4C3JJ

Structure of 14-subunit rna polymerase i at 3.35 a resolution, crystal form c2-90
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
69
structure length
69
Chain Sequence
MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNPLEKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-DIRECTED RNA POLYMERASE I SUBUNIT RPA190
publication title Crystal Structure of the 14-Subunit RNA Polymerase I
pubmed doi rcsb
molecule tags Transcription
total genus 13
structure length 69
sequence length 69
ec nomenclature
pdb deposition date 2013-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF01194 RNA_pol_N RNA polymerases N / 8 kDa subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 4c3jJ00
1GUUA 2Y30A 3SFIA 3WHCA 1MBGA 3TW6A 1UHSA 3GTPJ 3BQZA 4DW6A 3JRHA 4A3KJ 5IP7J 3H0GJ 5EGOB 3RZDJ 5IOZA 2L7MP 3Q3SA 2JMWA 4BKXA 2DA4A 4C3IJ 5E3MA 2NVTJ 2LR8A 1MBEA 5C3EJ 4JP0A 2CUFA 3Q0UA 1VF9A 2EQRA 2R5YB 1S7EA 3HB9A 1LE8A 1ETWA 1TWCJ 4A93J 4GFBA 2AO9A 3HOVJ 2CU7A 2YS9A 1A6IA 1P7JA 1RESA 2X6OA 5J1UA 1E3OC 1HLVA 3K7AJ 3A01A 1GV2A 2DN0A 3ZQLA 3S14J 3BT9A 3ZOBA 2NVXJ 1MBHA 2DA2A 1EF4A 1RKTA 4M3FA 1XG1A 1ETOA 2IAIA 2LVSA 3O8HA 5IYDJ 4JX6A 2ME6A 1JKOC 3ZQCA 3GTOJ 2DMUA 2XPUA 4M3GA 1IUFA 2B63J 5EG0A 4DYCA 2HOSA 2O9LA 1WGXA 3BR5A 3S2DJ 2Y0SN 4AUXA 3DCFA 4QTRA 2XB0X 2M9HA 2JA7J 2XGDA 3BTIA 1VFCA 3GTGJ 1HF0A 4UUSA 3OSFA 2NOGA 1TWHJ 2DMNA 4X1EA 3HGYA 4NDLA 2EZIA 1I50J 2LP0A 2XSDC 3JRIA 4MFDA 4A3BJ 4BBRJ 3FKIJ 5IYBJ 3S2HJ 1AU7A 1W0UA 3BG5A 3JRAA 1H89C 1Y1WJ 1AKHA 1IG7A 4M3BA 4XRSG 1OJLA 5IP6A 4A3DJ 3FIWA 3A03A 3M4OJ 4X6AJ 4MFEA 5IOYA 4XK4A 1APLC 3HOXJ 1X2NA 1JT6A 4B3AA 1B72A 2MG4A 5JLXA 2HYJA 5EF6A 1UMQA 3CCYA 3JRFA 2X48A 1IV6A 4I6ZA 1ZR2A 4AYBN 1TWFJ 3HKZN 2DA7A 3A02A 1GDTA 5F27A 1O4XA 3JRBA 4JYKA 2DTZA 1WCMJ 2PMZN 2Y2ZA 1JUPA 2ECCA 3HM5A 3VPRA 5C4JJ 4A3FJ 3LSRA 1PUFB 1TC3C 2ZB9A 2YUSA 1Y1VJ 3ZQIA 2GLOA 1JKRC 2MGQA 2RAEA 1FIAA 1MSFC 3TP3A 5EZHA 5DS9A 2XGCA 1JJ8C 1IDYA 1XS9A 1I3QJ 2JN6A 2L9RA 3IH3A 3D1NI 2VPRA 1WH7A 3MVPA 2MW8A 1ITYA 3BTLA 3OOUA 4UUTA 4LOCA 1HDDC 2R0QC 3M3YJ 2Y31A 1POGA 2K40A 4MO7A 5BNGA 4A3CJ 1FTZA 1JJ6C 1LFBA 4Y52J 1QRYA 1MNMC 4IHWA 1MH3A 1UG2A 4DZPA 2LY9A 2LLKA 1JTXA 2JWTA 1LE8B 2L0KA 2O7OA 3MKLA 4FE7A 4A69C 2EZLA 5M5YJ 2HI3A 3BR2A 2IEKA 5J3LA 1IJWC 2R5ZB 4B4CA 4I76A 1ETKA 3A01B 4IHYA 3G1LA 2LK2A 1ETXA 3NARA 3CMYA 2IBDA 1MBJA 5FLMJ 1MH4A 2M34A 3S1RJ 3LOCA 2XGEA 4A3LJ 4D5CA 2JA8J 2CRGA 3SDGA 3C2BA 4RDUA 4XRSA 3Q0WA 4W1UA 2Y9YA 2M8GX 5EGOA 2JA5J 3ZQHA 3LSPA 1YRNA 1I6HJ 4BY1J 3BR6A 1R9TJ 1JUMA 3FK7A 1JGGA 2E2HJ 4M3DA 2LKXA 1P7IA 2H1KA 4QSHA 2E2IJ 3GTMJ 3S1QJ 2CJJA 1VNDA 3E7LA 3ZQGA 1IRZA 2R5YA 3LNQA 1ZKGA 2FD5A 1RR7A 5M5WJ 1NK2P 3HOWJ 5J1YA 1RPWA 5E3LA 2KDZA 3QPSA 3GTLJ 1ZTRA 2LD5A 1LFUP 1BW5A 3CDLA 5F08A 1SANA 1WI3A 1IGNA 3QPLA 2NS7A 1AKHB 2Y9ZA 5FJ8J 4XIDA 2O8KA 2X9DA 2K9NA 2VKEA 4JX5A 1ETQA 3CQZJ 3QQAA 1ZGWA 3I4MJ 2VUMJ 2EZKA 2DJNA 4BBSJ 3RZOJ 3B6AA 3HEFA 3IV5A 3RKQA 1ZR4A 2XPWA 2DMQA 5F0CA 1B8IA 3HGGA 3K2AA 3S1NJ 3Q0VA 2HXOA 4DZJA 1OCTC 4CYCA 2M0CA 2WAQN 3B6CA 1TWGJ 5E3OA 4L5EA 4C3JJ 3HOZJ 3BG3A 5GP9A 1FJLA 2ME0A 2G0EA 3OIOA 4FE4A 1NK3P 1ETVA 3GTJJ 1HCRA 2EH3A 1BW6A 5EZGA 3LSGA 2KT0A 2R7ZJ 5HODA 1BJZA 2JK3A 2ECBA 3JRDA 3ZQFA 2NS8A 1H8AC 3FISA 3IH4A 4W97A 9ANTA 5JLWA 4A3EJ 1X58A 2DA1A 2ID6A 2CQXA 1WPKA 5FKMA 1BA5A 4BXXJ 2N8GA 2ELKA 3PO2J 1ZQ3P 2L7FP 1GV5A 1RKWA 3OSGA 2R93J 4M3EA 1K61A 2LFBA 2I10A 3JREA 1IDZA 1Z0XA 1T56A 4EEFG 4QIWN 1W0TA 1PUFA 1NTCA 3BQYA 3RQIA 4M6VA 3TP0A 2FX0A 2OF7A 2QCOA 1MBFA 2R92J 4BY7J 1X2MA 2VKVA 1D5YA 5M3MJ 1CQTA 5FKKA 3JRGA 5GPCA 3SJMA 1K83J 4V2FA 3BTJA 4A3MJ 3GTQJ 4C3HJ 1HDPA 5F1JA 1F43A 3PM1A 1QVUA 2DMPA 5C44J 1ENHA 5F0HA 2M2EA 2E2JJ 5EEAA 1YRNB 3TW7A 1DU6A 5J1RA 1FTTA 2K9SA 1U78A 3H3VK 1T33A 5IYCJ 5EDNA 1TWAJ 2CQQA 1AHDP 1F36A 4D7NA 5EG0B 2FQ4A 2JA6J 1DU0A 1ETYA 2WB1N 1OFCX 1JTYA 1ORKA 2FJ1A 4J19A 5K7ZA 2HOAA 1FEXA 4D5FA 4UUSB 4A3GJ 4S0HB 2R5ZA 4HNVA 3HOYJ 2DA6A 2W48A 2TRTA 3HDDA 3S1MJ 1U9OA 2GM4A 2MSYA 4XICA 2CUEA 5GPAA 5K7FA 2QF7A 2DMTA 4V2GA 1JKQC 2HQ5A 4DYRA 4G12A 3F0CA 3BR3A 4DYQA 2GBYA 5M3FJ 2HXIA 4JX4A 3S16J 1HOMA 4FISA 4MLOA 5FKOA 1B8IB 1BL0A 2E1OA 1B72B 1MSEC 2DA3A 2L7ZA 1MBKA 5FKLA 4CYCB 4AC0A 2DA5A 3O8GA 1QVTA 2D5VA 3NAUA 3DEWA 5C4XJ 4B1RA 2JJ7A 3G1MA 1U8BA 3BG9A 4IHXA 3PO3J 2ID3A 1GT0C 3BR1A 5IP9J 5E3NA 1QPIA 3BR0A 5FLVA 3JR9A 2COBA 1JUSA 2K9QA 3WHBA 3L1PA 2AHQA 5F04A 3HOUJ 3MN2A 1VI0A 1IC8A 1Z77A 4A3JJ 4FTHA 1WH5A 3I4NJ 2HDDA 2NVYJ 2TCTA 1RETA 4IEJA 2LTPA 5M5XJ 4MIMA 4D7MA 4FCYA 2WV1A 3TEDA 4RBOA 5FKNA 3FK6A 5K7HA 2HOTA 1H88C 3G1OA 3JRCA 5EYRA 1FIPA 3S17J 4Y7NJ 2E19A 2EBIA 1Q1VA 4ABZA 3LSJA 1G2HA 3IH2A 3BTCA 1GVDA 2EZHA 2XRLA 1ZK8A 5F0FA 2VI6A 4IHVA 2OPTA 3GBGA 3HBLA 4C2MJ 1SFOJ 2YU9J 1U9NA 2H8RA 5DTDA 1A5JA 1OCPA 1JKPC 3S15J 3UKGA 4XRMA 2P81A 3W6VA 2XB5A 2XPVA 2NVQJ 1JT0A 4A3IJ 1XC5A 5IPAA 3GTKJ
chains in the Genus database with same CATH superfamily
1GUUA 2Y30A 3SFIA 3KP4A 4NQWB 2Y69H 2AXLA 1B9MA 2LKPA 4HBLA 4A3KJ 2VJIA 5EGOB 1IRXA 1R22A 2X6YA 2R7WA 4I01A 2WTEA 2MABA 4Y17A 3NWSA 3Q3SA 1S7OA 4KICA 2DA4A 2UV1A 2KJCA 3DTKA 3LSIA 3OIQA 1MBEA 3CP8A 4JP0A 2VBXA 4BACA 1R58A 1VQ8I 2KRCA 1X3ZB 2KZVA 3HB9A 1S5LC 3FBNB 3AG3H 1VQ5I 2AS5F 1ETWA 3J81Z 1TWCJ 2Z2SB 3WU2C 1TZLA 1X3WB 3GLXA 2KFDA 2YS9A 4E6KG 1TQIA 5J1UA 4RGUA 4MHGA 1UZCA 1FYMA 2F5FA 4P9UA 4RGRA 4Q4ZF 1BIBA 1N75A 3K0LA 1QZZA 3ZOBA 1UG0A 5E8GA 4R1HA 2DA2A 2F48A 2KQRA 3E6CC 3EUHA 1W36C 1RKTA 4UY8I 2O61A 4PFOA 3SZTA 3H5NA 2XDVA 3KPHA 4EGYA 5E1WA 3HSFA 1JKOC 1SFEA 2E71A 3OIPA 1D5VA 1YX5A 1LDDA 2RQQA 5EG0A 1OKRA 2O9LA 2FUG2 3QP5A 3SYTA 5IT9Z 2Y0SN 4AUXA 3DCFA 3RPUA 5HDKA 4YIRX 2XB0X 2M9HA 1ON1A 3EUHC 3BTIA 2WY7Q 1VZ0A 2QWWA 3U9GA 2CW0F 1HF0A 3SFZA 4EM2A 4NBQA 2A5YB 5J6XA 4N9HA 3HGYA 2NVUB 2HQAA 2IGOA 1ZLKA 1I50J 4IRHA 3GXOA 3SXYA 2DOFA 2VOOA 2GIVA 2ELJA 2QQBA 4EM0B 4BBRJ 2P8TA 5B3SH 3S2HJ 1LFPA 2EILH 1U6GA 5LEKA 3CCQI 1QBJA 2E1CA 2UWMA 1OYYA 2R7RA 3H3ZA 2RQPA 2OTJI 1T8IA 5DDGA 4X6AJ 2CUJA 3F9KA 3BPVA 4FQGA 4XKVA 4B3AA 2J5OA 2RREA 1B72A 3F23A 3VSLA 5JLXA 3F22A 1XMXA 2UXXA 1P9QC 4ZZLA 5EF6A 4B43A 1UMQA 3CCYA 2CGPA 3IHUA 1BC7C 1FP1D 2L5QA 4I6ZA 1ZR2A 2VKDA 2M7AA 1WHUA 1TWFJ 3HKZN 3K1PA 4BQNA 5L3GA 1O4XA 4NHJA 5HLIA 3JRBA 4JYKA 1WCMJ 3H9JA 2NNNA 4BHPA 1O3RA 2H09A 4A2UA 2ECCA 3OY9A 4RLFA 3VPRA 3WE2A 2QSFX 1V5GA 1PUFB 2DFEA 4KIFA 4AIDA 3ONQA 5ED4A 3ZQIA 3TMOA 3QAHA 4CUGA 5LHIA 3GEZA 5B1AH 3F72A 1JJ8C 3FM3A 2PMUA 1IDYA 1XS9A 2EIKH 2L2OA 5DV5A 2EFQA 4XBFA 2EK5A 2QVOA 1WH7A 1GHCA 2MW8A 4G6QA 4TV7A 4M74A 2BGCA 5AONA 1XN7A 2ZNZA 4U0YA 1G8XA 3V7RA 2UUZA 4RB3C 2R0QC 4CSWA 3ZMDA 3PNYA 3D0SA 2Q2EA 4A3CJ 2XASA 4KIGA 2M45A 3PNVA 4Y52J 1XSDA 2X6XA 1MW7A 4ANJA 2ZSIB 3HSRA 4DZPA 2K7LA 2LY9A 4LD5A 5L3FA 3M8EA 2L0KA 1TW3A 1FSEA 2W1OA 4FE7A 4A69C 4NC6A 5CLSA 3LL7A 5M5YJ 2HI3A 2HQRA 3BR2A 3DWLE 2IEKA 3OYAA 3AG2H 3CDIA 1ETKA 2VN2A 2Q8KA 1IN8A 3RPQA 1SC7A 3BG7A 1FZPB 1Q1HA 4UV9A 2IBDA 1TP4A 5DM6F 3CMYA 1W5SA 1Z7LA 2CFXA 3K4NA 2VBWA 2FBHA 3HKZA 2DXIA 2JA8J 2CRGA 3C2BA 5H2FC 1HKQA 4ZYGA 3J80Z 2M8GX 4HLXA 4CCKA 4LK0F 1F4KA 2M1BA 3W6JB 1FYKA 2KDOA 3BR6A 1T38A 4ZYAA 1YS6A 1ON2A 1LB2A 3CP2A 4U0WA 5D6EA 3DLLF 2E2HJ 4M3DA 2LKXA 1P7IA 5CKTA 3CF2A 3OV8A 4KN4X 3S1QJ 3JTGA 2EA2A 2GQQA 2R5YA 1IRZA 2IS2A 3VYTB 1NK2P 3HOWJ 1WRJA 2JRTA 1X1AA 1QHHD 4FX0A 2HVSA 1ZTRA 2CQ7A 1J09A 1N25A 2P5VA 3J7ZI 1SANA 4C2TA 3I59B 4I2OA 3ABUA 3TOBA 4BQOA 2YX7A 1RNLA 1E0EA 1S29A 2IJLA 3GF2A 2O8KA 4HA8A 3TKYA 2IS6A 3CQZJ 3PIOF 5IT3A 4QPQA 2ESHA 3FHNA 3I4MJ 4UNOA 2PI0A 6PAXA 4CDGA 1U2WA 1K78B 1NG6A 3HEFA 1ZR4A 1S72I 3LSHA 1N77A 1B8IA 3Q0VA 1P6RA 1OCTC 1X3UA 4PJNA 4CYCA 1UJ8A 2M0CA 5AIPA 1TW2A 2JUCA 2PMHA 3RYPA 5KHDA 4Q5SF 4C3JJ 3FXLA 4GRIA 4AIJA 4ENMA 1FJLA 2ME0A 3D5LA 1QU3A 3ZQ7A 1IRGA 1P4XA 4E7SA 4LB5A 2ZXHA 1ZGJA 4R8HA 2IA0A 3GTJJ 4UXNA 1SFXA 3DLAA 3E6MA 5HODA 1K4SA 2ZFWA 2B9SA 2DK5A 2ECBA 4RLQA 1OR7A 2NS8A 5JFRA 4IX7A 3C18A 3F8MA 2IPQX 2BV6A 3CC4I 1BI1A 2OZUA 3O6BB 2X1DA 2IS1A 2LBFB 4BXXJ 1W7PA 3PO2J 1UAAA 2MC4A 3V7SA 1OR7C 2FBKA 3D5SC 1DP3A 4PJ0C 2GOXB 2CW8A 1Z6TA 4HSTA 2VC1A 4DJAA 3JREA 2KKOA 1D8KA 3FXQA 3KLNA 2CFOA 1IDZA 1T56A 3OYFA 4E7JA 2ZJ2A 2ACJA 3BQYA 4CGZA 1A04A 3FBIB 4O5VA 3TP0A 3MEXA 3IRRA 2QCOA 3E5QA 2OA4A 3H35A 2EPFA 5LHHA 2W24A 1GLNA 4BY7J 1X2MA 1ZG5A 