4C3JJ

Structure of 14-subunit rna polymerase i at 3.35 a resolution, crystal form c2-90
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
69
structure length
69
Chain Sequence
MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNPLEKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-DIRECTED RNA POLYMERASE I SUBUNIT RPA190
publication title Crystal Structure of the 14-Subunit RNA Polymerase I
pubmed doi rcsb
molecule tags Transcription
total genus 13
structure length 69
sequence length 69
ec nomenclature
pdb deposition date 2013-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF01194 RNA_pol_N RNA polymerases N / 8 kDa subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 4c3jJ00
2QCOA 4QIWN 2CUEA 2Y31A 5FLMJ 1BW5A 3LSGA 4HNVA 3S1QJ 2H8RA 3H3VK 3JRBA 2DA1A 4A3IJ 3LNQA 4FISA 3BR2A 4C3HJ 2MW8A 1PUFB 1MNMC 2Y0SN 2CJJA 5J1UA 1F36A 4XK4A 3BG5A 3ZQHA 3BG3A 3ZQCA 1JTXA 1MSEC 1LE8B 2HDDA 4G12A 2EZLA 5J1RA 1TC3C 1FJLA 2DA3A 2NS7A 2Y9YA 4X6AJ 2XPUA 2Y30A 3UKGA 2B63J 5EGOA 3TW7A 1BJZA 3TP3A 2LK2A 4CYCB 5F0FA 4XRSG 1IC8A 5JLXA 1LFUP 1ZR2A 2XB5A 1OCPA 4FE4A 2K9QA 1WI3A 2DMPA 5F27A 2K40A 2X9DA 2YS9A 5GPCA 3GTKJ 1MH4A 5EYRA 1DU6A 2MG4A 2LTPA 1JKPC 1YRNB 3D1NI 1IG7A 2R5YA 1VI0A 4DW6A 3B6AA 1UHSA 4A69C 3OIOA 5F08A 3JRIA 3F0CA 4JYKA 3G1OA 5J1YA 2CU7A 1X58A 1U78A 2HXOA 3HOUJ 2LVSA 1JGGA 2VPRA 3QPSA 1IDZA 5C44J 3SJMA 3I4MJ 2CRGA 4BY1J 3NARA 1IV6A 1QRYA 4S0HB 2QF7A 3CQZJ 1FEXA 2VI6A 4A3KJ 2HOTA 1CQTA 2O9LA 3BTCA 4B1RA 2XSDC 1Z0XA 4XRSA 2M8GX 1U8BA 3HEFA 1FIAA 3CDLA 3LSRA 4IHWA 4BBSJ 2LKXA 2N8GA 3MVPA 2MSYA 3C2BA 2JA8J 2R5ZB 2AO9A 3OSGA 5EDNA 1Z77A 5EG0B 2ME0A 2PMZN 3JRCA 3PO2J 4AC0A 1AKHA 3JRHA 2HOSA 1AU7A 1DU0A 3ZQGA 4XICA 4MFDA 3RQIA 3FK7A 4M6VA 3GTGJ 3HM5A 1U9OA 1BL0A 1ZQ3P 5M5WJ 2TCTA 3S1MJ 5K7ZA 4A3LJ 1JJ8C 1HOMA 1E3OC 5J3LA 2LR8A 2M2EA 2XB0X 1MBFA 3IH2A 1WCMJ 2NVQJ 1JUMA 2NVYJ 1ZR4A 5FLVA 1XG1A 2CUFA 2OF7A 1B72A 3GTMJ 1ETOA 2JWTA 5E3OA 3Q3SA 1XS9A 3K7AJ 3BR6A 1PUFA 1S7EA 3HOYJ 2E1OA 4BY7J 4AYBN 1GDTA 1ETWA 3CCYA 3JRAA 3W6VA 2LLKA 3S15J 1MBGA 2W48A 3OSFA 2FJ1A 2GM4A 1LE8A 2TRTA 4MFEA 4FCYA 2XGCA 4L5EA 1AHDP 4BXXJ 2ID3A 1SANA 3SFIA 1QVUA 4LOCA 2IEKA 2OPTA 3K2AA 3MN2A 1OCTC 4CYCA 2JMWA 2FX0A 3O8HA 1WH5A 2NVXJ 4C3IJ 5M3MJ 2DMTA 1FIPA 1JJ6C 2EQRA 1O4XA 1ENHA 5C4XJ 2FQ4A 4BBRJ 2AHQA 5C3EJ 3I4NJ 4DZPA 5M5YJ 1ETYA 4RBOA 3GTQJ 1BW6A 1NK2P 1YRNA 1EF4A 1JKRC 2M9HA 1JTYA 3S2HJ 4MIMA 2HYJA 3HOVJ 2GLOA 4IHYA 2NVTJ 4GFBA 3HGYA 4DZJA 1IDYA 3A01B 4A3CJ 1H8AC 1W0TA 3FIWA 5F0CA 4DYRA 2CQQA 2DTZA 1H88C 3Q0VA 4M3FA 1TWCJ 1OFCX 4EEFG 5E3NA 3JR9A 1MBKA 2DA7A 4M3BA 1SFOJ 4MO7A 1BA5A 3Q0UA 3IH4A 3L1PA 3HOXJ 1JUPA 1P7IA 1FTZA 3FKIJ 2JA7J 1XC5A 2Y2ZA 4NDLA 1AKHB 1JKOC 2ZB9A 2RAEA 1ZK8A 1ZTRA 3LSJA 2WB1N 1UMQA 4D7MA 2E2IJ 3BQZA 2O7OA 1IRZA 2R5ZA 3JRDA 1H89C 1ETQA 5EG0A 4UUSB 3A03A 3QQAA 1Y1VJ 2DN0A 4RDUA 1FTTA 2IAIA 3GTOJ 1UG2A 2R0QC 1K61A 4A3GJ 1B8IB 2L9RA 1OJLA 2XGEA 3TP0A 2JJ7A 1MH3A 3HOWJ 5F0HA 4MLOA 2WAQN 2VKVA 4D5FA 2K9NA 2JN6A 3GBGA 1MBEA 4M3DA 2E2HJ 3GTLJ 1ETVA 2CQXA 1G2HA 5C4JJ 3VPRA 2KT0A 2EH3A 3BTJA 4BKXA 5IOZA 3M3YJ 3HBLA 5K7FA 3ZQIA 3GTPJ 3E7LA 3HKZN 5M5XJ 3ZOBA 1NK3P 4DYQA 5EEAA 4Y52J 1P7JA 2COBA 2I10A 4ABZA 1GV5A 5FKOA 3FISA 4QSHA 2DA5A 1HCRA 1JKQC 1NTCA 1QVTA 2HOAA 3GTJJ 5IYCJ 1WGXA 1GVDA 2HQ5A 3IH3A 2JA6J 2X6OA 5EZGA 4D7NA 4A3BJ 3S2DJ 4J19A 2R7ZJ 3ZQFA 1GT0C 3A02A 3HB9A 4B3AA 3PM1A 1U9NA 3BTLA 2JK3A 5IPAA 3FK6A 5FKMA 3ZQLA 3BG9A 2ECBA 5FKKA 4A3JJ 9ANTA 1A6IA 3BQYA 3S17J 4Y7NJ 3BR3A 4I6ZA 5F04A 5GP9A 4XRMA 3A01A 2LP0A 5IP9J 2R93J 1RETA 2X48A 2L7ZA 2HI3A 4M3GA 4V2GA 1ZGWA 3PO3J 1HDPA 1I6HJ 1ETKA 4IHXA 1T33A 3S1NJ 4UUTA 1IJWC 1IUFA 3G1LA 3HOZJ 1X2NA 2NOGA 4FTHA 3QPLA 1JT6A 1B72B 1T56A 2O8KA 5F1JA 2ID6A 3BR1A 1W0UA 1I50J 5E3MA 2DA6A 3WHBA 4A3DJ 3HGGA 2LFBA 1ETXA 1VFCA 1ZKGA 4W1UA 3BTIA 5EF6A 4M3EA 2ELKA 1HDDC 3M4OJ 2LY9A 4D5CA 3BT9A 4UUSA 1R9TJ 3SDGA 2DA2A 1K83J 4IEJA 1VNDA 4IHVA 1VF9A 4A3MJ 1TWGJ 3HDDA 3LSPA 1WH7A 5M3FJ 1B8IA 1RPWA 2WV1A 1POGA 4W97A 4A3FJ 1JT0A 4AUXA 2FD5A 1QPIA 1TWHJ 4JX5A 4V2FA 2R92J 4A3EJ 2H1KA 3BR5A 3JREA 1F43A 4C3JJ 2L7FP 1TWFJ 1RR7A 5IP6A 3TEDA 1RESA 3G1MA 3OOUA 1GUUA 3Q0WA 2ME6A 1ITYA 5FKLA 3IV5A 2VKEA 2XRLA 4JX6A 5EGOB 5IYDJ 3RZOJ 3LOCA 1WPKA 1TWAJ 3H0GJ 5GPAA 5E3LA 1D5YA 2L0KA 2Y9ZA 2L7MP 3RZDJ 3TW6A 3DCFA 3S14J 3CMYA 3RKQA 1ORKA 2ECCA 5JLWA 4I76A 2JA5J 2EZHA 2P81A 1GV2A 3BR0A 3MKLA 2KDZA 1HLVA 3NAUA 4JX4A 4X1EA 2GBYA 1RKWA 1LFBA 2DMUA 2DJNA 2EBIA 2R5YB 4XIDA 3O8GA 3JRGA 4FE7A 2D5VA 3JRFA 1APLC 1Y1WJ 1MBJA 2M0CA 5EZHA 5DS9A 1Q1VA 4B4CA 2MGQA 3S1RJ 3S16J 1A5JA 2DA4A 5K7HA 2YU9J 5IOYA 5BNGA 5HODA 5IYBJ 3B6CA 2EZIA 1X2MA 5IP7J 2LD5A 2XPVA 1RKTA 5DTDA 1MSFC 2XGDA 5FKNA 2XPWA 2NS8A 2DMNA 2EZKA 4JP0A 2K9SA 2HXIA 4A93J 2VUMJ 4QTRA 5FJ8J 4C2MJ 3DEWA 2YUSA 4DYCA 2E2JJ 2DMQA 1JUSA 1I3QJ 3WHCA 2IBDA 2G0EA 1HF0A 1MBHA 2M34A 2E19A 1IGNA
chains in the Genus database with same CATH superfamily
2O03A 2QCOA 5K5QA 3QP5A 2VBWA 3MZYA 1BW5A 5FLMJ 3KLOA 4BXUA 6PAXA 4LJZF 2OD5A 4N0BA 3HOTA 3S1QJ 4L18B 2FE3A 1X1AA 3W2WA 1X1CA 5J4YA 2LY1A 3FXQA 2E60A 4A3IJ 4CCLA 1X19A 3BR2A 3WE3A 2LF8A 2EIKH 3ZMTA 3Q5FA 2BGCA 2MW8A 1YLFA 2CQKA 2HPIA 3DWLE 1J09A 2DJIA 1SD7A 2QUFA 4BQAA 2R7TA 4PSXA 2XROA 2CJJA 2HR3A 2FSWA 2H1LA 2B9SA 1KONA 4JK1X 2HDDA 2BYVE 1CF7B 3FXLA 3OL4A 2H09A 5E18F 3M8EA 3PIPF 2XPUA 2Y30A 2FA5A 3QOEA 2V79A 2CUZA 5GAEJ 1B1BA 4XRSG 1BBYA 2GAUA 4KMUX 3KP4A 1ZR2A 2XB5A 5E8IA 2Z99A 4LK0F 2GXBA 1YOVB 2K9QA 1OCZH 2XF5A 5BQTA 3K9TA 2E35A 2ZSHB 3FMSA 5J47A 2YS9A 4E7KA 3QODA 3J7YJ 1MH4A 2B7EA 2LTPA 3K6GA 1HW5A 1IG7A 3V8JA 2VKHA 1VI0A 2DFHA 4LLLA 4DW6A 1UHSA 2KRFA 1VQ8I 3JRIA 1IN4A 2VE9A 3MZ8A 1X3WB 2RV8A 2OQGA 3F8BA 4RAFA 2OCEA 2X6WA 1X1BA 1A6QA 4NB5A 1DP7P 3QPSA 1IDZA 4LB6B 2CRGA 1V5GA 4HBLA 1XB4A 1UB9A 3SQNA 5H6RA 1FEXA 2EA2A 4G6TB 1PVEA 2DTRA 2XAGA 1CQTA 2O9LA 3BTCA 4B1RA 3GXOA 1ON2A 4U0WA 3OMYA 2GIZA 2KIMA 4L9JA 3EPZA 4WXCA 4MEYF 4KN4X 1HKSA 3KX2A 1SFKA 4IPAA 3DV8A 1VQ9I 2W85A 2FF4A 3C2BA 1UAAA 2JA8J 1XMXA 2YX7A 3DPLC 4NQWA 3KZZA 5EDNA 4YIIA 5EG0B 2A61A 1IRFA 4BEHA 1EH8A 3PO2J 1AKHA 3LA7A 3C7JA 1QA6A 1I3AA 2VBXA 3CTAA 2XC7A 3GW2A 3RQIA 2GOMA 2ZJ2A 3FXKA 2XGXA 3HJEA 1U9OA 4Y15A 4KA4A 3WTZA 2TCTA 4RM3A 3VEPA 1QPMA 2V6CA 4C9YA 3V7RA 2RVCA 4ZH4F 1E3OC 5J3LA 2IGNA 3D5SC 2LR8A 2IS6A 3VYRB 2BBYA 4HNUA 4XLPF 4ZJZA 2VQHA 3MAJA 4M6XA 3TL4X 2EV6A 1K4TA 2CUFA 2K85A 3DEEA 4XONA 2KRCA 2LF7A 2HVSA 3Q3SA 5J40A 3RKWA 4PJNA 4BH9A 3FXOA 4LIUA 3DKXA 1N78A 3LL7A 3N05A 3CCYA 3LAJA 3U1KA 2HTJA 3TO7A 1MBGA 5E79C 2FJ1A 4R1HA 2LY2A 2V1UA 2HWVA 2P6SA 1CF7A 4E7ZA 4NC6A 5DDGA 5ICFA 2ID3A 4IRGA 2Z16A 5CYVA 3COAC 3S8PA 4LOCA 2OJED 2OPTA 3H3ZA 1YE9A 3MN2A 4HLXA 2NS0A 3ZRGA 5L3CA 2KRHA 2CV0A 3OYDA 1ODDA 2WA0A 3E97A 4AVPA 2WY8Q 1TQMA 1VQPI 3ASNH 5C3EJ 1UHMA 1ZELA 3CUQB 2HTSA 5M5YJ 1ETYA 3GTQJ 3OS2A 3QU6A 2O5RA 3QPTA 1J2XA 2HQAA 4WK8F 1D1CA 1AA7A 2ISZA 2XUBA 3J7ZI 3LA2A 1HKTA 4A3CJ 1H8AC 1W0TA 1Z7UA 5F0CA 4A12A 1H88C 2DTZA 2CSOA 4AU7A 1OFCX 2K02A 4A5MA 1R5GA 3JR9A 1I5ZA 2DA7A 1SFOJ 2LMDA 2O8XA 5GAHJ 1FOYA 1ONVA 3CLQA 4UB8C 2YPRA 3L1PA 1FNNA 2IA0A 3FKIJ 4F91B 1AKHB 1JKOC 2LC2A 4BHBA 4DNCA 2E71A 1QGPA 2PJRA 1ON1A 4DGWB 1XGMA 3S93A 3D5RC 5L3FA 1O57A 1H89C 5AIQA 3SZGA 5EG0A 3I56I 1WQ2A 2L9SA 2OZ6A 1F4KA 2IAIA 5D5VB 2R0QC 4YELA 2OAZA 4DQ2A 4CGZA 4V19K 1G59A 2JJ7A 1MH3A 4F93B 3L7WA 5F0HA 3A0BC 2W25A 4HX4A 2X6YA 4D5FA 1MKMA 1VQLI 3LSKA 1MBEA 2F4MB 3WTYC 1XN7A 1FSEA 2E2HJ 3G4SI 2E1MB 4Y4RA 2LKPA 3QPHA 3ZR8X 2BY1A 1WJEA 2KT0A 3DKWA 2IGKA 2IGOA 4CCJA 2X1CA 2L02A 1KU3A 2F5FA 2VLAA 1W1WE 1LB2A 3HBLA 2QYOA 2KISA 1OPCA 4ETSA 4G6DA 3K10A 2MC4A 3E7LA 3I64A 3ZOBA 2KP6A 2COBA 2DT5A 1GV5A 2GA2A 3WGHA 3FISA 4QSHA 1HCRA 1JKQC 2OU2A 2HOAA 4IHSA 5IYCJ 2XAUA 2TDXA 2EILH 5KAFC 3ABMH 2VONA 4D7NA 5EZGA 2BEOA 2R7ZJ 3PQKA 3ZQFA 3M9AA 4B3AA 1U9NA 1IAWA 3BTLA 3VB2A 3OYCA 5IPAA 5FKMA 3ZQLA 2L54A 3VSKA 3L2VA 2ECBA 2RNJA 3DTKA 1DPUA 5FKKA 1F5TA 9ANTA 2VL8A 1XSXA 3DXJF 3TGNA 3RIRA 2OUMA 2JUGA 2NRAC 1RETA 1MMNA 4IHTA 4PFPA 5D8LB 1MMSA 4PJJA 1MJ9A 4ZYAA 1G4DA 2KL4A 4M72A 3AKZA 4UUTA 4K2EA 2QQ9A 3AG2H 1VQMI 1IUFA 3G1LA 3H5NA 2DU9A 2NOGA 1GHCA 3KFWX 4XNFA 4KUMA 1T56A 3B73A 4MNUA 1C0WA 2ID6A 2DFFA 3GZ5A 2EV5A 3RSNA 5DCMB 1D0YA 5HNFA 3HGGA 1WZ2A 3HRUA 1ETXA 4RB0A 1T98A 1WWXA 1ZKGA 3PL8A 5EF6A 4M3EA 1N77A 3AAFA 3FBIB 3HHGA 4CA0A 4D5CA 2FBKA 2DA2A 3OV8A 4IEJA 4S05A 3DTEA 1DGWY 1LDJA 1TWGJ 5D8KB 2CW7A 1RPWA 3RPQA 4F7ZA 1POGA 1J5YA 1LEAA 4Z2YA 2ZFWA 3LSIA 3DBLB 2R92J 4MTEA 2H1KA 3BR5A 4NBQA 5LHIA 1WJCA 2M87A 3IUOA 1R1TA 1FLIA 1TWFJ 4RMNA 1RESA 3ELKA 4G7ZF 1P92A 3AG1H 2IS4A 1ITYA 3CCRI 1MJAA 5HVQC 1OCCH 1Z21A 2VKEA 4C2TA 2EV0A 4PSWA 1OLTA 4OU0A 5F1RA 2BHYA 