4C3JJ

Structure of 14-subunit rna polymerase i at 3.35 a resolution, crystal form c2-90
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
69
structure length
69
Chain Sequence
MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNPLEKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the 14-Subunit RNA Polymerase I
pubmed doi rcsb
molecule tags Transcription
molecule keywords DNA-DIRECTED RNA POLYMERASE I SUBUNIT RPA190
total genus 13
structure length 69
sequence length 69
ec nomenclature
pdb deposition date 2013-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF01194 RNA_pol_N RNA polymerases N / 8 kDa subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 4c3jJ00
2O9LA 2XGDA 1BW6A 3ZQFA 4A69C 2EZLA 2YUSA 4C3IJ 3S1MJ 1JKQC 1QPIA 3HM5A 3IV5A 5IYCJ 2GM4A 3Q0VA 1BJZA 5J1RA 1YRNB 2D5VA 1H8AC 3I4NJ 1T56A 1P7IA 3I4MJ 5IYDJ 1BA5A 1WH7A 2AHQA 2WV1A 2DA4A 2DMTA 5JLXA 3H0GJ 4FE4A 1MH3A 1MSEC 1OJLA 2XGCA 3BTIA 5C44J 5JLWA 2MW8A 1BL0A 5FKMA 2DMPA 2EZIA 3RKQA 2VUMJ 3RZOJ 4D7MA 1EF4A 1TWCJ 3S1RJ 1RESA 3K7AJ 3FK6A 2EH3A 2CUFA 3H3VK 3IH4A 3BTJA 1JUMA 4UUSA 3G1MA 4M3BA 2O8KA 2M0CA 4IHWA 5HODA 1ORKA 4Y52J 2HQ5A 4V2GA 1YRNA 5EZGA 1RKTA 1QVTA 1JTXA 5FLVA 3SDGA 5J1YA 1POGA 4S0HB 1MBEA 1XG1A 1AU7A 2CU7A 4QIWN 1MNMC 2E1OA 2CQQA 1IDYA 1HCRA 3NAUA 2K9NA 1K83J 2Y9YA 1B8IA 2NVYJ 1HDDC 5EZHA 4A3KJ 2LP0A 1RR7A 3TW6A 1BW5A 4C3JJ 4J19A 1GVDA 3MN2A 1MBKA 2CJJA 2ECCA 3MVPA 1GT0C 2DA7A 3F0CA 3CQZJ 1ETWA 2WAQN 3CCYA 5EYRA 4B1RA 1H89C 4NDLA 2ZB9A 2XGEA 1WGXA 4IHVA 3E7LA 3TEDA 4W97A 1NK2P 3BT9A 1QVUA 2CUEA 3S1QJ 1ZGWA 3QQAA 4Y7NJ 2O7OA 4JX6A 3GTKJ 4CYCA 2LKXA 2LVSA 2I10A 4AC0A 3ZQCA 3BTCA 1ETKA 2CRGA 2KT0A 1ETOA 3HEFA 2ME0A 4AUXA 1FEXA 1HDPA 1X58A 2VKEA 3BTLA 3HOUJ 3VPRA 4V2FA 3CDLA 1RKWA 3ZQHA 1U9OA 1W0TA 1JKRC 3TW7A 3S17J 1AKHB 1VNDA 2E2JJ 4A3CJ 1ZR4A 5C4XJ 1WPKA 3S16J 1VFCA 3HOXJ 2GLOA 1TWFJ 3LSJA 2DA3A 4XK4A 3BR0A 2HI3A 3OOUA 4QTRA 5DTDA 5M3FJ 5F04A 3JRFA 2FX0A 2NS8A 1U9NA 4UUTA 2XB0X 4C2MJ 3Q0UA 3BR1A 2GBYA 3JRDA 4QSHA 2MSYA 5F1JA 2YS9A 2DA1A 2DMUA 3LSRA 2EZHA 1Z0XA 2QF7A 4XRSA 1UHSA 1ETVA 1FIAA 2DA5A 4MLOA 5F0CA 1RETA 1A5JA 1JT6A 1U78A 2QCOA 4EEFG 1UMQA 3DEWA 5E3NA 1U8BA 1IC8A 2NVQJ 2COBA 3ZOBA 5C3EJ 1VF9A 2ID3A 4BXXJ 1IDZA 1TWGJ 2ECBA 3Q0WA 4A3FJ 2L7MP 5J1UA 1PUFA 2R5YB 1DU6A 3CMYA 3PM1A 2Y31A 4DZPA 1QRYA 1VI0A 5FKLA 4L5EA 1Y1WJ 5C4JJ 4LOCA 2FD5A 1TWAJ 1JT0A 1SANA 4D5FA 3FKIJ 1WI3A 1ZR2A 3G1OA 3W6VA 3WHCA 1ITYA 3BR3A 1Q1VA 2EBIA 2JA8J 1I50J 2XB5A 1ETYA 2XPVA 1SFOJ 3HOWJ 4FE7A 1JTYA 1K61A 3GTGJ 1RPWA 3M4OJ 3PO2J 3MKLA 2JMWA 3BR6A 2ID6A 4BKXA 4XRMA 4FISA 4G12A 2JA6J 1F36A 1OCPA 1ZTRA 2LD5A 3GTOJ 4A3GJ 3FISA 4JX4A 5GPAA 2XRLA 5E3MA 2PMZN 2L7FP 2H1KA 1T33A 2NS7A 3LNQA 3TP3A 4UUSB 3PO3J 2JN6A 1MBGA 5EDNA 1ZK8A 1S7EA 4M3EA 3JRAA 2M34A 2R93J 2TRTA 2HYJA 2X6OA 3A01A 3Q3SA 3RQIA 1O4XA 3OSGA 4DW6A 1E3OC 2OPTA 1JJ6C 2IAIA 3HDDA 1TC3C 1I6HJ 4RBOA 4X6AJ 5J3LA 3HGGA 2RAEA 2KDZA 5IP9J 3JR9A 4M3FA 5IPAA 4BY7J 4C3HJ 4XICA 5EGOB 2NOGA 3O8HA 3BQYA 2LFBA 2R7ZJ 2FQ4A 2L7ZA 2LK2A 3JRCA 3L1PA 2Y2ZA 1CQTA 2B63J 4IHYA 1JKPC 4MFDA 5K7FA 3BQZA 3BR2A 3IH2A 1IJWC 1FTZA 1LFUP 3BG9A 2DA6A 5F0FA 5F08A 2X9DA 1ETXA 1FTTA 2DMQA 1WH5A 3GTMJ 2JWTA 4B4CA 4BY1J 4IHXA 3GTLJ 3K2AA 4W1UA 1LE8A 2VPRA 1UG2A 4FCYA 2R0QC 2DN0A 3O8GA 1AHDP 4AYBN 2YU9J 3BG5A 3LSPA 3JREA 4A3LJ 2E19A 3HOYJ 5F0HA 2K40A 5E3LA 3S2HJ 5EGOA 3NARA 4A3DJ 3LOCA 4JP0A 3D1NI 4MO7A 4MIMA 2WB1N 1G2HA 3HBLA 2M9HA 1HF0A 2X48A 5E3OA 1NTCA 1MBJA 2R92J 2EZKA 4IEJA 2JK3A 5FKOA 4B3AA 2W48A 4D5CA 2L9RA 5F27A 2TCTA 1IV6A 1ZQ3P 1ETQA 1X2NA 1B72A 4RDUA 2NVTJ 2E2IJ 2M2EA 1XC5A 5FJ8J 2HXIA 1GV2A 2EQRA 1A6IA 2Y30A 5M5YJ 3HOZJ 5IOZA 2LY9A 3HB9A 2HOSA 1NK3P 2R5ZA 3GTPJ 1I3QJ 3B6AA 3FIWA 5BNGA 5EEAA 5IYBJ 4DZJA 4X1EA 4DYQA 4FTHA 1H88C 4I76A 3A02A 2ME6A 5K7HA 3FK7A 5M3MJ 1APLC 2DJNA 5IP7J 2LR8A 3JRIA 3S1NJ 3JRGA 1FIPA 2MGQA 4GFBA 2R5YA 1DU0A 1P7JA 3S14J 4DYCA 2LTPA 3BR5A 2IBDA 2OF7A 2M8GX 5GP9A 3SJMA 4DYRA 3GBGA 4A3BJ 4A3IJ 1GV5A 3ZQLA 2CQXA 2DA2A 3WHBA 1OFCX 1Z77A 2K9SA 3JRHA 3GTJJ 3HGYA 1MBFA 3C2BA 1GUUA 1JUPA 2FJ1A 1IG7A 2JJ7A 1Y1VJ 1JJ8C 3B6CA 3UKGA 1B8IB 1F43A 1JKOC 4JX5A 2E2HJ 4XRSG 2L0KA 5EG0B 3A01B 5IOYA 2LLKA 5EG0A 1ENHA 5EF6A 3SFIA 1LE8B 1ZKGA 2VI6A 2H8RA 1D5YA 2XPUA 2HOTA 3HKZN 3OIOA 1R9TJ 3QPLA 1HLVA 5GPCA 2XPWA 1PUFB 1HOMA 4I6ZA 3HOVJ 4XIDA 9ANTA 1X2MA 1IUFA 3LSGA 5M5XJ 2HXOA 3OSFA 2JA7J 1MH4A 2P81A 3BG3A 5DS9A 2N8GA 3A03A 4M3GA 4ABZA 4M6VA 3QPSA 1B72B 2DTZA 2Y0SN 4JYKA 2XSDC 4HNVA 3JRBA 3S15J 4MFEA 1JUSA 2G0EA 1JGGA 4A93J 3RZDJ 3ZQIA 5FKKA 1GDTA 1FJLA 1OCTC 2HOAA 4BBSJ 2R5ZB 4A3EJ 1IRZA 3DCFA 3TP0A 4CYCB 3IH3A 4D7NA 3GTQJ 1TWHJ 1MSFC 2JA5J 2VKVA 2AO9A 1MBHA 3S2DJ 2HDDA 5IP6A 3G1LA 2DMNA 3ZQGA 4A3JJ 4A3MJ 2IEKA 5K7ZA 1W0UA 2MG4A 4M3DA 1LFBA 5FLMJ 2K9QA 2ELKA 1AKHA 5FKNA 1IGNA 2Y9ZA 2NVXJ 1XS9A 1WCMJ 4BBRJ 5M5WJ 3M3YJ
chains in the Genus database with same CATH superfamily
1HQCA 2O9LA 4EMSA 3HSEA 3ZQFA 5JHUA 3S1MJ 3WTWC 2ISZA 2RV8A 4PFPA 3HM5A 4GRIA 1EV7A 5FFZA 3SFZA 2CWEA 2ZNYA 3WTTC 3OYKA 1DPRA 5J1RA 1OCOH 5B1BH 1T56A 1P7IA 3I4MJ 1VQ7I 1JXSA 2OQRA 4P9FA 2CV2A 1S8NA 2WV1A 3H0GJ 1X1DA 4B47A 5CPRB 4HZFA 5HS9A 2ZJQF 3K4CA 3SYTA 1ZLJA 5FKMA 2DK8A 1BIAA 3RKQA 4DJAA 2VUMJ 1SAXA 1OPCA 2ZBKA 3MD2A 2CMPA 1WSUA 1RESA 3K7AJ 4PGGA 4F52A 1BI3A 4Q5SF 2KZVA 3QU6A 3MQ0A 5ICGA 3KX2A 3E5XA 4OOIA 4ASNA 4G7ZF 4UUSA 3G1MA 2P7CB 2O8KA 2W24A 3WG7H 5L3DA 3CJTB 3K69A 5H6QA 1ORKA 3H9JA 3FBIB 4KIGA 3VYUB 1XMAA 1YRNA 4Y3OA 1OISA 1WJFA 3BC8A 1JTXA 1I3AA 2I8DA 2CUZA 3V4GA 5J1YA 2D1VA 5F1RA 1XG1A 5LGTA 2DOAA 3QOPA 1VQLI 3I4PA 3TOAA 3A2KA 4FHTA 3G6EI 2JVHA 2HFHA 2K02A 1TNTA 2CV1A 3RDIA 5EZHA 4KICA 3LFKA 1D8JA 2JPCA 1B6AA 3CMMA 1BW5A 5ED4A 1GVDA 3WU0A 1JGSA 1O57A 4ZYGA 2CJJA 2ZNZA 3EQLF 3QYEA 2A6TA 2DA7A 2IJLA 3CQZJ 3QOEA 2V7FA 2VKHA 3KPHA 2ZB9A 3CUQA 2IP2A 3V7RA 5JVTA 3AAFA 1RNLA 3E7LA 3TEDA 2ZXHA 3CCSI 1OLTA 4II3A 2FF4A 4KISA 3S1QJ 1PVEA 2O7OA 1FX7A 3GTKJ 1OYWA 2LBFB 4D0PA 4KIBA 4CYCA 2PX9A 4G7OF 2BY3A 4AC0A 4F55A 2G9WA 1ETKA 2OZ6A 3OOPA 4HNUA 2DLLA 1TP4A 1XGSA 3S3NA 4AUXA 1G59A 1HDPA 2M4KA 3GW2A 4LMYA 4E70A 4V2FA 4CCOA 2KL4A 4YFNF 1RKWA 1QZEA 2E36A 1ZRFA 1RUNA 4CA0A 3TW7A 3S17J 1VNDA 3HRUA 5BQTA 2E2JJ 1ZR4A 5C4XJ 1AA7A 2R7WA 2GLOA 1MMGA 2LOOA 3MWMA 3VDXA 1SC7A 5DTDA 1EH8A 1TW3A 2V9PA 2P7VB 1U9NA 3K70C 2LY2A 4C2MJ 3Q0UA 3TBIA 4BEHA 3HOTA 2YS9A 2JTVA 1W5CC 2V1DA 3OS1A 2F2EA 3KETA 1D1AA 2GA1A 1Z0XA 4U87A 1IXRC 1ETVA 4MLOA 5TRDA 2JA2A 4RAYA 4M74A 3G73A 2LYCA 1A5JA 1JT6A 2V26A 3FXOA 3ONQA 4EEFG 2E5ZA 1UMQA 4U0VA 4NBQA 2VASA 3ZR8X 3KP7A 1VF9A 1TTYA 2YPRA 3HYIA 1WJBA 3CD6I 1Z1DA 2L5QA 1YW8A 1ZRDA 1IDZA 1USTA 2ECBA 5EEGA 1YLFA 2L7MP 1PUFA 1OCRH 1DU6A 2Y75A 5DCFA 3H36A 3L2UA 2Y31A 4DZPA 1OCZH 1QRYA 1HW1A 2K5CA 1VI0A 1UFMA 1O7LA 2LKPA 1MW7A 1Y1WJ 3DWLE 3O2PE 4LOCA 4S04A 1TWAJ 5DDGA 1JT0A 3RYPA 4D5FA 3FKIJ 1ZR2A 4D9JA 3BCAA 3W6VA 4KA4A 2C6YA 3WHCA 2ESNA 4KYWA 1U5TC 3D5SC 3OV8A 1ITYA 3H5AA 4L5IA 1I50J 2WY7Q 2ZMEC 3QAHA 2FU4A 1ETYA 4BE1A 3HOWJ 5E1WA 3NWSA 1W7PA 3GTGJ 2ZSIB 3BR6A 1OYIA 3EPZA 4UB8C 3OYCA 4HDVA 1K6YA 3CUOA 5HOOA 1J7KA 4M6YA 3LQRA 5FLXK 1X4OA 4PJLA 3LL7A 2KPMA 4IHSA 4PUSA 2ISYA 5DM6F 3QYFA 3ERMA 2PMZN 3QRFF 2KP6A 1SAUA 4I0BA 4BGDA 1T33A 3HTSB 3LNQA 3G4SI 1MMAA 3ABLH 5FROA 4DGWB 1MBGA 5EDNA 4LG3A 4M3EA 2F5EA 3IAM2 1XSDA 2R93J 2TRTA 1R5GA 3K1MA 4HG2A 2FSWA 1JHFA 3MEXA 3FXRA 3PUBA 3WU1B 1E3OC 2A05A 1JJ6C 2IAIA 1TC3C 3VEPA 3C1DA 4RLQA 1B1BA 1F4KA 4C3HJ 3RKWA 4LLGF 4XQFA 4XICA 5EGOB 2NOGA 2BE5F 2IA2A 4IQJA 3CCQI 3L7WA 3JRCA 2Q0OA 4R79A 2B63J 4RAGA 3FXJA 3A0HC 2DFIA 5K7FA 4CYDA 1IJWC 4MQ9F 2WAQA 2A68F 2MBFA 1LFUP 3P9CA 4AVZA 2P5LC 2QUFA 3I58A 4A0YA 5L3FA 3E5UA 1FTTA 2DMQA 2HKXA 2JWTA 4UV9A 2HWVA 3ABTA 2M45A 3T8RA 2GAUA 4IRGA 1PP7U 2R0QC 2HQNA 3FF5A 3E5QA 3QYBA 5CKTA 1EH7A 4AYBN 1E3PA 3BG5A 4BJTA 3AL0C 1YX5A 2K40A 4JP0A 1V55H 3D1NI 3QP6A 3FHNA 1USSA 2BXYA 4M9XA 4L9TA 3B02A 1GHCA 3I56I 3I5UA 3CMAI 1HSJA 2LRDA 5GADJ 1WRJA 1SMTA 3EUHC 4B3XA 5KCMA 1B4AA 2TCTA 1W4MA 2IGOA 1IV6A 4BQQA 1LQ1A 3K2ZA 1ETQA 3JSOA 3ULQB 2NOJB 1X2NA 1J9IA 2WC2A 2E5NA 1XC5A 2M2EA 3DF8A 4BQOA 5FJ8J 2WTEA 5M5YJ 3MKZA 3HOZJ 3OYHA 2ZCWA 4NC6A 3DU6A 4E7IA 2HOSA 2GXBA 3S8PA 4BUPA 4EGYA 1SFUA 2ZFWA 4RS8A 2HQAA 3B6AA 4HPQA 3GF2A 1HW2A 2DOFA 4DZJA 4X1EA 4FTHA 4BNCA 3A02A 2ME6A 3M8EA 2K4BA 3K4JA 1X1AA 5K7HA 4R1HA 3OWTA 3FBNB 5DUKA 1FIPA 3M9AA 2BY2A 5F64A 4CCNA 2DFEA 2XKOA 2W57A 3DLAA 4B48A 1LEAA 2MD5A 2IPQX 2V1NA 3SJMA 1SFXA 3S3MA 5JHFA 2CGPA 3GBGA 2EFQA 4KJZA 1QBJA 2E71A 3F8NA 4EJUA 2H6CA 1T0FC 1B9NA 3C2BA 2Y69H 2XRNA 1IG7A 1JJ8C 1LDDA 2E2HJ 3C18A 3I54A 3L2WA 2R7FA 3BJOA 2EA2A 4EVIA 2DW4A 1VTNC 4G8XA 3A0BC 1MDMA 2Q8KA 1IUYA 3LSIA 3TDZC 