5GPCA 1C0WA 1K83J 1YQAA 2A6TA 4V2FA 4P5OA 1AWCA 2M8EA 3MZYA 3ZP5A 3A0HC 2H1LA 4F7ZA 2ZJPF 4C3HJ 2X1CA 2QA4I 2MD5A 3GCMA 3KZYA 1BBYA 3K10A 3PM1A 2A69F 4C9YA 4R79A 4YIIA 1BOAA 2CV1A 2ISZA 2NAZA 3KP5A 3F8BA 2DOEA 5HLGA 3ZCOA 1TWAJ 1FX7A 2CQQA 4EATA 2L54A 1PUEE 4ZDPA 1YLFA 2R7FA 3FXKA 2PJRA 1X1DA 2QYOA 2FU4A 2R4GA 4PGHA 2WB1N 5HDNA 2ZSHB 3FWEA 3H9QA 2FJ1A 1VQLI 1W5TA 1B59A 4D9JA 3CDHA 2E7WA 3M7GA 4HOBA 4D5FA 4HNTA 4KIBA 4S0HB 1SD5A 4HNVA 1YITI 3I54A 4ON0A 1DGWY 2DYRH 2TRTA 3RJPA 4EJUA 1U9OA 1USTA 2CUEA 2X4HA 4PUSA 1T2KA 2VC0A 3VODA 2JSCA 2DMTA 5GTIC 3J7AY 1J59A 2YU3A 2VT3A 4HYEA 2V1XA 3FF5A 5L3EA 4G12A 3CCVI 3BR3A 2HZTA 3AL0B 2VJ5A 4FISA 2LREA 4XLEA 5LBQA 1B8IB 2MLGA 1MD0A 2ZNYA 4Q47A 2NS0A 3Q9VA 5FKLA 2JPCA 4CYCB 4FASD 1SFKA 2DA5A 1T95A 1YTYA 1QA6A 4BXUA 1X1CA 5E1XA 2HKOA 1D0ZA 1IRFA 1XPXA 1U8RA 4B8XA 1H0MA 3V8LA 3CUQA 3WTVC 1U8BA 1KQ9A 3PO3J 2L01A 1FC3A 1QPIA 2PBIA 1F9NA 2GWRA 3JAMK 1HA8A 3WHBA 4DQ2A 3B73A 3L1PA 2UZKA 3FHZA 2KP6A 2DU9A 1H9GA 1FNNA 2DJIA 3U2RA 2NNYA 3QP6A 1YIJI 2VKHA 2L4AA 2V9PA 2RDPA 1VQNI 4A3JJ 2L02A 3CUQC 1FOYA 3LAPA 5HNHA 1TT0A 1KA8A 1KYWA 4ZC3A 4CZCA 1SMYF 3CD6I 2QQ9A 2X51A 2WB1A 4M71A 2Y48A 1BOBA 1J0RA 3C7JA 3LSTA 4MIMA 5ILVA 4ESBA 3ASNH 3K4KA 2BE5F 5K7HA 2OD5A 2P4WA 1H88C 4RM3A 1YFHA 4DBRA 3IAS2 3J7YJ 3S17J 4BHCA 1ZH5A 1Q1VA 4NUBA 3IH2A 4RAZA 4ZDLA 5F0FA 2WC2A 4IHVA 3DKYA 3MMYB 2OPTA 5LD2C 2EV0A 3HBLA 3RDIA 1R49A 2HTSA 2H27A 2YU9J 3TBIA 5AIQA 3BZCA 1HXDA 3QU3A 4XRMA 5D5XB 1IF1A 1ZLJA 2XPVA 3U1KA 2ZXIA 3E3VA 4M9XA 4E4HA 5IPAA 2DQLA 4I0BA 3WHCA 2DOAA 2KZGA 4I7HA 1UHSA 1MGTA 2ZMEC 2FBIA 3BQZA 5BPIA 1WJCA 4LLGF 3RKWA 4DW6A 4DGWB 3PSIA 3RZDJ 1A36A 2EA4A 2Q0OA 4GYGA 3NEUA 2OU2A 2H8WA 2JMWA 3KP3A 4BKXA 1L3LA 1DUXC 4EJOA 4IOAF 1HSTA 1ZAOA 5C3EJ 2B0LA 2DDBA 2CUFA 3I5UA 3Q0UA 1VF9A 1MDMA 3W2VA 1Z05A 2FEZA 4BJTA 2GAUA 4IL6C 1IZ1A 4BEHB 3OR2C 4A93J 3I71A 2AO9A 1FMVA 2R7DA 3HOVJ 2CUZA 1A6IA 2M7BA 1RESA 4AYBA 2M5WA 3HRTA 3ERMA 2HDWA 3EDPA 2DN0A 4F91B 2NYXA 4PK4A 4BDZA 3BJAA 2NVXJ 4AM3A 1MBHA 2OC6A 1RUNA 2MYSA 3OYEA 1ETOA 3HG9A 4PJMA 2OQGA 4JX6A 2KPMA 4B47A 1O3TA 1STZA 2DMUA 4KT6A 1KU2A 3ZMVA 3FX3A 4OIRF 4A12A 2B63J 2Z3YA 3U21A 1TTYA 4ZYEA 1LUJB 1ZGAA 2HOSA 1WGXA 3MAJA 3BR5A 3GZNB 3D5RC 2K5CA 5FRMA 2KJBA 1WJAA 3AKZA 4CYDA 3ML6A 2KRHA 2XGDA 4HF1A 3CUQB 1OCRH 4Z2YA 1VFCA 2UXNA 3DBHB 1EA3A 1Y6IA 4IRIA 3A0BC 2DPDA 2Z5UA 4JBAA 2AXTC 3S3MA 3M8JA 4UVBA 4A3BJ 3GYHX 3HRMA 3ZMZA 2X1EA 2F4IA 3BLYA 5KK1A 3JRAA 1Y1WJ 4YEJA 3R60A 4GXOA 4M3BA 4G7ZF 3FIWA 4A3DJ 1FY7A 2C6YA 5ICCA 4XK4A 2I5UA 4L9JA 2PQ8A 1IXRC 1X2NA 3GLLA 2FMYA 3SEQA 3WU1B 3DEEA 3GFMA 1OLTA 3O2PE 3A1YA 3JRFA 5DD8A 2X48A 3FMSA 3QPHA 1O57A 4UV8A 2Z33A 4E7ZA 2DA7A 3A02A 3U1DA 3WGHA 5L3BA 3FKJA 1DPRA 2IW5A 3I56I 4XLHA 1UELB 2YX4A 5HVQC 1O3SA 1CGPA 3CZ6A 2PMZN 2Y2ZA 1YS7A 1YG2A 2VIXA 5C4JJ 2CW7A 3V42A 2OTLI 2ZB9A 1IO2A 3HYIA 3BZ6A 2YUSA 4N0BA 4P9FA 1MNDA 2GLOA 4N9IA 1DDNA 1JKRC 3GFIA 2MGQA 1PP8F 2RAEA 1MSFC 1PYVA 3RQ4A 4OOIA 3TP3A 5EZHA 1NG7A 5DS9A 2L9RA 3MZ8A 5DUKA 4KYWA 1B9NA 3HRSA 3IH3A 5CQEA 3MVPA 2LYCA 1VQ4I 1O7FA 1Z3XA 4RAFA 3OOUA 3JTHA 1IN5A 2WBMA 4A6EA 4KA4A 1T08B 1ZRDA 1HDDC 3CMMA 1FOWA 2VXZA 1V5EA 2K40A 1Z1DA 4OWRB 3V8JA 1YJ9I 1R5HA 2LY2A 5BNGA 4G7OF 1FTZA 2KHMA 1BR2A 2V9VA 1QRYA 4IHWA 1UG2A 2XHKA 1SD7A 4XQFA 3EYYA 2FOKA 4O6JA 1Z6RA 2VJ4A 2LF8A 2XGXA 1I39A 3HZJA 2O7OA 1ZG1A 1PJRA 2P7CB 4M6YA 2X0LA 4H4KC 1IJWC 2Q1ZB 1EH8A 2R5ZB 4B4CA 4I76A 2DDAA 2OJED 4IJAA 3G1LA 3KIOA 2DFFA 3OYGA 1MH4A 3H92A 2F4MB 2M34A 3T8TA 3VDXA 4A3LJ 4D5CA 2VQCA 1HSJA 4JK1X 3SDGA 4J01A 2WAFA 5CVRA 4U0VA 4PGGA 1KYZA 3DTEA 3Q0WA 4W1UA 2EIMH 2Y9YA 4FETA 2PMZA 2HS5A 4QLCU 1FOKA 3F3XA 4ENJA 4BY1J 5DUIA 1JUMA 2AQEA 3FK7A 4XORA 3VYSB 5K1YA 2DI3A 3EETA 4EVIA 1EJ9A 2ZO4A 2E1MB 4PZJA 4E7IA 3ZQGA 4XRFA 1J5YA 3LA7A 1VQ7I 4F93B 2EV6A 4OMZA 1ZKGA 2FD5A 3CCRI 3OL4A 4CHUA 1RR7A 3I4PA 2LG4A 4IPAA 5E3LA 4DNCA 2KDZA 3PQJA 3RSNA 4YIFA 3HL2A 1Z21A 1YX3A 3CDLA 5JR3A 2FXAA 5HLTA 1WI3A 3F8CA 1MKMA 4BXFA 3HHHA 1HW2A 5FD6A 4PFPA 2NS7A 4I09A 5CVUA 3CCEI 2Y9ZA 1T0FA 2EFWA 3HPGA 2VL8A 4KISA 1FYLA 2XVCA 3G71I 2O3FA 3QQAA 2QKMB 1ZYRF 4Y13A 2VUMJ 2EFPA 2V79A 2JUGA 4LITA 2D2WA 4MQVA 5HS9A 4WX9A 1GVJA 5H6QA 4GO1A 4BJ6C 3CC7I 3IL2A 4IXAA 3RKQA 3TQNA 4KMUX 1T0FC 3S1NJ 1OCZH 2HXOA 4B3XA 2WAQN 3OOPA 2MFZA 5GP9A 4XN3A 1HCRA 4B44A 1G6NA 5EZGA 1VQKI 2R7ZJ 2Z99A 4M9ZA 1BJZA 3JRDA 3RYRA 4M6XA 4H0EA 4OIPF 1P92A 2JVGA 1S7AA 3ZN1A 2M0MA 1R6RA 3FM5A 2IS4A 4XLCA 2XAHA 2QSHX 1X58A 2XROA 3LSMA 3P5JA 2XAJA 2XKOA 2MBFA 4OU0A 2GOMA 4BYYA 2N8GA 5DYMA 1VTNC 3FXUA 1ZQ3P 4G7HF 2V1UA 3QODA 1OQYA 2BXYA 4EGZA 1YJWI 1F5TA 2IGNA 1K61A 1XGNA 2I10A 3KLOA 3L2VA 3HOTA 1DPUA 4ITVA 1YO5C 4XLNF 4OMYA 1UCRA 5ICGA 4OINF 2HU9A 1W0TA 3IC7A 4LGWA 4LIUA 2WY8Q 4ZYDA 2QUFA 2FX0A 5A2QZ 3CO6C 3HHGA 2R92J 4PSXA 3TOAA 3L2QA 3CTAA 3L00A 2DTRA 3MCZA 3JRGA 1TL8A 5HDGA 3E97A 3COAC 1CF7A 1LQ1A 4A3MJ 1IV8A 3GTQJ 3M9AA 4IQJA 4LB6B 1BIAA 2K3FA 2WAQA 1T98A 1WSUA 3K70C 1F43A 1QVUA 2DMPA 3OR1C 2VBYA 4RAGA 5F0HA 2E2JJ 4MNUA 3L2UA 4HF0A 3FZVA 1MIJA 3KP6A 5J1RA 1FTTA 1U78A 2JT1A 1V55H 1TT5B 5IYCJ 1XGMA 5LGNA 3T0YA 5EG0B 2FQ4A 2IGMA 1K4TA 3MQ0A 2V7FA 1W5CC 3BZKA 3LFKA 2XF5A 3WGGA 1PP7U 1ORKA 2ZJQF 2F4OB 3EUKL 4A5NA 4UUVA 2JQ7A 4RA2A 1E17A 1RI7A 3HOYJ 1LPQA 1RR8C 1IXSB 3C2GA 2XC7A 4GYIA 5KCMA 3HDDA 4XOTA 2HPIA 2GM4A 1DP7P 2HOEA 5GPAA 3IKVA 4BGDA 3CJTB 1MMDA 5K7FA 4HRIA 5B66C 2QF7A 4DYRA 1W36D 1RRJA 4CCJA 3F0CA 4JX4A 1HOMA 4MLOA 5LGUA 2LSOA 3TO7A 1B72B 4L9VA 3GZ6A 1K6YA 3E5XA 1BI0A 2ZBKA 2DA3A 1MBKA 4UB6C 4II3A 3GUDA 2QZ8A 2VLAA 3PUFA 2QEXI 2IP2A 4P1WA 3OYKA 4J00A 2P6SA 2DO7A 3G1MA 5TRDA 4HZFA 3BG9A 2W00A 4IHXA 2K3PA 1GT0C 3RI4A 1TQPA 3BR0A 5FLVA 3ASOH 2COBA 2E1NA 3QOEA 1PVEA 2R3SA 2K9QA 2XSJC 3P9KA 3JAMZ 1BI2A 2FNAA 2STTA 5E18F 1FWZA 3VYRB 5FRNA 1VI0A 3IUOA 2F5DA 4LLLA 4E7LA 1Z77A 3EYIA 1BR1A 3I4NJ 3AFHA 2NVYJ 2V26A 3K1NA 3R0JA 2EJRA 2CMPA 3WE3A 1IXCA 1WJFA 2HKXA 2F5EA 4Y4RA 1I6XA 2EINH 4ZZDA 4RBOA 2LC2A 4PJLA 2GIZA 2QQ8A 4NC8A 3WTZA 2HOTA 2W7NA 2XIGA 3HC7A 2Q2EB 2EBIA 2XV4S 4NB5A 2EZHA 2CSOA 2W57A 2XRLA 1ZK8A 5JHFA 2VI6A 5FO5A 1V3FA 2BW3A 3PFYA 3MKZA 1WJDA 3M1EA 1R00A 1R1TA 3BP8A 1O7LA 4C2MJ 4CCMA 1O3QA 1U9NA 2H8RA 1ZELA 5DTDA 3ZRGA 5A2QK 3I64A 1OCPA 3UKGA 2P81A 2XAGA 2QKLB 3K4MA 2IA1A 2XB5A 2E7XA 4G8XA 1I5ZA 1JT0A 4A3IJ 1XC5A 3TO6A 1OYWA 1TNTA 2V6CA 3B02A 1D0YA 3DV8A 3OS2A 4I98B 4L5JA 1XB4A 3I3LA 2E5NA 3JRHA 3ZN0A 3H0GJ 5IP7J 3QU6A 4MEXF 4IKFA 5IOZA 2NVTJ 5E3MA 3PNTA 3F6VA 2LR8A 3E0JB 1Y8RB 3K6GA 3BWGA 3DKXA 2EQRA 2R5YB 1WWXA 1S7EA 4II2A 1LE8A 3EUAA 3IWFA 3ABLH 4KUMA 4GFBA 2JVHA 3M1CA 1P7JA 2MH9A 2Y75A 1E3OC 3K7AJ 2OQRA 3A01A 2OCEA 4EM1A 5L3CA 3ZQLA 3S14J 3IRQA 5GAEJ 4LK1F 1TQMA 2QQAA 4LG3A 4OIQF 2V1NA 3HJEA 4XR6A 2QENA 1EF4A 4M3FA 1V4RA 2DFIA 1XG1A 2IAIA 2LVSA 1G3TA 1VQ9I 1RC9A 3S3OA 3ZQCA 3CJNA 4E7KA 1IUFA 4RGSA 3EPZA 3MD2A 2BXZA 4HV5A 2VE9A 1AA7A 2M4GA 1FLIA 2W4SA 4GDFA 3GX4X 2DQRA 3GTGJ 4YELA 4AD9A 4UUSA 1TWHJ 2VOPA 1G3SA 3FDYA 4NDLA 1IN7A 2L9NA 2EZIA 4A0ZA 3JRIA 4MFDA 1TBXA 3J7AO 1RZ4A 3C3WA 2OBPA 3FKIJ 5IYBJ 1AU7A 3ULQB 3BG5A 2XKPA 3C2HA 4XRSG 1OJLA 2FE3A 4BL0B 3RKXA 4KITB 4IOCF 2CG4A 3ELKA 2IRFG 1YHQI 1VQ6I 3G4SI 1JT6A 2KIFA 1D1AA 2VE8A 1R4MB 3H1CA 5F64A 4AWXB 1W7PB 4EJWA 4BQQA 2HR3A 4BUPA 4HLYA 3HXLA 1ZRFA 4AYBN 4X0GA 5LEJA 1I3AA 2G7HA 2QM3A 2PEXA 2ZC2A 2A05A 3ISPA 2DTZA 4BHBA 2M87A 2K86A 1ZARA 1FT9A 5ERIA 3P9CA 3DF8A 1KU7A 1ZG3A 1U3EM 2BVMA 1MMGA 3DXJF 4KJZA 4QPOA 4YG2F 2O8XA 3CJQB 5J8FA 5H6RA 3N97A 2JA2A 3ZR8X 4WCGA 2OCCH 1Y1VJ 4WF2A 4FX4A 1DQUA 1SVMA 3JSPA 4ENNA 5CQGA 4OAZA 1FBUA 1FIAA 3UR3C 1KQ8A 4OAYA 2XGCA 3VYUB 2A5WA 2ZMEA 1I3QJ 5GADJ 3H3UA 4S04A 4NC7A 1ITYA 3BTLA 4UUTA 1VQPI 2EFOA 3R61A 3HPHA 2Y31A 1POGA 2EWNA 4LJZF 4MO7A 4ZH4F 5LLQA 2HFHA 2ZKZA 2NRAC 3ERED 3WODF 2PG4A 2Z1DA 4HF2A 3PL8A 2MA3A 1BJAA 1K79A 4MEYF 2JRMA 1MNMC 4Y15A 4ESJA 4BNCA 3REOA 1Y0NA 3OYIA 5FFXA 1W7PD 2LLKA 5TISC 2PJRB 1JTXA 4HDUA 1LE8B 3I58A 3O3KA 3W2WA 3CMAI 2HEOA 4P55A 3N4MA 5DCMA 1WFXA 2EV5A 1V5FA 3ZPLA 3KEYA 5GAHJ 3SDBA 3A01B 4IHYA 2LK2A 3NARA 1UHWA 2LH9A 1MBJA 4HAMA 2RGVA 3S1RJ 1FBSA 3LOCA 2XGEA 1IW7F 1SVLA 2RNJA 1S3JA 3WTUC 2VXDA 4NQWA 2JPBA 4Y33A 5F6FA 5TJJA 2PX9A 4P96A 3W3CA 5ILUA 5GAGJ 4CCNA 5EGOA 5DCFA 4WXDA 4HDVA 3LSPA 3GZ5A 4IQ4A 1I6HJ 4EJTA 1R9TJ 2F5CA 