3LOCA 1F9NA 4IQJA 3L2WA 3OYLA 4ZDOA 3H36A 3MD2A 5ICEA 1FYKA 3FXRA 1D5YA 2L0KA 4AVZA 3RZDJ 3S14J 3DCFA 3CMYA 3RKQA 2HU9A 3MCZA 3QYEA 1I39A 1GV2A 3BR0A 3ROUA 1ZARA 1HLVA 2KIQA 1YW8A 3MFKA 4JX4A 3I9V2 1E0EA 5CKTA 2EB7A 2VJ4A 1Z91A 2JPBA 5E1WA 2P5LC 4XOTA 1KU2A 4M9XA 2DPDA 2D5VA 1SD6A 2LSOA 3H9GA 2VQGA 2CV2A 2DYSH 5LHGA 1MBJA 3KYLA 1P4WA 4IQ4A 2R7FA 3U2RA 4X0GA 4AIJA 4A0ZA 2FRHA 4L9VA 1BI0A 5GTIC 2MGQA 1SMTA 4H4KC 4WF2A 4Y17A 4KIBA 4KT6A 2QKLB 1S7OA 2V9PA 5BNGA 5IOYA 5IYBJ 5HODA 2EPFA 3GFMA 4RA2A 3CO6C 2XPVA 1RKTA 4RGXA 3WTUC 3E6BA 3S3OA 1V4RA 4M9SA 3DBHB 1PP7U 2LKSA 2DMNA 2EZKA 4JP0A 2K9MA 3BZKA 2R7XA 3RI4A 4A93J 1IN6A 3F6VA 3M7GA 2H94A 2IA2A 1R7JA 2X0LA 1TZLA 5ILUA 1D0XA 4IOCF 4BE2A 2ZXHA 3V4GA 2GZWA 1ERDA 2IBDA 2E19A 2QGUA 5DCMA 5ICCA 2R7VA 4BXFA 5L3EA 2ZMEB 2Y31A 1RC9A 5LD2C 4KDPA 3DPTA 5KVRA 1Z3YA 2R7DA 2IGMA 2H8RA 3K0LA 3H3VK 1H0MA 3VSLA 1XTAA 1TLHB 5FB2A 1SEUA 3CUOA 2A07F 4B47A 3JSOA 4KMFA 3LNQA 4XN3A 3LQRA 2H6BA 4UNOA 1BIBA 5EJCA 3DTIA 2J5OA 3I53A 2IS2A 1PUFB 5FD6A 5E17F 2CW0F 2DOFA 2MH2A 4E7SA 5JVGF 4O6JA 3L9FA 2P4WA 3DPUA 1HXDA 5J1UA 3OYKA 1F36A 2IXSA 1S6LA 3HHHA 3BG5A 1EH6A 4HV6A 4XK4A 5L3DA 3ZMUA 5IT3A 1JTXA 4LLNA 5D4SA 1MSEC 2KFDA 3HUGA 3VOEA 4I01A 1LE8B 4G12A 4LLGF 4HF0A 2DK5A 2EIJH 1TC3C 4LG3A 5HOOA 1P9QC 3PQJA 3UKGA 2B63J 4XKCA 1LFPA 2E7WA 2STTA 1BJZA 2PMUA 1VQ4I 5FO5A 3KZIC 3H3UA 3EUHC 4FE4A 2DBBA 2H27A 3MKYB 1NG7A 2R4GA 3QYBA 4II3A 2FNPA 3U21A 1TP4A 3GTKJ 4UV9A 1JXSA 1JI8A 3D1NI 4IZZA 1IN8A 3GFIA 1G3YA 1IXSB 4JYKA 5J1YA 1P4AA 4UV8A 2ICWG 3HSFA 1E2XA 2HXOA 3HOUJ 2UZKA 2LVSA 1J75A 1JGGA 5J4VA 1KU9A 2GXAA 4H0EA 5C44J 4IOAF 4BHPA 2AQEA 4OINF 5ILVA 3EUAA 1QZYA 2PLYA 1J9IA 1IV6A 4ENKA 3OS1A 2P5VA 3G73A 2VE8A 4RGUA 2HOTA 3PJRA 3RQ4A 2DYRH 5GAGJ 3LFUA 4F3QA 2XSDC 2WB1A 3EETA 3W6JB 2M8GX 4XRSA 3HEFA 3S3NA 2LRDA 3CDLA 1XD7A 1LVKA 3CJNA 4IRIA 3ML6A 4EGZA 4ZYDA 3H35A 3H9JA 1O3QA 5HDGA 3BJAA 3NWTA 3REOA 2AQFA 1RNLA 2ME0A 4EM2A 4BE0A 1MMGA 1Z3XA 4KJZA 3W2VA 1AU7A 3F9KA 2A5WA 1HSJA 3K2ZA 3ZQGA 2ZMEA 4MFDA 5BPIA 4EJOA 1MW7A 4M6VA 2WBMA 2KDOA 5B1BH 3JAMZ 3P9IA 4LGWA 1QQIA 1W5CC 4ESFA 1ZN2A 2WWYA 3K1NA 2OQRA 4P5OA 3F22A 4GDFA 2ZNYA 2XB0X 3J81Z 1WCMJ 2VN2A 2NVQJ 3EDPA 5D5UB 2OF7A 4A0XA 1E17A 1ETOA 3A1YA 1BI2A 1LJ9A 1I1GA 5DD4A 2E5ZA 3RPUA 3OYIA 1PUFA 2E1OA 4AYBN 4BACA 4HDUA 4J01A 1GDTA 4NHJA 3W6VA 2LLKA 1U8RA 2QSFX 3KYDB 2ZXWH 4B3XA 2QQBA 3HL2A 4EQQA 5HDNA 1LE8A 3MZHA 2L5QA 1RUNA 4FCYA 1UCRA 4BAYA 3LSHA 2VKDA 1D0ZA 1FP2A 4BXXJ 4U88A 4IRHA 4I0AA 2ZSIB 4XSZF 5BS6A 1QVUA 4AYBA 1JE8A 3I55I 3J7AO 4GCVA 1RRJA 1D8KA 2FX0A 5LRRA 3K4KA 2HNHA 5DYMA 4MTDA 4XLHA 3TO9A 1ZG5A 1YS6A 5HDKA 3CESA 3FXMA 4C3IJ 3W3CA 1E3HA 4KISA 2DFEA 2DMTA 4ZDPA 1FIPA 1JJ6C 1ZH5A 1YS7A 2FQ4A 3T0YA 2Y48A 4Q5SF 4S04A 2VBYA 1VQ7I 1T08B 4RBOA 1YJWI 3CJQB 1NK2P 2Z3YA 1PYVA 1JKRC 5GADJ 1V5EA 2GIVA 2XDVA 2HYJA 2W1OA 5HS7A 1O3SA 2XRNA 4GFBA 1Y8RB 2OA4A 2ZBKA 1AWCA 2CQQA 2QLZA 3FX3A 2V26A 1A31A 4I7HA 3KP2A 2GA1A 2Y0MA 1YTYA 4EEFG 2RDPA 4HQMA 5E3NA 3C3WA 2DFIA 4M6YA 4M3BA 1T0FA 4P9UA 1DGRM 2W84A 4O5VA 4HLYA 2LG4A 3H9QA 5IY5H 3R61A 4XQFA 2XAHA 4NC7A 4NDLA 1ZTRA 4ZTJA 3BQZA 1XCVA 2MC3A 1IRZA 1YQAA 5KK1A 4AM3A 1SVLA 1Z9CA 4KN7X 4IVNA 3AL0C 5CVIA 4UUSB 3A03A 4J00A 4RDUA 4CYDA 3RYRA 3QRFF 3GTOJ 1UG2A 1UJ8A 3OYHA 3HSRA 2RREA 4A3GJ 2Q0OA 2L9RA 2VBZA 3ABUA 5ILSA 3TDUC 2ZKZA 4MLOA 3KP3A 1Z6TA 2WAQN 4N4OB 3CF5F 4M74A 4F52A 3FM3A 3R0JA 4G7OF 1BR2A 1LNWA 2Z5UA 4P1WA 3W6KB 4E70A 4GO1A 2HZDA 2RNGA 1LQ1A 4OAYA 3V7CA 4GYIA 5C4JJ 2WAQA 3JW4A 5K5RA 3RYPA 3F8FA 2ISYA 3CCQI 1S72I 5K1YA 1XGOA 1MMAA 2F4IA 3WU0A 1ZREA 1QZZA 3M3YJ 3PFYA 2VB6A 2VIXA 3HTSB 1BC7C 2QVOA 5CQEA 3F72A 3S32A 3UR3C 5EEAA 4Y52J 2ZFUA 3CJRB 1S8NA 3T1BA 1QVTA 1U0JA 3P9CA 2ESNA 3ZMZA 5KAIC 1SFXA 2L9NA 4LMYA 2JA6J 1NHAA 3BJOA 1FYLA 4HOBA 5AONA 3PSIA 4RAYA 3S2DJ 2VXZA 1T95A 5ED4A 3GX4X 2QSHX 3CMEI 4O3MA 3A02A 3CDIA 1OCOH 4M73A 5DV5A 4A6EA 1QBJA 2K3FA 3JAMK 3QOPA 4P9FA 4XOPA 3IL2A 2K4BA 2LOOA 1JHHA 1TW3A 2ZXIA 2BXYA 2X51A 4DIQA 3IKVA 3BQYA 1A6IA 3J81K 3WGGA 4RS8A 3HXLA 1SD5A 1WHUA 3DP7A 5GP9A 4I6ZA 5CJ9A 2XKPA 1BI1A 2UXXA 2L7ZA 4BYYA 4QWQA 1I6HJ 1ETKA 3LMMA 5HNHA 3KIOA 4PK4A 1LDDA 4PUSA 4XN0A 3U9GA 1ZG3A 5ERIA 3HOZJ 4FTHA 3QPLA 1JT6A 1B72B 2O8KA 1TNSA 4BQNA 4DBQA 4E7JA 1YIJI 3BLYA 2DA6A 2DQRA 2LH9A 1OMIA 4A3DJ 3CC7I 2E7XA 1W7PD 1TTYA 4KYWA 2EK5A 3E6MA 2ELKA 3I58A 1R58A 2EFOA 2F5DA 2LY9A 1X4OA 4UUSA 2BVMA 1R9TJ 4XMYA 1OISA 1XMKA 1VQNI 2EFPA 3KEYA 1DPRA 2ETHA 4L5IA 4BGDA 2IVMA 4AUXA 3GYHX 4XORA 3SEZA 1TWHJ 2DK8A 2BZTA 3R4KA 2V4JC 3DBRB 4V2FA 2XAFA 3TDZC 4I98B 3CCMI 3BP8A 3M8FA 1HA8A 2RGVA 2BY0A 2W24A 4XBFA 4D9JA 4KICA 1RR7A 4B44A 1K78B 3OOUA 1GUUA 2O6GE 2ME6A 3ULQB 2OTJI 1TQPA 5FKLA 5K5OA 3ABTA 3ZPLA 2F5EA 4KFCA 4IF4A 5EGOB 2FU4A 1TL8A 1TNTA 3H0GJ 3OWTA 4JOMA 3OR2C 1A04A 3ONQA 3TW6A 1YHQI 1YI2I 3BY6A 1FBSA 1ORKA 2ECCA 2A05A 5JLWA 1MDMB 2IS1A 2EZHA 2P81A 3SHFA 4IKFA 4LK1F 1UZCA 2KDZA 2V1XA 3LAPA 1MMDA 1XMAA 4X1EA 3K1MA 4EM1A 1Y6IA 2GBYA 2PN6A 4OMYA 2DJNA 1B59A 1R22A 2M0MA 3JRGA 1YW9A 2GWRA 2HVQA 4EJTA 3D0SA 1I1SA 4C30A 1KYWA 3G3ZA 3GFJA 5L3GA 5IT9Z 5JR3A 2K5CA 1Y1WJ 1APLC 1UG0A 3B02A 1J59A 5DS9A 1BOAA 4D0PA 3PFIA 3S1RJ 3HC7A 5K7HA 2OTLI 1I27A 2EZIA 3TKYA 5LBQA 1YX5A 3F6OA 2HDCA 5DTDA 2VJ5A 2XGDA 1FT9A 4LIVA 4AIDA 4HAMA 1IUYA 4OIRF 1HC8A 1U5TB 2D1VA 4CH7A 2VUMJ 1Z1DA 4QTRA 5FJ8J 3OYGA 3C2GA 3GVAA 2VODA 3CUQA 2QENA 2QWWA 1JUSA 2DAOA 1K6OA 3KCCA 1I3QJ 1HF0A 5D5WB 2H8WA 2CO5A 1R4NB 2IJLA 3H1CA 3DLLF 4ESBA 3QU3A 2E1CA 3LSGA 4HNVA 3R60A 1YITI 3KETA 3OOPA 3A2KA 1YFHA 1KZHA 4HX8A 1SC7A 5DUIA 2NOJB 4AIHA 2WC2A 4C3HJ 4HF1A 1WJ5A 2CFXA 2RN7A 4NNJA 1FZPB 2L3DA 2IP2A 3K4NA 1SMYF 1TBXA 3ZQHA 1VQ6I 3BG3A 3ZQCA 1BI3A 1FYMA 3FM5A 1Y56A 2EFWA 1K78A 2I8DA 2KZVA 4PFOA 4ZYGA 5J1RA 3H92A 1BM9A 1FJLA 1ZLKA 3EYYA 3K4BA 2G9WA 4X6AJ 2V1NA 1S9HA 5DEQA 5EGOA 4IX7A 3OIPA 3BZ6A 3TBIA 1FBQA 2GOXB 2LK2A 5D5XB 2MABA 4CYCB 3BCAA 4WXDA 5HLHA 1OR7A 5CPRB 1ZLJA 3HPHA 1LUJB 1OCPA 4EVIA 2PQ8A 2DMPA 2YU3A 2K40A 1Z6RA 2X9DA 3ASOH 3MEXA 4LITA 3BROA 5CVRA 4EATA 1ZAOA 1S7AA 1DU6A 2MG4A 1JKPC 4UVBA 2KIFA 1ZHFA 3B6AA 4ON0A 3CP2A 2W00A 3OIOA 1XGSA 5F08A 1FOXA 3F0CA 2K27A 2CW8A 3HZJA 4WX9A 1X58A 1P2FA 1Y39A 5D6FA 3T8TA 2UWMA 1U78A 2M4GA 2V9KA 3M07A 3WTXC 2NVUB 5FROA 2VPRA 3SJMA 3I4MJ 3E3VA 1E3PA 3HPGA 2Z2SB 1QRYA 2CWEA 3CMAI 4TV7A 2DXIA 2AXTC 1HKQA 1J7KA 3CQZJ 2VI6A 1D8JA 4XKVA 3IC7A 2HYFA 3BC8A 1Z0XA 1U5TA 5E20A 1KYZA 4EM0B 2DI3A 1YJ9I 3FZVA 4CZZA 3IRQA 1KQ8A 3LSRA 2ZMEC 3E5UA 1FWZA 3MVPA 2MSYA 3GLXA 3RTRA 1FOKA 1VQOI 3UNGC 1BC8C 3ERED 3G71I 3OSGA 2HQRA 2PEXA 3VFZA 3IHUA 1KGSA 3DU6A 3JRCA 4AC0A 1MIJA 3JRHA 1OYWA 3KP5A 1DU0A 4XICA 1REPC 2HYGD 2MYSA 2OZUA 3FK7A 2HQNA 1T8IA 2JUCA 3GTGJ 2O3FA 3G6EI 3HM5A 4Y3OA 4HF2A 2M30A 3GMEA 1ZQ3P 3C2HA 1MZBA 5M5WJ 1WJFA 3S1MJ 4A3LJ 3ZMSA 1R36A 1RI7A 5IT9K 5FGMA 4EJUA 2M2EA 2BHZA 1V3FA 2RQQA 3IH2A 3T5XA 2VOOA 2MH9A 2VT3A 2XASA 3JSPA 3FHZA 5BPDA 1YG2A 2A5YB 5EEHA 5LGTA 5E3OA 1W36D 3K7AJ 2LDUA 2D1HA 3N4MA 3LSTA 1MJBA 2EWNA 1S7EA 2K4JA 4UB6C 3SZTA 1T38A 3OL3A 2CQ7A 3S15J 4G8XA 2W48A 4P96A 4G94A 4MFEA 5CQGA 1O7FA 4UXNA 1BR1A 3DEUA 3K4CA 3OIQA 4L5EA 4A5NA 1PJRA 2L2OA 4MQVA 3R0AA 1SANA 2ZNZA 3SFIA 3FXJA 2R7UA 2CMPA 4B09A 2BVLA 1W5SA 3CDHA 3K2AA 2HPMA 1WRJA 2R3SA 4CYCA 2JMWA 3HRSA 1SAUA 3O8HA 5D4RA 2UUZA 1WH5A 2F2EA 2NVXJ 2ZJRF 1X3ZB 5M3MJ 2L01A 3J80K 2JSCA 2HOEA 1ENHA 2L9VA 5C4XJ 4XLCA 2A3SA 4DZPA 4B43A 5LFAA 5LHHA 3LSMA 3I59B 1BW6A 2NAZA 1X1DA 2MD5A 2M9HA 4LD5A 5TGTA 1JTYA 2M1BA 4WCGA 3CCUI 3S2HJ 3FF5A 4MIMA 4CUGA 1T0FC 3HOVJ 5D6EA 2GLOA 4IHYA 2NVTJ 1KQ0A 4IO9F 3HGYA 4HX7A 3SDBA 3OYAA 2QZ8A 3FIWA 1LPQA 4ZC3A 2EIMH 4KITB 4M3FA 3FXUA 2F4OB 1P6RA 2VJIA 2OV7A 5TRDA 3WODF 2EA4A 1FPQA 2WV0A 2ELJA 4RLQA 3VYSB 3WU1B 2KPMA 3IRRA 2VOPA 2A6EF 2KLOA 1VQ5I 1FC3A 3IH4A 3E5QA 1EJ9A 1JUPA 3G2BA 2A68F 1BR4A 4QPOA 2ZB9A 3DKYA 2RAEA 4L0ZB 2FOKA 3ECOA 4XLEA 3LSJA 1UHWA 5J8FA 2WB1N 3PNYA 1UMQA 5FFXA 2E2IJ 1KU7A 2R7OA 2Z9OA 2O7OA 1USSA 3OS0A 3H5RA 2PX9A 4XRFA 1SVOA 2DN0A 1YO5C 1FTTA 4OAZA 2YR2A 1Z67A 1K61A 2A6HF 1B8IB 1OJLA 2DCEA 1IN5A 2XGEA 3N97A 4ZTFA 1BJAA 5EEGA 3H0DA 3NQOA 5B66C 3DQVC 3PIOF 4PCQA 2K9NA 4BDYA 3GBGA 2G7UA 1OKRA 5J6XA 2XVCA 3GTLJ 3I4PA 3VDXA 1DP3A 1U6GA 1N75A 5TJJA 1R6RA 3FMRA 4BL0B 2VC1A 5LGUA 3ISPA 2J5PA 4U7BA 3M8JA 3R6SA 4BKXA 1BIAA 2O0YA 1MGTA 3FDYA 2CQNA 1K4SA 3MQ0A 2B0LA 1R1VA 2AS5F 1W5TA 3GTPJ 4RLFA 2KJBA 3KEOA 3CCEI 2RC4A 3ZN0A 1NK3P 1QNTA 5AIPA 2G7HA 2DA5A 1NTCA 2XKOA 1I6XA 1WGXA 1GVDA 3PSFA 2IA1A 2HQ5A 2HDWA 3IH3A 1WFXA 4XKBA 4YEJA 1S5LC 4L5JA 3I3LA 4XM3A 2X85A 5LEKA 1GVJA 2M5WA 4CDGA 4HZFA 1W36C 1R5ID 1GT0C 3HB9A 3MKZA 1IV8A 1OYIA 1RZ4A 2JK3A 2M7BA 1XCBA 2ADUA 2F48A 3F3XA 4BUPA 3L2UA 