3QP5A 1FOKA 2H8RA 1D5YA 4ZDPA 5K5OA 2RQPA 2HOTA 1O7FA 3QPLA 4DBRA 2A5WA 3K4MA 5L3GA 2LF7A 1Z7LA 1R22A 1X2MA 1XX5A 4Q4ZF 3OSFA 2V4JC 4RM2A 1MH4A 2P0WA 2YX7A 4RMNA 2VIXA 4M6VA 1B72B 2DTZA 2Y0SN 2QBYA 2K4JA 5BS6A 2E7XA 4IXAA 3SEZA 2E1NA 3K0LA 1JUSA 2QKMB 1JGGA 2X1DA 1S7AA 2AXTC 3ZQIA 1GDTA 1FJLA 2P6SA 4BBSJ 2HOAA 1ZLKA 2B0LA 4A3EJ 3H5NA 4OMYA 3OR1C 4CH7A 2DO7A 3IKVA 4RM3A 2A61A 4ON0A 4DNCA 3GTQJ 4FT8A 1YIJI 2JPBA 2VQGA 3DFGA 2VKVA 1MSFC 1ZREA 1YOVB 3AFHA 5IP6A 1LFPA 2DPDA 2H8WA 1MJ9A 1KQ0A 3KIOA 3CP8A 1W0UA 3HPHA 4CHUA 2GXAA 1LUJB 2MG4A 3J7ZI 1XN7A 4M3DA 2A5YB 1LFBA 4Z2YA 5FLMJ 3FZVA 2ELKA 5FKNA 3PIOF 1XS9A 1YS7A 2OD5A 4GGGA 4BBRJ 1KYWA 3A4CA 4ZYHA 3TOBA 3CCMI 2BEOA 1D5VA 4A69C 1KQ8A 4H0EA 3HHGA 1JKQC 2OQGA 2CFOA 1LDKB 5IYCJ 1ON2A 1SD4A 3Q0VA 2M8EA 2MH9A 2ZJPF 3F22A 1U8RA 3CCJI 2IGNA 2OC6A 2R7DA 2R3SA 1MJBA 1YRNB 2D5VA 4RLFA 5IYDJ 2PMZA 2F48A 1WH7A 2LG4A 3C3WA 2DA4A 4LLLA 5JLXA 1RZ4A 1LJ9A 1MSEC 4G6DA 2UXXA 3BTIA 3J81K 3FWEA 1F1ZA 4F91B 5DM7F 3S3OA 2MW8A 1BL0A 4LLNA 3ZMSA 1BR4A 2L9VA 3U1KA 1ZAOA 4XONA 2QQ9A 3K70D 2KRCA 2F4MB 1ERDA 2EH3A 3D5RC 2CUFA 3KZIC 2UZKA 1XDSA 2CW7A 2HR3A 1U6GA 4M3BA 2M0CA 2EB7A 4M72A 2WB1A 5J40A 3OYFA 1L3LA 5HODA 4WK8F 2X4HA 2WAEA 3G3ZA 3WGIA 4Y52J 4V2GA 3OYGA 1QVTA 1P4AA 4E7JA 3SZTA 4UVAA 1S5LC 2VE9A 3DXJF 3SDGA 4X0GA 2KDOA 5E1XA 4AIJA 1MBEA 4ENKA 4ENJA 3GZ5A 3GVAA 2FOWA 4QIWN 3TO6A 1MNMC 2E1OA 3K4LA 3NAUA 2Y9YA 3Q9VA 1FYLA 2O5RA 1W5TA 2O3FA 4J19A 3HTUA 2DTRA 2V6CA 3IAS2 1FBUA 1GT0C 3CCYA 1RR8C 2D2WA 5E8IA 3DBLB 3SEQA 2CYYA 5E18F 2XAUA 4XORA 3TQNA 4IHVA 3SHFA 2KKOA 4W97A 4ZTJA 4JK1X 3WTUC 1NK2P 1P4WA 1P4XA 3NEUA 2IGMA 1QU3A 3QQAA 3UNGC 2KMUA 5CLSA 4MGRA 4XN3A 1G8XA 4HRIA 1E3HA 5J4YA 2I10A 2M0MA 3ESWB 5HLHA 5D5VB 1E0EA 3QODA 3BTCA 4ZYEA 4BJ6C 3PSIA 1ETOA 3HEFA 1TNSA 2ME0A 5TGTA 4YELA 4HQEA 2DFHA 3CF5F 1I27A 2E60A 5KHDA 1U9OA 3ML6A 4XM3A 1HC8A 2BW3A 3KYLA 3DPUA 5ILUA 3GZNB 2VQCA 4LD5A 1P2FA 1WPKA 4EQQA 3OS0A 3HOXJ 2XC7A 1TWFJ 1GXQA 1Y56A 1ZN2A 2DT5A 2Z3YA 3F9KA 2EFPA 2BYVE 1A04A 2Y0MA 2GZWA 4MHGA 3JRFA 2OTLI 3BR1A 4XSXF 3P9KA 2P8TA 4RGRA 1H0MA 4IVNA 2EPFA 4E7LA 2O0YA 1WHUA 3LSRA 4PK4A 2V6EA 4WXDA 1UHSA 2X85A 3JAMK 2JSPA 3IRRA 5ICEA 3BWGA 2VB6A 1HXDA 1FSEA 3F8MA 4AD9A 5FB2A 5E20A 3C7JA 2FXAA 4LGWA 1K4TA 2A07F 2MABA 2ZMEA 3WTXC 3KCCA 4M6XA 3OY9A 3F3XA 5E3NA 2NS0A 2NVQJ 2COBA 2KRFA 5J6XA 2ID3A 4P1WA 2FUG2 4BXXJ 1ZG1A 2X6WA 2PJPA 3DKYA 2E7WA 1XCVA 3ABUA 5J1UA 4EJWA 3CMYA 4TV7A 1YIOA 3KZYA 3I3LA 5FKLA 3M8JA 4ETSA 5LHIA 2XHKA 2XAQA 3NWTA 4E7HA 2WY8Q 2QSFX 2ZXWH 2FD5A 3CESA 3LSKA 3HOSA 3I71A 1AWCA 1TT0A 3DEEA 1G3YA 2NRAC 4OAYA 1ON1A 3F8CA 1FOWA 1ACIA 2DQRA 1B59A 3MZHA 1ZRCA 3BR3A 3NRVA 1PJRA 2EBIA 2JA8J 4EV0A 4G6TB 2DJIA 1WJDA 2XB5A 3PFYA 4QPOA 4RB0A 4LG0B 1J2XA 5K1YA 1UHWA 2DYSH 2MD0A 2IW5A 2OZUA 1EKEA 2QKLB 3MKLA 3PO2J 3M4OJ 3FM5A 1MJAA 2ID6A 2RDPA 2M4GA 3JCUC 1RI7A 2BZTA 1F36A 1QZZA 4ITVA 1MNEA 4JX4A 3RYRA 2KFDA 4P5OA 4CCKA 1Y0NA 1H9TA 2ELHA 1R1TA 1W5SA 2FE3A 4RGUA 4CCJA 5LGNA 3W6JB 1TQIA 2QQAA 2H1KA 2EIJH 3P7NA 3TP3A 3PO3J 2M7BA 4KITB 4KUMA 1M1EB 4M9ZA 3L09A 4OU0A 2M34A 2HYJA 2HKOA 4I02A 2H09A 4N4NB 3OIPA 4AIDA 3RQIA 3L9FA 2XKPA 2I5UA 4M71A 3F21A 4A5MA 2OPTA 4CZCA 3HSRA 3HDDA 5DCMA 2NYXA 4NHJA 3MMYB 3FDYA 5ICFA 4N9IA 3BOQA 4X6AJ 1MD0A 3E0JB 1K6OA 2RAEA 2KDZA 3WODF 3DEUA 2M1BA 3DPTA 1WWXA 2ZO4A 5AIPA 3BQYA 2LFBA 1QHHD 2LK2A 4C30A 2XAHA 1ZG3A 2LKSA 3OYLA 2ZKZA 1LEBA 1WI9A 3BQZA 3CJNA 4ANJA 2D45A 2VPLA 3NQOA 1SEUA 4HAMA 2KLOA 2RN7A 5F08A 3CDHA 2GQQA 4NB5A 1FC3A 1DQUA 3S32A 5FRMA 5A2QZ 4KMFA 5HDNA 3MAJA 4QWQA 3WGHA 3LSMA 3TKYA 4BY1J 3K2AA 2R4GA 2VPRA 2VN2A 2X51A 3HRMA 2DN0A 3L2CA 3O8GA 1A31A 2O03A 1NH3A 1AHDP 2YU9J 4I7HA 4AU7A 4UNOA 3WG9A 2BXZA 3ROUA 2OU2A 2ZMEB 2A6EF 1HBXG 4EJVA 3HJEA 4FQGA 4UVCA 2LDUA 1FSHA 4OINF 1MMNA 3LA3A 2GXGA 3KYDB 3OYNA 1G6NA 1MKMA 2HNHA 3P5JA 3R0JA 2CW0F 2DQLA 4LB6B 4U0YA 3J7AO 4OIQF 1E17A 2OBPA 2M9HA 1IN5A 2X48A 3OYBA 3CUQC 2PJRB 1IF1A 2X1CA 3CO6C 4IEJA 4M73A 2LY1A 2VQHA 2OCEA 2VE8A 2W48A 5F27A 5FO5A 2PMHA 3K9TA 2KIQA 2HGCA 2Q2EA 2DT7B 2OUMA 1T0FA 4GYIA 5B66C 2PEXA 3LA7A 2K7LA 2JRMA 1FP2A 2E2IJ 1I39A 1GV2A 2KJCA 2NNYA 2BBYA 2Y30A 2LY9A 5CVRA 5HS8A 1FP1D 3FM3A 4EM1A 3HRSA 3ASNH 3CDIA 3FIWA 1GVJA 1QGPA 1BI1A 4FASD 3M8FA 4AIHA 1F9NA 4I76A 1G3WA 3E1SA 2EFWA 2JT1A 1IN6A 4KIFA 4HOBA 5M3MJ 5K5RA 3GZ6A 3DP7A 5IP7J 1O3QA 5DD8A 1C0WA 3S1NJ 3JRGA 5GTIC 1XDUA 2MGQA 4CCMA 2R5YA 3S14J 1T98A 3BPVA 4UY8I 4RA2A 2VBXA 3T5XA 2Z1DA 4G6QA 1I1GA 3J80Z 4S05A 1P9QC 2O8XA 5CVJA 1BJAA 4DYRA 4A3BJ 2VKDA 3WHBA 4HA8A 4OMZA 3N97A 2K9SA 4PZJA 3JRHA 1I5ZA 3IWFA 1IXCA 1JUPA 2K85A 2FJ1A 3BDDA 4RGSA 3AG3H 4CXFA 1B8IB 1MMSA 3B6CA 2FQ3A 2F4OB 4XRSG 2YX4A 3E6MA 1V5EA 2XAJA 3VB2A 5IOYA 2LLKA 1ENHA 1T38A 4HLYA 2DK5A 4HBLA 2OTJI 3L00A 1A6QA 2IS6A 2FMYA 1VQ6I 1QZYA 2XVCA 3HKZN 3P9IA 1T2KA 1HLVA 1PUFB 3H5RA 1DP3A 5B3SH 3KEQA 1R23A 3GXOA 4PFOA 1G4DA 3ZQ7A 4HLXA 1IUFA 1TQMA 3LSGA 5M5XJ 2QSGX 4KMUX 3KFWX 2WBMA 3CTAA 2P81A 3BG3A 5KVRA 3W2WA 1IW7F 4M3GA 3DV8A 2CV0A 4IJAA 1SVOA 1Y0UA 4JYKA 4A6DA 2FNAA 4IHTA 1DDNA 2CQKA 2HPIA 2K86A 3M7GA 3KLOA 4OAZA 4MFEA 1YO5C 3KE2A 1NHAA 3I59B 3K4NA 5TJJA 3RZDJ 3SXYA 4HF1A 2R5ZB 3DCFA 3TP0A 2W7NA 2RGVA 2EV5A 1VQNI 4D7NA 4WCGA 4XKVA 2VOOA 1PP8F 3S2DJ 4L0ZB 1S29A 3LAJA 2DMNA 4A3JJ 2XF5A 4ZZLA 4O6JA 3LFUA 1JE8A 1V4RA 5D6EA 3WE2A 1KQ9A 2K9QA 1AKHA 5CJ9A 1IGNA 2Y9ZA 2NVXJ 1WCMJ 1WFXA 4V19K 2XGDA 1K78B 1BW6A 1W7PD 1UELB 2CH0A 2EZLA 4C3IJ 1J75A 5CVUA 3J7YJ 1JI8A 5KAFC 4L18B 1J59A 4XLEA 1QPIA 3ZGKA 2PJRA 2GM4A 4BQNA 4Z6YA 1R49A 3F8FA 1EA3A 1BBYA 3D5LA 3W2VA 1R4NB 4GDFA 1TZLA 1H8AC 5GTHC 1U0JA 2F5FA 3I4NJ 1BC8C 4YFKF 2AHQA 4P9UA 4AWXB 4FE4A 1XGOA 4H4KC 1KA8A 1PYVA 5HDKA 3OYDA 1YG2A 2XGCA 3ZQQA 3HUGA 5C44J 2QQBA 5JLWA 3GFLA 1OR7C 2F5VA 1FMVA 2K3FA 2V79A 2DI3A 3RZOJ 4N0BA 4D7MA 1RUOA 1TWCJ 5JI6A 1XB4A 2HTJA 3IKTA 3S1RJ 1X1PA 1XGMA 1HKSA 3FK6A 3K6GA 1QHGA 5EJCA 4XLNF 3IH4A 3BTJA 5D5WB 1TW2A 6PAXA 1BI0A 3PNYA 1Y8RB 2DPUA 4IHWA 3MKWB 2AQEA 1WKMA 4PSWA 1KU9A 2MLKA 1J5YA 4XKWA 2HQ5A 2Z99A 2VJ4A 3GUDA 5ILSA 3F6VA 1XTAA 3M1CA 3CJQB 4XL9A 4ZH4F 1POGA 4S0HB 1AU7A 4AYBA 2XV4S 4CSWA 3HL2A 5FD5A 1HCRA 2CW8A 2K9NA 1B8IA 5IY5H 3K1NA 1MNDA 2NVYJ 3T0YA 2BVMA 3D0SA 4BDZA 5IT9K 4UXNA 3F8BA 2DU9A 3RPUA 2LF8A 1IN8A 3MZ8A 4BHPA 1MBKA 2W1OA 3GMEA 2ECCA 2XAGA 4XMYA 4M9SA 3ZMTA 4FX4A 5EYRA 1VZ0A 2RVCA 3BG6A 1Y8QB 1V5FA 5CVVA 4NDLA 3ERED 3CCUI 4E7SA 1STZA 3WTSC 2XGEA 2KISA 3CC2I 1RRJA 3BT9A 3EDPA 3M07A 1QVUA 2CUEA 4HQMA 3H3UA 3MFKA 1ZGWA 3EUHA 4WWCA 2P5VA 1WQ2A 4K2EA 4JX6A 3RPQA 2VODA 2LKXA 1N77A 2VL8A 2DDBA 2X6YA 2AXLA 3ZN1A 3ZQCA 3I9V2 3QPTA 2CRGA 4OIRF 1KYZA 2COMA 3H0DA 1FEXA 1OYYA 1X3UA 1OQYA 3HOUJ 3V42A 3CDLA 3ZQHA 2D1HA 1JKRC 2MC3A 3RCOA 4HSTA 4LIUA 3J7AY 1MIJA 3W6KB 2M87A 3ISPA 4PJJA 3LSJA 4WXHA 2DA3A 4XK4A 3BR0A 2HI3A 4QTRA 3VYSB 2EA4A 5M3FJ 2FX0A 2FA5A 2GA2A 2NS8A 4UUTA 2XB0X 4L0YB 1WJ5A 1TT5B 3OL4A 4Y15A 2HVSA 2JUCA 3G71I 2MSYA 1V54H 3R61A 1VQPI 3F72A 3R6SA 2YSRA 3IWZA 3U1DA 2MC4A 2DMUA 3ABMH 3AG1H 2EZHA 5BMZA 2P6TA 2EFNA 5D5UB 1TLHB 2EK5A 3VSLA 1IRFA 2W82A 4EGZA 1FIAA 3LSTA 2FMLA 3DKXA 2EIKH 1RETA 1F5TA 3OIQA 3PQJA 5HNFA 3TO9A 1Z67A 3W3CA 3DEWA 1BM9A 1U8BA 1IC8A 3S2WA 5C3EJ 2GOMA 4YFXF 3ABKH 5IT3A 1WVRA 4BE0A 2MH2A 3EUKL 1TWGJ 3Q0WA 4HNTA 2L4AA 3ASOH 4OWRB 3DTEA 4I0AA 1LNWA 3H3ZA 2R5YB 1WJAA 3K1PA 4BACA 2DBBA 3IRQA 1UCRA 3BZ6A 4DBQA 2WADA 4ESBA 4ZJZA 2Z33A 2O61A 3LMMA 5C4JJ 1GXPA 2QBYB 2ACJA 1WZ2A 5GAEJ 1WI3A 2BY0A 2WA0A 2R7QA 3HRTA 4ZYDA 3LAPA 3QU3A 1YJWI 2E1MC 3FMRA 2HS5A 3HPGA 2QGUA 4RAZA 3I53A 3PJRA 1R5ID 3TMOA 3VWBA 5BPDA 4UV8A 1G3SA 1X1BA 2VT2A 2HVQA 4I01A 2PG4A 2L01A 2HYGD 2XPVA 3MZYA 4LIVA 2RKHA 4FE7A 5EEHA 5TISC 1JTYA 1K61A 4UHTA 1JHHA 2F6CA 1TBXA 3K10A 3U9GA 5CYVA 2KIMA 1RPWA 5DCMB 3RTRA 4EM0B 4P55A 2JMWA 4BHBA 4HDUA 2QENA 1Z6TA 5E1ZB 4FISA 2LH9A 1XMXA 4G12A 2FBKA 4EJTA 3GTOJ 4BEHB 1X4PA 4A3GJ 3FISA 1G3TA 4FX0A 1Z7UA 5LFAA 5AIQA 2FBIA 4WF2A 5E3MA 3ZN0A 3OS2A 1YS6A 2GOXB 3L2VA 3WE3A 2E1CA 4XKBA 3TO7A 2VT3A 1LB2A 1A36A 2IVMA 1ZK8A 2O6GE 4ZYAA 2LSOA 2X6OA 3OYMA 3BJ6A 1R36A 3Q3SA 3ZXSA 3VOEA 1D0XA 3AL0B 1O4XA 4DW6A 1I6HJ 4CICA 2IS1A 1BI2A 4MNUA 1IAWA 2V9VA 5ERIA 4RBOA 5J3LA 5IP9J 4IOCF 1S6LA 1BOBA 1XSXA 3VODA 2XROA 4M3FA 5IPAA 3JR9A 1D1BA 3OYEA 3O8HA 2AS5F 2UV1A 2CO5A 2IS4A 4KNYA 3IHUA 3RI4A 1SFKA 2L4MA 3L1PA 5DUIA 1YJ9I 3PNTA 5HNHA 1CQTA 1ONVA 3FXKA 4IHYA 2NXNB 4MFDA 4YIRX 1I1SA 1VQKI 5ICCA 1FLIA 3BG9A 4LFUA 4XOTA 1K4SA 4HF0A 3ZMDA 4ENNA 3GX4X 2X9DA 3R0AA 2JZYA 4IQ4A 2OAZA 5D8LB 2HU9A 4Y4RA 4C2TA 2Y0SA 3QPHA 1HKTA 4B4CA 5CQEA 3GLLA 1QO0D 4BS9A 4ZTFA 1LE8A 2NNNA 4KN7X 2QLZA 2R7RA 3IL2A 2B7EA 1UB9A 2XF6A 3DPLC 1FOXA 4UVBA 4ZDLA 5D4RA 3JREA 4A3LJ 2UWMA 