1R1VA 1TLHB 5DM7F 2H6CA 1D3YA 2PN6A 2XAFA 4RS8A 4A0XA 4QSHA 4ZJZA 5GTHC 2E2IJ 1J2XA 3QOPA 4DIQA 2DT6A 1VNDA 3E7LA 3GTMJ 3K1MA 4F52A 3H9GA 3LNQA 3Q5FA 3DPUA 5M5WJ 1RPWA 2CYYA 5L3DA 3GTLJ 2LD5A 2P5KA 4L18B 1BW5A 3HTSB 5D4SA 5CPRB 2VQGA 4HNUA 1IGNA 3QPLA 1KONA 3EQLF 3P7NA 4XL9A 2V4JC 5D5WB 2FSWA 3TL4X 2HNHA 5FJ8J 4XIDA 1J75A 5J40A 2K9NA 1V54H 4A5MA 2ICWG 4JX5A 2L7KA 3M07A 2A6EF 1ZGWA 1JHFA 2EZKA 2DJNA 3UNGC 3RZOJ 2CQNA 2DLLA 1Y0UA 3B6AA 5ILSA 2W25A 3KE2A 5F0CA 3C1DA 3F6OA 3S3NA 4BH9A 2L3DA 2RVCA 4C2UA 2WA0A 1DGRM 3DQVC 4L5EA 3HOZJ 3BG3A 1SVOA 1X4PA 4JQFA 4S05A 2G9WA 4FE4A 1YW8A 3K4CA 3WTWC 2LDUA 5DD4A 1R5GA 3KEQA 2EH3A 1BW6A 3H36A 5KVRA 1S6LA 1SD6A 1WI9A 3MFKA 3ESWB 3S93A 3ZQFA 3H5RA 5CVIA 2Y0MA 5ICEA 3FISA 2ZMEB 5E17F 5D5UB 2RV8A 1W4MA 2VT2A 3L7WA 3NWTA 2E5ZA 2CQXA 1EKEA 3VFZA 5FKMA 1OYIA 3KX2A 1BA5A 5K5RA 1L0OC 2KISA 3R6SA 4YFKF 1JE8A 1GV5A 3TDZC 1RKWA 3OSGA 2R93J 1I27A 5FB2A 4HG2A 4V19K 1HW5A 1XX5A 3FMRA 2V1DA 1QNTA 1Z0XA 2BY2A 1KU9A 1XMKA 4BS9A 1SMTA 4EEFG 4HSRA 4Z6YA 4QIWN 2QGUA 1PUFA 2F5VA 3RQIA 1A31A 1KGSA 5CJ9A 2OF7A 4XSZF 1YW7A 4AIKA 1MDMB 4UVAA 3K9TA 1R4NB 2VKVA 1D5YA 4WXCA 5M3MJ 2WWYA 1JI8A 3ZMTA 3SJMA 3GW2A 3KYLA 2ISYA 4IHTA 5FLXK 3WGIA 3ZGKA 1LKXA 1S8NA 1D8JA 2ESNA 2HPMA 2LOOA 1QQIA 3WG9A 3OYBA 2YR2A 1HDPA 4YFXF 5F1JA 1YI2I 3OYLA 5J47A 3LA2A 2R7QA 5CVVA 5C44J 1IN4A 2KLOA 3VEPA 3TW7A 3ZXSA 1IUYA 2HWVA 3BDDA 1SEUA 1DU6A 1XCBA 2K9SA 3H3VK 3L2RA 5HNFA 5EDNA 1AHDP 1F36A 1W1WE 2KRFA 4D7NA 4KNYA 5EEHA 2DAOA 3G2BA 4YFNF 5HS8A 1ETYA 5FGMA 3SZGA 3TDUC 3OYCA 4HPQA 1JTYA 2LY1A 4E7HA 4GGGA 5K7ZA 1J7KA 1E3HA 1ZN2A 1FEXA 2GXBA 2DA6A 1HKSA 4M9SA 2IA2A 4XLFA 2W48A 2KMUA 4WXHA 2IVMA 1UFMA 4XICA 5JVGF 3I55I 3M8FA 2E36A 1R36A 3QYBA 1JKQC 1MMNA 3QRFF 3DU5A 3R4KA 4HW0A 4WK8F 4CO8A 4DYQA 2GBYA 1BC8C 2VASA 3P9IA 4K2EA 2GXGA 1XMAA 2HXIA 4O3MA 3S16J 1YJNI 4B09A 1JXSA 5FKOA 2E1OA 4KMFA 1MSEC 1R71A 2L7ZA 3K4BA 2KIQA 3T1BA 4AC0A 1RUOA 3HIFA 5TGTA 1ZREA 1B6AA 3O8GA 2FOWA 4CCOA 4MTDA 3NAUA 1AOYA 4ZYHA 2XAQA 4B1RA 3GWZA 3V7CA 4D0PA 3OS0A 3FMQA 3WTSC 2ADUA 2YSRA 3VSKA 4ENKA 1QGPA 3QYFA 3BG6A 3QPTA 3I59A 3KYCB 2CQKA 3BR1A 5IP9J 5E3NA 4MQ9F 3JR9A 1J9IA 2BY1A 2AHQA 1Y39A 3HOUJ 3MN2A 2TDXA 3DP7A 2VBZA 4U7DA 1WH5A 2MC3A 2VQLA 1XD7A 4PJJA 1K78A 4BE2A 1RETA 1UB9A 1X19A 4L9TA 5M5XJ 5KNLA 5EEGA 2XF6A 3DBLB 2K27A 5FROA 4BQAA 2OUMA 4BJ5C 1UHMA 4RMNA 4B48A 5FKNA 2Z9OA 1A6QA 2BY0A 2HTJA 3FK6A 4FT8A 3I9V2 1MZBA 1OMIA 3G1OA 2WADA 3MZHA 3LSJA 1G2HA 3DPLC 2P5LC 1N78A 1GVDA 4EQQA 1OPCA 5E20A 3RKYA 2FMLA 2ELHA 1H9TA 3DBRB 2YPRA 4CICA 4HX7A 2Y0SA 1JKPC 3S15J 1YOVB 3BCAA 3K2ZA 3QWLA 1G59A 4I0AA 3CCJI 2MD0A 1FMWA 2DK8A 2LBFA 3GTKJ 2JTVA 3ABTA 4G6DA 1QHGA 3CMEI 4F55A 4WWCA 3FXJA 1WJBA 3KYDB 1MBGA 2BHZA 3TW6A 1FBQA 3KFWX 4XKCA 2RN7A 3GTPJ 2XRNA 2P6TA 2HVRA 3F21A 3BC8A 3BROA 1U5TA 2L7MP 3GVAA 2KIMA 4XKWA 1MJBA 3BJ6A 4C3IJ 2W84A 1FOXA 4RM2A 3GFLA 5IY5H 4EMSA 1S9HA 2CH0A 3PQKA 5E8IA 2W82A 4CXFA 4N4OB 3TGNA 3J81K 3WTTC 3G73A 2V9KA 1U5TC 2CU7A 2K4JA 1GXPA 2X6OA 4XKBA 4RB1A 4GCVA 2FRHA 1HLVA 1GV2A 2XAUA 4NNJA 3SHFA 2BVLA 2DT5A 3BT9A 3OYHA 3DKWA 3CUOA 5J4YA 5CYVA 1USSA 2D1VA 4M72A 3LMMA 3O8HA 1NH3A 5IYDJ 5HS7A 1LVAA 4A6DA 2ME6A 2A68F 2IT0A 1OCCH 3GTOJ 2XPUA 4M3GA 3SZPA 2J5PA 4A0YA 4BAYA 4ZTFA 4ZTJA 2VB6A 4DYCA 1ERDA 4C30A 3S2DJ 2F2EA 5IT9K 1WJ5A 4QTRA 2JA7J 2K9MA 3HOSA 4FHTA 2ZXJA 1G3WA 4U87A 2VONA 3OSFA 3E6DA 3CCUI 2NOGA 3Q9SA 2STWA 2DMNA 2NOJB 4X1EA 3MKYB 1QPMA 2LP0A 2XSDC 4OIOF 2O03A 4JOMA 4ASNA 2BYVE 1G3YA 2E34A 3IKTA 3BOQA 1W0UA 1Z9CA 3VOEA 1AKHA 1H89C 3ECHA 1IG7A 3ZQQA 5IP6A 2LRDA 3A03A 3V4GA 3M4OJ 3CCMI 4MFEA 5IOYA 2HQNA 3RPUD 3IP4B 3HOXJ 1OISA 1APLC 1ULYA 2R7UA 2MG4A 1F1ZA 2HYJA 3CESA 2OAZA 4LMYA 5J8CA 4IF4A 4N4NB 3AG1H 5HLHA 1HBXG 1IV6A 1I1SA 3MKWB 2VODA 4D1QA 5F27A 1GDTA 2QSGX 4ETSA 3V8KA 1FP2A 4XSXF 3AL0C 3T8RA 1YE9A 4KN7X 3TO9A 2H6BA 2D45A 1Z67A 3G3ZA 1JUPA 3HM5A 5D5VB 4DOZA 4A3FJ 3LSRA 4KDPA 1NHAA 1TC3C 2A3SA 1Z7UA 4G6TB 4IO9F 3AG4H 3WTYC 2HZDA 4PDKA 2ZCWA 5D8LB 1SAXA 2CV0A 1XDUA 4L0ZB 1D0XA 3HRUA 2BY3A 1GXQA 2MH2A 2H94A 2JN6A 4AIHA 2K4BA 4IVNA 1CF7B 1X1BA 2K85A 3ABMH 3D1NI 2VPRA 5BPDA 2BZTA 1Z91A 4G94A 2JSPA 1REPC 3I53A 1M1EB 4LOCA 3K4JA 5K5QA 1PDNC 3M3YJ 2FQ3A 1A35A 2IGKA 2FNPA 2L4MA 5BMZA 1U5TB 5D4RA 3LQRA 2FA5A 1ZHFA 3LSKA 1JJ6C 2GXAA 1QZYA 1LFBA 3CO7C 3RTRA 3WG7H 1MH3A 1D1BA 5F1RA 2RC4A 3N05A 1R1UA 1KU3A 2JWTA 5JHUA 1U0JA 1P2FA 5HOOA 3SEZA 3MKLA 2EZLA 2DW4A 3E6BA 2M4KA 3LQQA 3HTUA 5J3LA 2CWEA 2L9SA 2O5RA 4XLAA 1YYVA 1ETXA 3HSEA 4RAYA 1LEAA 5FLMJ 1I1GA 4BE1A 3K4LA 3L2CA 3W2AA 4RDUA 3K70D 1YIOA 1MMAA 4XRSA 3ECOA 1T6SA 1E2XA 5EJCA 5B1BH 3J80K 3DU6A 1SD4A 2JA5J 1R23A 4F3QA 1XSVA 4UHTA 3ZQHA 1Y56A 1YRNA 2VQHA 3H0DA 5KAFC 1JGGA 4BU2A 1EH6A 1MNEA 3CLQA 2ZXWH 4LG0A 2OV7A 2H1KA 2CS3A 2JZYA 1ODDA 2R7SA 2CJJA 1HQCA 2WV0A 3BPXA 3BY6A 1KZHA 4U7BA 1K7AA 3G6EI 1LEBA 4BEHA 5J1YA 3QPSA 3S2WA 5LRRA 3CLOA 3A4CA 2FF4A 1LFUP 5F08A 4XNFA 4CZZA 5D8KB 2EFNA 1E3PA 3KETA 1AKHB 2X9DA 2LF7A 1FSHA 3ZMUA 2HVQA 2VKEA 1ETQA 1VQMI 1MJ9A 3JW4A 1HW1A 3CCSI 2ZJRF 2BBYA 1ACIA 1T39A 3L2WA 3I0TA 5ICFA 4BBSJ 3OMYA 1G4DA 3IV5A 3KP7A 2LNBA 2Z16A 3K69A 2XPWA 3OYJA 2DMQA 2X6WA 1IAWA 4AVPA 2M3AA 3PUBA 1RIOH 3HGGA 3ZMSA 3K2AA 2VJJA 4DZJA 5BOXA 3LA3A 3T5XA 3B6CA 1TWGJ 3NRVA 5E3OA 2PLYA 2P0WA 4QWQA 2XF7A 1P4WA 2B7EA 2G0EA 3OIOA 1BR4A 3OL3A 4IRGA 1NK3P 1ETVA 1ONVA 3LSGA 2KT0A 1WKMA 4IHSA 2JK3A 4HQMA 2BW3B 1WZ2A 4PSWA 4AU7A 4RGXA 1BN5A 2A6HF 1H8AC 3IWZA 3IH4A 3E5UA 4LFUA 4CA0A 4W97A 5CVJA 9ANTA 3VWBA 5JLWA 4A3EJ 5DEQA 4I99C 1JGSA 2A07F 3LFUA 4HV6A 2DA1A 2X85A 2HYFA 2ID6A 2RKHA 2XUBA 1WPKA 2QBYA 3A2KA 2MLKA 2EIJH 2I8DA 2ELKA 4MTEA 3F8NA 1HKTA 3VB2A 1IN6A 3OYNA 1MMSA 2COMA 2L7FP 4EJVA 1LDJA 1YW9A 2O0YA 4E70A 4M3EA 4RB0A 2LFBA 2K02A 2GZWA 2HGCA 2R7OA 2IXSA 5KAIC 2W85A 3PJRA 2DODA 3RIRA 1VQOI 2PFBA 3ABKH 2R7VA 1NTCA 4XOPA 2PJPA 2ZFUA 4M6VA 4XM3A 3X2QH 1MBFA 3W6KB 3GO5A 5H20A 2CV2A 2ETHA 3E1SA 1CQTA 3HUGA 5FKKA 2A61A 5E79C 4UVCA 1MJAA 5FLXZ 3BTJA 1B4AA 1EH7A 3KCCA 5FFZA 4G9YA 2GA1A 2EB7A 3H5AA 2E35A 2KIUA 3DTIA 5BS6A 4UB8C 4XONA 1XGOA 1ENHA 3R0AA 2M2EA 3ROUA 2K9LA 5EEAA 2DCEA 5K5OA 1YRNB 3FXMA 1R7JA 2BOLA 3PSFA 4XN0A 3WTXC 3NQOA 1T33A 3JSOA 4LG0B 5J4VA 2VPLA 4HQEA 3RCOA 3LAJA 1X1PA 2QLZA 4ESFA 2JA6J 4L9NA 4F92B 1DU0A 4U88A 2BEOA 1OFCX 1JHHA 2LMDA 2GA2A 4J19A 2L9VA 2HOAA 3DFGA 2DFHA 4Q48A 1Y8QB 4UUSB 4A3GJ 2R5ZA 4KFCA 2R7TA 1Z3YA 2NXNB 3S1MJ 3CJRB 1LNWA 2MSYA 1WVRA 4DBQA 1R5ID 4L5IA 3BJOA 3KZZA 5FD5A 4V2GA 3PFIA 2HQ5A 2DPUA 3L09A 2BHYA 5M3FJ 3SQNA 4CH7A 3JCUC 1BL0A 2O6GE 2DYSH 4HX4A 1KQ0A 4AVZA 3QYEA 2E60A 4BDYA 1LDKB 2HYGD 2LKSA 2KL4A 3FXOA 5D6FA 4CCLA 1QVTA 2P7VB 4KT5C 2D5VA 3DEWA 5C4XJ 1WQ2A 4XMYA 2JJ7A 1XDSA 3KZIC 2DBBA 1WJEA 3GFJA 2ID3A 4I02A 4HX8A 3DPTA 3WU0A 4HEA2 1EV7A 1XGSA 4ZDOA 1XSXA 4BE0A 1JUSA 2E1MC 2HDCA 1QO0D 3IAM2 5LRSA 2RNGA 1ZRCA 5F04A 1LVKA 2QBYB 1IC8A 3OYMA 1SAUA 5BQTA 1FPQA 4FTHA 2HDDA 3MWMA 5LGTA 4Y3OA 3AAFA 2TCTA 4M73A 2V6EA 4PCQA 3OYDA 4IEJA 2LTPA 3OWTA 3PIPF 2AQFA 3BCBA 3DEUA 4IZZA 3CCLI 2F6CA 4D7MA 4FCYA 5LFAA 4L0YB 3GMEA 2DT7B 2WV1A 4LIVA 1OCOH 1QZEA 3TEDA 2R7XA 3L9FA 1BI3A 1TNSA 1LJ9A 3JRCA 1HC8A 5EYRA 3LWFA 4MGRA 1FIPA 3S32A 4Y7NJ 2E19A 2M30A 4ABZA 3F8FA 1P4AA 3BTCA 3CC2I 1XTAA 3FXRA 4YRVA 1XCVA 5B5EC 4XLPF 1B1BA 2D1HA 3GBGA 3HUGB 4LLNA 1SFOJ 2G7UA 1SFUA 5DCMB 1A5JA 5JVTA 2OZ6A 1D1CA 2WAEA 3S8PA 4EV0A 3KEOA 5JI6A 1K6OA 4RB2C 3W6VA 3CF5F 2NVQJ 5E1ZB 1BM9A 5LHGA 1X4OA 2CO5A 3KP2A 3OS1A
chains in the Genus database with same CATH topology