3FK6A 4GRIA 3I59A 3KYCB 3DF8A 2Q2EB 1D1BA 1K6YA 1XDSA 4A3JJ 3TO6A 4RM2A 2DT7B 1JGSA 1G3TA 3BDDA 4Y7NJ 3CCVI 3BR3A 3EYIA 3E6DA 5F04A 3S2WA 1R1UA 3KE2A 2JTVA 1GXQA 2WAEA 1FBUA 3W2AA 4V2GA 3HTUA 4QPQA 1G3WA 3AFHA 2HFHA 2D45A 4EGYA 3PO3J 1B4AA 1T33A 2COMA 2XF6A 4E7LA 5FLXZ 3SXYA 4CHUA 1X2NA 2DDBA 2AXLA 3GFLA 1TW2A 3FKJA 4UVCA 1ZGJA 1OCRH 2MLGA 3FHNA 4ASNA 1I50J 1QHGA 3WHBA 1GXPA 4ANJA 2W82A 3E1SA 1D5VA 1A36A 3KEQA 3GLLA 2HVRA 1LKXA 3M4OJ 3FBNB 4ENJA 1K83J 1VNDA 4IHVA 3HRMA 4A3MJ 5H20A 3HDDA 3LSPA 5M3FJ 1B8IA 2EFQA 4L0YB 2KHMA 1JT0A 2MD0A 4LFUA 5CLSA 3BOQA 3BG7A 4JX5A 1A35A 4HSTA 1WSUA 1L0OC 4FQGA 5E1XA 3JREA 4KNYA 2IT0A 2L7FP 5IP6A 3G1MA 1UFMA 4A0YA 3Q0WA 1KQ9A 1JHFA 2BOLA 2BXZA 4PDKA 2HKXA 2QQAA 3IV5A 4Q47A 1G3SA 2NYXA 1KA8A 2XRLA 4CZCA 1NG6A 5IYDJ 3RZOJ 2M3AA 4LG0B 5CVVA 2MBFA 5HS9A 1TWAJ 1R49A 3F8MA 3X2QH 3OYBA 3EUHA 5B3SH 4HW0A 1XSVA 2Y9ZA 2QM3A 3ZQ7A 4UHTA 4WWCA 3CC4I 1R71A 1H9GA 2V1DA 1LEBA 1XPXA 3CF2A 5ICGA 3JTHA 2PG4A 2E36A 2YSRA 4NUBA 3NAUA 2F6CA 4XLFA 3O3KA 5DCFA 2JQ7A 1RKWA 2Q8KA 4BU2A 1QO0D 2R5YB 4XIDA 2R7QA 1B6AA 3VODA 2CS3A 3OY9A 2QQ8A 1BOBA 4HA8A 4CICA 2FUG2 5E1ZB 3O6BB 3TQNA 2P7CB 1V55H 3K4MA 2F5CA 1ZYRF 3OR1C 1FP1D 4Q4ZF 1PP8F 2PJRB 3CD6I 2ZCWA 5HLIA 4AIKA 4BS9A 1A5JA 4BJ5C 2YU9J 3PUBA 3B6CA 2Q2EA 2RQPA 2E5NA 3OYNA 4FHTA 2KMUA 1G6NA 4BQOA 2LD5A 2NNYA 4E7IA 1MSFC 4BJTA 3CUQC 2VQLA 1EH7A 1ULYA 1IRXA 4OWRB 2M8EA 2EJRA 2QA4I 1X4PA 2NS8A 2R7RA 3AG3H 2K9SA 2HXIA 4HNTA 2W57A 1IF1A 4C2MJ 2V6EA 2JVHA 3AL0B 2YUSA 2NXNB 2K3PA 4UVAA 2DMQA 1R00A 4E6KG 1DUXC 1ZRDA 3BPVA 3KLNA 3WHCA 2G0EA 4P55A 5F64A 4I0BA 3C18A 3WE2A 2Y75A 1MBHA 4PJ0C 2K9LA 4QIWN 5DM6F 3HRTA 2CUEA 2BY2A 1F1ZA 2YX4A 1HW1A 3TOBA 2JRTA 3K69A 1ACIA 2EFNA 4Y33A 2OBPA 1RUOA 3K70C 3JCUC 3JRBA 1GLNA 2DA1A 4U7DA 2BW3B 1D1AA 4N9HA 2LREA 4FISA 4M71A 1X3UA 2K86A 1MNMC 2Y0SN 3QYFA 4E7HA 2XAJA 4XKWA 3I0TA 1D3YA 4IL6C 1WJAA 5JVTA 1OR7C 2L4MA 4EJWA 2EZLA 3DFGA 4DBRA 2CFOA 2DA3A 2OCCH 2NS7A 2Y9YA 4GGGA 1B9MA 2Y0SA 3NRVA 3SYTA 4RGSA 3RDIA 3TW7A 4I02A 4LG0A 2E1MC 1IRGA 5FLXK 3TP3A 5F0FA 2UV1A 3J7AY 3P5JA 4ZDLA 3P9KA 1IC8A 4HV5A 5JLXA 1LFUP 1SVMA 4HEA2 2K7LA 3MWMA 4ENNA 5A2QZ 2IW5A 4U87A 4I09A 3CP8A 2XAQA 1WI3A 4WXHA 4XSXF 5F27A 3U1DA 5FRNA 5GPCA 2VXDA 3LWFA 5EYRA 1YRNB 1STZA 4F55A 2R5YA 2CUJA 3SFZA 1S29A 2VQCA 4MQ9F 4A69C 1K79A 5KNLA 1ZG1A 2DOEA 2A69F 3CMMA 3G1OA 2CU7A 3HG9A 1M1EB 3ZP5A 4II2A 3WG7H 1U5TC 4CCOA 1R5HA 4BDZA 3IAM2 3MKWB 2L4AA 4OMZA 3FMQA 2ZC2A 1YJNI 4HG2A 2GXGA 2C6YA 4BY1J 3GZNB 3NARA 3GCMA 4S0HB 2QF7A 3PNVA 4A3KJ 2XHKA 3BG6A 3E5XA 4RAZA 1L3LA 3OYFA 4ZZLA 1YW7A 1U8BA 4G7HF 5J8CA 3ESWB 1Z05A 1FIAA 3K1PA 3AG4H 3L00A 3L2RA 4BBSJ 2P5KA 4IHWA 2LKXA 2Z1DA 3O2PE 2N8GA 2FEZA 2FBHA 2R5ZB 2WAFA 2AO9A 2X1EA 1T39A 1QZEA 1Z77A 4KIGA 3NWSA 2OC6A 2PMZN 2LYCA 3RPUD 3L2CA 1PUEE 3DU5A 1QU3A 1LVAA 3D5LA 2HOSA 3Q9SA 3E6CC 5FRMA 2M7AA 4RB2C 2HZTA 1IXRC 4BNCA 1BL0A 4ESJA 1Q1HA 3TOAA 5K7ZA 3ZGKA 5H6QA 4RB3C 2PMZA 1JJ8C 1HOMA 4YRVA 2M45A 4R8HA 1MBFA 2JT1A 4FETA 2BW3A 3I54A 1SAXA 1JUMA 2NVYJ 1ZR4A 4R79A 5FLVA 1XG1A 2UXNA 1B72A 3GTMJ 2JWTA 3A4CA 5F6FA 3CZ6A 3RKXA 4A6DA 1XS9A 3BR6A 2JVGA 3HOYJ 4BY7J 3F23A 3J80Z 1FX7A 4XLAA 1ETWA 3JRAA 2GQQA 4U0YA 3OSFA 4DJAA 2GM4A 1SFEA 3BZCA 2TRTA 5BMZA 1U3EM 3QAHA 2XGCA 3HIFA 1AHDP 3BJ6A 4CXFA 1VQKI 1WI9A 2L7KA 2IEKA 4HSRA 2P8TA 1OCTC 2VJJA 4FX4A 3L2QA 4LB5A 4FX0A 5JHFA 4YFNF 1O3RA 4HDVA 1RR8C 2CG4A 1OQYA 2Z33A 2PFBA 3VWBA 2RKHA 3L09A 2EQRA 3SEQA 2X6XA 1O4XA 1P4XA 4BBRJ 2AHQA 3I4NJ 1G8XA 2ESHA 2F5VA 3ERMA 3F8CA 1YYVA 2V9VA 1IXCA 1YRNA 1EF4A 2VASA 3WG9A 3ZMVA 2DT6A 2P6TA 1QHHD 2BV6A 2I5UA 3ZXSA 4AD9A 4DZJA 1IDYA 3A01B 4OIQF 2P7VB 3S3MA 1IW7F 4DYRA 3ZMDA 5HLGA 1MDMA 3Q0VA 2IRFG 2ZO4A 1TWCJ 4E4HA 2FOWA 4XR6A 3GO5A 3H5AA 2QBYB 1MBKA 4ITVA 3GZ6A 1AOYA 2XIGA 4MO7A 1RIOH 1FY7A 4HRIA 3Q0UA 1BA5A 4XLNF 3HSEA 2DLLA 3HOXJ 5H2FC 2PJPA 1Y0UA 1TQIA 1P7IA 4EV0A 1FTZA 3A0HC 2JA7J 1XC5A 1IO2A 3GEZA 2X4HA 2Y2ZA 2JRMA 2FNAA 2LNBA 3HYIA 2IPQX 3M1EA 4CO8A 4YFXF 1ZK8A 1LDKB 3CCJI 3KPHA 4PZJA 2MLKA 4D7MA 2HGCA 3C1DA 2KKOA 3HUGB 3JRDA 2R5ZA 5KHDA 2MA3A 1H9TA 4MEXF 1ETQA 5DM7F 2JSPA 5A2QK 2PMHA 3QQAA 1Y1VJ 3WGIA 4BJ6C 3OYJA 3PNTA 3WTTC 2XV4S 1TT0A 4BE1A 3RKYA 3TP0A 4BQQA 1WVRA 3HOWJ 3FWEA 4CCNA 2FMYA 3BCBA 2VKVA 4L9TA 3GWZA 3ZN1A 3GUDA 1PDNC 1J0RA 1MNEA 2JN6A 2R7WA 5CVUA 4M3DA 3V8LA 2EINH 1ETVA 2CQXA 1W7PB 3WTSC 2KJCA 4HPQA 4ZYEA 1G2HA 2PBIA 2ZJPF 5L3BA 4PGGA 1NH3A 2DOAA 3VPRA 3CLOA 4MGRA 2VT2A 2EH3A 4B8XA 3BTJA 1S3JA 1EA3A 3VYTB 2E34A 4G6QA 2DODA 5IOZA 3CCLI 5K7FA 2ELHA 3ZQIA 1T6SA 2DQLA 5GTHC 2XSJC 1X1PA 2HEOA 1FSHA 3HKZN 5M5XJ 4Q48A 2DW4A 4DYQA 1Y8QB 1ZRFA 4L9NA 1P7JA 1OYYA 2I10A 3EQLF 3IAS2 2QKMB 4ABZA 3CO7C 1ZRCA 5FKOA 4HQEA 1R23A 1V54H 5FD5A 3GTJJ 3I5UA 4KIFA 5BOXA 2X6OA 4A3BJ 3F21A 3QWLA 3WU2C 4J19A 3HKZA 1HW2A 3K4LA 3PM1A 2LBFB 3IWFA 4NC8A 4CCMA 4IJAA 3ZCOA 2DDAA 3BG9A 3ECHA 3GF2A 3RCOA 2VC0A 4A2UA 2WY7Q 3HOSA 1BN5A 2CYYA 1MD0A 3S17J 4KT5C 3WTVC 3P7NA 1V5FA 3ABKH 4QLCU 1VZ0A 4XRMA 4D1QA 1USTA 2LP0A 3A01A 5IP9J 4YG2F 2O61A 2R93J 4UUVA 2M4KA 2X48A 4MHGA 2H6CA 3E0JB 2HI3A 3MMYB 4M3GA 1EV7A 1ZGWA 1HDPA 4IHXA 3S1NJ 2QBYA 1IJWC 5TISC 2QSGX 1SD4A 5LRSA 4FT8A 5B1AH 4C2UA 5F1JA 3BR1A 3VYUB 3V42A 1W0UA 4F92B 5E3MA 4I99C 4EMSA 2ACJA 2STWA 4I2OA 3ABLH 2LFBA 2FBIA 1VFCA 3K4JA 1W4MA 2KIUA 4W1UA 3PUFA 3BTIA 3OYEA 4FASD 1UELB 4YIRX 1HDDC 1YIOA 2Y69H 2XF7A 4IXAA 1O3TA 4ZZDA 2JPCA 3BT9A 4CSWA 3SDGA 4M9ZA 1VF9A 1WJBA 1HQCA 2W4SA 1SFUA 5FFZA 2BE5F 1WH7A 2KQRA 5HLTA 2W7NA 2WV1A 4W97A 1HSTA 2E1NA 2QEXI 4A3FJ 2A6TA 1XSDA 2FD5A 1QPIA 3M1CA 3CC2I 4OIOF 4A3EJ 1HBXG 1B9NA 5JI6A 4UY8I 4JBAA 1XDUA 1TT5B 4U0VA 1F43A 4C3JJ 3TEDA 4AWXB 4CCKA 3EUKL 4ZYHA 1W7PA 3BPXA 1T2KA 1Z7LA 2P0WA 4RB1A 4GYGA 3LQQA 5KCMA 4XL9A 4JX6A 4DOZA 1R4MB 3KP6A 4EJVA 5B5EC 4ENMA 1WPKA 4BHCA 4RGRA 5CVJA 5GPAA 2JZYA 5E3LA 1FOWA 4GXOA 4JQFA 1CGPA 2L7MP 3KP7A 1EKEA 3V8KA 4I76A 2JA5J 4YIFA 2ZJQF 3MKLA 2WADA 1K7AA 1LFBA 2DMUA 5LEJA 5JHUA 1U2WA 4Z6YA 1VTNC 3CJTB 1FMWA 2EBIA 2KZGA 3O8GA 2NNNA 4FE7A 2Q1ZB 5LGNA 1XX5A 2CGPA 3JRFA 1ZGAA 4N4NB 4PJMA 2D2WA 3RJPA 1YX3A 2M0CA 5EZHA 3V7SA 4OIPF 4YFKF 5HS8A 3DLAA 2VPLA 2LBFA 4G9YA 1XGNA 3LA3A 1DQUA 4N9IA 1Q1VA 3NEUA 2DO7A 2FXAA 4B4CA 3IKTA 2DA4A 2DPUA 4HYEA 3S16J 2MFZA 3CCSI 2JA2A 3T8RA 1X2MA 1O7LA 2CH0A 5IP7J 1DDNA 3LFKA 3OYMA 2BY3A 3BWGA 5DUKA 4RAGA 2WTEA 1FMVA 5FKNA 3IP4B 1IZ1A 2XPWA 3WTWC 1N25A 3JTGA 2R7SA 2ZXJA 4PJLA 5JFRA 2FMLA 1WKMA 2V7FA 4OOIA 3IWZA 1MNDA 5DD8A 2HS5A 2X1DA 3DEWA 3F8NA 1IN7A 2CV1A 4DYCA 4Y13A 2E2JJ 3KZYA 2FQ3A 4NQWB 3Q9VA 1WJDA 2HKOA 1Y0NA 3SZPA 2PI0A 5LLQA 3QP6A 3I71A 4B48A 5E8GA 4BEHB 3TMOA 3K70D 2M34A 3ZQQA 4PGHA 1IGNA
chains in the Genus database with same CATH topology
2QCOA 4QIWN 2CUEA 2Y31A 5FLMJ 1BW5A 3LSGA 4HNVA 3S1QJ 2H8RA 3H3VK 3JRBA 2DA1A 4A3IJ 3LNQA 4FISA 3BR2A 4C3HJ 2MW8A 1PUFB 1MNMC 2Y0SN 2CJJA 5J1UA 1F36A 4XK4A 3BG5A 3ZQHA 3BG3A 3ZQCA 1JTXA 1MSEC 1LE8B 2HDDA 4G12A 2EZLA 5J1RA 1TC3C 1FJLA 2DA3A 2NS7A 2Y9YA 4X6AJ 2XPUA 2Y30A 3UKGA 2B63J 5EGOA 3TW7A 1BJZA 3TP3A 2LK2A 4CYCB 5F0FA 4XRSG 1IC8A 5JLXA 1LFUP 1ZR2A 2XB5A 1OCPA 4FE4A 2K9QA 1WI3A 2DMPA 5F27A 2K40A 2X9DA 2YS9A 5GPCA 3GTKJ 1MH4A 5EYRA 1DU6A 2MG4A 2LTPA 1JKPC 1YRNB 3D1NI 1IG7A 2R5YA 1VI0A 4DW6A 3B6AA 1UHSA 4A69C 3OIOA 5F08A 3JRIA 3F0CA 4JYKA 3G1OA 5J1YA 2CU7A 1X58A 1U78A 2HXOA 3HOUJ 2LVSA 1JGGA 2VPRA 3QPSA 1IDZA 5C44J 3SJMA 3I4MJ 2CRGA 4BY1J 3NARA 1IV6A 1QRYA 4S0HB 2QF7A 3CQZJ 1FEXA 2VI6A 4A3KJ 2HOTA 1CQTA 2O9LA 3BTCA 4B1RA 2XSDC 1Z0XA 4XRSA 2M8GX 1U8BA 3HEFA 1FIAA 3CDLA 3LSRA 4IHWA 4BBSJ 2LKXA 2N8GA 3MVPA 2MSYA 3C2BA 2JA8J 2R5ZB 2AO9A 3OSGA 5EDNA 1Z77A 5EG0B 2ME0A 2PMZN 3JRCA 3PO2J 4AC0A 1AKHA 3JRHA 2HOSA 1AU7A 1DU0A 3ZQGA 4XICA 4MFDA 3RQIA 3FK7A 4M6VA 3GTGJ 3HM5A 1U9OA 1BL0A 1ZQ3P 5M5WJ 2TCTA 3S1MJ 5K7ZA 4A3LJ 1JJ8C 1HOMA 1E3OC 5J3LA 2LR8A 2M2EA 2XB0X 1MBFA 3IH2A 1WCMJ 2NVQJ 1JUMA 2NVYJ 1ZR4A 5FLVA 1XG1A 2CUFA 2OF7A 1B72A 3GTMJ 1ETOA 2JWTA 5E3OA 3Q3SA 1XS9A 3K7AJ 3BR6A 1PUFA 1S7EA 3HOYJ 2E1OA 4BY7J 4AYBN 1GDTA 1ETWA 3CCYA 3JRAA 3W6VA 2LLKA 3S15J 1MBGA 2W48A 3OSFA 2FJ1A 2GM4A 1LE8A 2TRTA 4MFEA 4FCYA 2XGCA 4L5EA 1AHDP 4BXXJ 2ID3A 1SANA 3SFIA 1QVUA 4LOCA 2IEKA 2OPTA 3K2AA 3MN2A 1OCTC 4CYCA 2JMWA 2FX0A 3O8HA 1WH5A 2NVXJ 4C3IJ 5M3MJ 2DMTA 1FIPA 1JJ6C 2EQRA 1O4XA 1ENHA 5C4XJ 2FQ4A 4BBRJ 2AHQA 5C3EJ 3I4NJ 4DZPA 5M5YJ 1ETYA 4RBOA 3GTQJ 1BW6A 1NK2P 1YRNA 1EF4A 1JKRC 2M9HA 1JTYA 3S2HJ 4MIMA 2HYJA 3HOVJ 2GLOA 4IHYA 2NVTJ 4GFBA 3HGYA 4DZJA 1IDYA 3A01B 4A3CJ 1H8AC 1W0TA 3FIWA 5F0CA 4DYRA 2CQQA 2DTZA 1H88C 3Q0VA 4M3FA 1TWCJ 1OFCX 4EEFG 5E3NA 3JR9A 1MBKA 2DA7A 4M3BA 1SFOJ 4MO7A 1BA5A 3Q0UA 3IH4A 3L1PA 3HOXJ 1JUPA 1P7IA 1FTZA 3FKIJ 2JA7J 1XC5A 2Y2ZA 4NDLA 