CCE A;  1HR0 W;  4A3L G;  3BZK A;  3EN2 A;  4C3J H;  1EFW A;  2VUM G;  2UXC Q;  4BBR H;  1IBK Q;  2VQE L;  1D7Q A;  4QIW E;  3HOZ G;  4L5T A;  2VQF L;  4JI8 L;  3PUY A;  3RR5 A;  5M5Y H;  1LUZ A;  4NXN L;  4A3M H;  3HOU G;  5M5W H;  2UXB Q;  5HY6 A;  3CCU A;  4C2M H;  2OQK A;  4GLA C;  4IPC A;  1EUJ A;  1EWI A;  1CKN A;  2JJQ A;  3JAM i;  1Y1V G;  1SFO H;  2NZH A;  4POG A;  4IFD G;  2R93 H;  3UDI A;  1VQA A;  1SLJ A;  1FJG Q;  4DV3 L;  4IPG A;  2QEX A;  3S17 H;  2LSS A;  1CSQ A;  1FGU A;  4DK3 C;  5FLM H;  1XMO Q;  1ASY A;  2B63 H;  4X66 Q;  2CQO A;  5H1S E;  3T1H L;  3AQQ A;  4DV0 Q;  1J5E Q;  3J80 i;  4A3I G;  5LMN L;  2BA1 A;  4DV2 L;  4OWW B;  4Y7N H;  1VQ8 A;  2NVY H;  4LFC Q;  1PA6 A;  1XPU A;  2XGT A;  4LFB Q;  3PIO A;  4YHH Q;  3L0O A;  4JOI A;  4OWT B;  3L2P A;  1N36 L;  4LF6 Q;  4UP9 A;  3LGJ A;  4PZ8 A;  4L5S A;  4GKJ Q;  3OW2 A;  2VQE Q;  1IBM L;  4HJ7 A;  1PVO A;  2ALY B;  4JI8 Q;  4DV7 L;  1Q86 C;  2N3S A;  2ZTD A;  1JJG A;  4DV4 Q;  2WFW A;  1K0R A;  1AE3 A;  1FL0 A;  2R6G A;  1SMX A;  2KEN A;  4JBM A;  1MJE A;  2I5L X;  4DR7 Q;  1VQM A;  2IX0 A;  4AYB G;  3KDF A;  1GO3 E;  4P73 A;  3IRB A;  3GTJ H;  2AWN A;  4WJ4 A;  1UE5 A;  2EQS A;  3K80 C;  1VCI A;  1WYD A;  2ZTC A;  3TS2 A;  3F2B A;  4BXX G;  2IT1 A;  1K73 C;  3SGI A;  4A3D H;  1SR3 A;  4DV2 Q;  3HOX H;  3W1B A;  2E2H H;  2JK8 A;  1HNX L;  1E1T A;  2MNA A;  1U5K A;  4WJ3 M;  2JA5 G;  1LYL A;  4JI5 Q;  1P8L A;  1Q12 A;  5E7N A;  2QA4 A;  1OXV A;  4R1J A;  1TWA H;  1YIJ A;  2GVA A;  3KF6 B;  4LF5 L;  1T9H A;  1MKH A;  5EAY A;  3S1N H;  1XPO A;  3GTK H;  3JAM c;  3EIV A;  2JA7 H;  4R4Q A;  1KXL A;  1S72 A;  1G29 1;  4GOP A;  3I4M H;  1E24 A;  2K14 A;  2QGQ A;  1HNZ L;  4A3B H;  4JI0 L;  5ELO A;  1EOV A;  2MO0 A;  3PCO B;  4JBJ A;  3ZJY C;  5C4J H;  3A5U A;  1HZB A;  1R9T H;  1XNR L;  1V1Q A;  2AKW B;  5GAE C;  1X54 A;  1OTC A;  4JI6 Q;  4P74 A;  3D0F A;  3J80 c;  2JA6 H;  3T1Y Q;  5IY0 A;  2JA8 H;  3CP0 A;  5C0X G;  4BY7 H;  5GAG C;  2R7Z H;  3GTO H;  1KAW A;  3FP9 A;  1K9M C;  4A3J G;  5HGQ A;  1X56 A;  2B3G A;  4GNX C;  1SRU A;  3K0X A;  3I7F A;  4JYA L;  2A1A A;  3F2D A;  2CWP A;  5JEA J;  4GOP C;  1HNX Q;  2AMC B;  3CC4 A;  1PYB A;  5C4X H;  2ID0 A;  1YI2 A;  4LF4 L;  1YZ6 A;  4GLX A;  1OXS C;  1IBK L;  3CCV A;  4JG2 A;  5IYD H;  4YY3 Q;  2WB1 G;  3AEV A; 
#chains in the Genus database with same CATH topology
 1I3Q B;  3OIP A;  5ELD A;  5LMN W;  2K5D A;  2NZO A;  2UU9 Q;  2JEA I;  4JI3 Q;  4Y52 H;  1NBW A;  1FJG L;  4A3E H;  4OO1 I;  4BY7 G;  1PH4 A;  4IO9 A;  4EGV A;  3T13 A;  4B3T Q;  1CTM A;  4R4C A;  2PO4 A;  4LFC L;  1PH6 A;  1LTR D;  4XT3 B;  2HIV A;  3F2U A;  2LXJ A;  2F0W A;  4FF4 A;  1EEF D;  4LF4 Q;  2Q8R E;  1LAC A;  3O13 A;  4KD3 A;  2L0C A;  4IPD A;  3FKI B;  3K7A H;  3VR5 A;  4DV4 L;  2Z4I A;  2WB1 B;  4IOC A;  1TWC H;  5ISR A;  3MEH A;  1OO9 B;  3ERO A;  1XNQ Q;  3BDO A;  4LAA A;  3SE0 A;  2K01 A;  2RF4 A;  1KQS A;  2KCN A;  1UE1 A;  4MTN A;  1B4O A;  1KD1 C;  1K8O A;  1GM5 A;  5EQ0 A;  3C3L A;  1F9R A;  4TQU S;  4X65 Q;  4QIW B;  1IKM A;  1WTH A;  1Y14 B;  1EYC A;  4ODG A;  4C3J G;  1M8A A;  2K75 A;  4ID6 A;  1SXT A;  4JI5 L;  4C3I H;  3VA5 A;  5C6A A;  4NDX A;  2PW7 A;  1HH2 P;  1Z7T A;  1MSH A;  1Q1B A;  4A3M G;  4DNR B;  3BG3 A;  4DR3 Q;  5EBC A;  4YCV A;  1TR5 A;  3WOF A;  4LMQ D;  4F8M A;  4TKO B;  2B8G A;  2WII B;  1DOL A;  3OWE B;  1BO0 A;  1W6J A;  3E9H A;  1FD7 D;  1PTO B;  2ZT9 C;  2TSS A;  1A3V A;  1Q81 C;  5FLM G;  3U58 A;  1X32 A;  1VQF A;  1T5X D;  4ZKC B;  3PIO 3;  5LMU Q;  2R3Z A;  1C8C A;  4C3I G;  2RCF A;  5G3L D;  3CPF A;  2P5Z X;  2R7D A;  4IJH A;  5AFW A;  3QJY A;  1RTO A;  4YY3 L;  1O7Y A;  3R2I A;  4C3J B;  2HIX A;  5CV9 A;  3P7J A;  1XYI A;  3RNU A;  4YWK A;  2HT1 A;  4A3M B;  4KHP L;  1G2S A;  4M1U B;  4MIU A;  3WDN A;  4JCV E;  3M4O H;  3CF5 A;  4ZCK A;  2KHJ A;  2PZW A;  4QY7 A;  1BBW A;  5ELB A;  1SFO B;  1F9Q A;  3C1E A;  1WTV A;  3PGZ A;  3KLR A;  4KY7 A;  1ASZ A;  2UXD L;  4A3D G;  4RCO A;  2B2U C;  4DK0 A;  2Q2I A;  4RMF A;  1PTO D;  1PYW D;  2Z4H A;  4DU9 A;  2F0I A;  1CK1 A;  1PFS A;  2WKC A;  2ZTE A;  1I4X A;  4JI7 Q;  1Q46 A;  4GZY C;  2VZA A;  5JEA G;  3VR2 A;  1LAB A;  1EWC A;  4A3B G;  2A5H A;  1Y8N B;  5GQO A;  4KTA A;  1XPR A;  2R7F A;  3H0G H;  3T56 B;  4LF7 L;  4OO1 H;  5FOB B;  3CMA A;  3ERS X;  1VQC A;  2JA8 G;  4LW1 A;  4IUR A;  5GAH C;  2EJM A;  4PMB A;  1SN8 A;  4JBK A;  3BS1 A;  4DV5 Q;  4HID A;  5GRO A;  2IY5 B;  