1GUUA 2Y30A 3SFIA 3WHCA 1MBGA 3TW6A 1UHSA 3GTPJ 3BQZA 4DW6A 3JRHA 4A3KJ 5IP7J 3H0GJ 5EGOB 3RZDJ 5IOZA 2L7MP 3Q3SA 2JMWA 4BKXA 2DA4A 4C3IJ 5E3MA 2NVTJ 2LR8A 1MBEA 5C3EJ 4JP0A 2CUFA 3Q0UA 1VF9A 2EQRA 2R5YB 1S7EA 3HB9A 1LE8A 1ETWA 1TWCJ 4A93J 4GFBA 2AO9A 3HOVJ 2CU7A 2YS9A 1A6IA 1P7JA 1RESA 2X6OA 5J1UA 1E3OC 1HLVA 3K7AJ 3A01A 1GV2A 2DN0A 3ZQLA 3S14J 3BT9A 3ZOBA 2NVXJ 1MBHA 2DA2A 1EF4A 1RKTA 4M3FA 1XG1A 1ETOA 2IAIA 2LVSA 3O8HA 5IYDJ 4JX6A 2ME6A 1JKOC 3ZQCA 3GTOJ 2DMUA 2XPUA 4M3GA 1IUFA 2B63J 5EG0A 4DYCA 2HOSA 2O9LA 1WGXA 3BR5A 3S2DJ 2Y0SN 4AUXA 3DCFA 4QTRA 2XB0X 2M9HA 2JA7J 2XGDA 3BTIA 1VFCA 3GTGJ 1HF0A 4UUSA 3OSFA 2NOGA 1TWHJ 2DMNA 4X1EA 3HGYA 4NDLA 2EZIA 1I50J 2LP0A 2XSDC 3JRIA 4MFDA 4A3BJ 4BBRJ 3FKIJ 5IYBJ 3S2HJ 1AU7A 1W0UA 3BG5A 3JRAA 1H89C 1Y1WJ 1AKHA 1IG7A 4M3BA 4XRSG 1OJLA 5IP6A 4A3DJ 3FIWA 3A03A 3M4OJ 4X6AJ 4MFEA 5IOYA 4XK4A 1APLC 3HOXJ 1X2NA 1JT6A 4B3AA 1B72A 2MG4A 5JLXA 2HYJA 5EF6A 1UMQA 3CCYA 3JRFA 2X48A 1IV6A 4I6ZA 1ZR2A 4AYBN 1TWFJ 3HKZN 2DA7A 3A02A 1GDTA 5F27A 1O4XA 3JRBA 4JYKA 2DTZA 1WCMJ 2PMZN 2Y2ZA 1JUPA 2ECCA 3HM5A 3VPRA 5C4JJ 4A3FJ 3LSRA 1PUFB 1TC3C 2ZB9A 2YUSA 1Y1VJ 3ZQIA 2GLOA 1JKRC 2MGQA 2RAEA 1FIAA 1MSFC 3TP3A 5EZHA 5DS9A 2XGCA 1JJ8C 1IDYA 1XS9A 1I3QJ 2JN6A 2L9RA 3IH3A 3D1NI 2VPRA 1WH7A 3MVPA 2MW8A 1ITYA 3BTLA 3OOUA 4UUTA 4LOCA 1HDDC 2R0QC 3M3YJ 2Y31A 1POGA 2K40A 4MO7A 5BNGA 4A3CJ 1FTZA 1JJ6C 1LFBA 4Y52J 1QRYA 1MNMC 4IHWA 1MH3A 1UG2A 4DZPA 2LY9A 2LLKA 1JTXA 2JWTA 1LE8B 2L0KA 2O7OA 3MKLA 4FE7A 4A69C 2EZLA 5M5YJ 2HI3A 3BR2A 2IEKA 5J3LA 1IJWC 2R5ZB 4B4CA 4I76A 1ETKA 3A01B 4IHYA 3G1LA 2LK2A 1ETXA 3NARA 3CMYA 2IBDA 1MBJA 5FLMJ 1MH4A 2M34A 3S1RJ 3LOCA 2XGEA 4A3LJ 4D5CA 2JA8J 2CRGA 3SDGA 3C2BA 4RDUA 4XRSA 3Q0WA 4W1UA 2Y9YA 2M8GX 5EGOA 2JA5J 3ZQHA 3LSPA 1YRNA 1I6HJ 4BY1J 3BR6A 1R9TJ 1JUMA 3FK7A 1JGGA 2E2HJ 4M3DA 2LKXA 1P7IA 2H1KA 4QSHA 2E2IJ 3GTMJ 3S1QJ 2CJJA 1VNDA 3E7LA 3ZQGA 1IRZA 2R5YA 3LNQA 1ZKGA 2FD5A 1RR7A 5M5WJ 1NK2P 3HOWJ 5J1YA 1RPWA 5E3LA 2KDZA 3QPSA 3GTLJ 1ZTRA 2LD5A 1LFUP 1BW5A 3CDLA 5F08A 1SANA 1WI3A 1IGNA 3QPLA 2NS7A 1AKHB 2Y9ZA 5FJ8J 4XIDA 2O8KA 2X9DA 2K9NA 2VKEA 4JX5A 1ETQA 3CQZJ 3QQAA 1ZGWA 3I4MJ 2VUMJ 2EZKA 2DJNA 4BBSJ 3RZOJ 3B6AA 3HEFA 3IV5A 3RKQA 1ZR4A 2XPWA 2DMQA 5F0CA 1B8IA 3HGGA 3K2AA 3S1NJ 3Q0VA 2HXOA 4DZJA 1OCTC 4CYCA 2M0CA 2WAQN 3B6CA 1TWGJ 5E3OA 4L5EA 4C3JJ 3HOZJ 3BG3A 5GP9A 1FJLA 2ME0A 2G0EA 3OIOA 4FE4A 1NK3P 1ETVA 3GTJJ 1HCRA 2EH3A 1BW6A 5EZGA 3LSGA 2KT0A 2R7ZJ 5HODA 1BJZA 2JK3A 2ECBA 3JRDA 3ZQFA 2NS8A 1H8AC 3FISA 3IH4A 4W97A 9ANTA 5JLWA 4A3EJ 1X58A 2DA1A 2ID6A 2CQXA 1WPKA 5FKMA 1BA5A 4BXXJ 2N8GA 2ELKA 3PO2J 1ZQ3P 2L7FP 1GV5A 1RKWA 3OSGA 2R93J 4M3EA 1K61A 2LFBA 2I10A 3JREA 1IDZA 1Z0XA 1T56A 4EEFG 4QIWN 1W0TA 1PUFA 1NTCA 3BQYA 3RQIA 4M6VA 3TP0A 2FX0A 2OF7A 2QCOA 1MBFA 2R92J 4BY7J 1X2MA 2VKVA 1D5YA 5M3MJ 1CQTA 5FKKA 3JRGA 5GPCA 3SJMA 1K83J 4V2FA 3BTJA 4A3MJ 3GTQJ 4C3HJ 1HDPA 5F1JA 1F43A 3PM1A 1QVUA 2DMPA 5C44J 1ENHA 5F0HA 2M2EA 2E2JJ 5EEAA 1YRNB 3TW7A 1DU6A 5J1RA 1FTTA 2K9SA 1U78A 3H3VK 1T33A 5IYCJ 5EDNA 1TWAJ 2CQQA 1AHDP 1F36A 4D7NA 5EG0B 2FQ4A 2JA6J 1DU0A 1ETYA 2WB1N 1OFCX 1JTYA 1ORKA 2FJ1A 4J19A 5K7ZA 2HOAA 1FEXA 4D5FA 4UUSB 4A3GJ 4S0HB 2R5ZA 4HNVA 3HOYJ 2DA6A 2W48A 2TRTA 3HDDA 3S1MJ 1U9OA 2GM4A 2MSYA 4XICA 2CUEA 5GPAA 5K7FA 2QF7A 2DMTA 4V2GA 1JKQC 2HQ5A 4DYRA 4G12A 3F0CA 3BR3A 4DYQA 2GBYA 5M3FJ 2HXIA 4JX4A 3S16J 1HOMA 4FISA 4MLOA 5FKOA 1B8IB 1BL0A 2E1OA 1B72B 1MSEC 2DA3A 2L7ZA 1MBKA 5FKLA 4CYCB 4AC0A 2DA5A 3O8GA 1QVTA 2D5VA 3NAUA 3DEWA 5C4XJ 4B1RA 2JJ7A 3G1MA 1U8BA 3BG9A 4IHXA 3PO3J 2ID3A 1GT0C 3BR1A 5IP9J 5E3NA 1QPIA 3BR0A 5FLVA 3JR9A 2COBA 1JUSA 2K9QA 3WHBA 3L1PA 2AHQA 5F04A 3HOUJ 3MN2A 1VI0A 1IC8A 1Z77A 4A3JJ 4FTHA 1WH5A 3I4NJ 2HDDA 2NVYJ 2TCTA 1RETA 4IEJA 2LTPA 5M5XJ 4MIMA 4D7MA 4FCYA 2WV1A 3TEDA 4RBOA 5FKNA 3FK6A 5K7HA 2HOTA 1H88C 3G1OA 3JRCA 5EYRA 1FIPA 3S17J 4Y7NJ 2E19A 2EBIA 1Q1VA 4ABZA 3LSJA 1G2HA 3IH2A 3BTCA 1GVDA 2EZHA 2XRLA 1ZK8A 5F0FA 2VI6A 4IHVA 2OPTA 3GBGA 3HBLA 4C2MJ 1SFOJ 2YU9J 1U9NA 2H8RA 5DTDA 1A5JA 1OCPA 1JKPC 3S15J 3UKGA 4XRMA 2P81A 3W6VA 2XB5A 2XPVA 2NVQJ 1JT0A 4A3IJ 1XC5A 5IPAA 3GTKJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GUU A;  2Y30 A;  3SFI A;  3WHC A;  1MBG A;  3TW6 A;  1UHS A;  3GTP J;  3BQZ A;  4DW6 A;  3JRH A;  4A3K J;  5IP7 J;  3H0G J;  5EGO B;  3RZD J;  5IOZ A;  2L7M P;  3Q3S A;  2JMW A;  4BKX A;  2DA4 A;  4C3I J;  5E3M A;  2NVT J;  2LR8 A;  1MBE A;  5C3E J;  4JP0 A;  2CUF A;  3Q0U A;  1VF9 A;  2EQR A;  2R5Y B;  1S7E A;  3HB9 A;  1LE8 A;  1ETW A;  1TWC J;  4A93 J;  4GFB A;  2AO9 A;  3HOV J;  2CU7 A;  2YS9 A;  1A6I A;  1P7J A;  1RES A;  2X6O A;  5J1U A;  1E3O C;  1HLV A;  3K7A J;  3A01 A;  1GV2 A;  2DN0 A;  3ZQL A;  3S14 J;  3BT9 A;  3ZOB A;  2NVX J;  1MBH A;  2DA2 A;  1EF4 A;  1RKT A;  4M3F A;  1XG1 A;  1ETO A;  2IAI A;  2LVS A;  3O8H A;  5IYD J;  4JX6 A;  2ME6 A;  1JKO C;  3ZQC A;  3GTO J;  2DMU A;  2XPU A;  4M3G A;  1IUF A;  2B63 J;  5EG0 A;  4DYC A;  2HOS A;  2O9L A;  1WGX A;  3BR5 A;  3S2D J;  2Y0S N;  4AUX A;  3DCF A;  4QTR A;  2XB0 X;  2M9H A;  2JA7 J;  2XGD A;  3BTI A;  1VFC A;  3GTG J;  1HF0 A;  4UUS A;  3OSF A;  2NOG A;  1TWH J;  2DMN A;  4X1E A;  3HGY A;  4NDL A;  2EZI A;  1I50 J;  2LP0 A;  2XSD C;  3JRI A;  4MFD A;  4A3B J;  4BBR J;  3FKI J;  5IYB J;  3S2H J;  1AU7 A;  1W0U A;  3BG5 A;  3JRA A;  1H89 C;  1Y1W J;  1AKH A;  1IG7 A;  4M3B A;  4XRS G;  1OJL A;  5IP6 A;  4A3D J;  3FIW A;  3A03 A;  3M4O J;  4X6A J;  4MFE A;  5IOY A;  4XK4 A;  1APL C;  3HOX J;  1X2N A;  1JT6 A;  4B3A A;  1B72 A;  2MG4 A;  5JLX A;  2HYJ A;  5EF6 A;  1UMQ A;  3CCY A;  3JRF A;  2X48 A;  1IV6 A;  4I6Z A;  1ZR2 A;  4AYB N;  1TWF J;  3HKZ N;  2DA7 A;  3A02 A;  1GDT A;  5F27 A;  1O4X A;  3JRB A;  4JYK A;  2DTZ A;  1WCM J;  2PMZ N;  2Y2Z A;  1JUP A;  2ECC A;  3HM5 A;  3VPR A;  5C4J J;  4A3F J;  3LSR A;  1PUF B;  1TC3 C;  2ZB9 A;  2YUS A;  1Y1V J;  3ZQI A;  2GLO A;  1JKR C;  2MGQ A;  2RAE A;  1FIA A;  1MSF C;  3TP3 A;  5EZH A;  5DS9 A;  2XGC A;  1JJ8 C;  1IDY A;  1XS9 A;  1I3Q J;  2JN6 A;  2L9R A;  3IH3 A;  3D1N I;  2VPR A;  1WH7 A;  3MVP A;  2MW8 A;  1ITY A;  3BTL A;  3OOU A;  4UUT A;  4LOC A;  1HDD C;  2R0Q C;  3M3Y J;  2Y31 A;  1POG A;  2K40 A;  4MO7 A;  5BNG A;  4A3C J;  1FTZ A;  1JJ6 C;  1LFB A;  4Y52 J;  1QRY A;  1MNM C;  4IHW A;  1MH3 A;  1UG2 A;  4DZP A;  2LY9 A;  2LLK A;  1JTX A;  2JWT A;  1LE8 B;  2L0K A;  2O7O A;  3MKL A;  4FE7 A;  4A69 C;  2EZL A;  5M5Y J;  2HI3 A;  3BR2 A;  2IEK A;  5J3L A;  1IJW C;  2R5Z B;  4B4C A;  4I76 A;  1ETK A;  3A01 B;  4IHY A;  3G1L A;  2LK2 A;  1ETX A;  3NAR A;  3CMY A;  2IBD A;  1MBJ A;  5FLM J;  1MH4 A;  2M34 A;  3S1R J;  3LOC A;  2XGE A;  4A3L J;  4D5C A;  2JA8 J;  2CRG A;  3SDG A;  3C2B A;  4RDU A;  4XRS A;  3Q0W A;  4W1U A;  2Y9Y A;  2M8G X;  5EGO A;  2JA5 J;  3ZQH A;  3LSP A;  1YRN A;  1I6H J;  4BY1 J;  3BR6 A;  1R9T J;  1JUM A;  3FK7 A;  1JGG A;  2E2H J;  4M3D A;  2LKX A;  1P7I A;  2H1K A;  4QSH A;  2E2I J;  3GTM J;  3S1Q J;  2CJJ A;  1VND A;  3E7L A;  3ZQG A;  1IRZ A;  2R5Y A;  3LNQ A;  1ZKG A;  2FD5 A;  1RR7 A;  5M5W J;  1NK2 P;  3HOW J;  5J1Y A;  1RPW A;  5E3L A;  2KDZ A;  3QPS A;  3GTL J;  1ZTR A;  2LD5 A;  1LFU P;  1BW5 A;  3CDL A;  5F08 A;  1SAN A;  1WI3 A;  1IGN A;  3QPL A;  2NS7 A;  1AKH B;  2Y9Z A;  5FJ8 J;  4XID A;  2O8K A;  2X9D A;  2K9N A;  2VKE A;  4JX5 A;  1ETQ A;  3CQZ J;  3QQA A;  1ZGW A;  3I4M J;  2VUM J;  2EZK A;  2DJN A;  4BBS J;  3RZO J;  3B6A A;  3HEF A;  3IV5 A;  3RKQ A;  1ZR4 A;  2XPW A;  2DMQ A;  5F0C A;  1B8I A;  3HGG A;  3K2A A;  3S1N J;  3Q0V A;  2HXO A;  4DZJ A;  1OCT C;  4CYC A;  2M0C A;  2WAQ N;  3B6C A;  1TWG J;  5E3O A;  4L5E A;  4C3J J;  3HOZ J;  3BG3 A;  5GP9 A;  1FJL A;  2ME0 A;  2G0E A;  3OIO A;  4FE4 A;  1NK3 P;  1ETV A;  3GTJ J;  1HCR A;  2EH3 A;  1BW6 A;  5EZG A;  3LSG A;  2KT0 A;  2R7Z J;  5HOD A;  1BJZ A;  2JK3 A;  2ECB A;  3JRD A;  3ZQF A;  2NS8 A;  1H8A C;  3FIS A;  3IH4 A;  4W97 A;  9ANT A;  5JLW A;  4A3E J;  1X58 A;  2DA1 A;  2ID6 A;  2CQX A;  1WPK A;  5FKM A;  1BA5 A;  4BXX J;  2N8G A;  2ELK A;  3PO2 J;  1ZQ3 P;  2L7F P;  1GV5 A;  1RKW A;  3OSG A;  2R93 J;  4M3E A;  1K61 A;  2LFB A;  2I10 A;  3JRE A;  1IDZ A;  1Z0X A;  1T56 A;  4EEF G;  4QIW N;  1W0T A;  1PUF A;  1NTC A;  3BQY A;  3RQI A;  4M6V A;  3TP0 A;  2FX0 A;  2OF7 A;  2QCO A;  1MBF A;  2R92 J;  4BY7 J;  1X2M A;  2VKV A;  1D5Y A;  5M3M J;  1CQT A;  5FKK A;  3JRG A;  5GPC A;  3SJM A;  1K83 J;  4V2F A;  3BTJ A;  4A3M J;  3GTQ J;  4C3H J;  1HDP A;  5F1J A;  1F43 A;  3PM1 A;  1QVU A;  2DMP A;  5C44 J;  1ENH A;  5F0H A;  2M2E A;  2E2J J;  5EEA A;  1YRN B;  3TW7 A;  1DU6 A;  5J1R A;  1FTT A;  2K9S A;  1U78 A;  3H3V K;  1T33 A;  5IYC J;  5EDN A;  1TWA J;  2CQQ A;  1AHD P;  1F36 A;  4D7N A;  5EG0 B;  2FQ4 A;  2JA6 J;  1DU0 A;  1ETY A;  2WB1 N;  1OFC X;  1JTY A;  1ORK A;  2FJ1 A;  4J19 A;  5K7Z A;  2HOA A;  1FEX A;  4D5F A;  4UUS B;  4A3G J;  4S0H B;  2R5Z A;  4HNV A;  3HOY J;  2DA6 A;  2W48 A;  2TRT A;  3HDD