2E19A 5CVIA 3BJAA 3ECHA 3LQQA 5F0HA 3WTVC 3JSPA 3HOYJ 3OYJA 1T08B 1P92A 3FXQA 4LK0F 4PDKA 4YEJA 3TL4X 5E3LA 3GEZA 1U3EM 4CCLA 3J80K 1KGSA 2BHYA 4MO7A 2QEXI 4B8XA 3SZGA 4KFCA 2WB1N 1G2HA 3O6BB 3E6CC 4MTEA 4II2A 5GAGJ 5IT9Z 4G7HF 3F23A 4QPQA 3HBLA 3LA2A 1HF0A 4G9YA 1NTCA 1MBJA 2CG4A 2R92J 5FKOA 4EM2A 4NQWA 5KAIC 3QWLA 4PCQA 1ZQ3P 3R4KA 1K7AA 3OR2C 1UHMA 3X2QH 2LBFA 2W84A 1B72A 2QVOA 4RDUA 5JR3A 1IV8A 1GLNA 4I99C 2HXIA 5GAHJ 1OCCH 2EJRA 2B9SA 3KP4A 4IL6C 1O3TA 3HB9A 1NK3P 2VBYA 3E6DA 3GTPJ 3ZMVA 2L2OA 3FMSA 5BNGA 4JQFA 5EEAA 2CSOA 1T6SA 3JTHA 3C2HA 5IYBJ 4DYQA 3M1EA 1H88C 1VQ9I 4HSRA 4NC7A 3IUOA 4QLCU 4ESFA 2MLGA 3FK7A 2FBHA 2DJNA 1V3FA 2G7HA 3EYYA 2IRFG 4GFBA 3DKWA 2CUJA 4DYCA 2LTPA 1BOAA 3BR5A 3ZMUA 3FXMA 2OF7A 2M8GX 5GP9A 1Z05A 2K9LA 2Y48A 2EILH 4A3IJ 2MFZA 1KU3A 3ZQLA 2CQXA 2DA2A 1OFCX 1NG7A 1Z77A 4YRVA 1J09A 3GTJJ 1PUEE 2XIGA 3FKJA 3PIPF 1Y1VJ 3R60A 3O3KA 2PMUA 4JX5A 3H1CA 1SVMA 2R7VA 2L0KA 5EG0B 5J8CA 5EG0A 1YX3A 3GFJA 2ZXJA 4MEYF 3K4BA 4UUVA 2VI6A 4EATA 1IXSB 3CO7C 3CCLI 1D0ZA 3RJPA 3KZZA 5HLTA 3VYTB 4BDYA 2BVLA 3OIOA 3Q9SA 1R9TJ 4DIQA 5GPCA 2XPWA 1HOMA 4N9HA 2DT6A 4XIDA 1ZARA 4BXFA 2BY1A 3V8LA 3V8KA 1FY7A 4EJOA 4YIFA 1IRXA 1W36D 4IRIA 4O3MA 1ZH5A 2YR2A 3AKZA 2HXOA 4XLCA 3GLXA 2IA1A 5HS7A 5DS9A 3A03A 1TQPA 4IOAF 3L2QA 4YIIA 3QPSA 4JBAA 3FXLA 1FWZA 2W00A 4HX7A 3H92A 1YE9A 4B09A 1FYMA 3CJRB 2XSDC 1W36C 4RB3C 1TL8A 3I55I 4A2UA 2F5CA 3S15J 3LWFA 2G0EA 1CGPA 4OIPF 1IRZA 4CYCB 5FGMA 3IH3A 4HV5A 4RAFA 1FMWA 3N4MA 4A0ZA 5JFRA 3ZRGA 4LG0A 2XDVA 2JA5J 1MBHA 2J5PA 2J5OA 3MKYB 3G1LA 2H6BA 3OMYA 2EIMH 1Z6RA 1FNNA 3K4KA 3SQNA 4A3MJ 2KIFA 4D1QA 2IEKA 1UZCA 1N78A 2BOLA 4HW0A 3ZP5A 3N05A 1HA8A 1ZGJA 4E6KG 5M5WJ 2JUGA 3CLQA 3W2AA 4BJ5C 1REPC 3RPUD 4UB6C 2YUSA 2PQ8A 1UG0A 1KONA 4E4HA 1T8IA 1D3YA 2A6HF 3IV5A 3PQKA 1ZG5A 1VQ5I 1OMIA 5D6FA 2WWYA 2F5DA 1LKXA 5L3BA 1BJZA 4HF2A 2XGXA 2L3DA 1BA5A 3KP5A 4C9YA 2ZJ2A 3GFMA 2DMTA 2RQQA 2XASA 1YW7A 1YI2I 1MH3A 4C2UA 1OJLA 3EETA 3COAC 2K9MA 3ZMZA 4PGHA 3RIRA 2DYRH 4L9VA 3CCRI 2DODA 1EH6A 2DMPA 3PUFA 2EZIA 2GIZA 4I2OA 3TDUC 4E7ZA 1EF4A 2A69F 5H2FC 1VQ8I 1BR2A 3ELKA 2EINH 3H3VK 2H94A 2JQ7A 1YYVA 3BCBA 2W85A 3HXLA 4AM3A 1JUMA 4XN0A 2H27A 1WJCA 1X1CA 2KIUA 2XUBA 2NAZA 2QA4I 5CQGA 3G2BA 3OYIA 2OA4A 2M5WA 2ICWG 1SD6A 2VONA 1RKTA 5EZGA 2LNBA 4CO8A 5FLVA 1D8KA 3UR3C 2CU7A 3ZCOA 2ESHA 3RQ4A 3REOA 3PNVA 2CQQA 1IDYA 1D1CA 1K83J 3I59A 1HDDC 1OKRA 4A3KJ 2LP0A 1RR7A 1O3RA 4Q47A 3KP2A 3TW6A 4XR6A 4C3JJ 3V8JA 3MN2A 1SVLA 2K3PA 5LRSA 5BOXA 3MVPA 4MEXF 2X1EA 4R8HA 1LPQA 1I6XA 3F0CA 1RIOH 1ETWA 2WAQN 4B1RA 1XD7A 4L9JA 4XLPF 1H89C 4BXUA 3E3VA 1XGNA 1IZ1A 5D4SA 2FNPA 1WGXA 4P96A 2QWWA 2PBIA 4DQ2A 2M7AA 5JVGF 4BHCA 3U21A 1IRGA 5J47A 2VXZA 5FRNA 4HX8A 2VJIA 4Y7NJ 3BROA 3Q5FA 4GO1A 1K78A 2LVSA 2VC0A 2AQFA 1E2XA 2UUZA 1XCBA 1ZELA 3BPXA 5A2QK 1S7OA 2KT0A 3DQVC 1X58A 2PFBA 2VKEA 3BTLA 1Z9CA 3WTZA 3VPRA 2F4IA 5LHGA 4Q48A 2FEZA 4KN4X 4ZC3A 3AG4H 3VSKA 1W0TA 4PJMA 4XLAA 1XPXA 2UXNA 1AKHB 1K79A 4A3CJ 1IN7A 1Y6IA 3CC7I 4AVPA 3S16J 1VFCA 4A0XA 2IA0A 2RNJA 3OL3A 3DTIA 3PFIA 5H6RA 3CUQB 3DBHB 4IKFA 3V7SA 2HDCA 3OOUA 2EFOA 2L9SA 4MQVA 4PJ0C 1HSTA 1LDJA 5F04A 2HYFA 2L54A 3BP8A 3EYIA 2GBYA 5L3CA 3JRDA 4QSHA 4RGXA 2JVGA 2P5KA 5F1JA 1D0YA 3I0TA 2DA1A 2HOEA 1KU7A 1UAAA 2QF7A 4XLFA 4XRSA 4A12A 2DA5A 2K27A 5F0CA 1SMYF 3HUGB 1KZHA 1U78A 2QCOA 3BLYA 5LEKA 1FZPB 5D8KB 2RREA 4XBFA 1X19A 1YHQI 3ZOBA 2VBZA 2ZSHB 5DEQA 4I09A 3OYAA 5KNLA 4Y13A 2XF7A 4Y33A 1B9MA 4A3FJ 3GWZA 2ZJRF 1YFHA 1R1VA 2STWA 3KP3A 1VQOI 3PSFA 3PM1A 3CCEI 5K5QA 1YJNI 2HPMA 2P4WA 3ZPLA 2EWNA 3JW4A 4L5EA 4HEA2 2Z2SB 2KHMA 1J0RA 4I98B 1SANA 3CC4I 3TGNA 3BZCA 2GWRA 2X0LA 3J81Z 4XKCA 3G1OA 2JRTA 4PSXA 3FMQA 5BPIA 2BGCA 2IXSA 5E79C 5F6FA 5LRRA 2L7KA 5FD6A 2EV0A 3GCMA 3KP6A 4ZDOA 1Q1VA 2R7TA 2M30A 1Q1HA 3C2GA 2BHZA 1SD7A 2XAFA 2VJJA 5D5XB 3RKYA 2VQLA 1SFOJ 4G94A 5E8GA 3FXUA 2Z5UA 3I64A 1FT9A 4IF4A 1O3SA 3PL8A 1BIBA 2JSCA 2OJED 3WU2C 4BKXA 4XRMA 4LJZF 1S9HA 4BQAA 4ZZDA 2JA6J 1R5HA 1OCPA 1ZTRA 5ILVA 2LD5A 2V9KA 5LLQA 3BY6A 3H9GA 1HKQA 2HZDA 4E7KA 5GPAA 1BR1A 1X3WB 2XRLA 3KYCB 1DGRM 4U7DA 2TDXA 2L7FP 2R7XA 4NUBA 5E17F 2L02A 2NS7A 2HZTA 1RC9A 5HLGA 4UUSB 2JN6A 2W25A 2G7UA 1IN4A 3JRAA 1S7EA 1HW5A 3JAMZ 3F6OA 4N4OB 2MYSA 3BG7A 2YU3A 3A01A 2Q2EB 1U5TB 2E34A 2A3SA 1U5TA 4U7BA 2VLAA 3OSGA 1CF7A 1CF7B 4IPAA 1YTYA 3SZPA 1ODDA 4B44A 1W7PB 2PLYA 4LITA 3SDBA 5KK1A 2FRHA 1Z3XA 3WGGA 1FBQA 1FOYA 3HGGA 2FOKA 2V1XA 1FBSA 4ESJA 4BY7J 1OR7A 2QSHX 2ADUA 1WJEA 2R7ZJ 1ZHFA 2FQ4A 2KRHA 1ULYA 2L7ZA 3KLNA 2VXDA 4RB2C 2Y2ZA 1JKPC 4WXCA 3BR2A 2HQRA 3IH2A 2W4SA 1BC7C 1FTZA 2KJBA 1QA6A 2DA6A 5F0FA 5B1AH 2NVUB 4YG2F 4DOZA 1ETXA 3HZJA 5HLIA 4BYYA 3KEYA 2ELJA 2HVRA 3ECOA 1MGTA 2IGKA 4XSZF 1WH5A 4NC8A 5DV5A 3GTMJ 4IHXA 3GTLJ 1NG6A 4W1UA 1MDMB 1MMDA 1UG2A 1R00A 1FPQA 4FCYA 3RSNA 2RC4A 4MTDA 3BZKA 3CP2A 4U0WA 4BAYA 2ZC2A 2QYOA 4CUGA 3LSPA 3E97A 3S2HJ 2EV6A 2HTSA 3NARA 2CS3A 5DD4A 1SD5A 3LOCA 5EGOA 1YITI 4A3DJ 1H9GA 4FETA 1FYKA 4MIMA 4J01A 4IRHA 3DBRB 3HSFA 4O5VA 2QZ8A 5LBQA 3HIFA 1N25A 1T95A 1AOYA 2OV7A 2DXIA 5E3OA 2E1MB 5LHHA 4HX4A 5B5EC 3GFIA 2EZKA 1MZBA 2JK3A 5L3EA 1R71A 4XRFA 1R4MB 4B3AA 3A1YA 4D5CA 2L9RA 4GCVA 1W1WE 1YW9A 1X3ZB 4BE2A 1LVKA 2H1LA 1P6RA 3GYHX 2NVTJ 5HVQC 4Y17A 2DDAA 2EQRA 1A6IA 1R1UA 3FHZA 5LGUA 3H9QA 5LD2C 4BH9A 2V1UA 3HC7A 4B43A 4IO9F 5IOZA 3LSHA 4LK1F 3CLOA 4IZZA 5DYMA 1DUXC 3T1BA 2R5ZA 2M3AA 1I3QJ 2DAOA 2VBWA 4NNJA 3WTYC 4OIOF 4HV6A 2HDWA 1T39A 3CCVI 2WAFA 2HEOA 2ETHA 1S72I 3VYRB 1APLC 2LR8A 5HDGA 3JRIA 1N75A 4KT5C 3RKXA 1VQMI 1V5GA 1BN5A 1P7JA 1DU0A 1VQ4I 3T8TA 4JOMA 1KU2A 1Z3YA 2DFFA 3IC7A 5LEJA 2IBDA 2KQRA 1DP7P 3CMEI 2KZGA 4GYGA 4LB5A 1U2WA 4RB1A 5AONA 4F92B 4J00A 3FX3A 2DCEA 3S93A 4F93B 2R7SA 1GV5A 3DLLF 2R7UA 4GXOA 2R7OA 2ZXIA 4CZZA 3HGYA 1MBFA 2CQNA 2STTA 1GUUA 2JJ7A 4IX7A 3UKGA 1F43A 3JTGA 4AIKA 1JKOC 4ENMA 2ZFUA 5J4VA 2DOEA 4KDPA 1SFEA 2X6XA 3A01B 4F3QA 1UJ8A 3AG2H 3E6BA 5EF6A 4L5JA 3SFIA 1LE8B 1ZKGA 2QQ8A 2Z9OA 5FFXA 2XPUA 4BL0B 1ZGAA 2BV6A 2VOPA 3VFZA 2QM3A 4XOPA 1PDNC 1DPUA 2GIVA 4BU2A 2PN6A 4I6ZA 3KEOA 1Z21A 4WX9A 3HOVJ 2LMDA 2XSJC 1A35A 9ANTA 3EUAA 3DU5A 2JA7J 1ZYRF 1EJ9A 1LVAA 2N8GA 1S3JA 4CGZA 3GO5A 3B73A 4ABZA 3DTKA 1R7JA 2IT0A 2WV0A 2Z16A 4PJNA 3HKZA 4XLHA 1IO2A 4F7ZA 3H35A 1Z91A 2L9NA 3HHHA 4HNVA 3CF2A 4A6EA 3JRBA 2OCCH 2LC2A 4U88A 2CFXA 4A5NA 4A93J 2RNGA 4NQWB 5FKKA 2LREA 1OCTC 3MCZA 1L0OC 4XNFA 1XMKA 1XSVA 2MA3A 1QNTA 3IP4B 5H20A 2VC1A 1YQAA 1QQIA 1TWHJ 2Q1ZB 4L9NA 2CQ7A 4KT6A 2AO9A 1QPMA 2HDDA 2VJ5A 4CDGA 3ZQGA 2PI0A 3HG9A 3CZ6A 5K7ZA 5J8FA 1DGWY 3L2RA 2IS2A 2BW3B 1Y39A 1R58A 2E35A 3V7CA 5FLXZ 1R6RA 3U2RA 4HYEA 3M3YJ
chains in the Genus database with same CATH topology
2O9LA 2XGDA 1BW6A 3ZQFA 4A69C 2EZLA 2YUSA 4C3IJ 3S1MJ 1JKQC 1QPIA 3HM5A 3IV5A 5IYCJ 2GM4A 3Q0VA 1BJZA 5J1RA 1YRNB 2D5VA 1H8AC 3I4NJ 1T56A 1P7IA 3I4MJ 5IYDJ 1BA5A 1WH7A 2AHQA 2WV1A 2DA4A 2DMTA 5JLXA 3H0GJ 4FE4A 1MH3A 1MSEC 1OJLA 2XGCA 3BTIA 5C44J 5JLWA 2MW8A 1BL0A 5FKMA 2DMPA 2EZIA 3RKQA 2VUMJ 3RZOJ 4D7MA 1EF4A 1TWCJ 3S1RJ 1RESA 3K7AJ 3FK6A 2EH3A 2CUFA 3H3VK 3IH4A 3BTJA 1JUMA 4UUSA 3G1MA 4M3BA 2O8KA 2M0CA 4IHWA 5HODA 1ORKA 4Y52J 2HQ5A 4V2GA 1YRNA 5EZGA 1RKTA 1QVTA 1JTXA 5FLVA 3SDGA 5J1YA 1POGA 4S0HB 1MBEA 1XG1A 1AU7A 2CU7A 4QIWN 1MNMC 2E1OA 2CQQA 1IDYA 1HCRA 3NAUA 2K9NA 1K83J 2Y9YA 1B8IA 2NVYJ 1HDDC 5EZHA 4A3KJ 2LP0A 1RR7A 3TW6A 1BW5A 4C3JJ 4J19A 1GVDA 3MN2A 1MBKA 2CJJA 2ECCA 3MVPA 1GT0C 2DA7A 3F0CA 3CQZJ 1ETWA 2WAQN 3CCYA 5EYRA 4B1RA 1H89C 4NDLA 2ZB9A 2XGEA 1WGXA 4IHVA 3E7LA 3TEDA 4W97A 1NK2P 3BT9A 1QVUA 2CUEA 3S1QJ 1ZGWA 3QQAA 4Y7NJ 2O7OA 4JX6A 3GTKJ 4CYCA 2LKXA 2LVSA 2I10A 4AC0A 3ZQCA 3BTCA 1ETKA 2CRGA 2KT0A 1ETOA 3HEFA 2ME0A 4AUXA 1FEXA 1HDPA 1X58A 2VKEA 3BTLA 3HOUJ 3VPRA 4V2FA 3CDLA 1RKWA 3ZQHA 1U9OA 1W0TA 1JKRC 3TW7A 3S17J 1AKHB 1VNDA 2E2JJ 4A3CJ 1ZR4A 5C4XJ 1WPKA 3S16J 1VFCA 3HOXJ 2GLOA 1TWFJ 3LSJA 2DA3A 4XK4A 3BR0A 2HI3A 3OOUA 4QTRA 5DTDA 5M3FJ 5F04A 3JRFA 2FX0A 2NS8A 1U9NA 4UUTA 2XB0X 4C2MJ 3Q0UA 3BR1A 2GBYA 3JRDA 4QSHA 2MSYA 5F1JA 2YS9A 2DA1A 2DMUA 3LSRA 2EZHA 1Z0XA 2QF7A 4XRSA 1UHSA 1ETVA 1FIAA 2DA5A 4MLOA 5F0CA 1RETA 1A5JA 1JT6A 1U78A 2QCOA 4EEFG 1UMQA 3DEWA 5E3NA 1U8BA 1IC8A 2NVQJ 2COBA 3ZOBA 5C3EJ 1VF9A 2ID3A 4BXXJ 1IDZA 1TWGJ 2ECBA 3Q0WA 4A3FJ 2L7MP 5J1UA 1PUFA 2R5YB 1DU6A 3CMYA 3PM1A 2Y31A 4DZPA 1QRYA 1VI0A 5FKLA 4L5EA 1Y1WJ 5C4JJ 4LOCA 2FD5A 1TWAJ 1JT0A 1SANA 4D5FA 3FKIJ 1WI3A 1ZR2A 3G1OA 3W6VA 3WHCA 1ITYA 3BR3A 1Q1VA 2EBIA 2JA8J 1I50J 2XB5A 1ETYA 2XPVA 1SFOJ 3HOWJ 4FE7A 1JTYA 1K61A 3GTGJ 1RPWA 3M4OJ 3PO2J 3MKLA 2JMWA 3BR6A 2ID6A 4BKXA 4XRMA 4FISA 4G12A 2JA6J 1F36A 1OCPA 1ZTRA 2LD5A 3GTOJ 4A3GJ 3FISA 4JX4A 5GPAA 2XRLA 5E3MA 2PMZN 2L7FP 