2YYZ A;  3RD4 A;  1EU3 A;  5EPJ A;  3RLO A;  1AZQ A;  2IL8 A;  4B9W A;  5JJK A;  1K0S A;  4B3M Q;  5IYD G;  2F4V L;  2NZ1 D;  2Y0S E;  1CUK A;  1TWG H;  4KK7 A;  3D4D A;  2UUA L;  4RHS A;  5J3B A;  5I9P A;  3GD7 A;  1EY4 A;  4IFD H;  2EJG C;  1SNQ A;  5BN4 A;  4QGU A;  5ELN A;  2YTV A;  1SYB A;  2RCN A;  1DOK A;  4LFA Q;  4XYO A;  4A3C G;  4DV1 Q;  4DPG A;  2L4N A;  4A3B B;  4DKA C;  1I94 L;  5KRU A;  2D0P A;  1NMG A;  2WKD A;  1PTO C;  2C5C A;  5BN5 A;  3DM3 A;  1LTS D;  2OWO A;  1G51 A;  1MD2 D;  1F77 A;  2E2J H;  3HFZ B;  5EGT A;  4JVZ A;  5I9O A;  3W1G A;  3NTI A;  1QCB D;  4TVA B;  4XQN A;  2WV6 D;  4Q5V A;  4KI0 A;  5CV6 A;  1VQ6 A;  2HHH Q;  3T4A C;  1EQR A;  1CA5 A;  3S1Q B;  3M7G A;  1FNU A;  1PH9 A;  3PIP A;  3G48 A;  3NBH A;  5AJ3 L;  3N6R A;  4GLV B;  3U4V A;  1GKH A;  1JJ2 A;  3GTG B;  4DR4 Q;  3U50 C;  5M3M B;  4B3R L;  5IYC G;  2DJF C;  2PQA A;  3S15 H;  2JA5 H;  2NVX H;  1MI2 A;  4EQP A;  2RQX A;  1Z6H A;  3C2P A;  2ICI A;  1Q82 C;  4NXN Q;  1BKB A;  1X3E A;  1VQ9 A;  1D5X C;  1Y8P B;  1IYJ B;  3ULP A;  3MAQ A;  2VB3 X;  1KTK A;  1HR0 L;  1PH8 A;  3NE5 B;  3MA2 B;  3Q24 A;  2VXW A;  1KAA A;  4C3H H;  2A6H D;  2MFI A;  4DV3 Q;  1RCV D;  2K33 A;  2EYJ A;  2N8N A;  3HKS A;  1A0I A;  2E2I H;  1GUS A;  1F2Z A;  4XIG S;  1BOS A;  3AFP A;  5IOD A;  1HHV A;  5T1I A;  4KHZ A;  5BR8 L;  5I6Y A;  5IGG A;  3Q23 A;  5LMN Q;  1WTO A;  1QVC A;  4K0K L;  3F1Z A;  3BYY B;  1X6O A;  2DNC A;  3A5Z B;  5E4W C;  2BA0 A;  1G91 A;  1M90 C;  1BUV T;  4QF4 A;  5I4D A;  1OXU A;  1TKW B;  1JOQ A;  3W2D A;  1C4Q A;  1D1K A;  2PMZ E;  1I50 H;  1SJE D;  3I90 A;  4OGQ C;  1ML0 D;  3K58 A;  4JV5 L;  1K3B C;  1EFI D;  4BY1 H;  3DWQ A;  3TME A;  4H7B A;  1DOM A;  2CCZ A;  2K5V A;  3K8A A;  1BVS A;  1KDC A;  4DV6 Q;  4KMU C;  2BH2 A;  3TRE A;  2E5L L;  1Z9F A;  2NVQ H;  3D6C A;  4HSP A;  2K52 A;  1STE A;  4K5V A;  5IWA L;  4LF5 Q;  1UAP A;  4OX9 Q;  1OXX K;  5C5M A;  2AQ2 B;  2X6G A;  2F1M A;  2KCT A;  2PZT A;  1GUN A;  3KOJ A;  3H3V I;  3BDC A;  3VYS A;  4JI0 Q;  1EQQ A;  1X55 A;  4XQQ A;  1WCM H;  3CU7 A;  4DUZ L;  5JJL A;  2G5D A;  4CJ1 B;  2E2D C;  5IT9 E;  1XNR Q;  1CHP D;  4BY1 G;  3F2C A;  1PHJ A;  3G6E A;  2M2L A;  1DYQ A;  2EY2 A;  2UUC L;  2EDG A;  1NR4 A;  5CYU A;  5I2Y A;  2JYO A;  4JYA Q;  1RL2 A;  4A3I H;  1WTX A;  3D6W A;  1YBY A;  2YTY A;  3UDX A;  4KN4 C;  1E2Z A;  3BVG A;  4QIW E;  2WIN B;  1HQM C;  1BQQ T;  1PTO F;  2VQF L;  3MXP A;  3HOU G;  5DAU A;  1W6K A;  4K8J A;  4DXF A;  4C2M H;  4IPC A;  1UEA B;  3JAM i;  4BS9 A;  2R93 H;  4QMG A;  3MXN A;  2O5I C;  1ICW A;  2AQ3 B;  3M3Y B;  3G7L A;  1V8Q A;  3I70 A;  4DK3 C;  1XMO Q;  1H9K A;  1HFG A;  4HMI A;  1AEX A;  3AB9 A;  1F2L A;  1J5E Q;  4A3I G;  5CV8 A;  1FNW A;  2NVY H;  1VQ8 A;  1JWS D;  5JVH 3;  4OWT B;  3A7A B;  1N36 L;  4MHE A;  1PFN A;  3LGJ A;  3H6M A;  1ZYR D;  3OW2 A;  1PVO A;  4JI8 Q;  3TP7 A;  4DV7 L;  1Q86 C;  1TQO A;  2EYL A;  3D4R A;  1X3P A;  2NTS A;  1CI3 M;  3DWA A;  1U4L A;  4RAU C;  3K0Y A;  2KEN A;  5CV7 A;  3HOU B;  3MWY W;  1TS4 A;  1Y1W B;  4P73 A;  3IRB A;  1WTW A;  3GTJ H;  5EPK A;  3MHB A;  3VR6 A;  2F0G A;  2XNA C;  2MNA A;  1FGB D;  3IKJ A;  1P8L A;  1GUG A;  3NQI A;  5JPN C;  3K5M A;  1TWA H;  2SEB D;  3KF6 B;  1T9H A;  1MKH A;  1ILQ A;  2B2W A;  3I73 A;  3CRL C;  3EIV A;  5IGF A;  4C1N I;  1S72 A;  4GOP A;  2J0T D;  1E24 A;  4ZKB B;  2K14 A;  2O4X A;  3P1H A;  5C4J H;  5L37 A;  1RDP D;  2BE5 D;  1Y8O B;  2EYF A;  1V1Q A;  4J1M A;  1FNV A;  1ZXT A;  1XWE A;  2R7Z H;  3IAY A;  4A3J G;  5J39 A;  2EYH A;  5HGQ A;  1ILP A;  2F0J A;  2KOL A;  1VF5 C;  4LF4 L;  1B3Q A;  3RUZ A;  2HUG A;  3NSW A;  3V05 A;  1PDQ A;  1Q3L A;  3OYY A;  1CQV A;  1O7I A;  3P75 A;  4MTK A;  4LK1 C;  4DN4 M;  3JAM E;  3KBX A;  1JCK B;  4L6T B;  1XNQ L;  1NTG A;  1HA6 A;  4R4O A;  4H02 A;  2AUJ D;  3I4L A;  3T51 B;  5FJ8 H;  4PZ6 A;  3HGB A;  4YCW A;  4X65 L;  2I46 A;  3S24 A;  4DV0 L;  3H15 A;  4RG1 A;  1RF2 D;  4DNT B;  4ZAI A;  4A3K B;  4UP8 A;  1AH9 A;  1P16 A;  1SE2 A;  3I4O A;  3F8T A;  4A3J B;  1EYG A;  3S1M B;  2EJF C;  4DR1 Q;  4LF6 L;  1BDO A;  2AHO B;  3PO2 H;  1CKM A;  1IZ6 A;  2B2V A;  2Y0S B;  4GKJ L;  1JT8 A;  1CA6 A;  3EFX D;  2MPM A;  1E7Z A;  5M3F G;  4A93 H;  3GV6 A;  1B50 A;  1L0Y B;  5E4X A;  3SK5 A;  5KNB A;  4DR7 L;  2F0T A;  5IT9 L;  4BBS H;  2O5J C;  2K32 A;  2ZM6 Q;  1G6P A;  4HIM A;  5IE8 A;  2R61 A;  4PG3 A;  1B53 A;  1LV9 A;  2B2Y A;  4X3U A;  3BZD B;  1SNC A;  2F52 A;  