1AKHB 1JKOC 2ZB9A 2RAEA 1ZK8A 1ZTRA 3LSJA 2WB1N 1UMQA 4D7MA 2E2IJ 3BQZA 2O7OA 1IRZA 2R5ZA 3JRDA 1H89C 1ETQA 5EG0A 4UUSB 3A03A 3QQAA 1Y1VJ 2DN0A 4RDUA 1FTTA 2IAIA 3GTOJ 1UG2A 2R0QC 1K61A 4A3GJ 1B8IB 2L9RA 1OJLA 2XGEA 3TP0A 2JJ7A 1MH3A 3HOWJ 5F0HA 4MLOA 2WAQN 2VKVA 4D5FA 2K9NA 2JN6A 3GBGA 1MBEA 4M3DA 2E2HJ 3GTLJ 1ETVA 2CQXA 1G2HA 5C4JJ 3VPRA 2KT0A 2EH3A 3BTJA 4BKXA 5IOZA 3M3YJ 3HBLA 5K7FA 3ZQIA 3GTPJ 3E7LA 3HKZN 5M5XJ 3ZOBA 1NK3P 4DYQA 5EEAA 4Y52J 1P7JA 2COBA 2I10A 4ABZA 1GV5A 5FKOA 3FISA 4QSHA 2DA5A 1HCRA 1JKQC 1NTCA 1QVTA 2HOAA 3GTJJ 5IYCJ 1WGXA 1GVDA 2HQ5A 3IH3A 2JA6J 2X6OA 5EZGA 4D7NA 4A3BJ 3S2DJ 4J19A 2R7ZJ 3ZQFA 1GT0C 3A02A 3HB9A 4B3AA 3PM1A 1U9NA 3BTLA 2JK3A 5IPAA 3FK6A 5FKMA 3ZQLA 3BG9A 2ECBA 5FKKA 4A3JJ 9ANTA 1A6IA 3BQYA 3S17J 4Y7NJ 3BR3A 4I6ZA 5F04A 5GP9A 4XRMA 3A01A 2LP0A 5IP9J 2R93J 1RETA 2X48A 2L7ZA 2HI3A 4M3GA 4V2GA 1ZGWA 3PO3J 1HDPA 1I6HJ 1ETKA 4IHXA 1T33A 3S1NJ 4UUTA 1IJWC 1IUFA 3G1LA 3HOZJ 1X2NA 2NOGA 4FTHA 3QPLA 1JT6A 1B72B 1T56A 2O8KA 5F1JA 2ID6A 3BR1A 1W0UA 1I50J 5E3MA 2DA6A 3WHBA 4A3DJ 3HGGA 2LFBA 1ETXA 1VFCA 1ZKGA 4W1UA 3BTIA 5EF6A 4M3EA 2ELKA 1HDDC 3M4OJ 2LY9A 4D5CA 3BT9A 4UUSA 1R9TJ 3SDGA 2DA2A 1K83J 4IEJA 1VNDA 4IHVA 1VF9A 4A3MJ 1TWGJ 3HDDA 3LSPA 1WH7A 5M3FJ 1B8IA 1RPWA 2WV1A 1POGA 4W97A 4A3FJ 1JT0A 4AUXA 2FD5A 1QPIA 1TWHJ 4JX5A 4V2FA 2R92J 4A3EJ 2H1KA 3BR5A 3JREA 1F43A 4C3JJ 2L7FP 1TWFJ 1RR7A 5IP6A 3TEDA 1RESA 3G1MA 3OOUA 1GUUA 3Q0WA 2ME6A 1ITYA 5FKLA 3IV5A 2VKEA 2XRLA 4JX6A 5EGOB 5IYDJ 3RZOJ 3LOCA 1WPKA 1TWAJ 3H0GJ 5GPAA 5E3LA 1D5YA 2L0KA 2Y9ZA 2L7MP 3RZDJ 3TW6A 3DCFA 3S14J 3CMYA 3RKQA 1ORKA 2ECCA 5JLWA 4I76A 2JA5J 2EZHA 2P81A 1GV2A 3BR0A 3MKLA 2KDZA 1HLVA 3NAUA 4JX4A 4X1EA 2GBYA 1RKWA 1LFBA 2DMUA 2DJNA 2EBIA 2R5YB 4XIDA 3O8GA 3JRGA 4FE7A 2D5VA 3JRFA 1APLC 1Y1WJ 1MBJA 2M0CA 5EZHA 5DS9A 1Q1VA 4B4CA 2MGQA 3S1RJ 3S16J 1A5JA 2DA4A 5K7HA 2YU9J 5IOYA 5BNGA 5HODA 5IYBJ 3B6CA 2EZIA 1X2MA 5IP7J 2LD5A 2XPVA 1RKTA 5DTDA 1MSFC 2XGDA 5FKNA 2XPWA 2NS8A 2DMNA 2EZKA 4JP0A 2K9SA 2HXIA 4A93J 2VUMJ 4QTRA 5FJ8J 4C2MJ 3DEWA 2YUSA 4DYCA 2E2JJ 2DMQA 1JUSA 1I3QJ 3WHCA 2IBDA 2G0EA 1HF0A 1MBHA 2M34A 2E19A 1IGNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QCO A;  4QIW N;  2CUE A;  2Y31 A;  5FLM J;  1BW5 A;  3LSG A;  4HNV A;  3S1Q J;  2H8R A;  3H3V K;  3JRB A;  2DA1 A;  4A3I J;  3LNQ A;  4FIS A;  3BR2 A;  4C3H J;  2MW8 A;  1PUF B;  1MNM C;  2Y0S N;  2CJJ A;  5J1U A;  1F36 A;  4XK4 A;  3BG5 A;  3ZQH A;  3BG3 A;  3ZQC A;  1JTX A;  1MSE C;  1LE8 B;  2HDD A;  4G12 A;  2EZL A;  5J1R A;  1TC3 C;  1FJL A;  2DA3 A;  2NS7 A;  2Y9Y A;  4X6A J;  2XPU A;  2Y30 A;  3UKG A;  2B63 J;  5EGO A;  3TW7 A;  1BJZ A;  3TP3 A;  2LK2 A;  4CYC B;  5F0F A;  4XRS G;  1IC8 A;  5JLX A;  1LFU P;  1ZR2 A;  2XB5 A;  1OCP A;  4FE4 A;  2K9Q A;  1WI3 A;  2DMP A;  5F27 A;  2K40 A;  2X9D A;  2YS9 A;  5GPC A;  3GTK J;  1MH4 A;  5EYR A;  1DU6 A;  2MG4 A;  2LTP A;  1JKP C;  1YRN B;  3D1N I;  1IG7 A;  2R5Y A;  1VI0 A;  4DW6 A;  3B6A A;  1UHS A;  4A69 C;  3OIO A;  5F08 A;  3JRI A;  3F0C A;  4JYK A;  3G1O A;  5J1Y A;  2CU7 A;  1X58 A;  1U78 A;  2HXO A;  3HOU J;  2LVS A;  1JGG A;  2VPR A;  3QPS A;  1IDZ A;  5C44 J;  3SJM A;  3I4M J;  2CRG A;  4BY1 J;  3NAR A;  1IV6 A;  1QRY A;  4S0H B;  2QF7 A;  3CQZ J;  1FEX A;  2VI6 A;  4A3K J;  2HOT A;  1CQT A;  2O9L A;  3BTC A;  4B1R A;  2XSD C;  1Z0X A;  4XRS A;  2M8G X;  1U8B A;  3HEF A;  1FIA A;  3CDL A;  3LSR A;  4IHW A;  4BBS J;  2LKX A;  2N8G A;  3MVP A;  2MSY A;  3C2B A;  2JA8 J;  2R5Z B;  2AO9 A;  3OSG A;  5EDN A;  1Z77 A;  5EG0 B;  2ME0 A;  2PMZ N;  3JRC A;  3PO2 J;  4AC0 A;  1AKH A;  3JRH A;  2HOS A;  1AU7 A;  1DU0 A;  3ZQG A;  4XIC A;  4MFD A;  3RQI A;  3FK7 A;  4M6V A;  3GTG J;  3HM5 A;  1U9O A;  1BL0 A;  1ZQ3 P;  5M5W J;  2TCT A;  3S1M J;  5K7Z A;  4A3L J;  1JJ8 C;  1HOM A;  1E3O C;  5J3L A;  2LR8 A;  2M2E A;  2XB0 X;  1MBF A;  3IH2 A;  1WCM J;  2NVQ J;  1JUM A;  2NVY J;  1ZR4 A;  5FLV A;  1XG1 A;  2CUF A;  2OF7 A;  1B72 A;  3GTM J;  1ETO A;  2JWT A;  5E3O A;  3Q3S A;  1XS9 A;  3K7A J;  3BR6 A;  1PUF A;  1S7E A;  3HOY J;  2E1O A;  4BY7 J;  4AYB N;  1GDT A;  1ETW A;  3CCY A;  3JRA A;  3W6V A;  2LLK A;  3S15 J;  1MBG A;  2W48 A;  3OSF A;  2FJ1 A;  2GM4 A;  1LE8 A;  2TRT A;  4MFE A;  4FCY A;  2XGC A;  4L5E A;  1AHD P;  4BXX J;  2ID3 A;  1SAN A;  3SFI A;  1QVU A;  4LOC A;  2IEK A;  2OPT A;  3K2A A;  3MN2 A;  1OCT C;  4CYC A;  2JMW A;  2FX0 A;  3O8H A;  1WH5 A;  2NVX J;  4C3I J;  5M3M J;  2DMT A;  1FIP A;  1JJ6 C;  2EQR A;  1O4X A;  1ENH A;  5C4X J;  2FQ4 A;  4BBR J;  2AHQ A;  5C3E J;  3I4N J;  4DZP A;  5M5Y J;  1ETY A;  4RBO A;  3GTQ J;  1BW6 A;  1NK2 P;  1YRN A;  1EF4 A;  1JKR C;  2M9H A;  1JTY A;  3S2H J;  4MIM A;  2HYJ A;  3HOV J;  2GLO A;  4IHY A;  2NVT J;  4GFB A;  3HGY A;  4DZJ A;  1IDY A;  3A01 B;  4A3C J;  1H8A C;  1W0T A;  3FIW A;  5F0C A;  4DYR A;  2CQQ A;  2DTZ A;  1H88 C;  3Q0V A;  4M3F A;  1TWC J;  1OFC X;  4EEF G;  5E3N A;  3JR9 A;  1MBK A;  2DA7 A;  4M3B A;  1SFO J;  4MO7 A;  1BA5 A;  3Q0U A;  3IH4 A;  3L1P A;  3HOX J;  1JUP A;  1P7I A;  1FTZ A;  3FKI J;  2JA7 J;  1XC5 A;  2Y2Z A;  4NDL A;  1AKH B;  1JKO C;  2ZB9 A;  2RAE A;  1ZK8 A;  1ZTR A;  3LSJ A;  2WB1 N;  1UMQ A;  4D7M A;  2E2I J;  3BQZ A;  2O7O A;  1IRZ A;  2R5Z A;  3JRD A;  1H89 C;  1ETQ A;  5EG0 A;  4UUS B;  3A03 A;  3QQA A;  1Y1V J;  2DN0 A;  4RDU A;  1FTT A;  2IAI A;  3GTO J;  1UG2 A;  2R0Q C;  1K61 A;  4A3G J;  1B8I B;  2L9R A;  1OJL A;  2XGE A;  3TP0 A;  2JJ7 A;  1MH3 A;  3HOW J;  5F0H A;  4MLO A;  2WAQ N;  2VKV A;  4D5F A;  2K9N A;  2JN6 A;  3GBG A;  1MBE A;  4M3D A;  2E2H J;  3GTL J;  1ETV A;  2CQX A;  1G2H A;  5C4J J;  3VPR A;  2KT0 A;  2EH3 A;  3BTJ A;  4BKX A;  5IOZ A;  3M3Y J;  3HBL A;  5K7F A;  3ZQI A;  3GTP J;  3E7L A;  3HKZ N;  5M5X J;  3ZOB A;  1NK3 P;  4DYQ A;  5EEA A;  4Y52 J;  1P7J A;  2COB A;  2I10 A;  4ABZ A;  1GV5 A;  5FKO A;  3FIS A;  4QSH A;  2DA5 A;  1HCR A;  1JKQ C;  1NTC A;  1QVT A;  2HOA A;  3GTJ J;  5IYC J;  1WGX A;  1GVD A;  2HQ5 A;  3IH3 A;  2JA6 J;  2X6O A;  5EZG A;  4D7N A;  4A3B J;  3S2D J;  4J19 A;  2R7Z J;  3ZQF A;  1GT0 C;  3A02 A;  3HB9 A;  4B3A A;  3PM1 A;  1U9N A;  3BTL A;  2JK3 A;  5IPA A;  3FK6 A;  5FKM A;  3ZQL A;  3BG9 A;  2ECB A;  5FKK A;  4A3J J;  9ANT A;  1A6I A;  3BQY A;  3S17 J;  4Y7N J;  3BR3 A;  4I6Z A;  5F04 A;  5GP9 A;  4XRM A;  3A01 A;  2LP0 A;  5IP9 J;  2R93 J;  1RET A;  2X48 A;  2L7Z A;  2HI3 A;  4M3G A;  4V2G A;  1ZGW A;  3PO3 J;  1HDP A;  1I6H J;  1ETK A;  4IHX A;  1T33 A;  3S1N J;  4UUT A;  1IJW C;  1IUF A;  3G1L A;  3HOZ J;  1X2N A;  2NOG A;  4FTH A;  3QPL A;  1JT6 A;  1B72 B;  1T56 A;  2O8K A;  5F1J A;  2ID6 A;  3BR1 A;  1W0U A;  1I50 J;  5E3M A;  2DA6 A;  3WHB A;  4A3D J;  3HGG A;  2LFB A;  1ETX A;  1VFC A;  1ZKG A;  4W1U A;  3BTI A;  5EF6 A;  4M3E A;  2ELK A;  1HDD C;  3M4O J;  2LY9 A;  4D5C A;  3BT9 A;  4UUS A;  1R9T J;  3SDG A;  2DA2 A;  1K83 J;  4IEJ A;  1VND A;  4IHV A;  1VF9 A;  4A3M J;  1TWG J;  3HDD A;  3LSP A;  1WH7 A;  5M3F J;  1B8I A;  1RPW A;  2WV1 A;  1POG A;  4W97 A;  4A3F J;  1JT0 A;  4AUX A;  2FD5 A;  1QPI A;  1TWH J;  4JX5 A;  4V2F A;  2R92 J;  4A3E J;  2H1K A;  3BR5 A;  3JRE A;  1F43 A;  4C3J J;  2L7F P;  1TWF J;  1RR7 A;  5IP6 A;  3TED A;  1RES A;  3G1M A;  3OOU A;  1GUU A;  3Q0W A;  2ME6 A;  1ITY A;  5FKL A;  3IV5 A;  2VKE A;  2XRL A;  4JX6 A;  5EGO B;  5IYD J;  3RZO J;  3LOC A;  1WPK A;  1TWA J;  3H0G J;  5GPA A;  5E3L A;  1D5Y A;  2L0K A;  2Y9Z A;  2L7M P;  3RZD J;  3TW6 A;  3DCF A;  3S14 J;  3CMY A;  3RKQ A;  1ORK A;  2ECC A;  5JLW A;  4I76 A;  2JA5 J;  2EZH A;  2P81 A;  1GV2 A;  3BR0 A;  3MKL A;  2KDZ A;  1HLV A;  3NAU A;  4JX4 A;  4X1E A;  2GBY A;  1RKW A;  1LFB A;  2DMU A;  2DJN A;  2EBI A;  2R5Y B;  4XID A;  3O8G A;  3JRG A;  4FE7 A;  2D5V A;  3JRF A;  1APL C;  1Y1W J;  1MBJ A;  2M0C A;  5EZH A;  5DS9 A;  1Q1V A;  4B4C A;  2MGQ A;  3S1R J;  3S16 J;  1A5J A;  2DA4 A;  5K7H A;  2YU9 J;  5IOY A;  5BNG A;  5HOD A;  5IYB J;  3B6C A;  2EZI A;  1X2M A;  5IP7 J;  2LD5 A;  2XPV A;  1RKT A;  5DTD A;  1MSF C;  2XGD A;  5FKN A;  2XPW A;  2NS8 A;  2DMN A;  2EZK A;  4JP0 A;  2K9S A;  2HXI A;  4A93 J;  2VUM J;  4QTR A;  5FJ8 J;  4C2M J;  3DEW A;  2YUS A;  4DYC A;  2E2J J;  2DMQ A;  1JUS A;  1I3Q J;  3WHC A;  2IBD A;  2G0E A;  1HF0 A;  1MBH A;  2M34 A;  2E19 A;  1IGN A; 
#chains in the Genus database with same CATH topology