2H1KA 1T33A 2NS7A 3LNQA 3TP3A 4UUSB 3PO3J 2JN6A 1MBGA 5EDNA 1ZK8A 1S7EA 4M3EA 3JRAA 2M34A 2R93J 2TRTA 2HYJA 2X6OA 3A01A 3Q3SA 3RQIA 1O4XA 3OSGA 4DW6A 1E3OC 2OPTA 1JJ6C 2IAIA 3HDDA 1TC3C 1I6HJ 4RBOA 4X6AJ 5J3LA 3HGGA 2RAEA 2KDZA 5IP9J 3JR9A 4M3FA 5IPAA 4BY7J 4C3HJ 4XICA 5EGOB 2NOGA 3O8HA 3BQYA 2LFBA 2R7ZJ 2FQ4A 2L7ZA 2LK2A 3JRCA 3L1PA 2Y2ZA 1CQTA 2B63J 4IHYA 1JKPC 4MFDA 5K7FA 3BQZA 3BR2A 3IH2A 1IJWC 1FTZA 1LFUP 3BG9A 2DA6A 5F0FA 5F08A 2X9DA 1ETXA 1FTTA 2DMQA 1WH5A 3GTMJ 2JWTA 4B4CA 4BY1J 4IHXA 3GTLJ 3K2AA 4W1UA 1LE8A 2VPRA 1UG2A 4FCYA 2R0QC 2DN0A 3O8GA 1AHDP 4AYBN 2YU9J 3BG5A 3LSPA 3JREA 4A3LJ 2E19A 3HOYJ 5F0HA 2K40A 5E3LA 3S2HJ 5EGOA 3NARA 4A3DJ 3LOCA 4JP0A 3D1NI 4MO7A 4MIMA 2WB1N 1G2HA 3HBLA 2M9HA 1HF0A 2X48A 5E3OA 1NTCA 1MBJA 2R92J 2EZKA 4IEJA 2JK3A 5FKOA 4B3AA 2W48A 4D5CA 2L9RA 5F27A 2TCTA 1IV6A 1ZQ3P 1ETQA 1X2NA 1B72A 4RDUA 2NVTJ 2E2IJ 2M2EA 1XC5A 5FJ8J 2HXIA 1GV2A 2EQRA 1A6IA 2Y30A 5M5YJ 3HOZJ 5IOZA 2LY9A 3HB9A 2HOSA 1NK3P 2R5ZA 3GTPJ 1I3QJ 3B6AA 3FIWA 5BNGA 5EEAA 5IYBJ 4DZJA 4X1EA 4DYQA 4FTHA 1H88C 4I76A 3A02A 2ME6A 5K7HA 3FK7A 5M3MJ 1APLC 2DJNA 5IP7J 2LR8A 3JRIA 3S1NJ 3JRGA 1FIPA 2MGQA 4GFBA 2R5YA 1DU0A 1P7JA 3S14J 4DYCA 2LTPA 3BR5A 2IBDA 2OF7A 2M8GX 5GP9A 3SJMA 4DYRA 3GBGA 4A3BJ 4A3IJ 1GV5A 3ZQLA 2CQXA 2DA2A 3WHBA 1OFCX 1Z77A 2K9SA 3JRHA 3GTJJ 3HGYA 1MBFA 3C2BA 1GUUA 1JUPA 2FJ1A 1IG7A 2JJ7A 1Y1VJ 1JJ8C 3B6CA 3UKGA 1B8IB 1F43A 1JKOC 4JX5A 2E2HJ 4XRSG 2L0KA 5EG0B 3A01B 5IOYA 2LLKA 5EG0A 1ENHA 5EF6A 3SFIA 1LE8B 1ZKGA 2VI6A 2H8RA 1D5YA 2XPUA 2HOTA 3HKZN 3OIOA 1R9TJ 3QPLA 1HLVA 5GPCA 2XPWA 1PUFB 1HOMA 4I6ZA 3HOVJ 4XIDA 9ANTA 1X2MA 1IUFA 3LSGA 5M5XJ 2HXOA 3OSFA 2JA7J 1MH4A 2P81A 3BG3A 5DS9A 2N8GA 3A03A 4M3GA 4ABZA 4M6VA 3QPSA 1B72B 2DTZA 2Y0SN 4JYKA 2XSDC 4HNVA 3JRBA 3S15J 4MFEA 1JUSA 2G0EA 1JGGA 4A93J 3RZDJ 3ZQIA 5FKKA 1GDTA 1FJLA 1OCTC 2HOAA 4BBSJ 2R5ZB 4A3EJ 1IRZA 3DCFA 3TP0A 4CYCB 3IH3A 4D7NA 3GTQJ 1TWHJ 1MSFC 2JA5J 2VKVA 2AO9A 1MBHA 3S2DJ 2HDDA 5IP6A 3G1LA 2DMNA 3ZQGA 4A3JJ 4A3MJ 2IEKA 5K7ZA 1W0UA 2MG4A 4M3DA 1LFBA 5FLMJ 2K9QA 2ELKA 1AKHA 5FKNA 1IGNA 2Y9ZA 2NVXJ 1XS9A 1WCMJ 4BBRJ 5M5WJ 3M3YJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2O9L A;  2XGD A;  1BW6 A;  3ZQF A;  4A69 C;  2EZL A;  2YUS A;  4C3I J;  3S1M J;  1JKQ C;  1QPI A;  3HM5 A;  3IV5 A;  5IYC J;  2GM4 A;  3Q0V A;  1BJZ A;  5J1R A;  1YRN B;  2D5V A;  1H8A C;  3I4N J;  1T56 A;  1P7I A;  3I4M J;  5IYD J;  1BA5 A;  1WH7 A;  2AHQ A;  2WV1 A;  2DA4 A;  2DMT A;  5JLX A;  3H0G J;  4FE4 A;  1MH3 A;  1MSE C;  1OJL A;  2XGC A;  3BTI A;  5C44 J;  5JLW A;  2MW8 A;  1BL0 A;  5FKM A;  2DMP A;  2EZI A;  3RKQ A;  2VUM J;  3RZO J;  4D7M A;  1EF4 A;  1TWC J;  3S1R J;  1RES A;  3K7A J;  3FK6 A;  2EH3 A;  2CUF A;  3H3V K;  3IH4 A;  3BTJ A;  1JUM A;  4UUS A;  3G1M A;  4M3B A;  2O8K A;  2M0C A;  4IHW A;  5HOD A;  1ORK A;  4Y52 J;  2HQ5 A;  4V2G A;  1YRN A;  5EZG A;  1RKT A;  1QVT A;  1JTX A;  5FLV A;  3SDG A;  5J1Y A;  1POG A;  4S0H B;  1MBE A;  1XG1 A;  1AU7 A;  2CU7 A;  4QIW N;  1MNM C;  2E1O A;  2CQQ A;  1IDY A;  1HCR A;  3NAU A;  2K9N A;  1K83 J;  2Y9Y A;  1B8I A;  2NVY J;  1HDD C;  5EZH A;  4A3K J;  2LP0 A;  1RR7 A;  3TW6 A;  1BW5 A;  4C3J J;  4J19 A;  1GVD A;  3MN2 A;  1MBK A;  2CJJ A;  2ECC A;  3MVP A;  1GT0 C;  2DA7 A;  3F0C A;  3CQZ J;  1ETW A;  2WAQ N;  3CCY A;  5EYR A;  4B1R A;  1H89 C;  4NDL A;  2ZB9 A;  2XGE A;  1WGX A;  4IHV A;  3E7L A;  3TED A;  4W97 A;  1NK2 P;  3BT9 A;  1QVU A;  2CUE A;  3S1Q J;  1ZGW A;  3QQA A;  4Y7N J;  2O7O A;  4JX6 A;  3GTK J;  4CYC A;  2LKX A;  2LVS A;  2I10 A;  4AC0 A;  3ZQC A;  3BTC A;  1ETK A;  2CRG A;  2KT0 A;  1ETO A;  3HEF A;  2ME0 A;  4AUX A;  1FEX A;  1HDP A;  1X58 A;  2VKE A;  3BTL A;  3HOU J;  3VPR A;  4V2F A;  3CDL A;  1RKW A;  3ZQH A;  1U9O A;  1W0T A;  1JKR C;  3TW7 A;  3S17 J;  1AKH B;  1VND A;  2E2J J;  4A3C J;  1ZR4 A;  5C4X J;  1WPK A;  3S16 J;  1VFC A;  3HOX J;  2GLO A;  1TWF J;  3LSJ A;  2DA3 A;  4XK4 A;  3BR0 A;  2HI3 A;  3OOU A;  4QTR A;  5DTD A;  5M3F J;  5F04 A;  3JRF A;  2FX0 A;  2NS8 A;  1U9N A;  4UUT A;  2XB0 X;  4C2M J;  3Q0U A;  3BR1 A;  2GBY A;  3JRD A;  4QSH A;  2MSY A;  5F1J A;  2YS9 A;  2DA1 A;  2DMU A;  3LSR A;  2EZH A;  1Z0X A;  2QF7 A;  4XRS A;  1UHS A;  1ETV A;  1FIA A;  2DA5 A;  4MLO A;  5F0C A;  1RET A;  1A5J A;  1JT6 A;  1U78 A;  2QCO A;  4EEF G;  1UMQ A;  3DEW A;  5E3N A;  1U8B A;  1IC8 A;  2NVQ J;  2COB A;  3ZOB A;  5C3E J;  1VF9 A;  2ID3 A;  4BXX J;  1IDZ A;  1TWG J;  2ECB A;  3Q0W A;  4A3F J;  2L7M P;  5J1U A;  1PUF A;  2R5Y B;  1DU6 A;  3CMY A;  3PM1 A;  2Y31 A;  4DZP A;  1QRY A;  1VI0 A;  5FKL A;  4L5E A;  1Y1W J;  5C4J J;  4LOC A;  2FD5 A;  1TWA J;  1JT0 A;  1SAN A;  4D5F A;  3FKI J;  1WI3 A;  1ZR2 A;  3G1O A;  3W6V A;  3WHC A;  1ITY A;  3BR3 A;  1Q1V A;  2EBI A;  2JA8 J;  1I50 J;  2XB5 A;  1ETY A;  2XPV A;  1SFO J;  3HOW J;  4FE7 A;  1JTY A;  1K61 A;  3GTG J;  1RPW A;  3M4O J;  3PO2 J;  3MKL A;  2JMW A;  3BR6 A;  2ID6 A;  4BKX A;  4XRM A;  4FIS A;  4G12 A;  2JA6 J;  1F36 A;  1OCP A;  1ZTR A;  2LD5 A;  3GTO J;  4A3G J;  3FIS A;  4JX4 A;  5GPA A;  2XRL A;  5E3M A;  2PMZ N;  2L7F P;  2H1K A;  1T33 A;  2NS7 A;  3LNQ A;  3TP3 A;  4UUS B;  3PO3 J;  2JN6 A;  1MBG A;  5EDN A;  1ZK8 A;  1S7E A;  4M3E A;  3JRA A;  2M34 A;  2R93 J;  2TRT A;  2HYJ A;  2X6O A;  3A01 A;  3Q3S A;  3RQI A;  1O4X A;  3OSG A;  4DW6 A;  1E3O C;  2OPT A;  1JJ6 C;  2IAI A;  3HDD A;  1TC3 C;  1I6H J;  4RBO A;  4X6A J;  5J3L A;  3HGG A;  2RAE A;  2KDZ A;  5IP9 J;  3JR9 A;  4M3F A;  5IPA A;  4BY7 J;  4C3H J;  4XIC A;  5EGO B;  2NOG A;  3O8H A;  3BQY A;  2LFB A;  2R7Z J;  2FQ4 A;  2L7Z A;  2LK2 A;  3JRC A;  3L1P A;  2Y2Z A;  1CQT A;  2B63 J;  4IHY A;  1JKP C;  4MFD A;  5K7F A;  3BQZ A;  3BR2 A;  3IH2 A;  1IJW C;  1FTZ A;  1LFU P;  3BG9 A;  2DA6 A;  5F0F A;  5F08 A;  2X9D A;  1ETX A;  1FTT A;  2DMQ A;  1WH5 A;  3GTM J;  2JWT A;  4B4C A;  4BY1 J;  4IHX A;  3GTL J;  3K2A A;  4W1U A;  1LE8 A;  2VPR A;  1UG2 A;  4FCY A;  2R0Q C;  2DN0 A;  3O8G A;  1AHD P;  4AYB N;  2YU9 J;  3BG5 A;  3LSP A;  3JRE A;  4A3L J;  2E19 A;  3HOY J;  5F0H A;  2K40 A;  5E3L A;  3S2H J;  5EGO A;  3NAR A;  4A3D J;  3LOC A;  4JP0 A;  3D1N I;  4MO7 A;  4MIM A;  2WB1 N;  1G2H A;  3HBL A;  2M9H A;  1HF0 A;  2X48 A;  5E3O A;  1NTC A;  1MBJ A;  2R92 J;  2EZK A;  4IEJ A;  2JK3 A;  5FKO A;  4B3A A;  2W48 A;  4D5C A;  2L9R A;  5F27 A;  2TCT A;  1IV6 A;  1ZQ3 P;  1ETQ A;  1X2N A;  1B72 A;  4RDU A;  2NVT J;  2E2I J;  2M2E A;  1XC5 A;  5FJ8 J;  2HXI A;  1GV2 A;  2EQR A;  1A6I A;  2Y30 A;  5M5Y J;  3HOZ J;  5IOZ A;  2LY9 A;  3HB9 A;  2HOS A;  1NK3 P;  2R5Z A;  3GTP J;  1I3Q J;  3B6A A;  3FIW A;  5BNG A;  5EEA A;  5IYB J;  4DZJ A;  4X1E A;  4DYQ A;  4FTH A;  1H88 C;  4I76 A;  3A02 A;  2ME6 A;  5K7H A;  3FK7 A;  5M3M J;  1APL C;  2DJN A;  5IP7 J;  2LR8 A;  3JRI A;  3S1N J;  3JRG A;  1FIP A;  2MGQ A;  4GFB A;  2R5Y A;  1DU0 A;  1P7J A;  3S14 J;  4DYC A;  2LTP A;  3BR5 A;  2IBD A;  2OF7 A;  2M8G X;  5GP9 A;  3SJM A;  4DYR A;  3GBG A;  4A3B J;  4A3I J;  1GV5 A;  3ZQL A;  2CQX A;  2DA2 A;  3WHB A;  1OFC X;  1Z77 A;  2K9S A;  3JRH A;  3GTJ J;  3HGY A;  1MBF A;  3C2B A;  1GUU A;  1JUP A;  2FJ1 A;  1IG7 A;  2JJ7 A;  1Y1V J;  1JJ8 C;  3B6C A;  3UKG A;  1B8I B;  1F43 A;  1JKO C;  4JX5 A;  2E2H J;  4XRS G;  2L0K A;  5EG0 B;  3A01 B;  5IOY A;  2LLK A;  5EG0 A;  1ENH A;  5EF6 A;  3SFI A;  1LE8 B;  1ZKG A;  2VI6 A;  2H8R A;  1D5Y A;  2XPU A;  2HOT A;  3HKZ N;  3OIO A;  1R9T J;  3QPL A;  1HLV A;  5GPC A;  2XPW A;  1PUF B;  1HOM A;  4I6Z A;  3HOV J;  4XID A;  9ANT A;  1X2M A;  1IUF A;  3LSG A;  5M5X J;  2HXO A;  3OSF A;  2JA7 J;  1MH4 A;  2P81 A;  3BG3 A;  5DS9 A;  2N8G A;  3A03 A;  4M3G A;  4ABZ A;  4M6V A;  3QPS A;  1B72 B;  2DTZ A;  2Y0S N;  4JYK A;  2XSD C;  4HNV A;  3JRB A;  3S15 J;  4MFE A;  1JUS A;  2G0E A;  1JGG A;  4A93 J;  3RZD J;  3ZQI A;  5FKK A;  1GDT A;  1FJL A;  1OCT C;  2HOA A;  4BBS J;  2R5Z B;  4A3E J;  1IRZ A;  3DCF A;  3TP0 A;  4CYC B;  3IH3 A;  4D7N A;  3GTQ J;  1TWH J;  1MSF C;  2JA5 J;  2VKV A;  2AO9 A;  1MBH A;  3S2D J;  2HDD A;  5IP6 A;  3G1L A;  2DMN A;  3ZQG A;  4A3J J;  4A3M J;  2IEK A;  5K7Z A;  1W0U A;  2MG4 A;  4M3D A;  1LFB A;  5FLM J;  2K9Q A;  2ELK A;  1AKH A;  5FKN A;  1IGN A;  2Y9Z A;  2NVX J;  1XS9 A;  1WCM J;  4BBR J;  5M5W J;  3M3Y J; 
#chains in the Genus database with same CATH topology