5LMU L;  1KIX A;  1ENF A;  2KA7 A;  5ELF A;  1S5B D;  4OIK A;  1EY7 A;  1UWV A;  3SDZ A;  3HOV H;  2NB0 A;  1YEZ A;  4BBR G;  4APV A;  3FVQ A;  4GKK Q;  1VQO A;  1R4Q B;  3C46 A;  2IW3 A;  4X3K A;  3S2D H;  1K83 B;  4KV6 A;  1EYD A;  5D65 A;  4HED A;  2JEB I;  2VUM B;  4WJW A;  3ULJ A;  4P72 A;  3NEL A;  5GAD C;  5M3F B;  4OWX B;  1I6H B;  2FHT A;  4RKL A;  1GHK A;  1NAP A;  4LF8 Q;  2F0E A;  2LY7 A;  2B63 G;  1STG A;  3T1Y L;  2X6L A;  4JI2 Q;  3S16 H;  1G8Z D;  2UUB Q;  2F03 A;  1X3G A;  1SSO A;  4X62 Q;  2L9H A;  4IAL A;  2OEO A;  4KHV A;  1PH3 A;  4ALP A;  4IQZ A;  1N32 Q;  3D8G A;  5CC4 A;  4CKC A;  2NVT H;  2Q2U A;  1BNZ A;  4PZ7 A;  4DFA A;  3UDG A;  4QCL A;  4BBR B;  2K5N A;  1V1P A;  1U0L A;  3DHQ A;  4GNX A;  1ZEQ X;  4AH6 A;  3TS0 A;  1TXY A;  4FDB A;  5M5W B;  1HRJ A;  1XTC D;  4AQY L;  4LF9 Q;  3LNN A;  1EIH A;  1B9M A;  1L1O A;  4B3S Q;  1TWF H;  1X9N A;  1B70 B;  2F0O A;  1AE2 A;  3MXN B;  5JAV A;  4IZ8 A;  2EE1 A;  1DON A;  1LTG D;  3S17 B;  4LUO A;  1NNX A;  3FKI H;  3HEJ A;  3NK9 A;  3HOX G;  1IBL Q;  2B63 B;  4DUY L;  5DNF A;  1PRT F;  3KBG A;  2BDN A;  4Y7N B;  5K36 H;  3KFU A;  5C3E H;  4HCS A;  3MVV A;  4X64 Q;  1EY6 A;  3CCQ A;  1TU2 B;  1WD1 A;  2IHF A;  3I4M G;  2K04 A;  4DR6 Q;  4UPA A;  2C9O A;  4LFA L;  5D3D A;  3CD6 A;  3U9O A;  4DV1 L;  1D2B A;  1II3 A;  2H1E A;  1LTT D;  2A69 D;  2KUM A;  1PMR A;  3RZD H;  2JA6 G;  1JE5 A;  2CKZ B;  4K14 A;  4RGN A;  1MBY A;  2JA9 A;  1VQ4 A;  3DWP A;  1H95 A;  3ND8 A;  5DLQ E;  3SVM A;  4JPB W;  4A3L H;  1D6E C;  2PCF B;  4GN4 B;  2ZXP A;  3FHW A;  2FXQ A;  5FLX c;  4POF A;  3HOX B;  1EY8 A;  4DXG A;  1PH7 A;  1Q7Y C;  1PV4 A;  2HHH L;  3JC6 6;  1V43 A;  2EY1 A;  3JAM L;  3K5L A;  2EXD A;  1WOC A;  4IFD I;  4ME3 A;  5A35 A;  4KY6 A;  4CKE A;  1WJJ A;  3OMG A;  3I4M B;  4A3E G;  3VYR A;  1G2T A;  4RCN A;  3CQZ H;  1YNJ C;  4J15 A;  1TS2 A;  3RZO B;  2JA6 B;  2Q2H A;  5ELE A;  4BY7 B;  4LUZ A;  1L2F A;  4N8X 1;  4IFD J;  2ZXR A;  4H13 C;  4IN3 A;  3BJU A;  2F0L A;  4JI4 Q;  2A73 B;  2EY5 A;  2MUY A;  2B8F A;  3PUZ A;  1VS0 A;  3J7Z C;  3S14 H;  1SE4 A;  3QOL A;  2A69 C;  3TEH B;  3A8I E;  1STN A;  2OT2 A;  3QIA A;  1QUQ B;  1TS5 A;  1D5M C;  1UUP A;  5IGD A;  2J4X A;  3MTS A;  1VF7 A;  4OXP A;  3M7N A;  3I2Z A;  1H9M A;  1IYU A;  2F4I A;  1HNW Q;  5I2X A;  4BXX H;  1YHQ A;  1GHJ A;  3N52 A;  5IIF A;  1RHP A;  4XQJ A;  3S9W A;  5ELC A;  1S5D D;  5E1F A;  1B1Z A;  3EJI A;  4HCE A;  3OMC A;  4DGZ A;  4HJA A;  2EY6 A;  3CC2 A;  2C35 B;  2CQA A;  2YV5 A;  4DK6 C;  3PF4 A;  3EBE A;  5NUC A;  2PW5 A;  3FEW X;  1ICF B;  4FVM A;  2VY3 A;  1VQH A;  1N34 L;  2RHQ B;  4PMC A;  3K7A B;  4CHT B;  2IWH A;  3NTH A;  1B7Y B;  2D2C C;  1EIG A;  1BR9 A;  4V0B A;  2RVL A;  3W3A A;  4YCU A;  2K5Q A;  4DV6 L;  3PMF A;  1BBX C;  2PNH A;  2F0S A;  3MFG A;  5IGC A;  1I4G A;  4QQB X;  1EL0 A;  4OX9 L;  1KAB A;  1IBM Q;  4ME5 A;  3J81 c;  2EYP A;  1IW7 D;  1S4Z A;  1S5C D;  1FVI A;  4C3I B;  1STB A;  2L5T A;  2KCM A;  3PQI A;  3UE0 A;  3Q0A A;  4Z9C B;  1EZ6 A;  2VL6 A;  3HP3 A;  1NJI C;  1PYS B;  1AP0 A;  3L3O C;  3I55 A;  3GV3 A;  2B2W C;  4JI1 L;  4RFB A;  5JJZ A;  1A2U A;  4FYD A;  3K57 A;  1J6Q A;  2DN8 A;  1LM0 A;  4CDE C;  4A3G H;  1E22 A;  2J7Z A;  5KYI A;  5J22 A;  3RLN A;  4ZUI A;  1N33 L;  4ABN A;  1EZ8 A;  4A3D B;  3I91 A;  1FYC A;  3D31 A;  1HZA A;  1WTR A;  4HTH A;  3CCJ A;  2BH8 A;  1HNZ Q;  1LT6 D;  1IKL A;  1QIL A;  1J8I A;  3S1R H;  1JJC B;  3E0E A;  1Y1V H;  3W5O A;  1YJ9 A;  1EOT A;  4K8I A;  1V1P B;  4GNX B;  2F0D A;  1A6X A;  3H0G G;  4DR5 L;  4JBW A;  4OO1 G;  2CFM A;  1WI5 A;  3J80 E;  1AW7 A;  2K7V A;  1V1O A;  2ZJQ A;  1XMQ Q;  1DM0 B;  3D3R A;  3M4O B;  1VQD A;  2F0F A;  1L1O B;  2XWB B;  3H94 A;  3MC0 B;  2K03 A;  1HR0 W;  1IW7 C;  3EN2 A;  1H9S A;  1EFW A;  2JA8 B;  5C3W A;  3KLS X;  1RKN A;  4JI8 L;  3PUY A;  5M5Y H;  2JSO A;  4FNF A;  5D3I B;  1AZP A;  1EWI A;  4IFD G;  1Y1V G;  1VQA A;  5KGU A;  1FJG Q;  2PQE A;  4IPG A;  4KY5 A;  1VMP A;  1CSQ A;  1FGU A;  2L11 A;  4FXD A;  3UI2 A;  4X66 Q;  3T1H L;  4IUN A;  3KF8 A;  2N88 A;  3KK7 A;  1O7L A;  3H0G B;  2M9V A;  4LFC Q;  1PA6 A;  3BYT B;  1QB5 D;  4M8A A;  1DD2 A;  1I4R A;  4YHH Q;  3U9S A;  1LT3 D;  2RDF A;  2EYO A;  2QIL A;  2VQE Q;  1JC7 A;  1F9P A;  1JJG A;  5IOC A;  4DV4 Q;  1BCP B;  2WFW A;  1K0R A;  2R6G A;  1SMX A;  4QB4 A;  3NXW A;  5C5L A;  1MJE A;  1QNK A;  2SOB A;  1NCV A;  4KN7 C;  1TWG B;  1ENA A;  2DY7 A;  4AYB G;  1I4H