 2O03 A;  2QCO A;  5K5Q A;  3QP5 A;  2VBW A;  3MZY A;  1BW5 A;  5FLM J;  3KLO A;  4BXU A;  6PAX A;  4LJZ F;  2OD5 A;  4N0B A;  3HOT A;  3S1Q J;  4L18 B;  2FE3 A;  1X1A A;  3W2W A;  1X1C A;  5J4Y A;  2LY1 A;  3FXQ A;  2E60 A;  4A3I J;  4CCL A;  1X19 A;  3BR2 A;  3WE3 A;  2LF8 A;  2EIK H;  3ZMT A;  3Q5F A;  2BGC A;  2MW8 A;  1YLF A;  2CQK A;  2HPI A;  3DWL E;  1J09 A;  2DJI A;  1SD7 A;  2QUF A;  4BQA A;  2R7T A;  4PSX A;  2XRO A;  2CJJ A;  2HR3 A;  2FSW A;  2H1L A;  2B9S A;  1KON A;  4JK1 X;  2HDD A;  2BYV E;  1CF7 B;  3FXL A;  3OL4 A;  2H09 A;  5E18 F;  3M8E A;  3PIP F;  2XPU A;  2Y30 A;  2FA5 A;  3QOE A;  2V79 A;  2CUZ A;  5GAE J;  1B1B A;  4XRS G;  1BBY A;  2GAU A;  4KMU X;  3KP4 A;  1ZR2 A;  2XB5 A;  5E8I A;  2Z99 A;  4LK0 F;  2GXB A;  1YOV B;  2K9Q A;  1OCZ H;  2XF5 A;  5BQT A;  3K9T A;  2E35 A;  2ZSH B;  3FMS A;  5J47 A;  2YS9 A;  4E7K A;  3QOD A;  3J7Y J;  1MH4 A;  2B7E A;  2LTP A;  3K6G A;  1HW5 A;  1IG7 A;  3V8J A;  2VKH A;  1VI0 A;  2DFH A;  4LLL A;  4DW6 A;  1UHS A;  2KRF A;  1VQ8 I;  3JRI A;  1IN4 A;  2VE9 A;  3MZ8 A;  1X3W B;  2RV8 A;  2OQG A;  3F8B A;  4RAF A;  2OCE A;  2X6W A;  1X1B A;  1A6Q A;  4NB5 A;  1DP7 P;  3QPS A;  1IDZ A;  4LB6 B;  2CRG A;  1V5G A;  4HBL A;  1XB4 A;  1UB9 A;  3SQN A;  5H6R A;  1FEX A;  2EA2 A;  4G6T B;  1PVE A;  2DTR A;  2XAG A;  1CQT A;  2O9L A;  3BTC A;  4B1R A;  3GXO A;  1ON2 A;  4U0W A;  3OMY A;  2GIZ A;  2KIM A;  4L9J A;  3EPZ A;  4WXC A;  4MEY F;  4KN4 X;  1HKS A;  3KX2 A;  1SFK A;  4IPA A;  3DV8 A;  1VQ9 I;  2W85 A;  2FF4 A;  3C2B A;  1UAA A;  2JA8 J;  1XMX A;  2YX7 A;  3DPL C;  4NQW A;  3KZZ A;  5EDN A;  4YII A;  5EG0 B;  2A61 A;  1IRF A;  4BEH A;  1EH8 A;  3PO2 J;  1AKH A;  3LA7 A;  3C7J A;  1QA6 A;  1I3A A;  2VBX A;  3CTA A;  2XC7 A;  3GW2 A;  3RQI A;  2GOM A;  2ZJ2 A;  3FXK A;  2XGX A;  3HJE A;  1U9O A;  4Y15 A;  4KA4 A;  3WTZ A;  2TCT A;  4RM3 A;  3VEP A;  1QPM A;  2V6C A;  4C9Y A;  3V7R A;  2RVC A;  4ZH4 F;  1E3O C;  5J3L A;  2IGN A;  3D5S C;  2LR8 A;  2IS6 A;  3VYR B;  2BBY A;  4HNU A;  4XLP F;  4ZJZ A;  2VQH A;  3MAJ A;  4M6X A;  3TL4 X;  2EV6 A;  1K4T A;  2CUF A;  2K85 A;  3DEE A;  4XON A;  2KRC A;  2LF7 A;  2HVS A;  3Q3S A;  5J40 A;  3RKW A;  4PJN A;  4BH9 A;  3FXO A;  4LIU A;  3DKX A;  1N78 A;  3LL7 A;  3N05 A;  3CCY A;  3LAJ A;  3U1K A;  2HTJ A;  3TO7 A;  1MBG A;  5E79 C;  2FJ1 A;  4R1H A;  2LY2 A;  2V1U A;  2HWV A;  2P6S A;  1CF7 A;  4E7Z A;  4NC6 A;  5DDG A;  5ICF A;  2ID3 A;  4IRG A;  2Z16 A;  5CYV A;  3COA C;  3S8P A;  4LOC A;  2OJE D;  2OPT A;  3H3Z A;  1YE9 A;  3MN2 A;  4HLX A;  2NS0 A;  3ZRG A;  5L3C A;  2KRH A;  2CV0 A;  3OYD A;  1ODD A;  2WA0 A;  3E97 A;  4AVP A;  2WY8 Q;  1TQM A;  1VQP I;  3ASN H;  5C3E J;  1UHM A;  1ZEL A;  3CUQ B;  2HTS A;  5M5Y J;  1ETY A;  3GTQ J;  3OS2 A;  3QU6 A;  2O5R A;  3QPT A;  1J2X A;  2HQA A;  4WK8 F;  1D1C A;  1AA7 A;  2ISZ A;  2XUB A;  3J7Z I;  3LA2 A;  1HKT A;  4A3C J;  1H8A C;  1W0T A;  1Z7U A;  5F0C A;  4A12 A;  1H88 C;  2DTZ A;  2CSO A;  4AU7 A;  1OFC X;  2K02 A;  4A5M A;  1R5G A;  3JR9 A;  1I5Z A;  2DA7 A;  1SFO J;  2LMD A;  2O8X A;  5GAH J;  1FOY A;  1ONV A;  3CLQ A;  4UB8 C;  2YPR A;  3L1P A;  1FNN A;  2IA0 A;  3FKI J;  4F91 B;  1AKH B;  1JKO C;  2LC2 A;  4BHB A;  4DNC A;  2E71 A;  1QGP A;  2PJR A;  1ON1 A;  4DGW B;  1XGM A;  3S93 A;  3D5R C;  5L3F A;  1O57 A;  1H89 C;  5AIQ A;  3SZG A;  5EG0 A;  3I56 I;  1WQ2 A;  2L9S A;  2OZ6 A;  1F4K A;  2IAI A;  5D5V B;  2R0Q C;  4YEL A;  2OAZ A;  4DQ2 A;  4CGZ A;  4V19 K;  1G59 A;  2JJ7 A;  1MH3 A;  4F93 B;  3L7W A;  5F0H A;  3A0B C;  2W25 A;  4HX4 A;  2X6Y A;  4D5F A;  1MKM A;  1VQL I;  3LSK A;  1MBE A;  2F4M B;  3WTY C;  1XN7 A;  1FSE A;  2E2H J;  3G4S I;  2E1M B;  4Y4R A;  2LKP A;  3QPH A;  3ZR8 X;  2BY1 A;  1WJE A;  2KT0 A;  3DKW A;  2IGK A;  2IGO A;  4CCJ A;  2X1C A;  2L02 A;  1KU3 A;  2F5F A;  2VLA A;  1W1W E;  1LB2 A;  3HBL A;  2QYO A;  2KIS A;  1OPC A;  4ETS A;  4G6D A;  3K10 A;  2MC4 A;  3E7L A;  3I64 A;  3ZOB A;  2KP6 A;  2COB A;  2DT5 A;  1GV5 A;  2GA2 A;  3WGH A;  3FIS A;  4QSH A;  1HCR A;  1JKQ C;  2OU2 A;  2HOA A;  4IHS A;  5IYC J;  2XAU A;  2TDX A;  2EIL H;  5KAF C;  3ABM H;  2VON A;  4D7N A;  5EZG A;  2BEO A;  2R7Z J;  3PQK A;  3ZQF A;  3M9A A;  4B3A A;  1U9N A;  1IAW A;  3BTL A;  3VB2 A;  3OYC A;  5IPA A;  5FKM A;  3ZQL A;  2L54 A;  3VSK A;  3L2V A;  2ECB A;  2RNJ A;  3DTK A;  1DPU A;  5FKK A;  1F5T A;  9ANT A;  2VL8 A;  1XSX A;  3DXJ F;  3TGN A;  3RIR A;  2OUM A;  2JUG A;  2NRA C;  1RET A;  1MMN A;  4IHT A;  4PFP A;  5D8L B;  1MMS A;  4PJJ A;  1MJ9 A;  4ZYA A;  1G4D A;  2KL4 A;  4M72 A;  3AKZ A;  4UUT A;  4K2E A;  2QQ9 A;  3AG2 H;  1VQM I;  1IUF A;  3G1L A;  3H5N A;  2DU9 A;  2NOG A;  1GHC A;  3KFW X;  4XNF A;  4KUM A;  1T56 A;  3B73 A;  4MNU A;  1C0W A;  2ID6 A;  2DFF A;  3GZ5 A;  2EV5 A;  3RSN A;  5DCM B;  1D0Y A;  5HNF A;  3HGG A;  1WZ2 A;  3HRU A;  1ETX A;  4RB0 A;  1T98 A;  1WWX A;  1ZKG A;  3PL8 A;  5EF6 A;  4M3E A;  1N77 A;  3AAF A;  3FBI B;  3HHG A;  4CA0 A;  4D5C A;  2FBK A;  2DA2 A;  3OV8 A;  4IEJ A;  4S05 A;  3DTE A;  1DGW Y;  1LDJ A;  1TWG J;  5D8K B;  2CW7 A;  1RPW A;  3RPQ A;  4F7Z A;  1POG A;  1J5Y A;  1LEA A;  4Z2Y A;  2ZFW A;  3LSI A;  3DBL B;  2R92 J;  4MTE A;  2H1K A;  3BR5 A;  4NBQ A;  5LHI A;  1WJC A;  2M87 A;  3IUO A;  1R1T A;  1FLI A;  1TWF J;  4RMN A;  1RES A;  3ELK A;  4G7Z F;  1P92 A;  3AG1 H;  2IS4 A;  1ITY A;  3CCR I;  1MJA A;  5HVQ C;  1OCC H;  1Z21 A;  2VKE A;  4C2T A;  2EV0 A;  4PSW A;  1OLT A;  4OU0 A;  5F1R A;  2BHY A;  3LOC A;  1F9N A;  4IQJ A;  3L2W A;  3OYL A;  4ZDO A;  3H36 A;  3MD2 A;  5ICE A;  1FYK A;  3FXR A;  1D5Y A;  2L0K A;  4AVZ A;  3RZD J;  3S14 J;  3DCF A;  3CMY A;  3RKQ A;  2HU9 A;  3MCZ A;  3QYE A;  1I39 A;  1GV2 A;  3BR0 A;  3ROU A;  1ZAR A;  1HLV A;  2KIQ A;  1YW8 A;  3MFK A;  4JX4 A;  3I9V 2;  1E0E A;  5CKT A;  2EB7 A;  2VJ4 A;  1Z91 A;  2JPB A;  5E1W A;  2P5L C;  4XOT A;  1KU2 A;  4M9X A;  2DPD A;  2D5V A;  1SD6 A;  2LSO A;  3H9G A;  2VQG A;  2CV2 A;  2DYS H;  5LHG A;  1MBJ A;  3KYL A;  1P4W A;  4IQ4 A;  2R7F A;  3U2R A;  4X0G A;  4AIJ A;  4A0Z A;  2FRH A;  4L9V A;  1BI0 A;  5GTI C;  2MGQ A;  1SMT A;  4H4K C;  4WF2 A;  4Y17 A;  4KIB A;  4KT6 A;  2QKL B;  1S7O A;  2V9P A;  5BNG A;  5IOY A;  5IYB J;  5HOD A;  2EPF A;  3GFM A;  4RA2 A;  3CO6 C;  2XPV A;  1RKT A;  4RGX A;  3WTU C;  3E6B A;  3S3O A;  1V4R A;  4M9S A;  3DBH B;  1PP7 U;  2LKS A;  2DMN A;  2EZK A;  4JP0 A;  2K9M A;  3BZK A;  2R7X A;  3RI4 A;  4A93 J;  1IN6 A;  3F6V A;  3M7G A;  2H94 A;  2IA2 A;  1R7J A;  2X0L A;  1TZL A;  5ILU A;  1D0X A;  4IOC F;  4BE2 A;  2ZXH A;  3V4G A;  2GZW A;  1ERD A;  2IBD A;  2E19 A;  2QGU A;  5DCM A;  5ICC A;  2R7V A;  4BXF A;  5L3E A;  2ZME B;  2Y31 A;  1RC9 A;  5LD2 C;  4KDP A;  3DPT A;  5KVR A;  1Z3Y A;  2R7D A;  2IGM A;  2H8R A;  3K0L A;  3H3V K;  1H0M A;  3VSL A;  1XTA A;  1TLH B;  5FB2 A;  1SEU A;  3CUO A;  2A07 F;  4B47 A;  3JSO A;  4KMF A;  3LNQ A;  4XN3 A;  3LQR A;  2H6B A;  4UNO A;  1BIB A;  5EJC A;  3DTI A;  2J5O A;  3I53 A;  2IS2 A;  1PUF B;  5FD6 A;  5E17 F;  2CW0 F;  2DOF A;  2MH2 A;  4E7S A;  5JVG F;  4O6J A;  3L9F A;  2P4W A;  3DPU A;  1HXD A;  5J1U A;  3OYK A;  1F36 A;  2IXS A;  1S6L A;  3HHH A;  3BG5 A;  1EH6 A;  4HV6 A;  4XK4 A;  5L3D A;  3ZMU A;  5IT3 A;  1JTX A;  4LLN A;  5D4S A;  1MSE C;  2KFD A;  3HUG A;  3VOE A;  4I01 A;  1LE8 B;  4G12 A;  4LLG F;  4HF0 A;  2DK5 A;  2EIJ H;  1TC3 C;  4LG3 A;  5HOO A;  1P9Q C;  3PQJ A;  3UKG A;  2B63 J;  4XKC A;  1LFP A;  2E7W A;  2STT A;  1BJZ A;  2PMU A;  1VQ4 I;  5FO5 A;  3KZI C;  3H3U A;  3EUH C;  4FE4 A;  2DBB A;  2H27 A;  3MKY B;  1NG7 A;  2R4G A;  3QYB A;  4II3 A;  2FNP A;  3U21 A;  1TP4 A;  3GTK J;  4UV9 A;  1JXS A;  1JI8 A;  3D1N I;  4IZZ A;  1IN8 A;  3GFI A;  1G3Y A;  1IXS B;  4JYK A;  5J1Y A;  1P4A A;  4UV8 A;  2ICW G;  3HSF A;  1E2X A;  2HXO A;  3HOU J;  2UZK A;  2LVS A;  1J75 A;  1JGG A;  5J4V A;  1KU9 A;  2GXA A;  4H0E A;  5C44 J;  4IOA F;  4BHP A;  2AQE A;  4OIN F;  5ILV A;  3EUA A;  1QZY A;  2PLY A;  1J9I A;  1IV6 A;  4ENK A;  3OS1 A;  2P5V A;  3G73 A;  2VE8 A;  4RGU A;  2HOT A;  3PJR A;  3RQ4 A;  2DYR H;  5GAG J;  3LFU A;  4F3Q A;  2XSD C;  2WB1 A;  3EET A;  3W6J B;  2M8G X;  4XRS A;  3HEF A;  3S3N A;  2LRD A;  3CDL A;  1XD7 A;  1LVK A;  3CJN A;  4IRI A;  3ML6 A;  4EGZ A;  4ZYD A;  3H35 A;  3H9J A;  1O3Q A;  5HDG A;  3BJA A;  3NWT A;  3REO A;  2AQF A;  1RNL A;  2ME0 A;  4EM2 A;  4BE0 A;  1MMG A;  1Z3X A;  4KJZ A;  3W2V A;  1AU7 A;  3F9K A;  2A5W A;  1HSJ A;  3K2Z A;  3ZQG A;  2ZME A;  4MFD A;  5BPI A;  4EJO A;  1MW7 A;  4M6V A;  2WBM A;  2KDO A;  5B1B H;  3JAM Z;  3P9I A;  4LGW A;  1QQI A;  1W5C C;  4ESF A;  1ZN2 A;  2WWY A;  3K1N A;  2OQR A;  4P5O A;  3F22 A;  4GDF A;  2ZNY A;  