 1HQC A;  2O9L A;  4EMS A;  3HSE A;  3ZQF A;  5JHU A;  3S1M J;  3WTW C;  2ISZ A;  2RV8 A;  4PFP A;  3HM5 A;  4GRI A;  1EV7 A;  5FFZ A;  3SFZ A;  2CWE A;  2ZNY A;  3WTT C;  3OYK A;  1DPR A;  5J1R A;  1OCO H;  5B1B H;  1T56 A;  1P7I A;  3I4M J;  1VQ7 I;  1JXS A;  2OQR A;  4P9F A;  2CV2 A;  1S8N A;  2WV1 A;  3H0G J;  1X1D A;  4B47 A;  5CPR B;  4HZF A;  5HS9 A;  2ZJQ F;  3K4C A;  3SYT A;  1ZLJ A;  5FKM A;  2DK8 A;  1BIA A;  3RKQ A;  4DJA A;  2VUM J;  1SAX A;  1OPC A;  2ZBK A;  3MD2 A;  2CMP A;  1WSU A;  1RES A;  3K7A J;  4PGG A;  4F52 A;  1BI3 A;  4Q5S F;  2KZV A;  3QU6 A;  3MQ0 A;  5ICG A;  3KX2 A;  3E5X A;  4OOI A;  4ASN A;  4G7Z F;  4UUS A;  3G1M A;  2P7C B;  2O8K A;  2W24 A;  3WG7 H;  5L3D A;  3CJT B;  3K69 A;  5H6Q A;  1ORK A;  3H9J A;  3FBI B;  4KIG A;  3VYU B;  1XMA A;  1YRN A;  4Y3O A;  1OIS A;  1WJF A;  3BC8 A;  1JTX A;  1I3A A;  2I8D A;  2CUZ A;  3V4G A;  5J1Y A;  2D1V A;  5F1R A;  1XG1 A;  5LGT A;  2DOA A;  3QOP A;  1VQL I;  3I4P A;  3TOA A;  3A2K A;  4FHT A;  3G6E I;  2JVH A;  2HFH A;  2K02 A;  1TNT A;  2CV1 A;  3RDI A;  5EZH A;  4KIC A;  3LFK A;  1D8J A;  2JPC A;  1B6A A;  3CMM A;  1BW5 A;  5ED4 A;  1GVD A;  3WU0 A;  1JGS A;  1O57 A;  4ZYG A;  2CJJ A;  2ZNZ A;  3EQL F;  3QYE A;  2A6T A;  2DA7 A;  2IJL A;  3CQZ J;  3QOE A;  2V7F A;  2VKH A;  3KPH A;  2ZB9 A;  3CUQ A;  2IP2 A;  3V7R A;  5JVT A;  3AAF A;  1RNL A;  3E7L A;  3TED A;  2ZXH A;  3CCS I;  1OLT A;  4II3 A;  2FF4 A;  4KIS A;  3S1Q J;  1PVE A;  2O7O A;  1FX7 A;  3GTK J;  1OYW A;  2LBF B;  4D0P A;  4KIB A;  4CYC A;  2PX9 A;  4G7O F;  2BY3 A;  4AC0 A;  4F55 A;  2G9W A;  1ETK A;  2OZ6 A;  3OOP A;  4HNU A;  2DLL A;  1TP4 A;  1XGS A;  3S3N A;  4AUX A;  1G59 A;  1HDP A;  2M4K A;  3GW2 A;  4LMY A;  4E70 A;  4V2F A;  4CCO A;  2KL4 A;  4YFN F;  1RKW A;  1QZE A;  2E36 A;  1ZRF A;  1RUN A;  4CA0 A;  3TW7 A;  3S17 J;  1VND A;  3HRU A;  5BQT A;  2E2J J;  1ZR4 A;  5C4X J;  1AA7 A;  2R7W A;  2GLO A;  1MMG A;  2LOO A;  3MWM A;  3VDX A;  1SC7 A;  5DTD A;  1EH8 A;  1TW3 A;  2V9P A;  2P7V B;  1U9N A;  3K70 C;  2LY2 A;  4C2M J;  3Q0U A;  3TBI A;  4BEH A;  3HOT A;  2YS9 A;  2JTV A;  1W5C C;  2V1D A;  3OS1 A;  2F2E A;  3KET A;  1D1A A;  2GA1 A;  1Z0X A;  4U87 A;  1IXR C;  1ETV A;  4MLO A;  5TRD A;  2JA2 A;  4RAY A;  4M74 A;  3G73 A;  2LYC A;  1A5J A;  1JT6 A;  2V26 A;  3FXO A;  3ONQ A;  4EEF G;  2E5Z A;  1UMQ A;  4U0V A;  4NBQ A;  2VAS A;  3ZR8 X;  3KP7 A;  1VF9 A;  1TTY A;  2YPR A;  3HYI A;  1WJB A;  3CD6 I;  1Z1D A;  2L5Q A;  1YW8 A;  1ZRD A;  1IDZ A;  1UST A;  2ECB A;  5EEG A;  1YLF A;  2L7M P;  1PUF A;  1OCR H;  1DU6 A;  2Y75 A;  5DCF A;  3H36 A;  3L2U A;  2Y31 A;  4DZP A;  1OCZ H;  1QRY A;  1HW1 A;  2K5C A;  1VI0 A;  1UFM A;  1O7L A;  2LKP A;  1MW7 A;  1Y1W J;  3DWL E;  3O2P E;  4LOC A;  4S04 A;  1TWA J;  5DDG A;  1JT0 A;  3RYP A;  4D5F A;  3FKI J;  1ZR2 A;  4D9J A;  3BCA A;  3W6V A;  4KA4 A;  2C6Y A;  3WHC A;  2ESN A;  4KYW A;  1U5T C;  3D5S C;  3OV8 A;  1ITY A;  3H5A A;  4L5I A;  1I50 J;  2WY7 Q;  2ZME C;  3QAH A;  2FU4 A;  1ETY A;  4BE1 A;  3HOW J;  5E1W A;  3NWS A;  1W7P A;  3GTG J;  2ZSI B;  3BR6 A;  1OYI A;  3EPZ A;  4UB8 C;  3OYC A;  4HDV A;  1K6Y A;  3CUO A;  5HOO A;  1J7K A;  4M6Y A;  3LQR A;  5FLX K;  1X4O A;  4PJL A;  3LL7 A;  2KPM A;  4IHS A;  4PUS A;  2ISY A;  5DM6 F;  3QYF A;  3ERM A;  2PMZ N;  3QRF F;  2KP6 A;  1SAU A;  4I0B A;  4BGD A;  1T33 A;  3HTS B;  3LNQ A;  3G4S I;  1MMA A;  3ABL H;  5FRO A;  4DGW B;  1MBG A;  5EDN A;  4LG3 A;  4M3E A;  2F5E A;  3IAM 2;  1XSD A;  2R93 J;  2TRT A;  1R5G A;  3K1M A;  4HG2 A;  2FSW A;  1JHF A;  3MEX A;  3FXR A;  3PUB A;  3WU1 B;  1E3O C;  2A05 A;  1JJ6 C;  2IAI A;  1TC3 C;  3VEP A;  3C1D A;  4RLQ A;  1B1B A;  1F4K A;  4C3H J;  3RKW A;  4LLG F;  4XQF A;  4XIC A;  5EGO B;  2NOG A;  2BE5 F;  2IA2 A;  4IQJ A;  3CCQ I;  3L7W A;  3JRC A;  2Q0O A;  4R79 A;  2B63 J;  4RAG A;  3FXJ A;  3A0H C;  2DFI A;  5K7F A;  4CYD A;  1IJW C;  4MQ9 F;  2WAQ A;  2A68 F;  2MBF A;  1LFU P;  3P9C A;  4AVZ A;  2P5L C;  2QUF A;  3I58 A;  4A0Y A;  5L3F A;  3E5U A;  1FTT A;  2DMQ A;  2HKX A;  2JWT A;  4UV9 A;  2HWV A;  3ABT A;  2M45 A;  3T8R A;  2GAU A;  4IRG A;  1PP7 U;  2R0Q C;  2HQN A;  3FF5 A;  3E5Q A;  3QYB A;  5CKT A;  1EH7 A;  4AYB N;  1E3P A;  3BG5 A;  4BJT A;  3AL0 C;  1YX5 A;  2K40 A;  4JP0 A;  1V55 H;  3D1N I;  3QP6 A;  3FHN A;  1USS A;  2BXY A;  4M9X A;  4L9T A;  3B02 A;  1GHC A;  3I56 I;  3I5U A;  3CMA I;  1HSJ A;  2LRD A;  5GAD J;  1WRJ A;  1SMT A;  3EUH C;  4B3X A;  5KCM A;  1B4A A;  2TCT A;  1W4M A;  2IGO A;  1IV6 A;  4BQQ A;  1LQ1 A;  3K2Z A;  1ETQ A;  3JSO A;  3ULQ B;  2NOJ B;  1X2N A;  1J9I A;  2WC2 A;  2E5N A;  1XC5 A;  2M2E A;  3DF8 A;  4BQO A;  5FJ8 J;  2WTE A;  5M5Y J;  3MKZ A;  3HOZ J;  3OYH A;  2ZCW A;  4NC6 A;  3DU6 A;  4E7I A;  2HOS A;  2GXB A;  3S8P A;  4BUP A;  4EGY A;  1SFU A;  2ZFW A;  4RS8 A;  2HQA A;  3B6A A;  4HPQ A;  3GF2 A;  1HW2 A;  2DOF A;  4DZJ A;  4X1E A;  4FTH A;  4BNC A;  3A02 A;  2ME6 A;  3M8E A;  2K4B A;  3K4J A;  1X1A A;  5K7H A;  4R1H A;  3OWT A;  3FBN B;  5DUK A;  1FIP A;  3M9A A;  2BY2 A;  5F64 A;  4CCN A;  2DFE A;  2XKO A;  2W57 A;  3DLA A;  4B48 A;  1LEA A;  2MD5 A;  2IPQ X;  2V1N A;  3SJM A;  1SFX A;  3S3M A;  5JHF A;  2CGP A;  3GBG A;  2EFQ A;  4KJZ A;  1QBJ A;  2E71 A;  3F8N A;  4EJU A;  2H6C A;  1T0F C;  1B9N A;  3C2B A;  2Y69 H;  2XRN A;  1IG7 A;  1JJ8 C;  1LDD A;  2E2H J;  3C18 A;  3I54 A;  3L2W A;  2R7F A;  3BJO A;  2EA2 A;  4EVI A;  2DW4 A;  1VTN C;  4G8X A;  3A0B C;  1MDM A;  2Q8K A;  1IUY A;  3LSI A;  3TDZ C;  3QP5 A;  1FOK A;  2H8R A;  1D5Y A;  4ZDP A;  5K5O A;  2RQP A;  2HOT A;  1O7F A;  3QPL A;  4DBR A;  2A5W A;  3K4M A;  5L3G A;  2LF7 A;  1Z7L A;  1R22 A;  1X2M A;  1XX5 A;  4Q4Z F;  3OSF A;  2V4J C;  4RM2 A;  1MH4 A;  2P0W A;  2YX7 A;  4RMN A;  2VIX A;  4M6V A;  1B72 B;  2DTZ A;  2Y0S N;  2QBY A;  2K4J A;  5BS6 A;  2E7X A;  4IXA A;  3SEZ A;  2E1N A;  3K0L A;  1JUS A;  2QKM B;  1JGG A;  2X1D A;  1S7A A;  2AXT C;  3ZQI A;  1GDT A;  1FJL A;  2P6S A;  4BBS J;  2HOA A;  1ZLK A;  2B0L A;  4A3E J;  3H5N A;  4OMY A;  3OR1 C;  4CH7 A;  2DO7 A;  3IKV A;  4RM3 A;  2A61 A;  4ON0 A;  4DNC A;  3GTQ J;  4FT8 A;  1YIJ I;  2JPB A;  2VQG A;  3DFG A;  2VKV A;  1MSF C;  1ZRE A;  1YOV B;  3AFH A;  5IP6 A;  1LFP A;  2DPD A;  2H8W A;  1MJ9 A;  1KQ0 A;  3KIO A;  3CP8 A;  1W0U A;  3HPH A;  4CHU A;  2GXA A;  1LUJ B;  2MG4 A;  3J7Z I;  1XN7 A;  4M3D A;  2A5Y B;  1LFB A;  4Z2Y A;  5FLM J;  3FZV A;  2ELK A;  5FKN A;  3PIO F;  1XS9 A;  1YS7 A;  2OD5 A;  4GGG A;  4BBR J;  1KYW A;  3A4C A;  4ZYH A;  3TOB A;  3CCM I;  2BEO A;  1D5V A;  4A69 C;  1KQ8 A;  4H0E A;  3HHG A;  1JKQ C;  2OQG A;  2CFO A;  1LDK B;  5IYC J;  1ON2 A;  1SD4 A;  3Q0V A;  2M8E A;  2MH9 A;  2ZJP F;  3F22 A;  1U8R A;  3CCJ I;  2IGN A;  2OC6 A;  2R7D A;  2R3S A;  1MJB A;  1YRN B;  2D5V A;  4RLF A;  5IYD J;  2PMZ A;  2F48 A;  1WH7 A;  2LG4 A;  3C3W A;  2DA4 A;  4LLL A;  5JLX A;  1RZ4 A;  1LJ9 A;  1MSE C;  4G6D A;  2UXX A;  3BTI A;  3J81 K;  3FWE A;  1F1Z A;  4F91 B;  5DM7 F;  3S3O A;  2MW8 A;  1BL0 A;  4LLN A;  3ZMS A;  1BR4 A;  2L9V A;  3U1K A;  1ZAO A;  4XON A;  2QQ9 A;  3K70 D;  2KRC A;  2F4M B;  1ERD A;  2EH3 A;  3D5R C;  2CUF A;  3KZI C;  2UZK A;  1XDS A;  2CW7 A;  2HR3 A;  1U6G A;  4M3B A;  2M0C A;  2EB7 A;  4M72 A;  2WB1 A;  5J40 A;  3OYF A;  1L3L A;  5HOD A;  4WK8 F;  2X4H A;  2WAE A;  3G3Z A;  3WGI A;  4Y52 J;  4V2G A;  3OYG A;  1QVT A;  1P4A A;  4E7J A;  3SZT A;  4UVA A;  1S5L C;  2VE9 A;  3DXJ F;  3SDG A;  4X0G A;  2KDO A;  5E1X A;  4AIJ A;  1MBE A;  4ENK A;  4ENJ A;  3GZ5 A;  3GVA A;  2FOW A;  4QIW N;  3TO6 A;  1MNM C;  2E1O A;  3K4L A;  3NAU A;  2Y9Y A;  3Q9V A;  1FYL A;  2O5R A;  1W5T A;  2O3F A;  4J19 A;  3HTU A;  2DTR A;  2V6C A;  3IAS 2;  1FBU A;  1GT0 C;  3CCY A;  1RR8 C;  2D2W A;  5E8I A;  3DBL B;  3SEQ A;  2CYY A;  5E18 F;  2XAU A;  4XOR A;  3TQN A;  4IHV A;  3SHF A;  2KKO A;  4W97 A;  4ZTJ A;  4JK1 X;  3WTU C;  1NK2 P;  1P4W A;  1P4X A;  3NEU A;  2IGM A;  1QU3 A;  3QQA A;  3UNG C;  2KMU A;  5CLS A;  4MGR A;  4XN3 A;  1G8X A;  4HRI A;  1E3H A;  5J4Y A;  2I10 A;  2M0M A;  3ESW B;  5HLH A;  5D5V B;  1E0E A;  3QOD A;  3BTC A;  4ZYE A;  4BJ6 C;  3PSI A;  1ETO A;  3HEF A;  1TNS A;  2ME0 A;  5TGT A;  4YEL A;  4HQE A;  2DFH A;  3CF5 F;  1I27 A;  2E60 A;  5KHD A;  1U9O A;  3ML6 A;  4XM3 A;  1HC8 A;  2BW3 A;  3KYL A;  3DPU A;  5ILU A;  3GZN B;  2VQC A;  4LD5 A;  1P2F A;  1WPK A;  4EQQ A;  3OS0 A;  3HOX J;  2XC7 A;  1TWF J;  1GXQ A;  1Y56 A;  1ZN2 A;  2DT5 A;  2Z3Y A;  3F9K A;  2EFP A;  2BYV E;  1A04 A;  2Y0M A;  2GZW A;  4MHG A;  3JRF A;  2OTL I;  3BR1 A;  4XSX F;  3P9K A;  2P8T A;  4RGR A;  1H0M A;  4IVN A;  2EPF A;  4E7L A;  2O0Y A;  1WHU A;  3LSR A;  4PK4 A;  2V6E A;  4WXD A;  