A;  3TZD A;  2EPB A;  2EQS A;  3TS2 A;  2IT1 A;  1K73 C;  1SR3 A;  3CRK C;  2E2H H;  4FO2 A;  1JOK A;  2JA5 G;  2XIW A;  4JI5 Q;  1Q12 A;  2QA4 A;  4I7A A;  1OXV A;  4B08 A;  4KD4 A;  3LX0 A;  5JPM C;  3S1N H;  3GTK H;  2JA7 H;  2L12 A;  1EWH A;  1TVX A;  3A8J E;  2EZV A;  1YNN D;  3IL8 A;  2E2J B;  4C3H G;  2K6A A;  1HZB A;  2K1B A;  4I65 A;  2Z1C A;  1K28 A;  3J80 c;  4HR7 B;  3K5N A;  1NSN S;  1BCP D;  3GTO H;  1KAW A;  4AYB B;  3T16 A;  4I7Z C;  2B3G A;  4GNX C;  1SRU A;  3I7F A;  4S3S A;  2AMC B;  3CC4 A;  5C4X H;  3HS0 C;  1YZ6 A;  4GLX A;  1IBK L;  4JG2 A;  1HCZ A;  4RHR A;  4YY3 Q;  3S15 B;  2JA5 B;  2NVX B;  5G3L F;  3PV0 A;  1QG7 A;  2UXB L;  2XRS D;  1FR3 A;  2YU9 H;  2A6H C;  2A8V A;  3PO3 H;  4F7X A;  5BN3 A;  4KHP Q;  2V1C C;  4ZUJ A;  1XJV A;  3X3M A;  3PSI A;  4IUU A;  2PI2 A;  4HJ5 A;  3CPW A;  1GVP A;  1IXR A;  1I6V C;  1LTI D;  3VDY A;  1KLG D;  2VS1 A;  4HN7 A;  2E2I B;  1SRO A;  1LO5 D;  2MGS A;  2XN9 C;  3CKI B;  4GKK L;  3A74 A;  3VYT A;  2LXK A;  2G9D A;  3STB D;  2XWJ B;  1Y1W H;  1YNN C;  3HOY H;  2MHV A;  3NPP A;  3M9B A;  1PH5 A;  3MXG A;  1QOH A;  4KKU A;  5IYB H;  4TSS A;  3X3N A;  3Q22 A;  2ES2 A;  1WCM G;  4O0A A;  3DLL A;  1DZ1 A;  1I50 B;  2MP1 A;  4GS3 A;  2BOS A;  1BCP C;  3LWE A;  4LF7 Q;  4LF8 L;  5EKI A;  3OOC A;  3AYH B;  1CZW A;  3QB3 A;  4IPH A;  4YWL A;  1L0X B;  3SXH A;  4JI2 L;  3BVM A;  1PH1 A;  2UUB L;  4BY1 B;  4K2K A;  2CW0 D;  4NXM Q;  5C44 H;  1YNX A;  1N32 L;  2R92 H;  3SK6 A;  3GTQ H;  2F4V Q;  4PNY A;  5C4H A;  2NVQ B;  2Z9H A;  2F0U A;  3HG9 A;  2UUA Q;  3QG1 A;  4AIM A;  3I4N H;  2CH4 A;  2QDL A;  4P71 A;  2PYK A;  2I5H A;  3CME A;  4CDC C;  2KVM A;  1DCZ A;  1AFP A;  4IUT A;  1MJC A;  1EYA A;  2R93 G;  1VQP A;  2CH4 W;  3PIP 3;  5CR3 A;  1I94 Q;  1DJR D;  1WCM B;  4JI6 L;  1QWY A;  1KRS A;  1LTL A;  5C44 G;  4MNO A;  3KJO A;  2KQ3 A;  3R3O A;  2EIF A;  4A3F H;  5EJW A;  3TN2 A;  1KLU D;  1KRT A;  3STB C;  4FP5 D;  1X3F A;  4DR2 Q;  4A3I B;  4G7Z C;  1A62 A;  3FPP A;  1B8A A;  1MIU A;  4KLK A;  2Q2T A;  2ATW A;  5IP7 H;  1SYC A;  3CCR A;  3S2H H;  5M5X B;  5JVG 3;  2JN4 A;  3H91 A;  3SK8 A;  5KNC A;  2EXZ A;  4A76 A;  4N9P A;  5A2Q E;  1EEI D;  2NTT A;  2F0M A;  1VQK A;  2UU9 L;  4JI3 L;  4C2M B;  4A3K H;  1NR2 A;  5AJ3 Q;  4A4I A;  2VW9 A;  3J7A F;  4MN3 A;  1RJT A;  2NN6 H;  3GTP H;  4G7O C;  1WTQ A;  4B3T L;  3NBH B;  1ZYR C;  1B44 D;  2JQO A;  3KF8 B;  2NVY B;  4C56 C;  1SEB D;  4UY8 C;  2HCC A;  4DNI A;  1XX8 A;  2K5W A;  2AWO A;  1HR0 Q;  2PQA B;  5CGK A;  4DA2 A;  4DAM A;  4GN3 B;  3PF5 A;  4EVO A;  2L15 A;  4DAP A;  3TRZ A;  5CBA E;  3RN2 A;  1PZJ D;  4O2D A;  3HOW H;  2XTI A;  1PH2 A;  3GTL H;  5I6W A;  3K7U C;  2R7Z G;  1GOZ A;  3WOE A;  2MQH A;  4K0K Q;  3KLW A;  3L9A X;  3GTM H;  3GTJ B;  3M4Q A;  4K6D A;  3R8B A;  3HOZ H;  3NEN A;  2QDB A;  3K59 A;  1QVF A;  4O1N A;  4DR3 L;  2E76 C;  2IHE A;  2Z6K A;  1LT5 D;  2D0O A;  4ZQ3 A;  2FFK B;  3C1F A;  2BE5 C;  1KHI A;  1XTD A;  1CQF A;  1RD9 D;  1QJO A;  4LWC A;  5FJ8 G;  1YVC A;  3ULL A;  5C4J B;  2BCO A;  3DMU A;  2F0Q A;  2E5L Q;  3G4S A;  2N49 A;  3OTO Q;  2R7Z B;  2A6E D;  4CDD C;  2RKS A;  5IWA Q;  1PLF A;  4EQO A;  3CAM A;  3PO2 G;  1U9R A;  5FKA C;  1TWH H;  5HGT A;  1F9S A;  4FF1 A;  3J81 i;  5FLX E;  1K8A C;  2KHI A;  4A93 G;  4DUZ Q;  3R2T A;  1GD7 A;  1H9J A;  4A75 A;  2CVR A;  2K50 A;  5D14 A;  1PFM A;  3M85 A;  4BBS G;  2UUC Q;  3ONA B;  1OXT A;  1CM9 A;  4PV1 C;  4U67 3;  3RN5 A;  2IJ0 A;  2MJ8 A;  2RDG A;  4L8J A;  2CWA A;  4GN5 A;  1HUN A;  1X65 A;  1I3Q H;  1JOO A;  2ASB A;  3HOV G;  1S5E D;  1STA A;  2VQF Q;  4X6A H;  3RMH A;  2G9H D;  3LWU A;  2EOT A;  1K8G A;  4F87 A;  2D5D A;  2N55 A;  3OPO A;  4JI7 L;  1HJP A;  1X3Q A;  3PO2 B;  2VNU D;  4L63 B;  2KEC A;  3ICE A;  4A93 B;  4F88 A;  3DUZ A;  3NUC A;  2IX1 A;  5C0X H;  2JXM B;  1MGS A;  3HKZ E;  2QF7 A;  2A6E C;  4IUQ A;  2QW7 A;  1Q1E A;  2KJX A;  4E6I A;  1SBB B;  4DV5 L;  1N36 Q;  3WWV A;  4AYB E;  4P75 A;  1U4R A;  1YHB A;  4YWM A;  2WAC A;  4QUC A;  2OTJ A;  4DV7 Q;  2RHS B;  1U4M A;  1JOR A;  4B3M L;  2WAQ G;  3I56 A;  4O42 A;  3CXC A;  3HOV B;  3M4Y A;  4XXE A;  1YJN A;  1SYG A;  2XSC A;  2OXP A;  3QR8 A;  1V9P A;  5A2Q L;  1DGS A;  1B9N A;  5T1G A;  3S2D B;  4R8N A;  3RZO H;  5KEE A;  1BBU A;  4NB3 A;  2JE6 I;  5DM7 3;  1LTB D;  1MHW C;  1XMQ L;  2NYZ D;  4CBV A;  4EQ5 A;  1ESR A;  1K8M A;  3FKI G;  1O80 A;  4NW2 A;  1K3R A;  3OHX C;  4PMW A;  4JW0 A;  3S16 