A;  3S1M J;  1U9O A;  2GM4 A;  2MSY A;  4XIC A;  2CUE A;  5GPA A;  5K7F A;  2QF7 A;  2DMT A;  4V2G A;  1JKQ C;  2HQ5 A;  4DYR A;  4G12 A;  3F0C A;  3BR3 A;  4DYQ A;  2GBY A;  5M3F J;  2HXI A;  4JX4 A;  3S16 J;  1HOM A;  4FIS A;  4MLO A;  5FKO A;  1B8I B;  1BL0 A;  2E1O A;  1B72 B;  1MSE C;  2DA3 A;  2L7Z A;  1MBK A;  5FKL A;  4CYC B;  4AC0 A;  2DA5 A;  3O8G A;  1QVT A;  2D5V A;  3NAU A;  3DEW A;  5C4X J;  4B1R A;  2JJ7 A;  3G1M A;  1U8B A;  3BG9 A;  4IHX A;  3PO3 J;  2ID3 A;  1GT0 C;  3BR1 A;  5IP9 J;  5E3N A;  1QPI A;  3BR0 A;  5FLV A;  3JR9 A;  2COB A;  1JUS A;  2K9Q A;  3WHB A;  3L1P A;  2AHQ A;  5F04 A;  3HOU J;  3MN2 A;  1VI0 A;  1IC8 A;  1Z77 A;  4A3J J;  4FTH A;  1WH5 A;  3I4N J;  2HDD A;  2NVY J;  2TCT A;  1RET A;  4IEJ A;  2LTP A;  5M5X J;  4MIM A;  4D7M A;  4FCY A;  2WV1 A;  3TED A;  4RBO A;  5FKN A;  3FK6 A;  5K7H A;  2HOT A;  1H88 C;  3G1O A;  3JRC A;  5EYR A;  1FIP A;  3S17 J;  4Y7N J;  2E19 A;  2EBI A;  1Q1V A;  4ABZ A;  3LSJ A;  1G2H A;  3IH2 A;  3BTC A;  1GVD A;  2EZH A;  2XRL A;  1ZK8 A;  5F0F A;  2VI6 A;  4IHV A;  2OPT A;  3GBG A;  3HBL A;  4C2M J;  1SFO J;  2YU9 J;  1U9N A;  2H8R A;  5DTD A;  1A5J A;  1OCP A;  1JKP C;  3S15 J;  3UKG A;  4XRM A;  2P81 A;  3W6V A;  2XB5 A;  2XPV A;  2NVQ J;  1JT0 A;  4A3I J;  1XC5 A;  5IPA A;  3GTK J; 
#chains in the Genus database with same CATH topology
 1GUU A;  2Y30 A;  3SFI A;  3KP4 A;  4NQW B;  2Y69 H;  2AXL A;  1B9M A;  2LKP A;  4HBL A;  4A3K J;  2VJI A;  5EGO B;  1IRX A;  1R22 A;  2X6Y A;  2R7W A;  4I01 A;  2WTE A;  2MAB A;  4Y17 A;  3NWS A;  3Q3S A;  1S7O A;  4KIC A;  2DA4 A;  2UV1 A;  2KJC A;  3DTK A;  3LSI A;  3OIQ A;  1MBE A;  3CP8 A;  4JP0 A;  2VBX A;  4BAC A;  1R58 A;  1VQ8 I;  2KRC A;  1X3Z B;  2KZV A;  3HB9 A;  1S5L C;  3FBN B;  3AG3 H;  1VQ5 I;  2AS5 F;  1ETW A;  3J81 Z;  1TWC J;  2Z2S B;  3WU2 C;  1TZL A;  1X3W B;  3GLX A;  2KFD A;  2YS9 A;  4E6K G;  1TQI A;  5J1U A;  4RGU A;  4MHG A;  1UZC A;  1FYM A;  2F5F A;  4P9U A;  4RGR A;  4Q4Z F;  1BIB A;  1N75 A;  3K0L A;  1QZZ A;  3ZOB A;  1UG0 A;  5E8G A;  4R1H A;  2DA2 A;  2F48 A;  2KQR A;  3E6C C;  3EUH A;  1W36 C;  1RKT A;  4UY8 I;  2O61 A;  4PFO A;  3SZT A;  3H5N A;  2XDV A;  3KPH A;  4EGY A;  5E1W A;  3HSF A;  1JKO C;  1SFE A;  2E71 A;  3OIP A;  1D5V A;  1YX5 A;  1LDD A;  2RQQ A;  5EG0 A;  1OKR A;  2O9L A;  2FUG 2;  3QP5 A;  3SYT A;  5IT9 Z;  2Y0S N;  4AUX A;  3DCF A;  3RPU A;  5HDK A;  4YIR X;  2XB0 X;  2M9H A;  1ON1 A;  3EUH C;  3BTI A;  2WY7 Q;  1VZ0 A;  2QWW A;  3U9G A;  2CW0 F;  1HF0 A;  3SFZ A;  4EM2 A;  4NBQ A;  2A5Y B;  5J6X A;  4N9H A;  3HGY A;  2NVU B;  2HQA A;  2IGO A;  1ZLK A;  1I50 J;  4IRH A;  3GXO A;  3SXY A;  2DOF A;  2VOO A;  2GIV A;  2ELJ A;  2QQB A;  4EM0 B;  4BBR J;  2P8T A;  5B3S H;  3S2H J;  1LFP A;  2EIL H;  1U6G A;  5LEK A;  3CCQ I;  1QBJ A;  2E1C A;  2UWM A;  1OYY A;  2R7R A;  3H3Z A;  2RQP A;  2OTJ I;  1T8I A;  5DDG A;  4X6A J;  2CUJ A;  3F9K A;  3BPV A;  4FQG A;  4XKV A;  4B3A A;  2J5O A;  2RRE A;  1B72 A;  3F23 A;  3VSL A;  5JLX A;  3F22 A;  1XMX A;  2UXX A;  1P9Q C;  4ZZL A;  5EF6 A;  4B43 A;  1UMQ A;  3CCY A;  2CGP A;  3IHU A;  1BC7 C;  1FP1 D;  2L5Q A;  4I6Z A;  1ZR2 A;  2VKD A;  2M7A A;  1WHU A;  1TWF J;  3HKZ N;  3K1P A;  4BQN A;  5L3G A;  1O4X A;  4NHJ A;  5HLI A;  3JRB A;  4JYK A;  1WCM J;  3H9J A;  2NNN A;  4BHP A;  1O3R A;  2H09 A;  4A2U A;  2ECC A;  3OY9 A;  4RLF A;  3VPR A;  3WE2 A;  2QSF X;  1V5G A;  1PUF B;  2DFE A;  4KIF A;  4AID A;  3ONQ A;  5ED4 A;  3ZQI A;  3TMO A;  3QAH A;  4CUG A;  5LHI A;  3GEZ A;  5B1A H;  3F72 A;  1JJ8 C;  3FM3 A;  2PMU A;  1IDY A;  1XS9 A;  2EIK H;  2L2O A;  5DV5 A;  2EFQ A;  4XBF A;  2EK5 A;  2QVO A;  1WH7 A;  1GHC A;  2MW8 A;  4G6Q A;  4TV7 A;  4M74 A;  2BGC A;  5AON A;  1XN7 A;  2ZNZ A;  4U0Y A;  1G8X A;  3V7R A;  2UUZ A;  4RB3 C;  2R0Q C;  4CSW A;  3ZMD A;  3PNY A;  3D0S A;  2Q2E A;  4A3C J;  2XAS A;  4KIG A;  2M45 A;  3PNV A;  4Y52 J;  1XSD A;  2X6X A;  1MW7 A;  4ANJ A;  2ZSI B;  3HSR A;  4DZP A;  2K7L A;  2LY9 A;  4LD5 A;  5L3F A;  3M8E A;  2L0K A;  1TW3 A;  1FSE A;  2W1O A;  4FE7 A;  4A69 C;  4NC6 A;  5CLS A;  3LL7 A;  5M5Y J;  2HI3 A;  2HQR A;  3BR2 A;  3DWL E;  2IEK A;  3OYA A;  3AG2 H;  3CDI A;  1ETK A;  2VN2 A;  2Q8K A;  1IN8 A;  3RPQ A;  1SC7 A;  3BG7 A;  1FZP B;  1Q1H A;  4UV9 A;  2IBD A;  1TP4 A;  5DM6 F;  3CMY A;  1W5S A;  1Z7L A;  2CFX A;  3K4N A;  2VBW A;  2FBH A;  3HKZ A;  2DXI A;  2JA8 J;  2CRG A;  3C2B A;  5H2F C;  1HKQ A;  4ZYG A;  3J80 Z;  2M8G X;  4HLX A;  4CCK A;  4LK0 F;  1F4K A;  2M1B A;  3W6J B;  1FYK A;  2KDO A;  3BR6 A;  1T38 A;  4ZYA A;  1YS6 A;  1ON2 A;  1LB2 A;  3CP2 A;  4U0W A;  5D6E A;  3DLL F;  2E2H J;  4M3D A;  2LKX A;  1P7I A;  5CKT A;  3CF2 A;  3OV8 A;  4KN4 X;  3S1Q J;  3JTG A;  2EA2 A;  2GQQ A;  2R5Y A;  1IRZ A;  2IS2 A;  3VYT B;  1NK2 P;  3HOW J;  1WRJ A;  2JRT A;  1X1A A;  1QHH D;  4FX0 A;  2HVS A;  1ZTR A;  2CQ7 A;  1J09 A;  1N25 A;  2P5V A;  3J7Z I;  1SAN A;  4C2T A;  3I59 B;  4I2O A;  3ABU A;  3TOB A;  4BQO A;  2YX7 A;  1RNL A;  1E0E A;  1S29 A;  2IJL A;  3GF2 A;  2O8K A;  4HA8 A;  3TKY A;  2IS6 A;  3CQZ J;  3PIO F;  5IT3 A;  4QPQ A;  2ESH A;  3FHN A;  3I4M J;  4UNO A;  2PI0 A;  6PAX A;  4CDG A;  1U2W A;  1K78 B;  1NG6 A;  3HEF A;  1ZR4 A;  1S72 I;  3LSH A;  1N77 A;  1B8I A;  3Q0V A;  1P6R A;  1OCT C;  1X3U A;  4PJN A;  4CYC A;  1UJ8 A;  2M0C A;  5AIP A;  1TW2 A;  2JUC A;  2PMH A;  3RYP A;  5KHD A;  4Q5S F;  4C3J J;  3FXL A;  4GRI A;  4AIJ A;  4ENM A;  1FJL A;  2ME0 A;  3D5L A;  1QU3 A;  3ZQ7 A;  1IRG A;  1P4X A;  4E7S A;  4LB5 A;  2ZXH A;  1ZGJ A;  4R8H A;  2IA0 A;  3GTJ J;  4UXN A;  1SFX A;  3DLA A;  3E6M A;  5HOD A;  1K4S A;  2ZFW A;  2B9S A;  2DK5 A;  2ECB A;  4RLQ A;  1OR7 A;  2NS8 A;  5JFR A;  4IX7 A;  3C18 A;  3F8M A;  2IPQ X;  2BV6 A;  3CC4 I;  1BI1 A;  2OZU A;  3O6B B;  2X1D A;  2IS1 A;  2LBF B;  4BXX J;  1W7P A;  3PO2 J;  1UAA A;  2MC4 A;  3V7S A;  1OR7 C;  2FBK A;  3D5S C;  1DP3 A;  4PJ0 C;  2GOX B;  2CW8 A;  1Z6T A;  4HST A;  2VC1 A;  4DJA A;  3JRE A;  2KKO A;  1D8K A;  3FXQ A;  3KLN A;  2CFO A;  1IDZ A;  1T56 A;  3OYF A;  4E7J A;  2ZJ2 A;  2ACJ A;  3BQY A;  4CGZ A;  1A04 A;  3FBI B;  4O5V A;  3TP0 A;  3MEX A;  3IRR A;  2QCO A;  3E5Q A;  2OA4 A;  3H35 A;  2EPF A;  5LHH A;  2W24 A;  1GLN A;  4BY7 J;  1X2M A;  1ZG5 A;  5GPC A;  1C0W A;  1K83 J;  1YQA A;  2A6T A;  4V2F A;  4P5O A;  1AWC A;  2M8E A;  3MZY A;  3ZP5 A;  3A0H C;  2H1L A;  4F7Z A;  2ZJP F;  4C3H J;  2X1C A;  2QA4 I;  2MD5 A;  3GCM A;  3KZY A;  1BBY A;  3K10 A;  3PM1 A;  2A69 F;  4C9Y A;  4R79 A;  4YII A;  1BOA A;  2CV1 A;  2ISZ A;  2NAZ A;  3KP5 A;  3F8B A;  2DOE A;  5HLG A;  3ZCO A;  1TWA J;  1FX7 A;  2CQQ A;  4EAT A;  2L54 A;  1PUE E;  4ZDP A;  1YLF A;  2R7F A;  3FXK A;  2PJR A;  1X1D A;  2QYO A;  2FU4 A;  2R4G A;  4PGH A;  2WB1 N;  5HDN A;  2ZSH B;  3FWE A;  3H9Q A;  2FJ1 A;  1VQL I;  1W5T A;  1B59 A;  4D9J A;  3CDH A;  2E7W A;  3M7G A;  4HOB A;  4D5F A;  4HNT A;  4KIB A;  4S0H B;  1SD5 A;  4HNV A;  1YIT I;  3I54 A;  4ON0 A;  1DGW Y;  2DYR H;  2TRT A;  3RJP A;  4EJU A;  1U9O A;  1UST A;  2CUE A;  2X4H A;  4PUS A;  1T2K A;  2VC0 A;  3VOD A;  2JSC A;  2DMT A;  5GTI C;  3J7A Y;  1J59 A;  2YU3 A;  2VT3 A;  4HYE A;  2V1X A;  3FF5 A;  5L3E A;  4G12 A;  3CCV I;  3BR3 A;  2HZT A;  3AL0 B;  2VJ5 A;  4FIS A;  2LRE A;  4XLE A;  5LBQ A;  1B8I B;  2MLG A;  1MD0 A;  2ZNY A;  4Q47 A;  2NS0 A;  3Q9V A;  5FKL A;  2JPC A;  4CYC B;  4FAS D;  1SFK A;  2DA5 A;  1T95 A;  1YTY A;  1QA6 A;  4BXU A;  1X1C A;  5E1X A;  2HKO A;  1D0Z A;  1IRF A;  1XPX A;  1U8R A;  4B8X A;  1H0M A;  3V8L A;  3CUQ A;  3WTV C;  1U8B A;  1KQ9 A;  3PO3 J;  2L01 A;  1FC3 A;  1QPI A;  2PBI A;  1F9N A;  2GWR A;  3JAM K;  1HA8 A;  3WHB A;  4DQ2 A;  3B73 A;  3L1P A;  2UZK A;  3FHZ A;  2KP6 A;  2DU9 A;  1H9G A;  1FNN A;  2DJI A;  3U2R A;  2NNY A;  3QP6 A;  1YIJ I;  2VKH A;  2L4A A;  2V9P A;  2RDP A;  1VQN I;  4A3J J;  2L02 A;  3CUQ C;  1FOY A;  3LAP A;  5HNH A;  1TT0 A;  1KA8 A;  1KYW A;  4ZC3 A;  4CZC A;  1SMY F;  3CD6 I;  2QQ9 A;  2X51 A;  2WB1 A;  4M71 A;  2Y48 A;  1BOB A;  1J0R A;  3C7J A;  3LST A;  4MIM A;  5ILV A;  4ESB A;  3ASN H;  3K4K