1UHS A;  2X85 A;  3JAM K;  2JSP A;  3IRR A;  5ICE A;  3BWG A;  2VB6 A;  1HXD A;  1FSE A;  3F8M A;  4AD9 A;  5FB2 A;  5E20 A;  3C7J A;  2FXA A;  4LGW A;  1K4T A;  2A07 F;  2MAB A;  2ZME A;  3WTX C;  3KCC A;  4M6X A;  3OY9 A;  3F3X A;  5E3N A;  2NS0 A;  2NVQ J;  2COB A;  2KRF A;  5J6X A;  2ID3 A;  4P1W A;  2FUG 2;  4BXX J;  1ZG1 A;  2X6W A;  2PJP A;  3DKY A;  2E7W A;  1XCV A;  3ABU A;  5J1U A;  4EJW A;  3CMY A;  4TV7 A;  1YIO A;  3KZY A;  3I3L A;  5FKL A;  3M8J A;  4ETS A;  5LHI A;  2XHK A;  2XAQ A;  3NWT A;  4E7H A;  2WY8 Q;  2QSF X;  2ZXW H;  2FD5 A;  3CES A;  3LSK A;  3HOS A;  3I71 A;  1AWC A;  1TT0 A;  3DEE A;  1G3Y A;  2NRA C;  4OAY A;  1ON1 A;  3F8C A;  1FOW A;  1ACI A;  2DQR A;  1B59 A;  3MZH A;  1ZRC A;  3BR3 A;  3NRV A;  1PJR A;  2EBI A;  2JA8 J;  4EV0 A;  4G6T B;  2DJI A;  1WJD A;  2XB5 A;  3PFY A;  4QPO A;  4RB0 A;  4LG0 B;  1J2X A;  5K1Y A;  1UHW A;  2DYS H;  2MD0 A;  2IW5 A;  2OZU A;  1EKE A;  2QKL B;  3MKL A;  3PO2 J;  3M4O J;  3FM5 A;  1MJA A;  2ID6 A;  2RDP A;  2M4G A;  3JCU C;  1RI7 A;  2BZT A;  1F36 A;  1QZZ A;  4ITV A;  1MNE A;  4JX4 A;  3RYR A;  2KFD A;  4P5O A;  4CCK A;  1Y0N A;  1H9T A;  2ELH A;  1R1T A;  1W5S A;  2FE3 A;  4RGU A;  4CCJ A;  5LGN A;  3W6J B;  1TQI A;  2QQA A;  2H1K A;  2EIJ H;  3P7N A;  3TP3 A;  3PO3 J;  2M7B A;  4KIT B;  4KUM A;  1M1E B;  4M9Z A;  3L09 A;  4OU0 A;  2M34 A;  2HYJ A;  2HKO A;  4I02 A;  2H09 A;  4N4N B;  3OIP A;  4AID A;  3RQI A;  3L9F A;  2XKP A;  2I5U A;  4M71 A;  3F21 A;  4A5M A;  2OPT A;  4CZC A;  3HSR A;  3HDD A;  5DCM A;  2NYX A;  4NHJ A;  3MMY B;  3FDY A;  5ICF A;  4N9I A;  3BOQ A;  4X6A J;  1MD0 A;  3E0J B;  1K6O A;  2RAE A;  2KDZ A;  3WOD F;  3DEU A;  2M1B A;  3DPT A;  1WWX A;  2ZO4 A;  5AIP A;  3BQY A;  2LFB A;  1QHH D;  2LK2 A;  4C30 A;  2XAH A;  1ZG3 A;  2LKS A;  3OYL A;  2ZKZ A;  1LEB A;  1WI9 A;  3BQZ A;  3CJN A;  4ANJ A;  2D45 A;  2VPL A;  3NQO A;  1SEU A;  4HAM A;  2KLO A;  2RN7 A;  5F08 A;  3CDH A;  2GQQ A;  4NB5 A;  1FC3 A;  1DQU A;  3S32 A;  5FRM A;  5A2Q Z;  4KMF A;  5HDN A;  3MAJ A;  4QWQ A;  3WGH A;  3LSM A;  3TKY A;  4BY1 J;  3K2A A;  2R4G A;  2VPR A;  2VN2 A;  2X51 A;  3HRM A;  2DN0 A;  3L2C A;  3O8G A;  1A31 A;  2O03 A;  1NH3 A;  1AHD P;  2YU9 J;  4I7H A;  4AU7 A;  4UNO A;  3WG9 A;  2BXZ A;  3ROU A;  2OU2 A;  2ZME B;  2A6E F;  1HBX G;  4EJV A;  3HJE A;  4FQG A;  4UVC A;  2LDU A;  1FSH A;  4OIN F;  1MMN A;  3LA3 A;  2GXG A;  3KYD B;  3OYN A;  1G6N A;  1MKM A;  2HNH A;  3P5J A;  3R0J A;  2CW0 F;  2DQL A;  4LB6 B;  4U0Y A;  3J7A O;  4OIQ F;  1E17 A;  2OBP A;  2M9H A;  1IN5 A;  2X48 A;  3OYB A;  3CUQ C;  2PJR B;  1IF1 A;  2X1C A;  3CO6 C;  4IEJ A;  4M73 A;  2LY1 A;  2VQH A;  2OCE A;  2VE8 A;  2W48 A;  5F27 A;  5FO5 A;  2PMH A;  3K9T A;  2KIQ A;  2HGC A;  2Q2E A;  2DT7 B;  2OUM A;  1T0F A;  4GYI A;  5B66 C;  2PEX A;  3LA7 A;  2K7L A;  2JRM A;  1FP2 A;  2E2I J;  1I39 A;  1GV2 A;  2KJC A;  2NNY A;  2BBY A;  2Y30 A;  2LY9 A;  5CVR A;  5HS8 A;  1FP1 D;  3FM3 A;  4EM1 A;  3HRS A;  3ASN H;  3CDI A;  3FIW A;  1GVJ A;  1QGP A;  1BI1 A;  4FAS D;  3M8F A;  4AIH A;  1F9N A;  4I76 A;  1G3W A;  3E1S A;  2EFW A;  2JT1 A;  1IN6 A;  4KIF A;  4HOB A;  5M3M J;  5K5R A;  3GZ6 A;  3DP7 A;  5IP7 J;  1O3Q A;  5DD8 A;  1C0W A;  3S1N J;  3JRG A;  5GTI C;  1XDU A;  2MGQ A;  4CCM A;  2R5Y A;  3S14 J;  1T98 A;  3BPV A;  4UY8 I;  4RA2 A;  2VBX A;  3T5X A;  2Z1D A;  4G6Q A;  1I1G A;  3J80 Z;  4S05 A;  1P9Q C;  2O8X A;  5CVJ A;  1BJA A;  4DYR A;  4A3B J;  2VKD A;  3WHB A;  4HA8 A;  4OMZ A;  3N97 A;  2K9S A;  4PZJ A;  3JRH A;  1I5Z A;  3IWF A;  1IXC A;  1JUP A;  2K85 A;  2FJ1 A;  3BDD A;  4RGS A;  3AG3 H;  4CXF A;  1B8I B;  1MMS A;  3B6C A;  2FQ3 A;  2F4O B;  4XRS G;  2YX4 A;  3E6M A;  1V5E A;  2XAJ A;  3VB2 A;  5IOY A;  2LLK A;  1ENH A;  1T38 A;  4HLY A;  2DK5 A;  4HBL A;  2OTJ I;  3L00 A;  1A6Q A;  2IS6 A;  2FMY A;  1VQ6 I;  1QZY A;  2XVC A;  3HKZ N;  3P9I A;  1T2K A;  1HLV A;  1PUF B;  3H5R A;  1DP3 A;  5B3S H;  3KEQ A;  1R23 A;  3GXO A;  4PFO A;  1G4D A;  3ZQ7 A;  4HLX A;  1IUF A;  1TQM A;  3LSG A;  5M5X J;  2QSG X;  4KMU X;  3KFW X;  2WBM A;  3CTA A;  2P81 A;  3BG3 A;  5KVR A;  3W2W A;  1IW7 F;  4M3G A;  3DV8 A;  2CV0 A;  4IJA A;  1SVO A;  1Y0U A;  4JYK A;  4A6D A;  2FNA A;  4IHT A;  1DDN A;  2CQK A;  2HPI A;  2K86 A;  3M7G A;  3KLO A;  4OAZ A;  4MFE A;  1YO5 C;  3KE2 A;  1NHA A;  3I59 B;  3K4N A;  5TJJ A;  3RZD J;  3SXY A;  4HF1 A;  2R5Z B;  3DCF A;  3TP0 A;  2W7N A;  2RGV A;  2EV5 A;  1VQN I;  4D7N A;  4WCG A;  4XKV A;  2VOO A;  1PP8 F;  3S2D J;  4L0Z B;  1S29 A;  3LAJ A;  2DMN A;  4A3J J;  2XF5 A;  4ZZL A;  4O6J A;  3LFU A;  1JE8 A;  1V4R A;  5D6E A;  3WE2 A;  1KQ9 A;  2K9Q A;  1AKH A;  5CJ9 A;  1IGN A;  2Y9Z A;  2NVX J;  1WCM J;  1WFX A;  4V19 K;  2XGD A;  1K78 B;  1BW6 A;  1W7P D;  1UEL B;  2CH0 A;  2EZL A;  4C3I J;  1J75 A;  5CVU A;  3J7Y J;  1JI8 A;  5KAF C;  4L18 B;  1J59 A;  4XLE A;  1QPI A;  3ZGK A;  2PJR A;  2GM4 A;  4BQN A;  4Z6Y A;  1R49 A;  3F8F A;  1EA3 A;  1BBY A;  3D5L A;  3W2V A;  1R4N B;  4GDF A;  1TZL A;  1H8A C;  5GTH C;  1U0J A;  2F5F A;  3I4N J;  1BC8 C;  4YFK F;  2AHQ A;  4P9U A;  4AWX B;  4FE4 A;  1XGO A;  4H4K C;  1KA8 A;  1PYV A;  5HDK A;  3OYD A;  1YG2 A;  2XGC A;  3ZQQ A;  3HUG A;  5C44 J;  2QQB A;  5JLW A;  3GFL A;  1OR7 C;  2F5V A;  1FMV A;  2K3F A;  2V79 A;  2DI3 A;  3RZO J;  4N0B A;  4D7M A;  1RUO A;  1TWC J;  5JI6 A;  1XB4 A;  2HTJ A;  3IKT A;  3S1R J;  1X1P A;  1XGM A;  1HKS A;  3FK6 A;  3K6G A;  1QHG A;  5EJC A;  4XLN F;  3IH4 A;  3BTJ A;  5D5W B;  1TW2 A;  6PAX A;  1BI0 A;  3PNY A;  1Y8R B;  2DPU A;  4IHW A;  3MKW B;  2AQE A;  1WKM A;  4PSW A;  1KU9 A;  2MLK A;  1J5Y A;  4XKW A;  2HQ5 A;  2Z99 A;  2VJ4 A;  3GUD A;  5ILS A;  3F6V A;  1XTA A;  3M1C A;  3CJQ B;  4XL9 A;  4ZH4 F;  1POG A;  4S0H B;  1AU7 A;  4AYB A;  2XV4 S;  4CSW A;  3HL2 A;  5FD5 A;  1HCR A;  2CW8 A;  2K9N A;  1B8I A;  5IY5 H;  3K1N A;  1MND A;  2NVY J;  3T0Y A;  2BVM A;  3D0S A;  4BDZ A;  5IT9 K;  4UXN A;  3F8B A;  2DU9 A;  3RPU A;  2LF8 A;  1IN8 A;  3MZ8 A;  4BHP A;  1MBK A;  2W1O A;  3GME A;  2ECC A;  2XAG A;  4XMY A;  4M9S A;  3ZMT A;  4FX4 A;  5EYR A;  1VZ0 A;  2RVC A;  3BG6 A;  1Y8Q B;  1V5F A;  5CVV A;  4NDL A;  3ERE D;  3CCU I;  4E7S A;  1STZ A;  3WTS C;  2XGE A;  2KIS A;  3CC2 I;  1RRJ A;  3BT9 A;  3EDP A;  3M07 A;  1QVU A;  2CUE A;  4HQM A;  3H3U A;  3MFK A;  1ZGW A;  3EUH A;  4WWC A;  2P5V A;  1WQ2 A;  4K2E A;  4JX6 A;  3RPQ A;  2VOD A;  2LKX A;  1N77 A;  2VL8 A;  2DDB A;  2X6Y A;  2AXL A;  3ZN1 A;  3ZQC A;  3I9V 2;  3QPT A;  2CRG A;  4OIR F;  1KYZ A;  2COM A;  3H0D A;  1FEX A;  1OYY A;  1X3U A;  1OQY A;  3HOU J;  3V42 A;  3CDL A;  3ZQH A;  2D1H A;  1JKR C;  2MC3 A;  3RCO A;  4HST A;  4LIU A;  3J7A Y;  1MIJ A;  3W6K B;  2M87 A;  3ISP A;  4PJJ A;  3LSJ A;  4WXH A;  2DA3 A;  4XK4 A;  3BR0 A;  2HI3 A;  4QTR A;  3VYS B;  2EA4 A;  5M3F J;  2FX0 A;  2FA5 A;  2GA2 A;  2NS8 A;  4UUT A;  2XB0 X;  4L0Y B;  1WJ5 A;  1TT5 B;  3OL4 A;  4Y15 A;  2HVS A;  2JUC A;  3G71 I;  2MSY A;  1V54 H;  3R61 A;  1VQP I;  3F72 A;  3R6S A;  2YSR A;  3IWZ A;  3U1D A;  2MC4 A;  2DMU A;  3ABM H;  3AG1 H;  2EZH A;  5BMZ A;  2P6T A;  2EFN A;  5D5U B;  1TLH B;  2EK5 A;  3VSL A;  1IRF A;  2W82 A;  4EGZ A;  1FIA A;  3LST A;  2FML A;  3DKX A;  2EIK H;  1RET A;  1F5T A;  3OIQ A;  3PQJ A;  5HNF A;  3TO9 A;  1Z67 A;  3W3C A;  3DEW A;  1BM9 A;  1U8B A;  1IC8 A;  3S2W A;  5C3E J;  2GOM A;  4YFX F;  3ABK H;  5IT3 A;  1WVR A;  4BE0 A;  2MH2 A;  3EUK L;  1TWG J;  3Q0W A;  4HNT A;  2L4A A;  3ASO H;  4OWR B;  3DTE A;  4I0A A;  1LNW A;  3H3Z A;  2R5Y B;  1WJA A;  3K1P A;  4BAC A;  2DBB A;  3IRQ A;  1UCR A;  3BZ6 A;  4DBQ A;  2WAD A;  4ESB A;  4ZJZ A;  2Z33 A;  2O61 A;  3LMM A;  5C4J J;  1GXP A;  2QBY B;  2ACJ A;  1WZ2 A;  5GAE J;  1WI3 A;  2BY0 A;  2WA0 A;  2R7Q A;  3HRT A;  4ZYD A;  3LAP A;  3QU3 A;  1YJW I;  2E1M C;  3FMR A;  2HS5 A;  3HPG A;  2QGU A;  4RAZ A;  3I53 A;  3PJR A;  1R5I D;  3TMO A;  3VWB A;  5BPD A;  4UV8 A;  1G3S A;  1X1B A;  2VT2 A;  2HVQ A;  4I01 A;  2PG4 A;  2L01 A;  2HYG D;  2XPV A;  3MZY A;  4LIV A;  2RKH A;  4FE7 A;  5EEH A;  5TIS C;  1JTY A;  1K61 A;  4UHT A;  1JHH A;  2F6C A;  1TBX A;  3K10 A;  3U9G A;  5CYV A;  2KIM A;  1RPW A;  5DCM B;  3RTR A;  4EM0 B;  4P55 A;  2JMW A;  4BHB A;  4HDU A;  2QEN A;  1Z6T A;  5E1Z B;  4FIS A;  2LH9 A;  1XMX A;  4G12 A;  2FBK A;  4EJT A;  3GTO J;  4BEH B;  1X4P A;  4A3G J;  3FIS A;  1G3T A;  4FX0 A;  1Z7U A;  5LFA A;  5AIQ A;  2FBI A;  4WF2 A;  5E3M A;  3ZN0 A;  3OS2 A;  1YS6 A;  2GOX B;  3L2V A;  