B;  1C9O A;  2HQE A;  5K36 G;  1QVG A;  1EY5 A;  1W2B A;  2LKV A;  5C3E G;  3PUV A;  2A68 D;  3J81 E;  2RBM A;  4CKB A;  4WRD A;  1HZ9 A;  1PTO H;  4MZ9 A;  2NVT B;  2F3W A;  3UE1 A;  3MEF A;  2WAQ B;  4EQN A;  1M4V A;  4L5R C;  4KJO A;  2JP1 A;  5DM6 3;  2B2T A;  1EQT A;  3DM1 A;  4X66 L;  1PZK D;  2FMM A;  4GOP B;  3A56 A;  2F3V A;  4HMJ A;  1SNM A;  4DR4 L;  1F2Y A;  1HPC A;  3H3V C;  1R9T B;  2WP8 J;  4CDF C;  1TWF B;  4YHH L;  4OEL B;  1NY4 A;  2IPK D;  3CCE A;  4A3L G;  3BZK A;  4C3J H;  2UXC Q;  2VQE L;  1D7Q A;  2L55 A;  1HQR D;  1GUW A;  1LUZ A;  4NXN L;  4A3M H;  1SAP A;  3AU7 A;  3CCU A;  1SMY D;  5IGE A;  4GLA C;  4DK1 A;  1HTP A;  1A15 A;  1CKN A;  1SFO H;  2NZH A;  5C3E B;  3UDI A;  1SLJ A;  1HXY D;  4DV3 L;  4RKB A;  2QEX A;  2KCC A;  5FLM H;  1KNA A;  2CQO A;  3HZX A;  4DV0 Q;  4OL7 A;  3J80 i;  1D1I A;  2EVB A;  5LMN L;  4OWW B;  3SR1 A;  3FRP B;  3RZD B;  4LFB Q;  4A3E B;  4U68 A;  4JOI A;  3L2P A;  4LF6 Q;  4UP9 A;  4PZ8 A;  4L5S A;  2A68 C;  4GKJ Q;  4Q0F A;  4HJ7 A;  2QEJ C;  2ALY B;  2ZXO A;  4G4K A;  5FLX L;  2N3S A;  1ET6 A;  3GQB A;  3VYU A;  1VMC A;  1FL0 A;  4KKT A;  3TZU A;  4DR7 Q;  2I5L X;  3TP6 A;  1VQM A;  1HTL D;  4G7H C;  1DXM A;  1ET9 A;  3KDF A;  3TSS A;  1GJX A;  1EY0 A;  1G6Z A;  1Q8I A;  2LFN A;  2AWN A;  2M00 A;  1UE5 A;  1SYE A;  3K80 C;  1VCI A;  2ZTC A;  5M9O A;  1TWC B;  4BXX G;  4A3D H;  4DV2 Q;  2EYM A;  3W1B A;  4WJ3 M;  3CQZ B;  1GUO A;  3NHH A;  4HSV A;  5J1Z A;  5FO7 B;  2FJ2 A;  4R1J A;  1D5Z C;  2AQ1 B;  1SMY C;  2GVA A;  4LF5 L;  4H44 C;  3SK4 A;  1XPO A;  1KXL A;  5JEA H;  1G29 1;  1STH A;  1B3A A;  1QE6 A;  3DEP A;  4A3B H;  3QO2 A;  4JI0 L;  4UHV A;  1EOV A;  2MO0 A;  3PCO B;  3A5U A;  1O78 A;  1XNR L;  3IFD A;  3S14 B;  1X54 A;  1AN8 A;  3D0F A;  3T1Y Q;  2A74 C;  5KIX A;  2JA8 H;  3CP0 A;  5GAG C;  2PPB C;  3FP9 A;  3NWT A;  1K9M C;  3DXJ C;  5LHY 1;  4NP5 A;  3K0X A;  4JYA L;  2A1A A;  3F2D A;  4YIJ A;  4GOP C;  1HNX Q;  3OWF A;  2D9U A;  1YI2 A;  1OXS C;  3CCV A;  5IYD H;  5IGB A;  1EQV A;  3S1Q H;  5KND A;  4UP7 A;  1SE8 A;  1IYV A;  2F3I A;  2A19 A;  4G57 A;  1D8L A;  3ITP A;  4BA1 I;  1HZC A;  1ONL A;  2MO1 A;  4AQY Q;  3GTG H;  5M3M H;  3E0J A;  4A3C H;  4CGY B;  4ZRZ A;  4DAY A;  1U4P A;  3KYH C;  2F0H A;  1XMO L;  3FDT A;  2DY8 A;  4HJ8 A;  4NXM L;  1J5E L;  4DUY Q;  4P2C B;  3CCS A;  4RGT A;  2K05 A;  1YIT A;  2NBF A;  4A3G G;  1M1K C;  4JC0 A;  1JB7 A;  3R93 A;  3J81 L;  2KBN A;  1VQN A;  3I3C A;  1CKO A;  3CW2 C;  4B9X A;  5M3M G;  1SNO A;  4RWS C;  4ILW A;  1CT1 D;  2HQL A;  5EKK A;  4K5W A;  1QZH A;  2V4D A;  3FMC A;  4HIK A;  4J6H A;  3J7A 5;  3KF6 A;  4OON A;  2B2V C;  4KJN A;  1LTA D;  4K2L A;  5IYC H;  3MXU A;  2Z6K C;  3IFT A;  3CC7 A;  2Z6B A;  2PI2 E;  2Q8I B;  1TT2 A;  4R8I A;  4IUV A;  2F0P A;  4L5Q A;  4DR2 L;  5C3X A;  2ZJR A;  4XYQ A;  2VB2 X;  1E1O A;  3EA6 A;  4A3G B;  1PFB A;  2B2Y C;  3A0J A;  4PQX A;  1VQJ A;  3HKZ G;  1VQL A;  4RGM A;  5CMD A;  1E3P A;  2X69 A;  2DGY A;  1SYF A;  3DEO A;  3H09 A;  3A55 A;  5CV4 A;  4RGO S;  3S1R B;  3GO5 A;  3I8Z A;  2RDH A;  1Y1V B;  1CZG A;  2N78 A;  2B39 A;  1S40 A;  4LNQ A;  3K81 C;  5JOB A;  2F0V A;  4XTC S;  1C0A A;  4NMZ A;  1JWU D;  4UDU C;  4LUV A;  3ER0 A;  1Y69 U;  1UE6 A;  2LS0 1;  1VQE A;  3SEB A;  3FPU B;  1VDZ A;  5JJI A;  1A8V A;  1E2W A;  5K5P A;  5KYL A;  5M5Y B;  1VQB A;  4BA2 I;  2KHS A;  4IJL A;  3CCL A;  1CKN B;  2E74 C;  1VQI A;  3HKZ B;  1ENC A;  1SE3 A;  3NBI A;  2XRQ D;  3I72 A;  4EX5 A;  1CFM A;  4ZLT F;  2NN6 I;  4X3S A;  1I4Q A;  2Q8T A;  4ZK9 B;  1A2T A;  2E8G A;  2GA4 B;  2SNS A;  3RLF A;  4DR1 L;  4JK1 C;  1S5F D;  2RSO A;  2ZJP A;  4DAV A;  3G6J B;  1N9W A;  1L1O C;  1N8R C;  1WTP A;  2JA7 G;  4UAI A;  1N34 Q;  3M3Y H;  3TQY A;  2CHB D;  3GP7 A;  4H0L C;  1RIP A;  4R4I A;  1B2T A;  1UEB A;  2ZM6 L;  2WAQ E;  2OTL A;  4C3H B;  3BDL A;  2BDO A;  5DEH A;  3KDF B;  1W3S A;  1YHA A;  3OTO L;  2UXD Q;  4BWG B;  1LT4 D;  3D4W A;  1EIF A;  5EBD A;  5C4X G;  3HOU H;  1Z47 A;  2E2H B;  3K5O A;  1IL2 A;  2SDF A;  4OIJ A;  3P20 A;  2QCP X;  4QL5 A;  2DUD A;  3V2T A;  1PRT B;  3TDQ A;  3PO3 G;  2WB1 E;  3S1N B;  3GTK B;  2JA7 B;  1BXT A;  3G71 A;  4K6L A;  3E9I A;  1H9R A;  3VR4 A;  1RTN A;  4RA8 A;  1EIY B;  1JWM D;  4JI1 Q;  3NTK A;  4C1N K;  3J80 L;  1GXD C;  2HDM A;  3AFQ A;  4HJ9 A;  1SJH D;  3NP8 A;  5M5X H;  1LLR D;  3NQT A;  5TSS A;  1KC8 C;  3GTO B;  5COY A;  2K5H A;  4X62 L;  3BZC A;  2B2T C;  2I0Q