A;  2BE5 F;  5K7H A;  2OD5 A;  2P4W A;  1H88 C;  4RM3 A;  1YFH A;  4DBR A;  3IAS 2;  3J7Y J;  3S17 J;  4BHC A;  1ZH5 A;  1Q1V A;  4NUB A;  3IH2 A;  4RAZ A;  4ZDL A;  5F0F A;  2WC2 A;  4IHV A;  3DKY A;  3MMY B;  2OPT A;  5LD2 C;  2EV0 A;  3HBL A;  3RDI A;  1R49 A;  2HTS A;  2H27 A;  2YU9 J;  3TBI A;  5AIQ A;  3BZC A;  1HXD A;  3QU3 A;  4XRM A;  5D5X B;  1IF1 A;  1ZLJ A;  2XPV A;  3U1K A;  2ZXI A;  3E3V A;  4M9X A;  4E4H A;  5IPA A;  2DQL A;  4I0B A;  3WHC A;  2DOA A;  2KZG A;  4I7H A;  1UHS A;  1MGT A;  2ZME C;  2FBI A;  3BQZ A;  5BPI A;  1WJC A;  4LLG F;  3RKW A;  4DW6 A;  4DGW B;  3PSI A;  3RZD J;  1A36 A;  2EA4 A;  2Q0O A;  4GYG A;  3NEU A;  2OU2 A;  2H8W A;  2JMW A;  3KP3 A;  4BKX A;  1L3L A;  1DUX C;  4EJO A;  4IOA F;  1HST A;  1ZAO A;  5C3E J;  2B0L A;  2DDB A;  2CUF A;  3I5U A;  3Q0U A;  1VF9 A;  1MDM A;  3W2V A;  1Z05 A;  2FEZ A;  4BJT A;  2GAU A;  4IL6 C;  1IZ1 A;  4BEH B;  3OR2 C;  4A93 J;  3I71 A;  2AO9 A;  1FMV A;  2R7D A;  3HOV J;  2CUZ A;  1A6I A;  2M7B A;  1RES A;  4AYB A;  2M5W A;  3HRT A;  3ERM A;  2HDW A;  3EDP A;  2DN0 A;  4F91 B;  2NYX A;  4PK4 A;  4BDZ A;  3BJA A;  2NVX J;  4AM3 A;  1MBH A;  2OC6 A;  1RUN A;  2MYS A;  3OYE A;  1ETO A;  3HG9 A;  4PJM A;  2OQG A;  4JX6 A;  2KPM A;  4B47 A;  1O3T A;  1STZ A;  2DMU A;  4KT6 A;  1KU2 A;  3ZMV A;  3FX3 A;  4OIR F;  4A12 A;  2B63 J;  2Z3Y A;  3U21 A;  1TTY A;  4ZYE A;  1LUJ B;  1ZGA A;  2HOS A;  1WGX A;  3MAJ A;  3BR5 A;  3GZN B;  3D5R C;  2K5C A;  5FRM A;  2KJB A;  1WJA A;  3AKZ A;  4CYD A;  3ML6 A;  2KRH A;  2XGD A;  4HF1 A;  3CUQ B;  1OCR H;  4Z2Y A;  1VFC A;  2UXN A;  3DBH B;  1EA3 A;  1Y6I A;  4IRI A;  3A0B C;  2DPD A;  2Z5U A;  4JBA A;  2AXT C;  3S3M A;  3M8J A;  4UVB A;  4A3B J;  3GYH X;  3HRM A;  3ZMZ A;  2X1E A;  2F4I A;  3BLY A;  5KK1 A;  3JRA A;  1Y1W J;  4YEJ A;  3R60 A;  4GXO A;  4M3B A;  4G7Z F;  3FIW A;  4A3D J;  1FY7 A;  2C6Y A;  5ICC A;  4XK4 A;  2I5U A;  4L9J A;  2PQ8 A;  1IXR C;  1X2N A;  3GLL A;  2FMY A;  3SEQ A;  3WU1 B;  3DEE A;  3GFM A;  1OLT A;  3O2P E;  3A1Y A;  3JRF A;  5DD8 A;  2X48 A;  3FMS A;  3QPH A;  1O57 A;  4UV8 A;  2Z33 A;  4E7Z A;  2DA7 A;  3A02 A;  3U1D A;  3WGH A;  5L3B A;  3FKJ A;  1DPR A;  2IW5 A;  3I56 I;  4XLH A;  1UEL B;  2YX4 A;  5HVQ C;  1O3S A;  1CGP A;  3CZ6 A;  2PMZ N;  2Y2Z A;  1YS7 A;  1YG2 A;  2VIX A;  5C4J J;  2CW7 A;  3V42 A;  2OTL I;  2ZB9 A;  1IO2 A;  3HYI A;  3BZ6 A;  2YUS A;  4N0B A;  4P9F A;  1MND A;  2GLO A;  4N9I A;  1DDN A;  1JKR C;  3GFI A;  2MGQ A;  1PP8 F;  2RAE A;  1MSF C;  1PYV A;  3RQ4 A;  4OOI A;  3TP3 A;  5EZH A;  1NG7 A;  5DS9 A;  2L9R A;  3MZ8 A;  5DUK A;  4KYW A;  1B9N A;  3HRS A;  3IH3 A;  5CQE A;  3MVP A;  2LYC A;  1VQ4 I;  1O7F A;  1Z3X A;  4RAF A;  3OOU A;  3JTH A;  1IN5 A;  2WBM A;  4A6E A;  4KA4 A;  1T08 B;  1ZRD A;  1HDD C;  3CMM A;  1FOW A;  2VXZ A;  1V5E A;  2K40 A;  1Z1D A;  4OWR B;  3V8J A;  1YJ9 I;  1R5H A;  2LY2 A;  5BNG A;  4G7O F;  1FTZ A;  2KHM A;  1BR2 A;  2V9V A;  1QRY A;  4IHW A;  1UG2 A;  2XHK A;  1SD7 A;  4XQF A;  3EYY A;  2FOK A;  4O6J A;  1Z6R A;  2VJ4 A;  2LF8 A;  2XGX A;  1I39 A;  3HZJ A;  2O7O A;  1ZG1 A;  1PJR A;  2P7C B;  4M6Y A;  2X0L A;  4H4K C;  1IJW C;  2Q1Z B;  1EH8 A;  2R5Z B;  4B4C A;  4I76 A;  2DDA A;  2OJE D;  4IJA A;  3G1L A;  3KIO A;  2DFF A;  3OYG A;  1MH4 A;  3H92 A;  2F4M B;  2M34 A;  3T8T A;  3VDX A;  4A3L J;  4D5C A;  2VQC A;  1HSJ A;  4JK1 X;  3SDG A;  4J01 A;  2WAF A;  5CVR A;  4U0V A;  4PGG A;  1KYZ A;  3DTE A;  3Q0W A;  4W1U A;  2EIM H;  2Y9Y A;  4FET A;  2PMZ A;  2HS5 A;  4QLC U;  1FOK A;  3F3X A;  4ENJ A;  4BY1 J;  5DUI A;  1JUM A;  2AQE A;  3FK7 A;  4XOR A;  3VYS B;  5K1Y A;  2DI3 A;  3EET A;  4EVI A;  1EJ9 A;  2ZO4 A;  2E1M B;  4PZJ A;  4E7I A;  3ZQG A;  4XRF A;  1J5Y A;  3LA7 A;  1VQ7 I;  4F93 B;  2EV6 A;  4OMZ A;  1ZKG A;  2FD5 A;  3CCR I;  3OL4 A;  4CHU A;  1RR7 A;  3I4P A;  2LG4 A;  4IPA A;  5E3L A;  4DNC A;  2KDZ A;  3PQJ A;  3RSN A;  4YIF A;  3HL2 A;  1Z21 A;  1YX3 A;  3CDL A;  5JR3 A;  2FXA A;  5HLT A;  1WI3 A;  3F8C A;  1MKM A;  4BXF A;  3HHH A;  1HW2 A;  5FD6 A;  4PFP A;  2NS7 A;  4I09 A;  5CVU A;  3CCE I;  2Y9Z A;  1T0F A;  2EFW A;  3HPG A;  2VL8 A;  4KIS A;  1FYL A;  2XVC A;  3G71 I;  2O3F A;  3QQA A;  2QKM B;  1ZYR F;  4Y13 A;  2VUM J;  2EFP A;  2V79 A;  2JUG A;  4LIT A;  2D2W A;  4MQV A;  5HS9 A;  4WX9 A;  1GVJ A;  5H6Q A;  4GO1 A;  4BJ6 C;  3CC7 I;  3IL2 A;  4IXA A;  3RKQ A;  3TQN A;  4KMU X;  1T0F C;  3S1N J;  1OCZ H;  2HXO A;  4B3X A;  2WAQ N;  3OOP A;  2MFZ A;  5GP9 A;  4XN3 A;  1HCR A;  4B44 A;  1G6N A;  5EZG A;  1VQK I;  2R7Z J;  2Z99 A;  4M9Z A;  1BJZ A;  3JRD A;  3RYR A;  4M6X A;  4H0E A;  4OIP F;  1P92 A;  2JVG A;  1S7A A;  3ZN1 A;  2M0M A;  1R6R A;  3FM5 A;  2IS4 A;  4XLC A;  2XAH A;  2QSH X;  1X58 A;  2XRO A;  3LSM A;  3P5J A;  2XAJ A;  2XKO A;  2MBF A;  4OU0 A;  2GOM A;  4BYY A;  2N8G A;  5DYM A;  1VTN C;  3FXU A;  1ZQ3 P;  4G7H F;  2V1U A;  3QOD A;  1OQY A;  2BXY A;  4EGZ A;  1YJW I;  1F5T A;  2IGN A;  1K61 A;  1XGN A;  2I10 A;  3KLO A;  3L2V A;  3HOT A;  1DPU A;  4ITV A;  1YO5 C;  4XLN F;  4OMY A;  1UCR A;  5ICG A;  4OIN F;  2HU9 A;  1W0T A;  3IC7 A;  4LGW A;  4LIU A;  2WY8 Q;  4ZYD A;  2QUF A;  2FX0 A;  5A2Q Z;  3CO6 C;  3HHG A;  2R92 J;  4PSX A;  3TOA A;  3L2Q A;  3CTA A;  3L00 A;  2DTR A;  3MCZ A;  3JRG A;  1TL8 A;  5HDG A;  3E97 A;  3COA C;  1CF7 A;  1LQ1 A;  4A3M J;  1IV8 A;  3GTQ J;  3M9A A;  4IQJ A;  4LB6 B;  1BIA A;  2K3F A;  2WAQ A;  1T98 A;  1WSU A;  3K70 C;  1F43 A;  1QVU A;  2DMP A;  3OR1 C;  2VBY A;  4RAG A;  5F0H A;  2E2J J;  4MNU A;  3L2U A;  4HF0 A;  3FZV A;  1MIJ A;  3KP6 A;  5J1R A;  1FTT A;  1U78 A;  2JT1 A;  1V55 H;  1TT5 B;  5IYC J;  1XGM A;  5LGN A;  3T0Y A;  5EG0 B;  2FQ4 A;  2IGM A;  1K4T A;  3MQ0 A;  2V7F A;  1W5C C;  3BZK A;  3LFK A;  2XF5 A;  3WGG A;  1PP7 U;  1ORK A;  2ZJQ F;  2F4O B;  3EUK L;  4A5N A;  4UUV A;  2JQ7 A;  4RA2 A;  1E17 A;  1RI7 A;  3HOY J;  1LPQ A;  1RR8 C;  1IXS B;  3C2G A;  2XC7 A;  4GYI A;  5KCM A;  3HDD A;  4XOT A;  2HPI A;  2GM4 A;  1DP7 P;  2HOE A;  5GPA A;  3IKV A;  4BGD A;  3CJT B;  1MMD A;  5K7F A;  4HRI A;  5B66 C;  2QF7 A;  4DYR A;  1W36 D;  1RRJ A;  4CCJ A;  3F0C A;  4JX4 A;  1HOM A;  4MLO A;  5LGU A;  2LSO A;  3TO7 A;  1B72 B;  4L9V A;  3GZ6 A;  1K6Y A;  3E5X A;  1BI0 A;  2ZBK A;  2DA3 A;  1MBK A;  4UB6 C;  4II3 A;  3GUD A;  2QZ8 A;  2VLA A;  3PUF A;  2QEX I;  2IP2 A;  4P1W A;  3OYK A;  4J00 A;  2P6S A;  2DO7 A;  3G1M A;  5TRD A;  4HZF A;  3BG9 A;  2W00 A;  4IHX A;  2K3P A;  1GT0 C;  3RI4 A;  1TQP A;  3BR0 A;  5FLV A;  3ASO H;  2COB A;  2E1N A;  3QOE A;  1PVE A;  2R3S A;  2K9Q A;  2XSJ C;  3P9K A;  3JAM Z;  1BI2 A;  2FNA A;  2STT A;  5E18 F;  1FWZ A;  3VYR B;  5FRN A;  1VI0 A;  3IUO A;  2F5D A;  4LLL A;  4E7L A;  1Z77 A;  3EYI A;  1BR1 A;  3I4N J;  3AFH A;  2NVY J;  2V26 A;  3K1N A;  3R0J A;  2EJR A;  2CMP A;  3WE3 A;  1IXC A;  1WJF A;  2HKX A;  2F5E A;  4Y4R A;  1I6X A;  2EIN H;  4ZZD A;  4RBO A;  2LC2 A;  4PJL A;  2GIZ A;  2QQ8 A;  4NC8 A;  3WTZ A;  2HOT A;  2W7N A;  2XIG A;  3HC7 A;  2Q2E B;  2EBI A;  2XV4 S;  4NB5 A;  2EZH A;  2CSO A;  2W57 A;  2XRL A;  1ZK8 A;  5JHF A;  2VI6 A;  5FO5 A;  1V3F A;  2BW3 A;  3PFY A;  3MKZ A;  1WJD A;  3M1E A;  1R00 A;  1R1T A;  3BP8 A;  1O7L A;  4C2M J;  4CCM A;  1O3Q A;  1U9N A;  2H8R A;  1ZEL A;  5DTD A;  3ZRG A;  5A2Q K;  3I64 A;  1OCP A;  3UKG A;  2P81 A;  2XAG A;  2QKL B;  3K4M A;  2IA1 A;  2XB5 A;  2E7X A;  4G8X A;  1I5Z A;  1JT0 A;  4A3I J;  1XC5 A;  3TO6 A;  1OYW A;  1TNT A;  2V6C A;  3B02 A;  1D0Y A;  3DV8 A;  3OS2 A;  4I98 B;  4L5J A;  1XB4 A;  3I3L A;  2E5N A;  3JRH A;  3ZN0 A;  3H0G J;  5IP7 J;  3QU6 A;  4MEX F;  4IKF A;  5IOZ A;  2NVT J;  5E3M A;  3PNT A;  3F6V A;  2LR8 A;  3E0J B;  1Y8R B;  3K6G A;  3BWG A;  3DKX A;  2EQR A;  2R5Y B;  1WWX A;  1S7E A;  4II2 A;  1LE8 A;  3EUA A;  3IWF A;  3ABL H;  4KUM A;  4GFB A;  2JVH A;  3M1C A;  1P7J A;  2MH9 A;  2Y75 A;  1E3O C;  3K7A J;  2OQR A;  3A01 A;  2OCE A;  4EM1 A;  5L3C A;  3ZQL A;  3S14 J;  3IRQ A;  5GAE J;  4LK1 F;  1TQM A;  2QQA A;  4LG3 A;  4OIQ F;  2V1N A;  3HJE A;  4XR6 A;  2QEN A;  1EF4 A;  4M3F A;  1V4R A;  2DFI A;  1XG1 A;  