2XB0 X;  3J81 Z;  1WCM J;  2VN2 A;  2NVQ J;  3EDP A;  5D5U B;  2OF7 A;  4A0X A;  1E17 A;  1ETO A;  3A1Y A;  1BI2 A;  1LJ9 A;  1I1G A;  5DD4 A;  2E5Z A;  3RPU A;  3OYI A;  1PUF A;  2E1O A;  4AYB N;  4BAC A;  4HDU A;  4J01 A;  1GDT A;  4NHJ A;  3W6V A;  2LLK A;  1U8R A;  2QSF X;  3KYD B;  2ZXW H;  4B3X A;  2QQB A;  3HL2 A;  4EQQ A;  5HDN A;  1LE8 A;  3MZH A;  2L5Q A;  1RUN A;  4FCY A;  1UCR A;  4BAY A;  3LSH A;  2VKD A;  1D0Z A;  1FP2 A;  4BXX J;  4U88 A;  4IRH A;  4I0A A;  2ZSI B;  4XSZ F;  5BS6 A;  1QVU A;  4AYB A;  1JE8 A;  3I55 I;  3J7A O;  4GCV A;  1RRJ A;  1D8K A;  2FX0 A;  5LRR A;  3K4K A;  2HNH A;  5DYM A;  4MTD A;  4XLH A;  3TO9 A;  1ZG5 A;  1YS6 A;  5HDK A;  3CES A;  3FXM A;  4C3I J;  3W3C A;  1E3H A;  4KIS A;  2DFE A;  2DMT A;  4ZDP A;  1FIP A;  1JJ6 C;  1ZH5 A;  1YS7 A;  2FQ4 A;  3T0Y A;  2Y48 A;  4Q5S F;  4S04 A;  2VBY A;  1VQ7 I;  1T08 B;  4RBO A;  1YJW I;  3CJQ B;  1NK2 P;  2Z3Y A;  1PYV A;  1JKR C;  5GAD J;  1V5E A;  2GIV A;  2XDV A;  2HYJ A;  2W1O A;  5HS7 A;  1O3S A;  2XRN A;  4GFB A;  1Y8R B;  2OA4 A;  2ZBK A;  1AWC A;  2CQQ A;  2QLZ A;  3FX3 A;  2V26 A;  1A31 A;  4I7H A;  3KP2 A;  2GA1 A;  2Y0M A;  1YTY A;  4EEF G;  2RDP A;  4HQM A;  5E3N A;  3C3W A;  2DFI A;  4M6Y A;  4M3B A;  1T0F A;  4P9U A;  1DGR M;  2W84 A;  4O5V A;  4HLY A;  2LG4 A;  3H9Q A;  5IY5 H;  3R61 A;  4XQF A;  2XAH A;  4NC7 A;  4NDL A;  1ZTR A;  4ZTJ A;  3BQZ A;  1XCV A;  2MC3 A;  1IRZ A;  1YQA A;  5KK1 A;  4AM3 A;  1SVL A;  1Z9C A;  4KN7 X;  4IVN A;  3AL0 C;  5CVI A;  4UUS B;  3A03 A;  4J00 A;  4RDU A;  4CYD A;  3RYR A;  3QRF F;  3GTO J;  1UG2 A;  1UJ8 A;  3OYH A;  3HSR A;  2RRE A;  4A3G J;  2Q0O A;  2L9R A;  2VBZ A;  3ABU A;  5ILS A;  3TDU C;  2ZKZ A;  4MLO A;  3KP3 A;  1Z6T A;  2WAQ N;  4N4O B;  3CF5 F;  4M74 A;  4F52 A;  3FM3 A;  3R0J A;  4G7O F;  1BR2 A;  1LNW A;  2Z5U A;  4P1W A;  3W6K B;  4E70 A;  4GO1 A;  2HZD A;  2RNG A;  1LQ1 A;  4OAY A;  3V7C A;  4GYI A;  5C4J J;  2WAQ A;  3JW4 A;  5K5R A;  3RYP A;  3F8F A;  2ISY A;  3CCQ I;  1S72 I;  5K1Y A;  1XGO A;  1MMA A;  2F4I A;  3WU0 A;  1ZRE A;  1QZZ A;  3M3Y J;  3PFY A;  2VB6 A;  2VIX A;  3HTS B;  1BC7 C;  2QVO A;  5CQE A;  3F72 A;  3S32 A;  3UR3 C;  5EEA A;  4Y52 J;  2ZFU A;  3CJR B;  1S8N A;  3T1B A;  1QVT A;  1U0J A;  3P9C A;  2ESN A;  3ZMZ A;  5KAI C;  1SFX A;  2L9N A;  4LMY A;  2JA6 J;  1NHA A;  3BJO A;  1FYL A;  4HOB A;  5AON A;  3PSI A;  4RAY A;  3S2D J;  2VXZ A;  1T95 A;  5ED4 A;  3GX4 X;  2QSH X;  3CME I;  4O3M A;  3A02 A;  3CDI A;  1OCO H;  4M73 A;  5DV5 A;  4A6E A;  1QBJ A;  2K3F A;  3JAM K;  3QOP A;  4P9F A;  4XOP A;  3IL2 A;  2K4B A;  2LOO A;  1JHH A;  1TW3 A;  2ZXI A;  2BXY A;  2X51 A;  4DIQ A;  3IKV A;  3BQY A;  1A6I A;  3J81 K;  3WGG A;  4RS8 A;  3HXL A;  1SD5 A;  1WHU A;  3DP7 A;  5GP9 A;  4I6Z A;  5CJ9 A;  2XKP A;  1BI1 A;  2UXX A;  2L7Z A;  4BYY A;  4QWQ A;  1I6H J;  1ETK A;  3LMM A;  5HNH A;  3KIO A;  4PK4 A;  1LDD A;  4PUS A;  4XN0 A;  3U9G A;  1ZG3 A;  5ERI A;  3HOZ J;  4FTH A;  3QPL A;  1JT6 A;  1B72 B;  2O8K A;  1TNS A;  4BQN A;  4DBQ A;  4E7J A;  1YIJ I;  3BLY A;  2DA6 A;  2DQR A;  2LH9 A;  1OMI A;  4A3D J;  3CC7 I;  2E7X A;  1W7P D;  1TTY A;  4KYW A;  2EK5 A;  3E6M A;  2ELK A;  3I58 A;  1R58 A;  2EFO A;  2F5D A;  2LY9 A;  1X4O A;  4UUS A;  2BVM A;  1R9T J;  4XMY A;  1OIS A;  1XMK A;  1VQN I;  2EFP A;  3KEY A;  1DPR A;  2ETH A;  4L5I A;  4BGD A;  2IVM A;  4AUX A;  3GYH X;  4XOR A;  3SEZ A;  1TWH J;  2DK8 A;  2BZT A;  3R4K A;  2V4J C;  3DBR B;  4V2F A;  2XAF A;  3TDZ C;  4I98 B;  3CCM I;  3BP8 A;  3M8F A;  1HA8 A;  2RGV A;  2BY0 A;  2W24 A;  4XBF A;  4D9J A;  4KIC A;  1RR7 A;  4B44 A;  1K78 B;  3OOU A;  1GUU A;  2O6G E;  2ME6 A;  3ULQ B;  2OTJ I;  1TQP A;  5FKL A;  5K5O A;  3ABT A;  3ZPL A;  2F5E A;  4KFC A;  4IF4 A;  5EGO B;  2FU4 A;  1TL8 A;  1TNT A;  3H0G J;  3OWT A;  4JOM A;  3OR2 C;  1A04 A;  3ONQ A;  3TW6 A;  1YHQ I;  1YI2 I;  3BY6 A;  1FBS A;  1ORK A;  2ECC A;  2A05 A;  5JLW A;  1MDM B;  2IS1 A;  2EZH A;  2P81 A;  3SHF A;  4IKF A;  4LK1 F;  1UZC A;  2KDZ A;  2V1X A;  3LAP A;  1MMD A;  1XMA A;  4X1E A;  3K1M A;  4EM1 A;  1Y6I A;  2GBY A;  2PN6 A;  4OMY A;  2DJN A;  1B59 A;  1R22 A;  2M0M A;  3JRG A;  1YW9 A;  2GWR A;  2HVQ A;  4EJT A;  3D0S A;  1I1S A;  4C30 A;  1KYW A;  3G3Z A;  3GFJ A;  5L3G A;  5IT9 Z;  5JR3 A;  2K5C A;  1Y1W J;  1APL C;  1UG0 A;  3B02 A;  1J59 A;  5DS9 A;  1BOA A;  4D0P A;  3PFI A;  3S1R J;  3HC7 A;  5K7H A;  2OTL I;  1I27 A;  2EZI A;  3TKY A;  5LBQ A;  1YX5 A;  3F6O A;  2HDC A;  5DTD A;  2VJ5 A;  2XGD A;  1FT9 A;  4LIV A;  4AID A;  4HAM A;  1IUY A;  4OIR F;  1HC8 A;  1U5T B;  2D1V A;  4CH7 A;  2VUM J;  1Z1D A;  4QTR A;  5FJ8 J;  3OYG A;  3C2G A;  3GVA A;  2VOD A;  3CUQ A;  2QEN A;  2QWW A;  1JUS A;  2DAO A;  1K6O A;  3KCC A;  1I3Q J;  1HF0 A;  5D5W B;  2H8W A;  2CO5 A;  1R4N B;  2IJL A;  3H1C A;  3DLL F;  4ESB A;  3QU3 A;  2E1C A;  3LSG A;  4HNV A;  3R60 A;  1YIT I;  3KET A;  3OOP A;  3A2K A;  1YFH A;  1KZH A;  4HX8 A;  1SC7 A;  5DUI A;  2NOJ B;  4AIH A;  2WC2 A;  4C3H J;  4HF1 A;  1WJ5 A;  2CFX A;  2RN7 A;  4NNJ A;  1FZP B;  2L3D A;  2IP2 A;  3K4N A;  1SMY F;  1TBX A;  3ZQH A;  1VQ6 I;  3BG3 A;  3ZQC A;  1BI3 A;  1FYM A;  3FM5 A;  1Y56 A;  2EFW A;  1K78 A;  2I8D A;  2KZV A;  4PFO A;  4ZYG A;  5J1R A;  3H92 A;  1BM9 A;  1FJL A;  1ZLK A;  3EYY A;  3K4B A;  2G9W A;  4X6A J;  2V1N A;  1S9H A;  5DEQ A;  5EGO A;  4IX7 A;  3OIP A;  3BZ6 A;  3TBI A;  1FBQ A;  2GOX B;  2LK2 A;  5D5X B;  2MAB A;  4CYC B;  3BCA A;  4WXD A;  5HLH A;  1OR7 A;  5CPR B;  1ZLJ A;  3HPH A;  1LUJ B;  1OCP A;  4EVI A;  2PQ8 A;  2DMP A;  2YU3 A;  2K40 A;  1Z6R A;  2X9D A;  3ASO H;  3MEX A;  4LIT A;  3BRO A;  5CVR A;  4EAT A;  1ZAO A;  1S7A A;  1DU6 A;  2MG4 A;  1JKP C;  4UVB A;  2KIF A;  1ZHF A;  3B6A A;  4ON0 A;  3CP2 A;  2W00 A;  3OIO A;  1XGS A;  5F08 A;  1FOX A;  3F0C A;  2K27 A;  2CW8 A;  3HZJ A;  4WX9 A;  1X58 A;  1P2F A;  1Y39 A;  5D6F A;  3T8T A;  2UWM A;  1U78 A;  2M4G A;  2V9K A;  3M07 A;  3WTX C;  2NVU B;  5FRO A;  2VPR A;  3SJM A;  3I4M J;  3E3V A;  1E3P A;  3HPG A;  2Z2S B;  1QRY A;  2CWE A;  3CMA I;  4TV7 A;  2DXI A;  2AXT C;  1HKQ A;  1J7K A;  3CQZ J;  2VI6 A;  1D8J A;  4XKV A;  3IC7 A;  2HYF A;  3BC8 A;  1Z0X A;  1U5T A;  5E20 A;  1KYZ A;  4EM0 B;  2DI3 A;  1YJ9 I;  3FZV A;  4CZZ A;  3IRQ A;  1KQ8 A;  3LSR A;  2ZME C;  3E5U A;  1FWZ A;  3MVP A;  2MSY A;  3GLX A;  3RTR A;  1FOK A;  1VQO I;  3UNG C;  1BC8 C;  3ERE D;  3G71 I;  3OSG A;  2HQR A;  2PEX A;  3VFZ A;  3IHU A;  1KGS A;  3DU6 A;  3JRC A;  4AC0 A;  1MIJ A;  3JRH A;  1OYW A;  3KP5 A;  1DU0 A;  4XIC A;  1REP C;  2HYG D;  2MYS A;  2OZU A;  3FK7 A;  2HQN A;  1T8I A;  2JUC A;  3GTG J;  2O3F A;  3G6E I;  3HM5 A;  4Y3O A;  4HF2 A;  2M30 A;  3GME A;  1ZQ3 P;  3C2H A;  1MZB A;  5M5W J;  1WJF A;  3S1M J;  4A3L J;  3ZMS A;  1R36 A;  1RI7 A;  5IT9 K;  5FGM A;  4EJU A;  2M2E A;  2BHZ A;  1V3F A;  2RQQ A;  3IH2 A;  3T5X A;  2VOO A;  2MH9 A;  2VT3 A;  2XAS A;  3JSP A;  3FHZ A;  5BPD A;  1YG2 A;  2A5Y B;  5EEH A;  5LGT A;  5E3O A;  1W36 D;  3K7A J;  2LDU A;  2D1H A;  3N4M A;  3LST A;  1MJB A;  2EWN A;  1S7E A;  2K4J A;  4UB6 C;  3SZT A;  1T38 A;  3OL3 A;  2CQ7 A;  3S15 J;  4G8X A;  2W48 A;  4P96 A;  4G94 A;  4MFE A;  5CQG A;  1O7F A;  4UXN A;  1BR1 A;  3DEU A;  3K4C A;  3OIQ A;  4L5E A;  4A5N A;  1PJR A;  2L2O A;  4MQV A;  3R0A A;  1SAN A;  2ZNZ A;  3SFI A;  3FXJ A;  2R7U A;  2CMP A;  4B09 A;  2BVL A;  1W5S A;  3CDH A;  3K2A A;  2HPM A;  1WRJ A;  2R3S A;  4CYC A;  2JMW A;  3HRS A;  1SAU A;  3O8H A;  5D4R A;  2UUZ A;  1WH5 A;  2F2E A;  2NVX J;  2ZJR F;  1X3Z B;  5M3M J;  2L01 A;  3J80 K;  2JSC A;  2HOE A;  1ENH A;  2L9V A;  5C4X J;  4XLC A;  2A3S A;  4DZP A;  4B43 A;  5LFA A;  5LHH A;  3LSM A;  3I59 B;  1BW6 A;  2NAZ A;  1X1D A;  2MD5 A;  2M9H A;  4LD5 A;  5TGT A;  1JTY A;  2M1B A;  4WCG A;  3CCU I;  3S2H J;  3FF5 A;  4MIM A;  4CUG A;  1T0F C;  3HOV J;  5D6E A;  2GLO A;  4IHY A;  2NVT J;  1KQ0 A;  4IO9 F;  3HGY A;  4HX7 A;  3SDB A;  3OYA A;  2QZ8 A;  3FIW A;  1LPQ A;  4ZC3 A;  2EIM H;  4KIT B;  4M3F A;  3FXU A;  2F4O B;  1P6R A;  2VJI A;  2OV7 A;  5TRD A;  3WOD F;  2EA4 A;  1FPQ A;  2WV0 A;  2ELJ A;  4RLQ A;  3VYS B;  3WU1 B;  2KPM A;  3IRR A;  2VOP A;  2A6E F;  2KLO A;  1VQ5 I;  1FC3 A;  3IH4 A;  3E5Q A;  1EJ9 A;  1JUP A;  3G2B A;  2A68 F;  1BR4 A;  4QPO A;  2ZB9 A;  3DKY A;  2RAE A;  4L0Z B;  2FOK A;  3ECO A;  4XLE A;  3LSJ A;  1UHW A;  5J8F A;  2WB1 N;  3PNY A;  1UMQ A;  5FFX A;  2E2I J;  1KU7 A;  2R7O A;  2Z9O A;  2O7O A;  1USS A;  3OS0 A;  3H5R A;  2PX9 