A;  1N33 Q;  1VQ5 A;  4N9T A;  3KLS A;  1CHQ D;  1IHZ A;  1PXU A;  1KDA A;  1Q8K A;  2PNR C;  3CCM A;  4NPS A;  1Y1W G;  3HOY G;  1VQG A;  4J8Q A;  1UE7 A;  5IYB G;  5C4X B;  1NUC A;  2OF1 A;  1WVL A;  5C4Z A;  3GDE A;  4QJF A;  2H4O A;  3NEM A;  1I5F A;  5EKL A;  4DR5 Q;  4LF9 L;  1QZG A;  2YU9 B;  2O2L D;  3PO3 B;  4FF2 A;  4B3S L;  4TRD A;  1E2V A;  1BF4 A;  3ZYY X;  2OCE A;  2RSN A;  1PRT D;  4FXK C;  3SHL A;  1JMC A;  1KL9 A;  1KNE A;  4DAY B;  2GVB A;  4XDX A;  1IBL L;  1HUM A;  3BU2 A;  5CV5 A;  1SYD A;  3MFY A;  3UDF A;  2R92 G;  1T5E A;  2I07 B;  2K4K A;  3I4N G;  4X64 L;  2PZU A;  2KED A;  1H9S B;  2B2U A;  2F0N A;  4DR6 L;  3HOY B;  2ENB A;  2Z8L A;  2NWG A;  3A7L A;  2FIN B;  4JOI C;  5CBE E;  1JB3 A;  1EY9 A;  3URY A;  2OQ0 A;  1ROD A;  3T1H Q;  4A3J H;  1Q90 A;  3PUW A;  2RA4 A;  5C0X I;  4CJ2 C;  1C7Y A;  3S1M H;  2R93 B;  1JR0 D;  2CW0 C;  5LL6 X;  4B3R Q;  3E6Z X;  3L7Z C;  3TBI B;  2E75 C;  3EVQ A;  4A3F G;  3KJP A;  2GN5 A;  4R4T A;  1WFQ A;  5LL6 S;  3E5S A;  1HFN A;  3J81 j;  5C44 B;  3T53 B;  1C48 A;  5IP7 G;  2H5X A;  5IP9 H;  2R92 B;  5C0X J;  4FF3 A;  1I4P A;  2NUC A;  1A3U A;  4IOA A;  3J7Y W;  5IT9 c;  1NMF A;  1XXG A;  1VQ7 A;  3GTQ B;  1TY0 A;  3ERQ A;  3PUX A;  3I4N B;  1S3O A;  2Z0S A;  1NE3 A;  4A3K G;  2SNM A;  1PRT C;  2B29 A;  2DNE A;  3EQL C;  4HIO A;  1TS3 A;  2NN6 G;  5BR8 Q;  2Y0S G;  3A8K E;  4NKL A;  1K83 H;  2UXC L;  1EU4 A;  4XT1 B;  2VUM H;  1JE4 A;  5EPL A;  1CSP A;  1IL8 A;  4A3F B;  5IP9 G;  3H3V H;  1QUQ A;  1ZKO A;  4JI4 L;  5M3F H;  1L0W A;  1I6H H;  2YTX A;  1YJW A;  4ULL A;  2XVS A;  2ICE C;  4OEM B;  1TWA B;  4V19 0;  3S2H B;  3BVZ A;  2I5M X;  4JV5 Q;  3B6Y A;  2D62 A;  3QWN A;  3HOW G;  3Q8D A;  1A63 A;  1HNW L;  4OHJ A;  3U4Z A;  3M4P A;  1WD0 A;  4LFB L;  3K6O A;  1BCP F;  4IUP A;  3HRZ C;  3ND9 A;  4FXG C;  2VUM G;  3GTP B;  4LJZ C;  4BBR H;  1IBK Q;  3HOZ G;  4L5T A;  1J9O A;  1E0B A;  1PZI D;  3RR5 A;  1GUT A;  3NWS A;  5FK9 C;  5M5W H;  2UXB Q;  5HY6 A;  4CJ0 B;  2OQK A;  1TII D;  5FO8 B;  1EUJ A;  4POG A;  2JJQ A;  2TMP A;  5FO9 B;  1SNP A;  5COR A;  3S17 H;  4N8F A;  3Q6S A;  3OW7 A;  2LSS A;  2B63 H;  1KDB A;  1ASY A;  5H1S E;  3AQQ A;  3A54 A;  3TP8 A;  4DV2 L;  2BA1 A;  1MSG A;  4Y7N H;  3J7A V;  1XPU A;  1TY2 A;  3AMU A;  2XGT A;  3HOW B;  3PIO A;  3GTL B;  4R9W A;  3L0O A;  3OIQ A;  4K5X A;  1ESF A;  3V96 A;  1SND A;  1IBM L;  2KEE A;  3GTM B;  2HDL A;  3TP5 A;  2ZTD A;  2F0K A;  1JQY D;  3HOZ B;  1AE3 A;  2FMC A;  3OSO A;  4JBM A;  4RH6 A;  2IX0 A;  1O7Z A;  2HCI A;  2DJG C;  3QOJ A;  1GO3 E;  5HUR A;  4WJ4 A;  1WYD A;  1F2M A;  3F2B A;  3SGI A;  1STY A;  4BBS B;  3HOX H;  2HD3 A;  2JK8 A;  1HNX L;  1E1T A;  1U5K A;  4X3T A;  1LYL A;  5E7N A;  1R4P B;  1YIJ A;  4DF7 A;  2LMC B;  2IX3 A;  4WFN 3;  3E3X A;  5EAY A;  4ZYS A;  3JAM c;  4R4Q A;  3VR3 A;  2QKI C;  3I4M H;  3MZ5 A;  4HAE A;  5F2D A;  2L1B A;  2QGQ A;  1HNZ L;  1TWH B;  5ELO A;  3ZJY C;  4JBJ A;  1R9T H;  2AKW B;  5GAE C;  4JI6 Q;  1OTC A;  1SDF A;  4P74 A;  2JA6 H;  5IY0 A;  5C0X G;  4BY7 H;  1A3T A;  4WOR A;  1YNJ D;  3VA7 A;  5E3F A;  1X56 A;  2K28 A;  1JIC A;  2CWP A;  5JEA J;  2PMZ B;  4QUF A;  2AUK A;  1PYB A;  2ID0 A;  1HA5 A;  3KUP A;  3CHB D;  1QNU A;  2WB1 G;  1UNS A;  4KKS A;  3AEV A; 
#chains in the Genus database with same CATH homology
 3S1Q H;  3PV0 A;  3OYY A;  4UP7 A;  2UXB L;  1O7I A;  1SE8 A;  2F3I A;  2A19 A;  2YU9 H;  2A8V A;  3PO3 H;  4KHP Q;  1D8L A;  2V1C C;  4BA1 I;  5LMN W;  1HZC A;  2NZO A;  1XJV A;  2MO1 A;  2UU9 Q;  2JEA I;  4AQY Q;  3GTG H;  3PSI A;  4JI3 Q;  1XNQ L;  1NTG A;  5M3M H;  4Y52 H;  1NBW A;  2PI2 A;  4A3C H;  4R4O A;  4HJ5 A;  1FJG L;  4H02 A;  4A3E H;  3CPW A;  4OO1 I;  1GVP A;  4BY7 G;  1IXR A;  5FJ8 H;  4PZ6 A;  3KYH C;  3VDY A;  1XMO L;  4IO9 A;  1PH4 A;  4YCW A;  4X65 L;  3S24 A;  4DV0 L;  4HJ8 A;  2VS1 A;  3H15 A;  4RG1 A;  1J5E L;  4NXM L;  4B3T Q;  4R4C A;  4DUY Q;  1SRO A;  1AH9 A;  1PH6 A;  4UP8 A;  4LFC L;  1P16 A;  3CCS A;  3I4O A;  3F8T A;  1YIT A;  2HIV A;  1EYG A;  2LXJ A;  4DR1 Q;  3A74 A;  4LF6 L;  4GKK L;  2AHO B;  4A3G G;  1M1K C;  2LXK A;  4JC0 A;  1JB7 A;  1CKM A;  1IZ6 A;  4LF4 Q;  3STB D;  3PO2 H;  4GKJ L;  1Y1W H;  3HOY H;  1JT8 A;  3M9B A;  1PH5 A;  2KBN A;  4IPD A;  5IYB H;  1VQN A;  3K7A H;  1E7Z A;  5M3F G;  4A93 H;  1CKO A;  4DV4 L;  3CW2 C;  4IOC A;  2ES2 A;  1WCM G;  1TWC H;  4O0A A;  5M3M G;  3DLL A;  4DR7 L;  4GS3 A;  4BBS H;  1G6P A;  2ZM6 Q;  1XNQ Q;  4LF7 Q;  4HIM A;  4LF8 L;  5IE8 A;  2HQL A;  1QZH A;  2RF4 A;  1KQS A;  4PG3 A;  1UE1 A;  3AYH B;  4MTN A;  4IPH A;  4YWL A;  4HIK A;  3J7A 5;  3KF6 A;  4OON A;  4JI2 L;  1KD1 C;  1PH1 A;  1GM5 A;  5IYC H;  2UUB L;  2F52 A;  5LMU L;  4TQU S;  4X65 Q;  1KIX A;  4NXM Q;  5C44 H;  2Z6K C;  1Y14 B;  3CC7 A;  1UWV A;  1YNX A;  2PI2 E;  3HOV H;  2K75 A;  1N32 L;  4JI5 L;  2R92 H;  4C3I H;  4L5Q A;  1YEZ A;  4BBR G;  4APV A;  4DR2 L;  3GTQ H;  2F4V Q;  2ZJR A;  1VQO A;  1HH2 P;  4GKK Q;  1Q1B A;  3S2D H;  4A3M G;  2UUA Q;  4AIM A;  4DR3 Q;  3I4N H;  1E1O A;  4P71 A;  2JEB I;  4YCV A;  2I5H A;  3CME A;  3A0J A;  3ULJ A;  1MJC A;  4P72 A;  3NEL A;  1VQJ A;  3HKZ G;  5GAD C;  2R93 G;  1VQP A;  1VQL A;  4OWX B;  1E3P A;  3E9H A;  2DGY A;  4LF8 Q;  1I94 Q;  1Q81 C;  4JI6 L;  2B63 G;  1KRS A;  3GO5 A;  5FLM G;  3T1Y L;  1LTL A;  3U58 A;  1VQF A;  2N78 A;  4JI2 Q;  3S16 H;  5C44 G;  1S40 A;  4LNQ A;  4MNO A;  3KJO A;  2UUB Q;  5LMU Q;  1X3G A;  2EIF A;  3K81 C;  4A3F H;  4X62 Q;  4XTC S;  1KRT A;  3STB C;  1PH3 A;  4ALP A;  3CPF A;  1C0A A;  1N32 Q;  2R7D A;  4IJH A;  2NVT H;  1X3F A;  4DR2 Q;  2Q2U A;  4PZ7 A;  1A62 A;  4LUV A;  1B8A A;  3UDG A;  1MIU A;  4KLK A;  4YY3 L;  2Q2T A;  5IP7 H;  3ER0 A;  3CCR A;  2ATW A;  3S2H H;  2HIX A;  1UE6 A;  2K5N A;  1U0L A;  1VQE A;  4GNX A;  4AH6 A;  4A76 A;  3TS0 A;  5JJI A;  1TXY A;  1A8V A;  3RNU A;  4YWK A;  4FDB A;  2HT1 A;  1VQB A;  4KHP L;  4BA2 I;  1VQK A;  2UU9 L;  4IJL A;  4AQY L;  4JI3 L;  4A3K H;  4LF9 Q;  4JCV E;  5AJ3 Q;  3M4O H;  4A4I A;  1L1O A;  2VW9 A;  3CF5 A;  3CCL A;  4B3S Q;  1TWF H;  2KHJ A;  1X9N A;  1CKN B;  4QY7 A;  1BBW A;  1B70 B;  1VQI A;  3GTP H;  1AE2 A;  3MXN B;  3PGZ A;  4EX5 A;  1ASZ A;  2NN6 I;  2UXD L;  4A3D G;  4LUO A;  3FKI H;  1IBL Q;  3HOX G;  4B3T L;  2E8G A;  4DUY L;  2Q2I A;  3NBH B;  4RMF A;  3RLF A;  2JQO A;  3KF8 B;  4DR1 L;  4UY8 C;  3KFU A;  1PFS A;  2ZJP A;  5C3E H;  2ZTE A;  4DNI A;  1N9W A;  1L1O C;  2AWO A;  1N8R C;  4JI7 Q;  1Q46 A;  4X64 Q;  1HR0 Q;  2PQA B;  3CCQ A;  2JA7 G;  2IHF A;  2VZA A;  5JEA G;  4DAM A;  1N34 Q;  4GN3 B;  3I4M G;  3M3Y H;  4DR6 Q;  3TQY A;  4UPA A;  4A3B G;  3PF5 A;  4LFA L;  2L15 A;  3CD6 A;  4DV1 L;  5GQO A;  1RIP A;  4R4I A;  1XPR A;  3TRZ A;  1UEB A;  2R7F A;  3H0G H;  2ZM6 L;  3RN2 A;  4LF7 L;  4O2D A;  2WAQ E;  3CMA A;  3RZD H;  3ERS X;  2JA6 G;  2XTI A;  1JE5 A;  1VQC A;  1PH2 A;  2CKZ B;  4LW1 A;  2JA8 G;  3K7U C;  3GTL H;  2R7Z G;  5GAH C;  2OTL A;  2MQH A;  1SN8 A;  2JA9 A;  4K0K Q;  3KLW A;  1VQ4 A;  4JBK A;  4DV5 Q;  4HID A;  3KDF B;  1W3S A;  5DLQ E;  1H95 A;  5GRO A;  1YHA A;  3OTO L;  3GTM H;  2YYZ A;  2IY5 B;  2UXD Q;  4A3L H;  3M4Q A;  3RLO A;  4GN4 B;  1EIF A;  3FHW A;  3HOZ H;  2FXQ A;  5FLX c;  5C4X G;  4POF A;  5JJK A;  3NEN A;  1Z47 A;  5IYD G;  4B3M Q;  3HOU H;  2F4V L;  1PH7 A;  1Q7Y C;  2Y0S E;  1PV4 A;  1IL2 A;  1QVF A;  1CUK A;  1TWG H;  4QL5 A;  2UUA L;  5J3B A;  4DR3 L;  2DUD A;  3JC6 6;  2HHH L;  3GD7 A;  1V43 A;  2IHE A;  2Z6K A;  2D0O A;  3PO3 G;  4QGU A;  2EXD A;  5ELN A;  2YTV A;  2WB1 E;  1WOC A;  1KHI A;  2RCN A;  1XTD A;  4ME3 A;  4LFA Q;  4IFD I;  4A3C G;  4DV1 Q;  1WJJ A;  3G71 A;  4DPG A;  3E9I A;  4LWC A;  4A3E G;  4DKA C;  1EIY B;  1I94 L;  5FJ8 G;  3CQZ H;  1YVC A;  2D0P A;  3ULL A;  4JI1 Q;  4J15 A;  1NMG A;  3AFQ A;  4HJ9 A;  2E5L Q;  3DM3 A;  5M5X H;  3G4S A;  2Q2H A;  2N49 A;  3OTO Q;  1KC8 C;  4LUZ A;  1L2F A;  2K5H A;  4X62 L;  2OWO A;  3BZC A;  5IWA Q;  4IFD J;  3CAM A;  1G51 A;  2I0Q A;  1N33 Q;  1VQ5 A;  3BJU A;  2E2J H;  3HFZ B;  3PO2 G;  3W1G A;  4JI4 Q;  1TWH H;  1Q8K A;  1Y1W G;  3CCM A;  3HOY G;  3J81 i;  4NPS A;  1VQG A;  1K8A C;  3PUZ A;  1UE7 A;  4TVA B;  5IYB G;  1VS0 A;  2KHI A;  4A93 G;  3J7Z C;  3S14 H;  4KI0 A;  4DUZ Q;  1VQ6 A;  1GD7 A;  2HHH Q;  4A75 A;  3TEH B;  2K50 A;  1EQR A;  3GDE A;  1PH9 A;  4QJF A;  3PIP A;  3M85 A;  3G48 A;  4BBS G;  3NEM A;  1I5F A;  4DR5 Q;  2UUC Q;  1QUQ B;  4LF9 L;  1QZG A;  5AJ3 L;  1OXT A;  4OXP A;  4GLV B;  3U4V A;  1GKH A;  1JJ2 A;  3I2Z A;  4B3S L;  3M7N A;  1HNW Q;  3RN5 A;  4DR4 Q;  3U50 C;  4BXX H;  4B3R L;  1YHQ A;  2OCE A;  1JMC A;  1KL9 A;  4DAY B;  5IYC G;  2GVB A;  2CWA A;  2PQA A;  4GN5 A;  3S15 H;  1IBL L;  2JA5 H;  2NVX H;  3BU2 A;  1X65 A;  1I3Q H;  2ASB A;  3UDF A;  3HOV G;  2R92 G;  2VQF Q;  1Q82 C;  4X6A H;  4NXN Q;  1BKB A;  4HJA A;  1K8G A;  1X3E A;  1VQ9 A;  2K4K A;  3CC2 A;  2C35 B;  1IYJ B;  2YV5 A;  4DK6 C;  3PF4 A;  3EBE