2IAI A;  2LVS A;  1G3T A;  1VQ9 I;  1RC9 A;  3S3O A;  3ZQC A;  3CJN A;  4E7K A;  1IUF A;  4RGS A;  3EPZ A;  3MD2 A;  2BXZ A;  4HV5 A;  2VE9 A;  1AA7 A;  2M4G A;  1FLI A;  2W4S A;  4GDF A;  3GX4 X;  2DQR A;  3GTG J;  4YEL A;  4AD9 A;  4UUS A;  1TWH J;  2VOP A;  1G3S A;  3FDY A;  4NDL A;  1IN7 A;  2L9N A;  2EZI A;  4A0Z A;  3JRI A;  4MFD A;  1TBX A;  3J7A O;  1RZ4 A;  3C3W A;  2OBP A;  3FKI J;  5IYB J;  1AU7 A;  3ULQ B;  3BG5 A;  2XKP A;  3C2H A;  4XRS G;  1OJL A;  2FE3 A;  4BL0 B;  3RKX A;  4KIT B;  4IOC F;  2CG4 A;  3ELK A;  2IRF G;  1YHQ I;  1VQ6 I;  3G4S I;  1JT6 A;  2KIF A;  1D1A A;  2VE8 A;  1R4M B;  3H1C A;  5F64 A;  4AWX B;  1W7P B;  4EJW A;  4BQQ A;  2HR3 A;  4BUP A;  4HLY A;  3HXL A;  1ZRF A;  4AYB N;  4X0G A;  5LEJ A;  1I3A A;  2G7H A;  2QM3 A;  2PEX A;  2ZC2 A;  2A05 A;  3ISP A;  2DTZ A;  4BHB A;  2M87 A;  2K86 A;  1ZAR A;  1FT9 A;  5ERI A;  3P9C A;  3DF8 A;  1KU7 A;  1ZG3 A;  1U3E M;  2BVM A;  1MMG A;  3DXJ F;  4KJZ A;  4QPO A;  4YG2 F;  2O8X A;  3CJQ B;  5J8F A;  5H6R A;  3N97 A;  2JA2 A;  3ZR8 X;  4WCG A;  2OCC H;  1Y1V J;  4WF2 A;  4FX4 A;  1DQU A;  1SVM A;  3JSP A;  4ENN A;  5CQG A;  4OAZ A;  1FBU A;  1FIA A;  3UR3 C;  1KQ8 A;  4OAY A;  2XGC A;  3VYU B;  2A5W A;  2ZME A;  1I3Q J;  5GAD J;  3H3U A;  4S04 A;  4NC7 A;  1ITY A;  3BTL A;  4UUT A;  1VQP I;  2EFO A;  3R61 A;  3HPH A;  2Y31 A;  1POG A;  2EWN A;  4LJZ F;  4MO7 A;  4ZH4 F;  5LLQ A;  2HFH A;  2ZKZ A;  2NRA C;  3ERE D;  3WOD F;  2PG4 A;  2Z1D A;  4HF2 A;  3PL8 A;  2MA3 A;  1BJA A;  1K79 A;  4MEY F;  2JRM A;  1MNM C;  4Y15 A;  4ESJ A;  4BNC A;  3REO A;  1Y0N A;  3OYI A;  5FFX A;  1W7P D;  2LLK A;  5TIS C;  2PJR B;  1JTX A;  4HDU A;  1LE8 B;  3I58 A;  3O3K A;  3W2W A;  3CMA I;  2HEO A;  4P55 A;  3N4M A;  5DCM A;  1WFX A;  2EV5 A;  1V5F A;  3ZPL A;  3KEY A;  5GAH J;  3SDB A;  3A01 B;  4IHY A;  2LK2 A;  3NAR A;  1UHW A;  2LH9 A;  1MBJ A;  4HAM A;  2RGV A;  3S1R J;  1FBS A;  3LOC A;  2XGE A;  1IW7 F;  1SVL A;  2RNJ A;  1S3J A;  3WTU C;  2VXD A;  4NQW A;  2JPB A;  4Y33 A;  5F6F A;  5TJJ A;  2PX9 A;  4P96 A;  3W3C A;  5ILU A;  5GAG J;  4CCN A;  5EGO A;  5DCF A;  4WXD A;  4HDV A;  3LSP A;  3GZ5 A;  4IQ4 A;  1I6H J;  4EJT A;  1R9T J;  2F5C A;  1R1V A;  1TLH B;  5DM7 F;  2H6C A;  1D3Y A;  2PN6 A;  2XAF A;  4RS8 A;  4A0X A;  4QSH A;  4ZJZ A;  5GTH C;  2E2I J;  1J2X A;  3QOP A;  4DIQ A;  2DT6 A;  1VND A;  3E7L A;  3GTM J;  3K1M A;  4F52 A;  3H9G A;  3LNQ A;  3Q5F A;  3DPU A;  5M5W J;  1RPW A;  2CYY A;  5L3D A;  3GTL J;  2LD5 A;  2P5K A;  4L18 B;  1BW5 A;  3HTS B;  5D4S A;  5CPR B;  2VQG A;  4HNU A;  1IGN A;  3QPL A;  1KON A;  3EQL F;  3P7N A;  4XL9 A;  2V4J C;  5D5W B;  2FSW A;  3TL4 X;  2HNH A;  5FJ8 J;  4XID A;  1J75 A;  5J40 A;  2K9N A;  1V54 H;  4A5M A;  2ICW G;  4JX5 A;  2L7K A;  3M07 A;  2A6E F;  1ZGW A;  1JHF A;  2EZK A;  2DJN A;  3UNG C;  3RZO J;  2CQN A;  2DLL A;  1Y0U A;  3B6A A;  5ILS A;  2W25 A;  3KE2 A;  5F0C A;  3C1D A;  3F6O A;  3S3N A;  4BH9 A;  2L3D A;  2RVC A;  4C2U A;  2WA0 A;  1DGR M;  3DQV C;  4L5E A;  3HOZ J;  3BG3 A;  1SVO A;  1X4P A;  4JQF A;  4S05 A;  2G9W A;  4FE4 A;  1YW8 A;  3K4C A;  3WTW C;  2LDU A;  5DD4 A;  1R5G A;  3KEQ A;  2EH3 A;  1BW6 A;  3H36 A;  5KVR A;  1S6L A;  1SD6 A;  1WI9 A;  3MFK A;  3ESW B;  3S93 A;  3ZQF A;  3H5R A;  5CVI A;  2Y0M A;  5ICE A;  3FIS A;  2ZME B;  5E17 F;  5D5U B;  2RV8 A;  1W4M A;  2VT2 A;  3L7W A;  3NWT A;  2E5Z A;  2CQX A;  1EKE A;  3VFZ A;  5FKM A;  1OYI A;  3KX2 A;  1BA5 A;  5K5R A;  1L0O C;  2KIS A;  3R6S A;  4YFK F;  1JE8 A;  1GV5 A;  3TDZ C;  1RKW A;  3OSG A;  2R93 J;  1I27 A;  5FB2 A;  4HG2 A;  4V19 K;  1HW5 A;  1XX5 A;  3FMR A;  2V1D A;  1QNT A;  1Z0X A;  2BY2 A;  1KU9 A;  1XMK A;  4BS9 A;  1SMT A;  4EEF G;  4HSR A;  4Z6Y A;  4QIW N;  2QGU A;  1PUF A;  2F5V A;  3RQI A;  1A31 A;  1KGS A;  5CJ9 A;  2OF7 A;  4XSZ F;  1YW7 A;  4AIK A;  1MDM B;  4UVA A;  3K9T A;  1R4N B;  2VKV A;  1D5Y A;  4WXC A;  5M3M J;  2WWY A;  1JI8 A;  3ZMT A;  3SJM A;  3GW2 A;  3KYL A;  2ISY A;  4IHT A;  5FLX K;  3WGI A;  3ZGK A;  1LKX A;  1S8N A;  1D8J A;  2ESN A;  2HPM A;  2LOO A;  1QQI A;  3WG9 A;  3OYB A;  2YR2 A;  1HDP A;  4YFX F;  5F1J A;  1YI2 I;  3OYL A;  5J47 A;  3LA2 A;  2R7Q A;  5CVV A;  5C44 J;  1IN4 A;  2KLO A;  3VEP A;  3TW7 A;  3ZXS A;  1IUY A;  2HWV A;  3BDD A;  1SEU A;  1DU6 A;  1XCB A;  2K9S A;  3H3V K;  3L2R A;  5HNF A;  5EDN A;  1AHD P;  1F36 A;  1W1W E;  2KRF A;  4D7N A;  4KNY A;  5EEH A;  2DAO A;  3G2B A;  4YFN F;  5HS8 A;  1ETY A;  5FGM A;  3SZG A;  3TDU C;  3OYC A;  4HPQ A;  1JTY A;  2LY1 A;  4E7H A;  4GGG A;  5K7Z A;  1J7K A;  1E3H A;  1ZN2 A;  1FEX A;  2GXB A;  2DA6 A;  1HKS A;  4M9S A;  2IA2 A;  4XLF A;  2W48 A;  2KMU A;  4WXH A;  2IVM A;  1UFM A;  4XIC A;  5JVG F;  3I55 I;  3M8F A;  2E36 A;  1R36 A;  3QYB A;  1JKQ C;  1MMN A;  3QRF F;  3DU5 A;  3R4K A;  4HW0 A;  4WK8 F;  4CO8 A;  4DYQ A;  2GBY A;  1BC8 C;  2VAS A;  3P9I A;  4K2E A;  2GXG A;  1XMA A;  2HXI A;  4O3M A;  3S16 J;  1YJN I;  4B09 A;  1JXS A;  5FKO A;  2E1O A;  4KMF A;  1MSE C;  1R71 A;  2L7Z A;  3K4B A;  2KIQ A;  3T1B A;  4AC0 A;  1RUO A;  3HIF A;  5TGT A;  1ZRE A;  1B6A A;  3O8G A;  2FOW A;  4CCO A;  4MTD A;  3NAU A;  1AOY A;  4ZYH A;  2XAQ A;  4B1R A;  3GWZ A;  3V7C A;  4D0P A;  3OS0 A;  3FMQ A;  3WTS C;  2ADU A;  2YSR A;  3VSK A;  4ENK A;  1QGP A;  3QYF A;  3BG6 A;  3QPT A;  3I59 A;  3KYC B;  2CQK A;  3BR1 A;  5IP9 J;  5E3N A;  4MQ9 F;  3JR9 A;  1J9I A;  2BY1 A;  2AHQ A;  1Y39 A;  3HOU J;  3MN2 A;  2TDX A;  3DP7 A;  2VBZ A;  4U7D A;  1WH5 A;  2MC3 A;  2VQL A;  1XD7 A;  4PJJ A;  1K78 A;  4BE2 A;  1RET A;  1UB9 A;  1X19 A;  4L9T A;  5M5X J;  5KNL A;  5EEG A;  2XF6 A;  3DBL B;  2K27 A;  5FRO A;  4BQA A;  2OUM A;  4BJ5 C;  1UHM A;  4RMN A;  4B48 A;  5FKN A;  2Z9O A;  1A6Q A;  2BY0 A;  2HTJ A;  3FK6 A;  4FT8 A;  3I9V 2;  1MZB A;  1OMI A;  3G1O A;  2WAD A;  3MZH A;  3LSJ A;  1G2H A;  3DPL C;  2P5L C;  1N78 A;  1GVD A;  4EQQ A;  1OPC A;  5E20 A;  3RKY A;  2FML A;  2ELH A;  1H9T A;  3DBR B;  2YPR A;  4CIC A;  4HX7 A;  2Y0S A;  1JKP C;  3S15 J;  1YOV B;  3BCA A;  3K2Z A;  3QWL A;  1G59 A;  4I0A A;  3CCJ I;  2MD0 A;  1FMW A;  2DK8 A;  2LBF A;  3GTK J;  2JTV A;  3ABT A;  4G6D A;  1QHG A;  3CME I;  4F55 A;  4WWC A;  3FXJ A;  1WJB A;  3KYD B;  1MBG A;  2BHZ A;  3TW6 A;  1FBQ A;  3KFW X;  4XKC A;  2RN7 A;  3GTP J;  2XRN A;  2P6T A;  2HVR A;  3F21 A;  3BC8 A;  3BRO A;  1U5T A;  2L7M P;  3GVA A;  2KIM A;  4XKW A;  1MJB A;  3BJ6 A;  4C3I J;  2W84 A;  1FOX A;  4RM2 A;  3GFL A;  5IY5 H;  4EMS A;  1S9H A;  2CH0 A;  3PQK A;  5E8I A;  2W82 A;  4CXF A;  4N4O B;  3TGN A;  3J81 K;  3WTT C;  3G73 A;  2V9K A;  1U5T C;  2CU7 A;  2K4J A;  1GXP A;  2X6O A;  4XKB A;  4RB1 A;  4GCV A;  2FRH A;  1HLV A;  1GV2 A;  2XAU A;  4NNJ A;  3SHF A;  2BVL A;  2DT5 A;  3BT9 A;  3OYH A;  3DKW A;  3CUO A;  5J4Y A;  5CYV A;  1USS A;  2D1V A;  4M72 A;  3LMM A;  3O8H A;  1NH3 A;  5IYD J;  5HS7 A;  1LVA A;  4A6D A;  2ME6 A;  2A68 F;  2IT0 A;  1OCC H;  3GTO J;  2XPU A;  4M3G A;  3SZP A;  2J5P A;  4A0Y A;  4BAY A;  4ZTF A;  4ZTJ A;  2VB6 A;  4DYC A;  1ERD A;  4C30 A;  3S2D J;  2F2E A;  5IT9 K;  1WJ5 A;  4QTR A;  2JA7 J;  2K9M A;  3HOS A;  4FHT A;  2ZXJ A;  1G3W A;  4U87 A;  2VON A;  3OSF A;  3E6D A;  3CCU I;  2NOG A;  3Q9S A;  2STW A;  2DMN A;  2NOJ B;  4X1E A;  3MKY B;  1QPM A;  2LP0 A;  2XSD C;  4OIO F;  2O03 A;  4JOM A;  4ASN A;  2BYV E;  1G3Y A;  2E34 A;  3IKT A;  3BOQ A;  1W0U A;  1Z9C A;  3VOE A;  1AKH A;  1H89 C;  3ECH A;  1IG7 A;  3ZQQ A;  5IP6 A;  2LRD A;  3A03 A;  3V4G A;  3M4O J;  3CCM I;  4MFE A;  5IOY A;  2HQN A;  3RPU D;  3IP4 B;  3HOX J;  1OIS A;  1APL C;  1ULY A;  2R7U A;  2MG4 A;  1F1Z A;  2HYJ A;  3CES A;  2OAZ A;  4LMY A;  5J8C A;  4IF4 A;  4N4N B;  3AG1 H;  5HLH A;  1HBX G;  1IV6 A;  1I1S A;  3MKW B;  2VOD A;  4D1Q A;  5F27 A;  1GDT A;  2QSG X;  4ETS A;  3V8K A;  1FP2 A;  4XSX F;  3AL0 C;  3T8R A;  1YE9 A;  4KN7 X;  3TO9 A;  2H6B A;  2D45 A;  1Z67 A;  3G3Z A;  1JUP A;  3HM5 A;  5D5V B;  4DOZ A;  4A3F J;  3LSR A;  4KDP A;  1NHA A;  1TC3 C;  2A3S A;  1Z7U A;  4G6T B;  4IO9 F;  3AG4 H;  3WTY C;  2HZD A;  4PDK A;  2ZCW A;  5D8L B;  1SAX A;  