3WE3 A;  2E1C A;  4XKB A;  3TO7 A;  2VT3 A;  1LB2 A;  1A36 A;  2IVM A;  1ZK8 A;  2O6G E;  4ZYA A;  2LSO A;  2X6O A;  3OYM A;  3BJ6 A;  1R36 A;  3Q3S A;  3ZXS A;  3VOE A;  1D0X A;  3AL0 B;  1O4X A;  4DW6 A;  1I6H J;  4CIC A;  2IS1 A;  1BI2 A;  4MNU A;  1IAW A;  2V9V A;  5ERI A;  4RBO A;  5J3L A;  5IP9 J;  4IOC F;  1S6L A;  1BOB A;  1XSX A;  3VOD A;  2XRO A;  4M3F A;  5IPA A;  3JR9 A;  1D1B A;  3OYE A;  3O8H A;  2AS5 F;  2UV1 A;  2CO5 A;  2IS4 A;  4KNY A;  3IHU A;  3RI4 A;  1SFK A;  2L4M A;  3L1P A;  5DUI A;  1YJ9 I;  3PNT A;  5HNH A;  1CQT A;  1ONV A;  3FXK A;  4IHY A;  2NXN B;  4MFD A;  4YIR X;  1I1S A;  1VQK I;  5ICC A;  1FLI A;  3BG9 A;  4LFU A;  4XOT A;  1K4S A;  4HF0 A;  3ZMD A;  4ENN A;  3GX4 X;  2X9D A;  3R0A A;  2JZY A;  4IQ4 A;  2OAZ A;  5D8L B;  2HU9 A;  4Y4R A;  4C2T A;  2Y0S A;  3QPH A;  1HKT A;  4B4C A;  5CQE A;  3GLL A;  1QO0 D;  4BS9 A;  4ZTF A;  1LE8 A;  2NNN A;  4KN7 X;  2QLZ A;  2R7R A;  3IL2 A;  2B7E A;  1UB9 A;  2XF6 A;  3DPL C;  1FOX A;  4UVB A;  4ZDL A;  5D4R A;  3JRE A;  4A3L J;  2UWM A;  2E19 A;  5CVI A;  3BJA A;  3ECH A;  3LQQ A;  5F0H A;  3WTV C;  3JSP A;  3HOY J;  3OYJ A;  1T08 B;  1P92 A;  3FXQ A;  4LK0 F;  4PDK A;  4YEJ A;  3TL4 X;  5E3L A;  3GEZ A;  1U3E M;  4CCL A;  3J80 K;  1KGS A;  2BHY A;  4MO7 A;  2QEX I;  4B8X A;  3SZG A;  4KFC A;  2WB1 N;  1G2H A;  3O6B B;  3E6C C;  4MTE A;  4II2 A;  5GAG J;  5IT9 Z;  4G7H F;  3F23 A;  4QPQ A;  3HBL A;  3LA2 A;  1HF0 A;  4G9Y A;  1NTC A;  1MBJ A;  2CG4 A;  2R92 J;  5FKO A;  4EM2 A;  4NQW A;  5KAI C;  3QWL A;  4PCQ A;  1ZQ3 P;  3R4K A;  1K7A A;  3OR2 C;  1UHM A;  3X2Q H;  2LBF A;  2W84 A;  1B72 A;  2QVO A;  4RDU A;  5JR3 A;  1IV8 A;  1GLN A;  4I99 C;  2HXI A;  5GAH J;  1OCC H;  2EJR A;  2B9S A;  3KP4 A;  4IL6 C;  1O3T A;  3HB9 A;  1NK3 P;  2VBY A;  3E6D A;  3GTP J;  3ZMV A;  2L2O A;  3FMS A;  5BNG A;  4JQF A;  5EEA A;  2CSO A;  1T6S A;  3JTH A;  3C2H A;  5IYB J;  4DYQ A;  3M1E A;  1H88 C;  1VQ9 I;  4HSR A;  4NC7 A;  3IUO A;  4QLC U;  4ESF A;  2MLG A;  3FK7 A;  2FBH A;  2DJN A;  1V3F A;  2G7H A;  3EYY A;  2IRF G;  4GFB A;  3DKW A;  2CUJ A;  4DYC A;  2LTP A;  1BOA A;  3BR5 A;  3ZMU A;  3FXM A;  2OF7 A;  2M8G X;  5GP9 A;  1Z05 A;  2K9L A;  2Y48 A;  2EIL H;  4A3I J;  2MFZ A;  1KU3 A;  3ZQL A;  2CQX A;  2DA2 A;  1OFC X;  1NG7 A;  1Z77 A;  4YRV A;  1J09 A;  3GTJ J;  1PUE E;  2XIG A;  3FKJ A;  3PIP F;  1Y1V J;  3R60 A;  3O3K A;  2PMU A;  4JX5 A;  3H1C A;  1SVM A;  2R7V A;  2L0K A;  5EG0 B;  5J8C A;  5EG0 A;  1YX3 A;  3GFJ A;  2ZXJ A;  4MEY F;  3K4B A;  4UUV A;  2VI6 A;  4EAT A;  1IXS B;  3CO7 C;  3CCL I;  1D0Z A;  3RJP A;  3KZZ A;  5HLT A;  3VYT B;  4BDY A;  2BVL A;  3OIO A;  3Q9S A;  1R9T J;  4DIQ A;  5GPC A;  2XPW A;  1HOM A;  4N9H A;  2DT6 A;  4XID A;  1ZAR A;  4BXF A;  2BY1 A;  3V8L A;  3V8K A;  1FY7 A;  4EJO A;  4YIF A;  1IRX A;  1W36 D;  4IRI A;  4O3M A;  1ZH5 A;  2YR2 A;  3AKZ A;  2HXO A;  4XLC A;  3GLX A;  2IA1 A;  5HS7 A;  5DS9 A;  3A03 A;  1TQP A;  4IOA F;  3L2Q A;  4YII A;  3QPS A;  4JBA A;  3FXL A;  1FWZ A;  2W00 A;  4HX7 A;  3H92 A;  1YE9 A;  4B09 A;  1FYM A;  3CJR B;  2XSD C;  1W36 C;  4RB3 C;  1TL8 A;  3I55 I;  4A2U A;  2F5C A;  3S15 J;  3LWF A;  2G0E A;  1CGP A;  4OIP F;  1IRZ A;  4CYC B;  5FGM A;  3IH3 A;  4HV5 A;  4RAF A;  1FMW A;  3N4M A;  4A0Z A;  5JFR A;  3ZRG A;  4LG0 A;  2XDV A;  2JA5 J;  1MBH A;  2J5P A;  2J5O A;  3MKY B;  3G1L A;  2H6B A;  3OMY A;  2EIM H;  1Z6R A;  1FNN A;  3K4K A;  3SQN A;  4A3M J;  2KIF A;  4D1Q A;  2IEK A;  1UZC A;  1N78 A;  2BOL A;  4HW0 A;  3ZP5 A;  3N05 A;  1HA8 A;  1ZGJ A;  4E6K G;  5M5W J;  2JUG A;  3CLQ A;  3W2A A;  4BJ5 C;  1REP C;  3RPU D;  4UB6 C;  2YUS A;  2PQ8 A;  1UG0 A;  1KON A;  4E4H A;  1T8I A;  1D3Y A;  2A6H F;  3IV5 A;  3PQK A;  1ZG5 A;  1VQ5 I;  1OMI A;  5D6F A;  2WWY A;  2F5D A;  1LKX A;  5L3B A;  1BJZ A;  4HF2 A;  2XGX A;  2L3D A;  1BA5 A;  3KP5 A;  4C9Y A;  2ZJ2 A;  3GFM A;  2DMT A;  2RQQ A;  2XAS A;  1YW7 A;  1YI2 I;  1MH3 A;  4C2U A;  1OJL A;  3EET A;  3COA C;  2K9M A;  3ZMZ A;  4PGH A;  3RIR A;  2DYR H;  4L9V A;  3CCR I;  2DOD A;  1EH6 A;  2DMP A;  3PUF A;  2EZI A;  2GIZ A;  4I2O A;  3TDU C;  4E7Z A;  1EF4 A;  2A69 F;  5H2F C;  1VQ8 I;  1BR2 A;  3ELK A;  2EIN H;  3H3V K;  2H94 A;  2JQ7 A;  1YYV A;  3BCB A;  2W85 A;  3HXL A;  4AM3 A;  1JUM A;  4XN0 A;  2H27 A;  1WJC A;  1X1C A;  2KIU A;  2XUB A;  2NAZ A;  2QA4 I;  5CQG A;  3G2B A;  3OYI A;  2OA4 A;  2M5W A;  2ICW G;  1SD6 A;  2VON A;  1RKT A;  5EZG A;  2LNB A;  4CO8 A;  5FLV A;  1D8K A;  3UR3 C;  2CU7 A;  3ZCO A;  2ESH A;  3RQ4 A;  3REO A;  3PNV A;  2CQQ A;  1IDY A;  1D1C A;  1K83 J;  3I59 A;  1HDD C;  1OKR A;  4A3K J;  2LP0 A;  1RR7 A;  1O3R A;  4Q47 A;  3KP2 A;  3TW6 A;  4XR6 A;  4C3J J;  3V8J A;  3MN2 A;  1SVL A;  2K3P A;  5LRS A;  5BOX A;  3MVP A;  4MEX F;  2X1E A;  4R8H A;  1LPQ A;  1I6X A;  3F0C A;  1RIO H;  1ETW A;  2WAQ N;  4B1R A;  1XD7 A;  4L9J A;  4XLP F;  1H89 C;  4BXU A;  3E3V A;  1XGN A;  1IZ1 A;  5D4S A;  2FNP A;  1WGX A;  4P96 A;  2QWW A;  2PBI A;  4DQ2 A;  2M7A A;  5JVG F;  4BHC A;  3U21 A;  1IRG A;  5J47 A;  2VXZ A;  5FRN A;  4HX8 A;  2VJI A;  4Y7N J;  3BRO A;  3Q5F A;  4GO1 A;  1K78 A;  2LVS A;  2VC0 A;  2AQF A;  1E2X A;  2UUZ A;  1XCB A;  1ZEL A;  3BPX A;  5A2Q K;  1S7O A;  2KT0 A;  3DQV C;  1X58 A;  2PFB A;  2VKE A;  3BTL A;  1Z9C A;  3WTZ A;  3VPR A;  2F4I A;  5LHG A;  4Q48 A;  2FEZ A;  4KN4 X;  4ZC3 A;  3AG4 H;  3VSK A;  1W0T A;  4PJM A;  4XLA A;  1XPX A;  2UXN A;  1AKH B;  1K79 A;  4A3C J;  1IN7 A;  1Y6I A;  3CC7 I;  4AVP A;  3S16 J;  1VFC A;  4A0X A;  2IA0 A;  2RNJ A;  3OL3 A;  3DTI A;  3PFI A;  5H6R A;  3CUQ B;  3DBH B;  4IKF A;  3V7S A;  2HDC A;  3OOU A;  2EFO A;  2L9S A;  4MQV A;  4PJ0 C;  1HST A;  1LDJ A;  5F04 A;  2HYF A;  2L54 A;  3BP8 A;  3EYI A;  2GBY A;  5L3C A;  3JRD A;  4QSH A;  4RGX A;  2JVG A;  2P5K A;  5F1J A;  1D0Y A;  3I0T A;  2DA1 A;  2HOE A;  1KU7 A;  1UAA A;  2QF7 A;  4XLF A;  4XRS A;  4A12 A;  2DA5 A;  2K27 A;  5F0C A;  1SMY F;  3HUG B;  1KZH A;  1U78 A;  2QCO A;  3BLY A;  5LEK A;  1FZP B;  5D8K B;  2RRE A;  4XBF A;  1X19 A;  1YHQ I;  3ZOB A;  2VBZ A;  2ZSH B;  5DEQ A;  4I09 A;  3OYA A;  5KNL A;  4Y13 A;  2XF7 A;  4Y33 A;  1B9M A;  4A3F J;  3GWZ A;  2ZJR F;  1YFH A;  1R1V A;  2STW A;  3KP3 A;  1VQO I;  3PSF A;  3PM1 A;  3CCE I;  5K5Q A;  1YJN I;  2HPM A;  2P4W A;  3ZPL A;  2EWN A;  3JW4 A;  4L5E A;  4HEA 2;  2Z2S B;  2KHM A;  1J0R A;  4I98 B;  1SAN A;  3CC4 I;  3TGN A;  3BZC A;  2GWR A;  2X0L A;  3J81 Z;  4XKC A;  3G1O A;  2JRT A;  4PSX A;  3FMQ A;  5BPI A;  2BGC A;  2IXS A;  5E79 C;  5F6F A;  5LRR A;  2L7K A;  5FD6 A;  2EV0 A;  3GCM A;  3KP6 A;  4ZDO A;  1Q1V A;  2R7T A;  2M30 A;  1Q1H A;  3C2G A;  2BHZ A;  1SD7 A;  2XAF A;  2VJJ A;  5D5X B;  3RKY A;  2VQL A;  1SFO J;  4G94 A;  5E8G A;  3FXU A;  2Z5U A;  3I64 A;  1FT9 A;  4IF4 A;  1O3S A;  3PL8 A;  1BIB A;  2JSC A;  2OJE D;  3WU2 C;  4BKX A;  4XRM A;  4LJZ F;  1S9H A;  4BQA A;  4ZZD A;  2JA6 J;  1R5H A;  1OCP A;  1ZTR A;  5ILV A;  2LD5 A;  2V9K A;  5LLQ A;  3BY6 A;  3H9G A;  1HKQ A;  2HZD A;  4E7K A;  5GPA A;  1BR1 A;  1X3W B;  2XRL A;  3KYC B;  1DGR M;  4U7D A;  2TDX A;  2L7F P;  2R7X A;  4NUB A;  5E17 F;  2L02 A;  2NS7 A;  2HZT A;  1RC9 A;  5HLG A;  4UUS B;  2JN6 A;  2W25 A;  2G7U A;  1IN4 A;  3JRA A;  1S7E A;  1HW5 A;  3JAM Z;  3F6O A;  4N4O B;  2MYS A;  3BG7 A;  2YU3 A;  3A01 A;  2Q2E B;  1U5T B;  2E34 A;  2A3S A;  1U5T A;  4U7B A;  2VLA A;  3OSG A;  1CF7 A;  1CF7 B;  4IPA A;  1YTY A;  3SZP A;  1ODD A;  4B44 A;  1W7P B;  2PLY A;  4LIT A;  3SDB A;  5KK1 A;  2FRH A;  1Z3X A;  3WGG A;  1FBQ A;  1FOY A;  3HGG A;  2FOK A;  2V1X A;  1FBS A;  4ESJ A;  4BY7 J;  1OR7 A;  2QSH X;  2ADU A;  1WJE A;  2R7Z J;  1ZHF A;  2FQ4 A;  2KRH A;  1ULY A;  2L7Z A;  3KLN A;  2VXD A;  4RB2 C;  2Y2Z A;  1JKP C;  4WXC A;  3BR2 A;  2HQR A;  3IH2 A;  2W4S A;  1BC7 C;  1FTZ A;  2KJB A;  1QA6 A;  2DA6 A;  5F0F A;  5B1A H;  2NVU B;  4YG2 F;  4DOZ A;  1ETX A;  3HZJ A;  5HLI A;  4BYY A;  3KEY A;  2ELJ A;  2HVR A;  3ECO A;  1MGT A;  2IGK A;  4XSZ F;  1WH5 A;  4NC8 A;  5DV5 A;  3GTM J;  4IHX A;  3GTL J;  1NG6 A;  4W1U A;  1MDM B;  1MMD A;  1UG2 A;  1R00 A;  1FPQ A;  4FCY A;  3RSN A;  2RC4 A;  4MTD A;  3BZK A;  3CP2 A;  4U0W A;  4BAY A;  2ZC2 A;  2QYO A;  4CUG A;  3LSP A;  3E97 A;  3S2H J;  2EV6 A;  2HTS A;  3NAR A;  2CS3 A;  5DD4 A;  1SD5 A;  3LOC A;  5EGO A;  1YIT I;  4A3D J;  1H9G A;  4FET A;  1FYK A;  4MIM A;  4J01 A;  4IRH A;  3DBR B;  3HSF A;  4O5V A;  2QZ8 A;  5LBQ A;  3HIF A;  1N25 A;  1T95 A;  1AOY A;  2OV7 A;  