A;  3ULP A;  3I4N G;  4JI7 L;  1HJP A;  4X64 L;  1HR0 L;  1PH8 A;  2VNU D;  2VY3 A;  1VQH A;  1N34 L;  4C3H H;  4DR6 L;  2RHQ B;  2MFI A;  4DV3 Q;  3HKS A;  2N8N A;  4JOI C;  3ICE A;  1A0I A;  1B7Y B;  2IX1 A;  2E2I H;  4XIG S;  3AFP A;  2OQ0 A;  3T1H Q;  4A3J H;  4KHZ A;  5BR8 L;  3PUW A;  5C0X I;  5LMN Q;  3HKZ E;  1C7Y A;  4YCU A;  3S1M H;  4B3R Q;  1Q1E A;  1QVC A;  3L7Z C;  4DV6 L;  4K0K L;  3F1Z A;  2PNH A;  4DV5 L;  1X6O A;  4QQB X;  1N36 Q;  3WWV A;  3A5Z B;  4A3F G;  2BA0 A;  4AYB E;  3KJP A;  2GN5 A;  4P75 A;  4R4T A;  1WFQ A;  1M90 C;  1YHB A;  4YWM A;  4OX9 L;  1OXU A;  1IBM Q;  3J81 c;  2OTJ A;  4DV7 Q;  3J81 j;  2PMZ E;  2RHS B;  4B3M L;  1I50 H;  2WAQ G;  3I56 A;  5IP7 G;  2H5X A;  5IP9 H;  3CXC A;  1FVI A;  5C0X J;  1YJN A;  4IOA A;  1VQ7 A;  5IT9 c;  1NMF A;  1V9P A;  2KCM A;  1DGS A;  3UE0 A;  4JV5 L;  3PUX A;  3RZO H;  1S3O A;  2Z0S A;  1BBU A;  1NE3 A;  4NB3 A;  4A3K G;  2VL6 A;  4BY1 H;  1NJI C;  2JE6 I;  2B29 A;  4HIO A;  2CCZ A;  1PYS B;  1XMQ L;  2NN6 G;  2K5V A;  3I55 A;  3K8A A;  5BR8 Q;  4JI1 L;  1BVS A;  2Y0S G;  3HOW H;  4EQ5 A;  4DV6 Q;  1J6Q A;  3FKI G;  2BH2 A;  3TRE A;  2E5L L;  1K83 H;  1Z9F A;  1LM0 A;  2NVQ H;  1K3R A;  2UXC L;  2K52 A;  4PMW A;  5IWA L;  4A3G H;  2VUM H;  4LF5 Q;  4OX9 Q;  1E22 A;  1C9O A;  1OXX K;  1CSP A;  3RLN A;  1N33 L;  5K36 G;  1QVG A;  2KCT A;  1W2B A;  5IP9 G;  3H3V H;  1QUQ A;  5C3E G;  4JI4 L;  3PUV A;  5M3F H;  3D31 A;  1L0W A;  3KOJ A;  1HZA A;  2YTX A;  1I6H H;  3H3V I;  3CCJ A;  1HZ9 A;  2BH8 A;  4MZ9 A;  1HNZ Q;  1YJW A;  3UE1 A;  1EQQ A;  1X55 A;  4JI0 Q;  1WCM H;  3MEF A;  4DUZ L;  5JJL A;  3S1R H;  4L5R C;  1JJC B;  3E0E A;  1Y1V H;  1XNR Q;  3W5O A;  1YJ9 A;  4BY1 G;  3F2C A;  2I5M X;  1PHJ A;  4JV5 Q;  3G6E A;  4GNX B;  3H0G G;  3B6Y A;  4DR5 L;  4JBW A;  2UUC L;  2D62 A;  4X66 L;  4OO1 G;  2CFM A;  1WI5 A;  4GOP B;  3HOW G;  3Q8D A;  1A63 A;  1HNW L;  4DR4 L;  3U4Z A;  1XMQ Q;  3M4P A;  2ZJQ A;  4JYA Q;  2WP8 J;  1RL2 A;  1VQD A;  1L1O B;  4A3I H;  4LFB L;  4YHH L;  1YBY A;  2YTY A;  1NY4 A;  3UDX A;  3CCE A;  1HR0 W;  4A3L G;  3BZK A;  3EN2 A;  4C3J H;  1EFW A;  2VUM G;  2UXC Q;  4BBR H;  1IBK Q;  2VQE L;  1D7Q A;  4QIW E;  3HOZ G;  4L5T A;  2VQF L;  4JI8 L;  3PUY A;  3RR5 A;  5M5Y H;  1LUZ A;  4NXN L;  4A3M H;  3HOU G;  5M5W H;  2UXB Q;  5HY6 A;  3CCU A;  4C2M H;  2OQK A;  4GLA C;  4IPC A;  1EUJ A;  1EWI A;  1CKN A;  2JJQ A;  3JAM i;  1Y1V G;  1SFO H;  2NZH A;  4POG A;  4IFD G;  2R93 H;  3UDI A;  1VQA A;  1SLJ A;  1FJG Q;  4DV3 L;  4IPG A;  2QEX A;  3S17 H;  2LSS A;  1CSQ A;  1FGU A;  4DK3 C;  5FLM H;  1XMO Q;  1ASY A;  2B63 H;  4X66 Q;  2CQO A;  5H1S E;  3T1H L;  3AQQ A;  4DV0 Q;  1J5E Q;  3J80 i;  4A3I G;  5LMN L;  2BA1 A;  4DV2 L;  4OWW B;  4Y7N H;  1VQ8 A;  2NVY H;  4LFC Q;  1PA6 A;  1XPU A;  2XGT A;  4LFB Q;  3PIO A;  4YHH Q;  3L0O A;  4JOI A;  4OWT B;  3L2P A;  1N36 L;  4LF6 Q;  4UP9 A;  3LGJ A;  4PZ8 A;  4L5S A;  4GKJ Q;  3OW2 A;  2VQE Q;  1IBM L;  4HJ7 A;  1PVO A;  2ALY B;  4JI8 Q;  4DV7 L;  1Q86 C;  2N3S A;  2ZTD A;  1JJG A;  4DV4 Q;  2WFW A;  1K0R A;  1AE3 A;  1FL0 A;  2R6G A;  1SMX A;  2KEN A;  4JBM A;  1MJE A;  2I5L X;  4DR7 Q;  1VQM A;  2IX0 A;  4AYB G;  3KDF A;  1GO3 E;  4P73 A;  3IRB A;  3GTJ H;  2AWN A;  4WJ4 A;  1UE5 A;  2EQS A;  3K80 C;  1VCI A;  1WYD A;  2ZTC A;  3TS2 A;  3F2B A;  4BXX G;  2IT1 A;  1K73 C;  3SGI A;  4A3D H;  1SR3 A;  4DV2 Q;  3HOX H;  3W1B A;  2E2H H;  2JK8 A;  1HNX L;  1E1T A;  2MNA A;  1U5K A;  4WJ3 M;  2JA5 G;  1LYL A;  4JI5 Q;  1P8L A;  1Q12 A;  5E7N A;  2QA4 A;  1OXV A;  4R1J A;  1TWA H;  1YIJ A;  2GVA A;  3KF6 B;  4LF5 L;  1T9H A;  1MKH A;  5EAY A;  3S1N H;  1XPO A;  3GTK H;  3JAM c;  3EIV A;  2JA7 H;  4R4Q A;  1KXL A;  1S72 A;  1G29 1;  4GOP A;  3I4M H;  1E24 A;  2K14 A;  2QGQ A;  1HNZ L;  4A3B H;  4JI0 L;  5ELO A;  1EOV A;  2MO0 A;  3PCO B;  4JBJ A;  3ZJY C;  5C4J H;  3A5U A;  1HZB A;  1R9T H;  1XNR L;  1V1Q A;  2AKW B;  5GAE C;  1X54 A;  1OTC A;  4JI6 Q;  4P74 A;  3D0F A;  3J80 c;  2JA6 H;  3T1Y Q;  5IY0 A;  2JA8 H;  3CP0 A;  5C0X G;  4BY7 H;  5GAG C;  2R7Z H;  3GTO H;  1KAW A;  3FP9 A;  1K9M C;  4A3J G;  5HGQ A;  1X56 A;  2B3G A;  4GNX C;  1SRU A;  3K0X A;  3I7F A;  4JYA L;  2A1A A;  3F2D A;  2CWP A;  5JEA J;  4GOP C;  1HNX Q;  2AMC B;  3CC4 A;  1PYB A;  5C4X H;  2ID0 A;  1YI2 A;  4LF4 L;  1YZ6 A;  4GLX A;  1OXS C;  1IBK L;  3CCV A;  4JG2 A;  5IYD H;  4YY3 Q;  2WB1 G;  3AEV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...