A;  4XRF A;  1SVO A;  2DN0 A;  1YO5 C;  1FTT A;  4OAZ A;  2YR2 A;  1Z67 A;  1K61 A;  2A6H F;  1B8I B;  1OJL A;  2DCE A;  1IN5 A;  2XGE A;  3N97 A;  4ZTF A;  1BJA A;  5EEG A;  3H0D A;  3NQO A;  5B66 C;  3DQV C;  3PIO F;  4PCQ A;  2K9N A;  4BDY A;  3GBG A;  2G7U A;  1OKR A;  5J6X A;  2XVC A;  3GTL J;  3I4P A;  3VDX A;  1DP3 A;  1U6G A;  1N75 A;  5TJJ A;  1R6R A;  3FMR A;  4BL0 B;  2VC1 A;  5LGU A;  3ISP A;  2J5P A;  4U7B A;  3M8J A;  3R6S A;  4BKX A;  1BIA A;  2O0Y A;  1MGT A;  3FDY A;  2CQN A;  1K4S A;  3MQ0 A;  2B0L A;  1R1V A;  2AS5 F;  1W5T A;  3GTP J;  4RLF A;  2KJB A;  3KEO A;  3CCE I;  2RC4 A;  3ZN0 A;  1NK3 P;  1QNT A;  5AIP A;  2G7H A;  2DA5 A;  1NTC A;  2XKO A;  1I6X A;  1WGX A;  1GVD A;  3PSF A;  2IA1 A;  2HQ5 A;  2HDW A;  3IH3 A;  1WFX A;  4XKB A;  4YEJ A;  1S5L C;  4L5J A;  3I3L A;  4XM3 A;  2X85 A;  5LEK A;  1GVJ A;  2M5W A;  4CDG A;  4HZF A;  1W36 C;  1R5I D;  1GT0 C;  3HB9 A;  3MKZ A;  1IV8 A;  1OYI A;  1RZ4 A;  2JK3 A;  2M7B A;  1XCB A;  2ADU A;  2F48 A;  3F3X A;  4BUP A;  3L2U A;  3FK6 A;  4GRI A;  3I59 A;  3KYC B;  3DF8 A;  2Q2E B;  1D1B A;  1K6Y A;  1XDS A;  4A3J J;  3TO6 A;  4RM2 A;  2DT7 B;  1JGS A;  1G3T A;  3BDD A;  4Y7N J;  3CCV I;  3BR3 A;  3EYI A;  3E6D A;  5F04 A;  3S2W A;  1R1U A;  3KE2 A;  2JTV A;  1GXQ A;  2WAE A;  1FBU A;  3W2A A;  4V2G A;  3HTU A;  4QPQ A;  1G3W A;  3AFH A;  2HFH A;  2D45 A;  4EGY A;  3PO3 J;  1B4A A;  1T33 A;  2COM A;  2XF6 A;  4E7L A;  5FLX Z;  3SXY A;  4CHU A;  1X2N A;  2DDB A;  2AXL A;  3GFL A;  1TW2 A;  3FKJ A;  4UVC A;  1ZGJ A;  1OCR H;  2MLG A;  3FHN A;  4ASN A;  1I50 J;  1QHG A;  3WHB A;  1GXP A;  4ANJ A;  2W82 A;  3E1S A;  1D5V A;  1A36 A;  3KEQ A;  3GLL A;  2HVR A;  1LKX A;  3M4O J;  3FBN B;  4ENJ A;  1K83 J;  1VND A;  4IHV A;  3HRM A;  4A3M J;  5H20 A;  3HDD A;  3LSP A;  5M3F J;  1B8I A;  2EFQ A;  4L0Y B;  2KHM A;  1JT0 A;  2MD0 A;  4LFU A;  5CLS A;  3BOQ A;  3BG7 A;  4JX5 A;  1A35 A;  4HST A;  1WSU A;  1L0O C;  4FQG A;  5E1X A;  3JRE A;  4KNY A;  2IT0 A;  2L7F P;  5IP6 A;  3G1M A;  1UFM A;  4A0Y A;  3Q0W A;  1KQ9 A;  1JHF A;  2BOL A;  2BXZ A;  4PDK A;  2HKX A;  2QQA A;  3IV5 A;  4Q47 A;  1G3S A;  2NYX A;  1KA8 A;  2XRL A;  4CZC A;  1NG6 A;  5IYD J;  3RZO J;  2M3A A;  4LG0 B;  5CVV A;  2MBF A;  5HS9 A;  1TWA J;  1R49 A;  3F8M A;  3X2Q H;  3OYB A;  3EUH A;  5B3S H;  4HW0 A;  1XSV A;  2Y9Z A;  2QM3 A;  3ZQ7 A;  4UHT A;  4WWC A;  3CC4 I;  1R71 A;  1H9G A;  2V1D A;  1LEB A;  1XPX A;  3CF2 A;  5ICG A;  3JTH A;  2PG4 A;  2E36 A;  2YSR A;  4NUB A;  3NAU A;  2F6C A;  4XLF A;  3O3K A;  5DCF A;  2JQ7 A;  1RKW A;  2Q8K A;  4BU2 A;  1QO0 D;  2R5Y B;  4XID A;  2R7Q A;  1B6A A;  3VOD A;  2CS3 A;  3OY9 A;  2QQ8 A;  1BOB A;  4HA8 A;  4CIC A;  2FUG 2;  5E1Z B;  3O6B B;  3TQN A;  2P7C B;  1V55 H;  3K4M A;  2F5C A;  1ZYR F;  3OR1 C;  1FP1 D;  4Q4Z F;  1PP8 F;  2PJR B;  3CD6 I;  2ZCW A;  5HLI A;  4AIK A;  4BS9 A;  1A5J A;  4BJ5 C;  2YU9 J;  3PUB A;  3B6C A;  2Q2E A;  2RQP A;  2E5N A;  3OYN A;  4FHT A;  2KMU A;  1G6N A;  4BQO A;  2LD5 A;  2NNY A;  4E7I A;  1MSF C;  4BJT A;  3CUQ C;  2VQL A;  1EH7 A;  1ULY A;  1IRX A;  4OWR B;  2M8E A;  2EJR A;  2QA4 I;  1X4P A;  2NS8 A;  2R7R A;  3AG3 H;  2K9S A;  2HXI A;  4HNT A;  2W57 A;  1IF1 A;  4C2M J;  2V6E A;  2JVH A;  3AL0 B;  2YUS A;  2NXN B;  2K3P A;  4UVA A;  2DMQ A;  1R00 A;  4E6K G;  1DUX C;  1ZRD A;  3BPV A;  3KLN A;  3WHC A;  2G0E A;  4P55 A;  5F64 A;  4I0B A;  3C18 A;  3WE2 A;  2Y75 A;  1MBH A;  4PJ0 C;  2K9L A;  4QIW N;  5DM6 F;  3HRT A;  2CUE A;  2BY2 A;  1F1Z A;  2YX4 A;  1HW1 A;  3TOB A;  2JRT A;  3K69 A;  1ACI A;  2EFN A;  4Y33 A;  2OBP A;  1RUO A;  3K70 C;  3JCU C;  3JRB A;  1GLN A;  2DA1 A;  4U7D A;  2BW3 B;  1D1A A;  4N9H A;  2LRE A;  4FIS A;  4M71 A;  1X3U A;  2K86 A;  1MNM C;  2Y0S N;  3QYF A;  4E7H A;  2XAJ A;  4XKW A;  3I0T A;  1D3Y A;  4IL6 C;  1WJA A;  5JVT A;  1OR7 C;  2L4M A;  4EJW A;  2EZL A;  3DFG A;  4DBR A;  2CFO A;  2DA3 A;  2OCC H;  2NS7 A;  2Y9Y A;  4GGG A;  1B9M A;  2Y0S A;  3NRV A;  3SYT A;  4RGS A;  3RDI A;  3TW7 A;  4I02 A;  4LG0 A;  2E1M C;  1IRG A;  5FLX K;  3TP3 A;  5F0F A;  2UV1 A;  3J7A Y;  3P5J A;  4ZDL A;  3P9K A;  1IC8 A;  4HV5 A;  5JLX A;  1LFU P;  1SVM A;  4HEA 2;  2K7L A;  3MWM A;  4ENN A;  5A2Q Z;  2IW5 A;  4U87 A;  4I09 A;  3CP8 A;  2XAQ A;  1WI3 A;  4WXH A;  4XSX F;  5F27 A;  3U1D A;  5FRN A;  5GPC A;  2VXD A;  3LWF A;  5EYR A;  1YRN B;  1STZ A;  4F55 A;  2R5Y A;  2CUJ A;  3SFZ A;  1S29 A;  2VQC A;  4MQ9 F;  4A69 C;  1K79 A;  5KNL A;  1ZG1 A;  2DOE A;  2A69 F;  3CMM A;  3G1O A;  2CU7 A;  3HG9 A;  1M1E B;  3ZP5 A;  4II2 A;  3WG7 H;  1U5T C;  4CCO A;  1R5H A;  4BDZ A;  3IAM 2;  3MKW B;  2L4A A;  4OMZ A;  3FMQ A;  2ZC2 A;  1YJN I;  4HG2 A;  2GXG A;  2C6Y A;  4BY1 J;  3GZN B;  3NAR A;  3GCM A;  4S0H B;  2QF7 A;  3PNV A;  4A3K J;  2XHK A;  3BG6 A;  3E5X A;  4RAZ A;  1L3L A;  3OYF A;  4ZZL A;  1YW7 A;  1U8B A;  4G7H F;  5J8C A;  3ESW B;  1Z05 A;  1FIA A;  3K1P A;  3AG4 H;  3L00 A;  3L2R A;  4BBS J;  2P5K A;  4IHW A;  2LKX A;  2Z1D A;  3O2P E;  2N8G A;  2FEZ A;  2FBH A;  2R5Z B;  2WAF A;  2AO9 A;  2X1E A;  1T39 A;  1QZE A;  1Z77 A;  4KIG A;  3NWS A;  2OC6 A;  2PMZ N;  2LYC A;  3RPU D;  3L2C A;  1PUE E;  3DU5 A;  1QU3 A;  1LVA A;  3D5L A;  2HOS A;  3Q9S A;  3E6C C;  5FRM A;  2M7A A;  4RB2 C;  2HZT A;  1IXR C;  4BNC A;  1BL0 A;  4ESJ A;  1Q1H A;  3TOA A;  5K7Z A;  3ZGK A;  5H6Q A;  4RB3 C;  2PMZ A;  1JJ8 C;  1HOM A;  4YRV A;  2M45 A;  4R8H A;  1MBF A;  2JT1 A;  4FET A;  2BW3 A;  3I54 A;  1SAX A;  1JUM A;  2NVY J;  1ZR4 A;  4R79 A;  5FLV A;  1XG1 A;  2UXN A;  1B72 A;  3GTM J;  2JWT A;  3A4C A;  5F6F A;  3CZ6 A;  3RKX A;  4A6D A;  1XS9 A;  3BR6 A;  2JVG A;  3HOY J;  4BY7 J;  3F23 A;  3J80 Z;  1FX7 A;  4XLA A;  1ETW A;  3JRA A;  2GQQ A;  4U0Y A;  3OSF A;  4DJA A;  2GM4 A;  1SFE A;  3BZC A;  2TRT A;  5BMZ A;  1U3E M;  3QAH A;  2XGC A;  3HIF A;  1AHD P;  3BJ6 A;  4CXF A;  1VQK I;  1WI9 A;  2L7K A;  2IEK A;  4HSR A;  2P8T A;  1OCT C;  2VJJ A;  4FX4 A;  3L2Q A;  4LB5 A;  4FX0 A;  5JHF A;  4YFN F;  1O3R A;  4HDV A;  1RR8 C;  2CG4 A;  1OQY A;  2Z33 A;  2PFB A;  3VWB A;  2RKH A;  3L09 A;  2EQR A;  3SEQ A;  2X6X A;  1O4X A;  1P4X A;  4BBR J;  2AHQ A;  3I4N J;  1G8X A;  2ESH A;  2F5V A;  3ERM A;  3F8C A;  1YYV A;  2V9V A;  1IXC A;  1YRN A;  1EF4 A;  2VAS A;  3WG9 A;  3ZMV A;  2DT6 A;  2P6T A;  1QHH D;  2BV6 A;  2I5U A;  3ZXS A;  4AD9 A;  4DZJ A;  1IDY A;  3A01 B;  4OIQ F;  2P7V B;  3S3M A;  1IW7 F;  4DYR A;  3ZMD A;  5HLG A;  1MDM A;  3Q0V A;  2IRF G;  2ZO4 A;  1TWC J;  4E4H A;  2FOW A;  4XR6 A;  3GO5 A;  3H5A A;  2QBY B;  1MBK A;  4ITV A;  3GZ6 A;  1AOY A;  2XIG A;  4MO7 A;  1RIO H;  1FY7 A;  4HRI A;  3Q0U A;  1BA5 A;  4XLN F;  3HSE A;  2DLL A;  3HOX J;  5H2F C;  2PJP A;  1Y0U A;  1TQI A;  1P7I A;  4EV0 A;  1FTZ A;  3A0H C;  2JA7 J;  1XC5 A;  1IO2 A;  3GEZ A;  2X4H A;  2Y2Z A;  2JRM A;  2FNA A;  2LNB A;  3HYI A;  2IPQ X;  3M1E A;  4CO8 A;  4YFX F;  1ZK8 A;  1LDK B;  3CCJ I;  3KPH A;  4PZJ A;  2MLK A;  4D7M A;  2HGC A;  3C1D A;  2KKO A;  3HUG B;  3JRD A;  2R5Z A;  5KHD A;  2MA3 A;  1H9T A;  4MEX F;  1ETQ A;  5DM7 F;  2JSP A;  5A2Q K;  2PMH A;  3QQA A;  1Y1V J;  3WGI A;  4BJ6 C;  3OYJ A;  3PNT A;  3WTT C;  2XV4 S;  1TT0 A;  4BE1 A;  3RKY A;  3TP0 A;  4BQQ A;  1WVR A;  3HOW J;  3FWE A;  4CCN A;  2FMY A;  3BCB A;  2VKV A;  4L9T A;  3GWZ A;  3ZN1 A;  3GUD A;  1PDN C;  1J0R A;  1MNE A;  2JN6 A;  2R7W A;  5CVU A;  4M3D A;  3V8L A;  2EIN H;  1ETV A;  2CQX A;  1W7P B;  3WTS C;  2KJC A;  4HPQ A;  4ZYE A;  1G2H A;  2PBI A;  2ZJP F;  5L3B A;  4PGG A;  1NH3 A;  2DOA A;  3VPR A;  3CLO A;  4MGR A;  2VT2 A;  2EH3 A;  4B8X A;  3BTJ A;  1S3J A;  1EA3 A;  3VYT B;  2E34 A;  4G6Q A;  2DOD A;  5IOZ A;  3CCL I;  5K7F A;  2ELH A;  3ZQI A;  1T6S A;  2DQL A;  5GTH C;  2XSJ C;  1X1P A;  2HEO A;  1FSH A;  3HKZ N;  5M5X J;  4Q48 A;  2DW4 A;  4DYQ A;  1Y8Q B;  1ZRF A;  4L9N A;  1P7J A;  1OYY A;  2I10 A;  3EQL F;  3IAS 2;  2QKM B;  4ABZ A;  3CO7 C;  1ZRC A;  5FKO A;  4HQE A;  1R23 A;  1V54 H;  5FD5 A;  3GTJ J;  3I5U A;  4KIF A;  5BOX A;  2X6O A;  4A3B J;  3F21 A;  3QWL A;  3WU2 C;  4J19 A;  3HKZ A;  1HW2 A;  3K4L A;  3PM1 A;  2LBF B;  3IWF A;  4NC8 A;  4CCM A;  4IJA A;  3ZCO A;  2DDA A;  3BG9 A;  3ECH A;  3GF2 A;  3RCO A;  2VC0 A;  4A2U A;  2WY7 Q;  3HOS A;  1BN5 A;  2CYY A;  1MD0 A;  3S17 J;  4KT5 C;  3WTV C;  3P7N A;  1V5F A;  3ABK H;  4QLC U;  1VZ0 A;  4XRM A;  4D1Q A;  1UST A;  2LP0 A;  3A01 A;  5IP9 J;  4YG2 F;  2O61 A;  2R93 J;  4UUV A;  2M4K A;  2X48 A;  4MHG A;  2H6C A;  3E0J B;  2HI3 A;  3MMY B;  4M3G A;  1EV7 A;  1ZGW A;  1HDP A;  4IHX A;  3S1N J;  2QBY A;  1IJW C;  5TIS C;  2QSG X;  1SD4 A;  5LRS A;  4FT8 A;  5B1A H;  4C2U A;  5F1J A;  3BR1 A;  3VYU B;  3V42 A;  1W0U A;  4F92 B;  5E3M A;  4I99 C;  4EMS A;  2ACJ A;  2STW A;  4I2O A;  3ABL H;  2LFB A;  2FBI A;  1VFC A;  3K4J A;  1W4M A;  2KIU A;  4W1U A;  3PUF A;  3BTI A;  3OYE A;  4FAS D;  1UEL B;  4YIR X;  1HDD C;  1YIO A;  2Y69 H;  2XF7 A;  4IXA A;  1O3T A;  4ZZD A;  2JPC A;  3BT9 A;  4CSW A;  3SDG A;  4M9Z A;  1VF9 A;  1WJB A;  1HQC A;  2W4S A;  1SFU A;  5FFZ A;  2BE5 F;  1WH7 A;  2KQR A;  5HLT A;  2W7N A;  2WV1 A;  4W97 A;  1HST A;  2E1N A;  2QEX I;  4A3F J;  2A6T A;  1XSD A;  2FD5 A;  1QPI A;  3M1C A;  3CC2 I;  4OIO F;  4A3E J;  1HBX G;  1B9N A;  5JI6 A;  4UY8 I;  4JBA A;  1XDU A;  1TT5 B;  4U0V A;  1F43 A;  4C3J J;  3TED A;  4AWX B;  4CCK A;  3EUK L;  4ZYH A;  1W7P A;  3BPX A;  1T2K A;  1Z7L A;  2P0W A;  4RB1 A;  4GYG A;  3LQQ A;  5KCM A;  4XL9 A;  4JX6 A;  4DOZ A;  1R4M B;  3KP6 A;  4EJV A;  5B5E C;  4ENM A;  1WPK A;  4BHC A;  4RGR A;  5CVJ A;  5GPA A;  2JZY A;  5E3L A;  1FOW A;  4GXO A;  4JQF A;  1CGP A;  2L7M P;  3KP7 A;  1EKE A;  3V8K A;  4I76 A;  2JA5 J;  4YIF A;  2ZJQ F;  3MKL A;  2WAD A;  1K7A A;  1LFB A;  2DMU A;  5LEJ A;  5JHU A;  1U2W A;  4Z6Y A;  1VTN C;  3CJT B;  1FMW A;  2EBI A;  2KZG A;  3O8G A;  2NNN A;  4FE7 A;  2Q1Z B;  5LGN A;  1XX5 A;  2CGP A;  3JRF A;  1ZGA A;  4N4N B;  4PJM A;  2D2W A;  3RJP A;  1YX3 A;  2M0C A;  5EZH A;  3V7S A;  4OIP F;  4YFK F;  5HS8 A;  3DLA A;  2VPL A;  2LBF A;  4G9Y A;  1XGN A;  3LA3 A;  1DQU A;  4N9I A;  1Q1V A;  3NEU A;  2DO7 A;  2FXA A;  4B4C A;  3IKT A;  2DA4 A;  2DPU A;  4HYE A;  3S16 J;  2MFZ A;  3CCS I;  2JA2 A;  3T8R A;  1X2M A;  1O7L A;  2CH0 A;  5IP7 J;  1DDN A;  3LFK A;  3OYM A;  2BY3 A;  3BWG A;  5DUK A;  4RAG A;  2WTE A;  1FMV A;  5FKN A;  3IP4 B;  1IZ1 A;  2XPW A;  3WTW C;  1N25 A;  3JTG A;  2R7S A;  2ZXJ A;  4PJL A;  5JFR A;  2FML A;  1WKM A;  2V7F A;  4OOI A;  3IWZ A;  1MND A;  5DD8 A;  2HS5 A;  2X1D A;  3DEW A;  3F8N A;  1IN7 A;  2CV1 A;  4DYC A;  4Y13 A;  2E2J J;  3KZY A;  2FQ3 A;  4NQW B;  3Q9V A;  1WJD A;  2HKO A;  1Y0N A;  3SZP A;  2PI0 A;  5LLQ A;  3QP6 A;  3I71 A;  4B48 A;  5E8G A;  4BEH B;  3TMO A;  3K70 D;  2M34 A;  3ZQQ A;  4PGH A;  1IGN A; 
#chains in the Genus database with same CATH homology
 2QCO A;  4QIW N;  2CUE A;  2Y31 A;  5FLM J;  1BW5 A;  3LSG A;  4HNV A;  3S1Q J;  2H8R A;  3H3V K;  3JRB A;  2DA1 A;  4A3I J;  3LNQ A;  4FIS A;  3BR2 A;  4C3H J;  2MW8 A;  1PUF B;  1MNM C;  2Y0S N;  2CJJ A;  5J1U A;  1F36 A;  4XK4 A;  3BG5 A;  3ZQH A;  3BG3 A;  3ZQC A;  1JTX A;  1MSE C;  1LE8 B;  2HDD A;  4G12 A;  2EZL A;  5J1R A;  1TC3 C;  1FJL A;  2DA3 A;  2NS7 A;  2Y9Y A;  4X6A J;  2XPU A;  2Y30 A;  3UKG A;  2B63 J;  5EGO A;  3TW7 A;  1BJZ A;  3TP3 A;  2LK2 A;  4CYC B;  5F0F A;  4XRS G;  1IC8 A;  5JLX A;  1LFU P;  1ZR2 A;  2XB5 A;  1OCP A;  4FE4 A;  2K9Q A;  1WI3 A;  2DMP A;  5F27 A;  2K40 A;  2X9D A;  2YS9 A;  5GPC A;  3GTK J;  1MH4 A;  5EYR A;  1DU6 A;  2MG4 A;  2LTP A;  1JKP C;  1YRN B;  3D1N I;  1IG7 A;  2R5Y A;  1VI0 A;  4DW6 A;  3B6A A;  1UHS A;  4A69 C;  3OIO A;  5F08 A;  3JRI A;  3F0C A;  4JYK A;  3G1O A;  5J1Y A;  2CU7 A;  1X58 A;  1U78 A;  2HXO A;  3HOU J;  2LVS A;  1JGG A;  2VPR A;  3QPS A;  1IDZ A;  5C44 J;  3SJM A;  3I4M J;  2CRG A;  4BY1 J;  3NAR A;  1IV6 A;  1QRY A;  4S0H B;  2QF7 A;  3CQZ J;  1FEX A;  2VI6 A;  4A3K J;  2HOT A;  1CQT A;  2O9L A;  3BTC A;  4B1R A;  2XSD C;  1Z0X A;  4XRS A;  2M8G X;  1U8B A;  3HEF A;  1FIA A;  3CDL A;  3LSR A;  4IHW A;  4BBS J;  2LKX A;  2N8G A;  3MVP A;  2MSY A;  3C2B A;  2JA8 J;  2R5Z B;  2AO9 A;  3OSG A;  5EDN A;  1Z77 A;  5EG0 B;  2ME0 A;  2PMZ N;  3JRC A;  3PO2 J;  4AC0 A;  1AKH A;  3JRH A;  2HOS A;  1AU7 A;  1DU0 A;  3ZQG A;  4XIC A;  4MFD A;  3RQI A;  3FK7 A;  4M6V A;  3GTG J;  3HM5 A;  1U9O A;  1BL0 A;  1ZQ3 P;  5M5W J;  2TCT A;  3S1M J;  5K7Z A;  4A3L J;  1JJ8 C;  1HOM A;  1E3O C;  5J3L A;  2LR8 A;  2M2E A;  2XB0 X;  1MBF A;  3IH2 A;  1WCM J;  2NVQ J;  1JUM A;  2NVY J;  1ZR4 A;  5FLV A;  1XG1 A;  2CUF A;  2OF7 A;  1B72 A;  3GTM J;  1ETO A;  2JWT A;  5E3O A;  3Q3S A;  1XS9 A;  3K7A J;  3BR6 A;  1PUF A;  1S7E A;  3HOY J;  2E1O A;  4BY7 J;  4AYB N;  1GDT A;  1ETW A;  3CCY A;  3JRA A;  3W6V A;  2LLK A;  3S15 J;  1MBG A;  2W48 A;  3OSF A;  2FJ1 A;  2GM4 A;  1LE8 A;  2TRT A;  4MFE A;  4FCY A;  2XGC A;  4L5E A;  1AHD P;  4BXX J;  2ID3 A;  1SAN A;  3SFI A;  1QVU A;  4LOC A;  2IEK A;  2OPT A;  3K2A A;  3MN2 A;  1OCT C;  4CYC A;  2JMW A;  2FX0 A;  3O8H A;  1WH5 A;  2NVX J;  4C3I J;  5M3M J;  2DMT A;  1FIP A;  1JJ6 C;  2EQR A;  1O4X A;  1ENH A;  5C4X J;  2FQ4 A;  4BBR J;  2AHQ A;  5C3E J;  3I4N J;  4DZP A;  5M5Y J;  1ETY A;  4RBO A;  3GTQ J;  1BW6 A;  1NK2 P;  1YRN A;  1EF4 A;  1JKR C;  2M9H A;  1JTY A;  3S2H J;  4MIM A;  2HYJ A;  3HOV J;  2GLO A;  4IHY A;  2NVT J;  4GFB A;  3HGY A;  4DZJ A;  1IDY A;  3A01 B;  4A3C J;  1H8A C;  1W0T A;  3FIW A;  5F0C A;  4DYR A;  2CQQ A;  2DTZ A;  1H88 C;  3Q0V A;  4M3F A;  1TWC J;  1OFC X;  4EEF G;  5E3N A;  3JR9 A;  1MBK A;  2DA7 A;  4M3B A;  1SFO J;  4MO7 A;  1BA5 A;  3Q0U A;  3IH4 A;  3L1P A;  3HOX J;  1JUP A;  1P7I A;  1FTZ A;  3FKI J;  2JA7 J;  1XC5 A;  2Y2Z A;  4NDL A;  1AKH B;  1JKO C;  2ZB9 A;  2RAE A;  1ZK8 A;  1ZTR A;  3LSJ A;  2WB1 N;  1UMQ A;  4D7M A;  2E2I J;  3BQZ A;  2O7O A;  1IRZ A;  2R5Z A;  3JRD A;  1H89 C;  1ETQ A;  5EG0 A;  4UUS B;  3A03 A;  3QQA A;  1Y1V J;  2DN0 A;  4RDU A;  1FTT A;  2IAI A;  3GTO J;  1UG2 A;  2R0Q C;  1K61 A;  4A3G J;  1B8I B;  2L9R A;  1OJL A;  2XGE A;  3TP0 A;  2JJ7 A;  1MH3 A;  3HOW J;  5F0H A;  4MLO A;  2WAQ N;  2VKV A;  4D5F A;  2K9N A;  2JN6 A;  3GBG A;  1MBE A;  4M3D A;  2E2H J;  3GTL J;  1ETV A;  2CQX A;  1G2H A;  5C4J J;  3VPR A;  2KT0 A;  2EH3 A;  3BTJ A;  4BKX A;  5IOZ A;  3M3Y J;  3HBL A;  5K7F A;  3ZQI A;  3GTP J;  3E7L A;  3HKZ N;  5M5X J;  3ZOB A;  1NK3 P;  4DYQ A;  5EEA A;  4Y52 J;  1P7J A;  2COB A;  2I10 A;  4ABZ A;  1GV5 A;  5FKO A;  3FIS A;  4QSH A;  2DA5 A;  1HCR A;  1JKQ C;  1NTC A;  1QVT A;  2HOA A;  3GTJ J;  5IYC J;  1WGX A;  1GVD A;  2HQ5 A;  3IH3 A;  2JA6 J;  2X6O A;  5EZG A;  4D7N A;  4A3B J;  3S2D J;  4J19 A;  2R7Z J;  3ZQF A;  1GT0 C;  3A02 A;  3HB9 A;  4B3A A;  3PM1 A;  1U9N A;  3BTL A;  2JK3 A;  5IPA A;  3FK6 A;  5FKM A;  3ZQL A;  3BG9 A;  2ECB A;  5FKK A;  4A3J J;  9ANT A;  1A6I A;  3BQY A;  3S17 J;  4Y7N J;  3BR3 A;  4I6Z A;  5F04 A;  5GP9 A;  4XRM A;  3A01 A;  2LP0 A;  5IP9 J;  2R93 J;  1RET A;  2X48 A;  2L7Z A;  2HI3 A;  4M3G A;  4V2G A;  1ZGW A;  3PO3 J;  1HDP A;  1I6H J;  1ETK A;  4IHX A;  1T33 A;  3S1N J;  4UUT A;  1IJW C;  1IUF A;  3G1L A;  3HOZ J;  1X2N A;  2NOG A;  4FTH A;  3QPL A;  1JT6 A;  1B72 B;  1T56 A;  2O8K A;  5F1J A;  2ID6 A;  3BR1 A;  1W0U A;  1I50 J;  5E3M A;  2DA6 A;  3WHB A;  4A3D J;  3HGG A;  2LFB A;  1ETX A;  1VFC A;  1ZKG A;  4W1U A;  3BTI A;  5EF6 A;  4M3E A;  2ELK A;  1HDD C;  3M4O J;  2LY9 A;  4D5C A;  3BT9 A;  4UUS A;  1R9T J;  3SDG A;  2DA2 A;  1K83 J;  4IEJ A;  1VND A;  4IHV A;  1VF9 A;  4A3M J;  1TWG J;  3HDD A;  3LSP A;  1WH7 A;  5M3F J;  1B8I A;  1RPW A;  2WV1 A;  1POG A;  4W97 A;  4A3F J;  1JT0 A;  4AUX A;  2FD5 A;  1QPI A;  1TWH J;  4JX5 A;  4V2F A;  2R92 J;  4A3E J;  2H1K A;  3BR5 A;  3JRE A;  1F43 A;  4C3J J;  2L7F P;  1TWF J;  1RR7 A;  5IP6 A;  3TED A;  1RES A;  3G1M A;  3OOU A;  1GUU A;  3Q0W A;  2ME6 A;  1ITY A;  5FKL A;  3IV5 A;  2VKE A;  2XRL A;  4JX6 A;  5EGO B;  5IYD J;  3RZO J;  3LOC A;  1WPK A;  1TWA J;  3H0G J;  5GPA A;  5E3L A;  1D5Y A;  2L0K A;  2Y9Z A;  2L7M P;  3RZD J;  3TW6 A;  3DCF A;  3S14 J;  3CMY A;  3RKQ A;  1ORK A;  2ECC A;  5JLW A;  4I76 A;  2JA5 J;  2EZH A;  2P81 A;  1GV2 A;  3BR0 A;  3MKL A;  2KDZ A;  1HLV A;  3NAU A;  4JX4 A;  4X1E A;  2GBY A;  1RKW A;  1LFB A;  2DMU A;  2DJN A;  2EBI A;  2R5Y B;  4XID A;  3O8G A;  3JRG A;  4FE7 A;  2D5V A;  3JRF A;  1APL C;  1Y1W J;  1MBJ A;  2M0C A;  5EZH A;  5DS9 A;  1Q1V A;  4B4C A;  2MGQ A;  3S1R J;  3S16 J;  1A5J A;  2DA4 A;  5K7H A;  2YU9 J;  5IOY A;  5BNG A;  5HOD A;  5IYB J;  3B6C A;  2EZI A;  1X2M A;  5IP7 J;  2LD5 A;  2XPV A;  1RKT A;  5DTD A;  1MSF C;  2XGD A;  5FKN A;  2XPW A;  2NS8 A;  2DMN A;  2EZK A;  4JP0 A;  2K9S A;  2HXI A;  4A93 J;  2VUM J;  4QTR A;  5FJ8 J;  4C2M J;  3DEW A;  2YUS A;  4DYC A;  2E2J J;  2DMQ A;  1JUS A;  1I3Q J;  3WHC A;  2IBD A;  2G0E A;  1HF0 A;  1MBH A;  2M34 A;  2E19 A;  1IGN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...