2DXI A;  5E3O A;  2E1M B;  5LHH A;  4HX4 A;  5B5E C;  3GFI A;  2EZK A;  1MZB A;  2JK3 A;  5L3E A;  1R71 A;  4XRF A;  1R4M B;  4B3A A;  3A1Y A;  4D5C A;  2L9R A;  4GCV A;  1W1W E;  1YW9 A;  1X3Z B;  4BE2 A;  1LVK A;  2H1L A;  1P6R A;  3GYH X;  2NVT J;  5HVQ C;  4Y17 A;  2DDA A;  2EQR A;  1A6I A;  1R1U A;  3FHZ A;  5LGU A;  3H9Q A;  5LD2 C;  4BH9 A;  2V1U A;  3HC7 A;  4B43 A;  4IO9 F;  5IOZ A;  3LSH A;  4LK1 F;  3CLO A;  4IZZ A;  5DYM A;  1DUX C;  3T1B A;  2R5Z A;  2M3A A;  1I3Q J;  2DAO A;  2VBW A;  4NNJ A;  3WTY C;  4OIO F;  4HV6 A;  2HDW A;  1T39 A;  3CCV I;  2WAF A;  2HEO A;  2ETH A;  1S72 I;  3VYR B;  1APL C;  2LR8 A;  5HDG A;  3JRI A;  1N75 A;  4KT5 C;  3RKX A;  1VQM I;  1V5G A;  1BN5 A;  1P7J A;  1DU0 A;  1VQ4 I;  3T8T A;  4JOM A;  1KU2 A;  1Z3Y A;  2DFF A;  3IC7 A;  5LEJ A;  2IBD A;  2KQR A;  1DP7 P;  3CME I;  2KZG A;  4GYG A;  4LB5 A;  1U2W A;  4RB1 A;  5AON A;  4F92 B;  4J00 A;  3FX3 A;  2DCE A;  3S93 A;  4F93 B;  2R7S A;  1GV5 A;  3DLL F;  2R7U A;  4GXO A;  2R7O A;  2ZXI A;  4CZZ A;  3HGY A;  1MBF A;  2CQN A;  2STT A;  1GUU A;  2JJ7 A;  4IX7 A;  3UKG A;  1F43 A;  3JTG A;  4AIK A;  1JKO C;  4ENM A;  2ZFU A;  5J4V A;  2DOE A;  4KDP A;  1SFE A;  2X6X A;  3A01 B;  4F3Q A;  1UJ8 A;  3AG2 H;  3E6B A;  5EF6 A;  4L5J A;  3SFI A;  1LE8 B;  1ZKG A;  2QQ8 A;  2Z9O A;  5FFX A;  2XPU A;  4BL0 B;  1ZGA A;  2BV6 A;  2VOP A;  3VFZ A;  2QM3 A;  4XOP A;  1PDN C;  1DPU A;  2GIV A;  4BU2 A;  2PN6 A;  4I6Z A;  3KEO A;  1Z21 A;  4WX9 A;  3HOV J;  2LMD A;  2XSJ C;  1A35 A;  9ANT A;  3EUA A;  3DU5 A;  2JA7 J;  1ZYR F;  1EJ9 A;  1LVA A;  2N8G A;  1S3J A;  4CGZ A;  3GO5 A;  3B73 A;  4ABZ A;  3DTK A;  1R7J A;  2IT0 A;  2WV0 A;  2Z16 A;  4PJN A;  3HKZ A;  4XLH A;  1IO2 A;  4F7Z A;  3H35 A;  1Z91 A;  2L9N A;  3HHH A;  4HNV A;  3CF2 A;  4A6E A;  3JRB A;  2OCC H;  2LC2 A;  4U88 A;  2CFX A;  4A5N A;  4A93 J;  2RNG A;  4NQW B;  5FKK A;  2LRE A;  1OCT C;  3MCZ A;  1L0O C;  4XNF A;  1XMK A;  1XSV A;  2MA3 A;  1QNT A;  3IP4 B;  5H20 A;  2VC1 A;  1YQA A;  1QQI A;  1TWH J;  2Q1Z B;  4L9N A;  2CQ7 A;  4KT6 A;  2AO9 A;  1QPM A;  2HDD A;  2VJ5 A;  4CDG A;  3ZQG A;  2PI0 A;  3HG9 A;  3CZ6 A;  5K7Z A;  5J8F A;  1DGW Y;  3L2R A;  2IS2 A;  2BW3 B;  1Y39 A;  1R58 A;  2E35 A;  3V7C A;  5FLX Z;  1R6R A;  3U2R A;  4HYE A;  3M3Y J; 
#chains in the Genus database with same CATH homology
 2O9L A;  2XGD A;  1BW6 A;  3ZQF A;  4A69 C;  2EZL A;  2YUS A;  4C3I J;  3S1M J;  1JKQ C;  1QPI A;  3HM5 A;  3IV5 A;  5IYC J;  2GM4 A;  3Q0V A;  1BJZ A;  5J1R A;  1YRN B;  2D5V A;  1H8A C;  3I4N J;  1T56 A;  1P7I A;  3I4M J;  5IYD J;  1BA5 A;  1WH7 A;  2AHQ A;  2WV1 A;  2DA4 A;  2DMT A;  5JLX A;  3H0G J;  4FE4 A;  1MH3 A;  1MSE C;  1OJL A;  2XGC A;  3BTI A;  5C44 J;  5JLW A;  2MW8 A;  1BL0 A;  5FKM A;  2DMP A;  2EZI A;  3RKQ A;  2VUM J;  3RZO J;  4D7M A;  1EF4 A;  1TWC J;  3S1R J;  1RES A;  3K7A J;  3FK6 A;  2EH3 A;  2CUF A;  3H3V K;  3IH4 A;  3BTJ A;  1JUM A;  4UUS A;  3G1M A;  4M3B A;  2O8K A;  2M0C A;  4IHW A;  5HOD A;  1ORK A;  4Y52 J;  2HQ5 A;  4V2G A;  1YRN A;  5EZG A;  1RKT A;  1QVT A;  1JTX A;  5FLV A;  3SDG A;  5J1Y A;  1POG A;  4S0H B;  1MBE A;  1XG1 A;  1AU7 A;  2CU7 A;  4QIW N;  1MNM C;  2E1O A;  2CQQ A;  1IDY A;  1HCR A;  3NAU A;  2K9N A;  1K83 J;  2Y9Y A;  1B8I A;  2NVY J;  1HDD C;  5EZH A;  4A3K J;  2LP0 A;  1RR7 A;  3TW6 A;  1BW5 A;  4C3J J;  4J19 A;  1GVD A;  3MN2 A;  1MBK A;  2CJJ A;  2ECC A;  3MVP A;  1GT0 C;  2DA7 A;  3F0C A;  3CQZ J;  1ETW A;  2WAQ N;  3CCY A;  5EYR A;  4B1R A;  1H89 C;  4NDL A;  2ZB9 A;  2XGE A;  1WGX A;  4IHV A;  3E7L A;  3TED A;  4W97 A;  1NK2 P;  3BT9 A;  1QVU A;  2CUE A;  3S1Q J;  1ZGW A;  3QQA A;  4Y7N J;  2O7O A;  4JX6 A;  3GTK J;  4CYC A;  2LKX A;  2LVS A;  2I10 A;  4AC0 A;  3ZQC A;  3BTC A;  1ETK A;  2CRG A;  2KT0 A;  1ETO A;  3HEF A;  2ME0 A;  4AUX A;  1FEX A;  1HDP A;  1X58 A;  2VKE A;  3BTL A;  3HOU J;  3VPR A;  4V2F A;  3CDL A;  1RKW A;  3ZQH A;  1U9O A;  1W0T A;  1JKR C;  3TW7 A;  3S17 J;  1AKH B;  1VND A;  2E2J J;  4A3C J;  1ZR4 A;  5C4X J;  1WPK A;  3S16 J;  1VFC A;  3HOX J;  2GLO A;  1TWF J;  3LSJ A;  2DA3 A;  4XK4 A;  3BR0 A;  2HI3 A;  3OOU A;  4QTR A;  5DTD A;  5M3F J;  5F04 A;  3JRF A;  2FX0 A;  2NS8 A;  1U9N A;  4UUT A;  2XB0 X;  4C2M J;  3Q0U A;  3BR1 A;  2GBY A;  3JRD A;  4QSH A;  2MSY A;  5F1J A;  2YS9 A;  2DA1 A;  2DMU A;  3LSR A;  2EZH A;  1Z0X A;  2QF7 A;  4XRS A;  1UHS A;  1ETV A;  1FIA A;  2DA5 A;  4MLO A;  5F0C A;  1RET A;  1A5J A;  1JT6 A;  1U78 A;  2QCO A;  4EEF G;  1UMQ A;  3DEW A;  5E3N A;  1U8B A;  1IC8 A;  2NVQ J;  2COB A;  3ZOB A;  5C3E J;  1VF9 A;  2ID3 A;  4BXX J;  1IDZ A;  1TWG J;  2ECB A;  3Q0W A;  4A3F J;  2L7M P;  5J1U A;  1PUF A;  2R5Y B;  1DU6 A;  3CMY A;  3PM1 A;  2Y31 A;  4DZP A;  1QRY A;  1VI0 A;  5FKL A;  4L5E A;  1Y1W J;  5C4J J;  4LOC A;  2FD5 A;  1TWA J;  1JT0 A;  1SAN A;  4D5F A;  3FKI J;  1WI3 A;  1ZR2 A;  3G1O A;  3W6V A;  3WHC A;  1ITY A;  3BR3 A;  1Q1V A;  2EBI A;  2JA8 J;  1I50 J;  2XB5 A;  1ETY A;  2XPV A;  1SFO J;  3HOW J;  4FE7 A;  1JTY A;  1K61 A;  3GTG J;  1RPW A;  3M4O J;  3PO2 J;  3MKL A;  2JMW A;  3BR6 A;  2ID6 A;  4BKX A;  4XRM A;  4FIS A;  4G12 A;  2JA6 J;  1F36 A;  1OCP A;  1ZTR A;  2LD5 A;  3GTO J;  4A3G J;  3FIS A;  4JX4 A;  5GPA A;  2XRL A;  5E3M A;  2PMZ N;  2L7F P;  2H1K A;  1T33 A;  2NS7 A;  3LNQ A;  3TP3 A;  4UUS B;  3PO3 J;  2JN6 A;  1MBG A;  5EDN A;  1ZK8 A;  1S7E A;  4M3E A;  3JRA A;  2M34 A;  2R93 J;  2TRT A;  2HYJ A;  2X6O A;  3A01 A;  3Q3S A;  3RQI A;  1O4X A;  3OSG A;  4DW6 A;  1E3O C;  2OPT A;  1JJ6 C;  2IAI A;  3HDD A;  1TC3 C;  1I6H J;  4RBO A;  4X6A J;  5J3L A;  3HGG A;  2RAE A;  2KDZ A;  5IP9 J;  3JR9 A;  4M3F A;  5IPA A;  4BY7 J;  4C3H J;  4XIC A;  5EGO B;  2NOG A;  3O8H A;  3BQY A;  2LFB A;  2R7Z J;  2FQ4 A;  2L7Z A;  2LK2 A;  3JRC A;  3L1P A;  2Y2Z A;  1CQT A;  2B63 J;  4IHY A;  1JKP C;  4MFD A;  5K7F A;  3BQZ A;  3BR2 A;  3IH2 A;  1IJW C;  1FTZ A;  1LFU P;  3BG9 A;  2DA6 A;  5F0F A;  5F08 A;  2X9D A;  1ETX A;  1FTT A;  2DMQ A;  1WH5 A;  3GTM J;  2JWT A;  4B4C A;  4BY1 J;  4IHX A;  3GTL J;  3K2A A;  4W1U A;  1LE8 A;  2VPR A;  1UG2 A;  4FCY A;  2R0Q C;  2DN0 A;  3O8G A;  1AHD P;  4AYB N;  2YU9 J;  3BG5 A;  3LSP A;  3JRE A;  4A3L J;  2E19 A;  3HOY J;  5F0H A;  2K40 A;  5E3L A;  3S2H J;  5EGO A;  3NAR A;  4A3D J;  3LOC A;  4JP0 A;  3D1N I;  4MO7 A;  4MIM A;  2WB1 N;  1G2H A;  3HBL A;  2M9H A;  1HF0 A;  2X48 A;  5E3O A;  1NTC A;  1MBJ A;  2R92 J;  2EZK A;  4IEJ A;  2JK3 A;  5FKO A;  4B3A A;  2W48 A;  4D5C A;  2L9R A;  5F27 A;  2TCT A;  1IV6 A;  1ZQ3 P;  1ETQ A;  1X2N A;  1B72 A;  4RDU A;  2NVT J;  2E2I J;  2M2E A;  1XC5 A;  5FJ8 J;  2HXI A;  1GV2 A;  2EQR A;  1A6I A;  2Y30 A;  5M5Y J;  3HOZ J;  5IOZ A;  2LY9 A;  3HB9 A;  2HOS A;  1NK3 P;  2R5Z A;  3GTP J;  1I3Q J;  3B6A A;  3FIW A;  5BNG A;  5EEA A;  5IYB J;  4DZJ A;  4X1E A;  4DYQ A;  4FTH A;  1H88 C;  4I76 A;  3A02 A;  2ME6 A;  5K7H A;  3FK7 A;  5M3M J;  1APL C;  2DJN A;  5IP7 J;  2LR8 A;  3JRI A;  3S1N J;  3JRG A;  1FIP A;  2MGQ A;  4GFB A;  2R5Y A;  1DU0 A;  1P7J A;  3S14 J;  4DYC A;  2LTP A;  3BR5 A;  2IBD A;  2OF7 A;  2M8G X;  5GP9 A;  3SJM A;  4DYR A;  3GBG A;  4A3B J;  4A3I J;  1GV5 A;  3ZQL A;  2CQX A;  2DA2 A;  3WHB A;  1OFC X;  1Z77 A;  2K9S A;  3JRH A;  3GTJ J;  3HGY A;  1MBF A;  3C2B A;  1GUU A;  1JUP A;  2FJ1 A;  1IG7 A;  2JJ7 A;  1Y1V J;  1JJ8 C;  3B6C A;  3UKG A;  1B8I B;  1F43 A;  1JKO C;  4JX5 A;  2E2H J;  4XRS G;  2L0K A;  5EG0 B;  3A01 B;  5IOY A;  2LLK A;  5EG0 A;  1ENH A;  5EF6 A;  3SFI A;  1LE8 B;  1ZKG A;  2VI6 A;  2H8R A;  1D5Y A;  2XPU A;  2HOT A;  3HKZ N;  3OIO A;  1R9T J;  3QPL A;  1HLV A;  5GPC A;  2XPW A;  1PUF B;  1HOM A;  4I6Z A;  3HOV J;  4XID A;  9ANT A;  1X2M A;  1IUF A;  3LSG A;  5M5X J;  2HXO A;  3OSF A;  2JA7 J;  1MH4 A;  2P81 A;  3BG3 A;  5DS9 A;  2N8G A;  3A03 A;  4M3G A;  4ABZ A;  4M6V A;  3QPS A;  1B72 B;  2DTZ A;  2Y0S N;  4JYK A;  2XSD C;  4HNV A;  3JRB A;  3S15 J;  4MFE A;  1JUS A;  2G0E A;  1JGG A;  4A93 J;  3RZD J;  3ZQI A;  5FKK A;  1GDT A;  1FJL A;  1OCT C;  2HOA A;  4BBS J;  2R5Z B;  4A3E J;  1IRZ A;  3DCF A;  3TP0 A;  4CYC B;  3IH3 A;  4D7N A;  3GTQ J;  1TWH J;  1MSF C;  2JA5 J;  2VKV A;  2AO9 A;  1MBH A;  3S2D J;  2HDD A;  5IP6 A;  3G1L A;  2DMN A;  3ZQG A;  4A3J J;  4A3M J;  2IEK A;  5K7Z A;  1W0U A;  2MG4 A;  4M3D A;  1LFB A;  5FLM J;  2K9Q A;  2ELK A;  1AKH A;  5FKN A;  1IGN A;  2Y9Z A;  2NVX J;  1XS9 A;  1WCM J;  4BBR J;  5M5W J;  3M3Y J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...