2CV0 A;  1XDU A;  4L0Z B;  1D0X A;  3HRU A;  2BY3 A;  1GXQ A;  2MH2 A;  2H94 A;  2JN6 A;  4AIH A;  2K4B A;  4IVN A;  1CF7 B;  1X1B A;  2K85 A;  3ABM H;  3D1N I;  2VPR A;  5BPD A;  2BZT A;  1Z91 A;  4G94 A;  2JSP A;  1REP C;  3I53 A;  1M1E B;  4LOC A;  3K4J A;  5K5Q A;  1PDN C;  3M3Y J;  2FQ3 A;  1A35 A;  2IGK A;  2FNP A;  2L4M A;  5BMZ A;  1U5T B;  5D4R A;  3LQR A;  2FA5 A;  1ZHF A;  3LSK A;  1JJ6 C;  2GXA A;  1QZY A;  1LFB A;  3CO7 C;  3RTR A;  3WG7 H;  1MH3 A;  1D1B A;  5F1R A;  2RC4 A;  3N05 A;  1R1U A;  1KU3 A;  2JWT A;  5JHU A;  1U0J A;  1P2F A;  5HOO A;  3SEZ A;  3MKL A;  2EZL A;  2DW4 A;  3E6B A;  2M4K A;  3LQQ A;  3HTU A;  5J3L A;  2CWE A;  2L9S A;  2O5R A;  4XLA A;  1YYV A;  1ETX A;  3HSE A;  4RAY A;  1LEA A;  5FLM J;  1I1G A;  4BE1 A;  3K4L A;  3L2C A;  3W2A A;  4RDU A;  3K70 D;  1YIO A;  1MMA A;  4XRS A;  3ECO A;  1T6S A;  1E2X A;  5EJC A;  5B1B H;  3J80 K;  3DU6 A;  1SD4 A;  2JA5 J;  1R23 A;  4F3Q A;  1XSV A;  4UHT A;  3ZQH A;  1Y56 A;  1YRN A;  2VQH A;  3H0D A;  5KAF C;  1JGG A;  4BU2 A;  1EH6 A;  1MNE A;  3CLQ A;  2ZXW H;  4LG0 A;  2OV7 A;  2H1K A;  2CS3 A;  2JZY A;  1ODD A;  2R7S A;  2CJJ A;  1HQC A;  2WV0 A;  3BPX A;  3BY6 A;  1KZH A;  4U7B A;  1K7A A;  3G6E I;  1LEB A;  4BEH A;  5J1Y A;  3QPS A;  3S2W A;  5LRR A;  3CLO A;  3A4C A;  2FF4 A;  1LFU P;  5F08 A;  4XNF A;  4CZZ A;  5D8K B;  2EFN A;  1E3P A;  3KET A;  1AKH B;  2X9D A;  2LF7 A;  1FSH A;  3ZMU A;  2HVQ A;  2VKE A;  1ETQ A;  1VQM I;  1MJ9 A;  3JW4 A;  1HW1 A;  3CCS I;  2ZJR F;  2BBY A;  1ACI A;  1T39 A;  3L2W A;  3I0T A;  5ICF A;  4BBS J;  3OMY A;  1G4D A;  3IV5 A;  3KP7 A;  2LNB A;  2Z16 A;  3K69 A;  2XPW A;  3OYJ A;  2DMQ A;  2X6W A;  1IAW A;  4AVP A;  2M3A A;  3PUB A;  1RIO H;  3HGG A;  3ZMS A;  3K2A A;  2VJJ A;  4DZJ A;  5BOX A;  3LA3 A;  3T5X A;  3B6C A;  1TWG J;  3NRV A;  5E3O A;  2PLY A;  2P0W A;  4QWQ A;  2XF7 A;  1P4W A;  2B7E A;  2G0E A;  3OIO A;  1BR4 A;  3OL3 A;  4IRG A;  1NK3 P;  1ETV A;  1ONV A;  3LSG A;  2KT0 A;  1WKM A;  4IHS A;  2JK3 A;  4HQM A;  2BW3 B;  1WZ2 A;  4PSW A;  4AU7 A;  4RGX A;  1BN5 A;  2A6H F;  1H8A C;  3IWZ A;  3IH4 A;  3E5U A;  4LFU A;  4CA0 A;  4W97 A;  5CVJ A;  9ANT A;  3VWB A;  5JLW A;  4A3E J;  5DEQ A;  4I99 C;  1JGS A;  2A07 F;  3LFU A;  4HV6 A;  2DA1 A;  2X85 A;  2HYF A;  2ID6 A;  2RKH A;  2XUB A;  1WPK A;  2QBY A;  3A2K A;  2MLK A;  2EIJ H;  2I8D A;  2ELK A;  4MTE A;  3F8N A;  1HKT A;  3VB2 A;  1IN6 A;  3OYN A;  1MMS A;  2COM A;  2L7F P;  4EJV A;  1LDJ A;  1YW9 A;  2O0Y A;  4E70 A;  4M3E A;  4RB0 A;  2LFB A;  2K02 A;  2GZW A;  2HGC A;  2R7O A;  2IXS A;  5KAI C;  2W85 A;  3PJR A;  2DOD A;  3RIR A;  1VQO I;  2PFB A;  3ABK H;  2R7V A;  1NTC A;  4XOP A;  2PJP A;  2ZFU A;  4M6V A;  4XM3 A;  3X2Q H;  1MBF A;  3W6K B;  3GO5 A;  5H20 A;  2CV2 A;  2ETH A;  3E1S A;  1CQT A;  3HUG A;  5FKK A;  2A61 A;  5E79 C;  4UVC A;  1MJA A;  5FLX Z;  3BTJ A;  1B4A A;  1EH7 A;  3KCC A;  5FFZ A;  4G9Y A;  2GA1 A;  2EB7 A;  3H5A A;  2E35 A;  2KIU A;  3DTI A;  5BS6 A;  4UB8 C;  4XON A;  1XGO A;  1ENH A;  3R0A A;  2M2E A;  3ROU A;  2K9L A;  5EEA A;  2DCE A;  5K5O A;  1YRN B;  3FXM A;  1R7J A;  2BOL A;  3PSF A;  4XN0 A;  3WTX C;  3NQO A;  1T33 A;  3JSO A;  4LG0 B;  5J4V A;  2VPL A;  4HQE A;  3RCO A;  3LAJ A;  1X1P A;  2QLZ A;  4ESF A;  2JA6 J;  4L9N A;  4F92 B;  1DU0 A;  4U88 A;  2BEO A;  1OFC X;  1JHH A;  2LMD A;  2GA2 A;  4J19 A;  2L9V A;  2HOA A;  3DFG A;  2DFH A;  4Q48 A;  1Y8Q B;  4UUS B;  4A3G J;  2R5Z A;  4KFC A;  2R7T A;  1Z3Y A;  2NXN B;  3S1M J;  3CJR B;  1LNW A;  2MSY A;  1WVR A;  4DBQ A;  1R5I D;  4L5I A;  3BJO A;  3KZZ A;  5FD5 A;  4V2G A;  3PFI A;  2HQ5 A;  2DPU A;  3L09 A;  2BHY A;  5M3F J;  3SQN A;  4CH7 A;  3JCU C;  1BL0 A;  2O6G E;  2DYS H;  4HX4 A;  1KQ0 A;  4AVZ A;  3QYE A;  2E60 A;  4BDY A;  1LDK B;  2HYG D;  2LKS A;  2KL4 A;  3FXO A;  5D6F A;  4CCL A;  1QVT A;  2P7V B;  4KT5 C;  2D5V A;  3DEW A;  5C4X J;  1WQ2 A;  4XMY A;  2JJ7 A;  1XDS A;  3KZI C;  2DBB A;  1WJE A;  3GFJ A;  2ID3 A;  4I02 A;  4HX8 A;  3DPT A;  3WU0 A;  4HEA 2;  1EV7 A;  1XGS A;  4ZDO A;  1XSX A;  4BE0 A;  1JUS A;  2E1M C;  2HDC A;  1QO0 D;  3IAM 2;  5LRS A;  2RNG A;  1ZRC A;  5F04 A;  1LVK A;  2QBY B;  1IC8 A;  3OYM A;  1SAU A;  5BQT A;  1FPQ A;  4FTH A;  2HDD A;  3MWM A;  5LGT A;  4Y3O A;  3AAF A;  2TCT A;  4M73 A;  2V6E A;  4PCQ A;  3OYD A;  4IEJ A;  2LTP A;  3OWT A;  3PIP F;  2AQF A;  3BCB A;  3DEU A;  4IZZ A;  3CCL I;  2F6C A;  4D7M A;  4FCY A;  5LFA A;  4L0Y B;  3GME A;  2DT7 B;  2WV1 A;  4LIV A;  1OCO H;  1QZE A;  3TED A;  2R7X A;  3L9F A;  1BI3 A;  1TNS A;  1LJ9 A;  3JRC A;  1HC8 A;  5EYR A;  3LWF A;  4MGR A;  1FIP A;  3S32 A;  4Y7N J;  2E19 A;  2M30 A;  4ABZ A;  3F8F A;  1P4A A;  3BTC A;  3CC2 I;  1XTA A;  3FXR A;  4YRV A;  1XCV A;  5B5E C;  4XLP F;  1B1B A;  2D1H A;  3GBG A;  3HUG B;  4LLN A;  1SFO J;  2G7U A;  1SFU A;  5DCM B;  1A5J A;  5JVT A;  2OZ6 A;  1D1C A;  2WAE A;  3S8P A;  4EV0 A;  3KEO A;  5JI6 A;  1K6O A;  4RB2 C;  3W6V A;  3CF5 F;  2NVQ J;  5E1Z B;  1BM9 A;  5LHG A;  1X4O A;  2CO5 A;  3KP2 A;  3OS1 A; 
#chains in the Genus database with same CATH homology
 1GUU A;  2Y30 A;  3SFI A;  3WHC A;  1MBG A;  3TW6 A;  1UHS A;  3GTP J;  3BQZ A;  4DW6 A;  3JRH A;  4A3K J;  5IP7 J;  3H0G J;  5EGO B;  3RZD J;  5IOZ A;  2L7M P;  3Q3S A;  2JMW A;  4BKX A;  2DA4 A;  4C3I J;  5E3M A;  2NVT J;  2LR8 A;  1MBE A;  5C3E J;  4JP0 A;  2CUF A;  3Q0U A;  1VF9 A;  2EQR A;  2R5Y B;  1S7E A;  3HB9 A;  1LE8 A;  1ETW A;  1TWC J;  4A93 J;  4GFB A;  2AO9 A;  3HOV J;  2CU7 A;  2YS9 A;  1A6I A;  1P7J A;  1RES A;  2X6O A;  5J1U A;  1E3O C;  1HLV A;  3K7A J;  3A01 A;  1GV2 A;  2DN0 A;  3ZQL A;  3S14 J;  3BT9 A;  3ZOB A;  2NVX J;  1MBH A;  2DA2 A;  1EF4 A;  1RKT A;  4M3F A;  1XG1 A;  1ETO A;  2IAI A;  2LVS A;  3O8H A;  5IYD J;  4JX6 A;  2ME6 A;  1JKO C;  3ZQC A;  3GTO J;  2DMU A;  2XPU A;  4M3G A;  1IUF A;  2B63 J;  5EG0 A;  4DYC A;  2HOS A;  2O9L A;  1WGX A;  3BR5 A;  3S2D J;  2Y0S N;  4AUX A;  3DCF A;  4QTR A;  2XB0 X;  2M9H A;  2JA7 J;  2XGD A;  3BTI A;  1VFC A;  3GTG J;  1HF0 A;  4UUS A;  3OSF A;  2NOG A;  1TWH J;  2DMN A;  4X1E A;  3HGY A;  4NDL A;  2EZI A;  1I50 J;  2LP0 A;  2XSD C;  3JRI A;  4MFD A;  4A3B J;  4BBR J;  3FKI J;  5IYB J;  3S2H J;  1AU7 A;  1W0U A;  3BG5 A;  3JRA A;  1H89 C;  1Y1W J;  1AKH A;  1IG7 A;  4M3B A;  4XRS G;  1OJL A;  5IP6 A;  4A3D J;  3FIW A;  3A03 A;  3M4O J;  4X6A J;  4MFE A;  5IOY A;  4XK4 A;  1APL C;  3HOX J;  1X2N A;  1JT6 A;  4B3A A;  1B72 A;  2MG4 A;  5JLX A;  2HYJ A;  5EF6 A;  1UMQ A;  3CCY A;  3JRF A;  2X48 A;  1IV6 A;  4I6Z A;  1ZR2 A;  4AYB N;  1TWF J;  3HKZ N;  2DA7 A;  3A02 A;  1GDT A;  5F27 A;  1O4X A;  3JRB A;  4JYK A;  2DTZ A;  1WCM J;  2PMZ N;  2Y2Z A;  1JUP A;  2ECC A;  3HM5 A;  3VPR A;  5C4J J;  4A3F J;  3LSR A;  1PUF B;  1TC3 C;  2ZB9 A;  2YUS A;  1Y1V J;  3ZQI A;  2GLO A;  1JKR C;  2MGQ A;  2RAE A;  1FIA A;  1MSF C;  3TP3 A;  5EZH A;  5DS9 A;  2XGC A;  1JJ8 C;  1IDY A;  1XS9 A;  1I3Q J;  2JN6 A;  2L9R A;  3IH3 A;  3D1N I;  2VPR A;  1WH7 A;  3MVP A;  2MW8 A;  1ITY A;  3BTL A;  3OOU A;  4UUT A;  4LOC A;  1HDD C;  2R0Q C;  3M3Y J;  2Y31 A;  1POG A;  2K40 A;  4MO7 A;  5BNG A;  4A3C J;  1FTZ A;  1JJ6 C;  1LFB A;  4Y52 J;  1QRY A;  1MNM C;  4IHW A;  1MH3 A;  1UG2 A;  4DZP A;  2LY9 A;  2LLK A;  1JTX A;  2JWT A;  1LE8 B;  2L0K A;  2O7O A;  3MKL A;  4FE7 A;  4A69 C;  2EZL A;  5M5Y J;  2HI3 A;  3BR2 A;  2IEK A;  5J3L A;  1IJW C;  2R5Z B;  4B4C A;  4I76 A;  1ETK A;  3A01 B;  4IHY A;  3G1L A;  2LK2 A;  1ETX A;  3NAR A;  3CMY A;  2IBD A;  1MBJ A;  5FLM J;  1MH4 A;  2M34 A;  3S1R J;  3LOC A;  2XGE A;  4A3L J;  4D5C A;  2JA8 J;  2CRG A;  3SDG A;  3C2B A;  4RDU A;  4XRS A;  3Q0W A;  4W1U A;  2Y9Y A;  2M8G X;  5EGO A;  2JA5 J;  3ZQH A;  3LSP A;  1YRN A;  1I6H J;  4BY1 J;  3BR6 A;  1R9T J;  1JUM A;  3FK7 A;  1JGG A;  2E2H J;  4M3D A;  2LKX A;  1P7I A;  2H1K A;  4QSH A;  2E2I J;  3GTM J;  3S1Q J;  2CJJ A;  1VND A;  3E7L A;  3ZQG A;  1IRZ A;  2R5Y A;  3LNQ A;  1ZKG A;  2FD5 A;  1RR7 A;  5M5W J;  1NK2 P;  3HOW J;  5J1Y A;  1RPW A;  5E3L A;  2KDZ A;  3QPS A;  3GTL J;  1ZTR A;  2LD5 A;  1LFU P;  1BW5 A;  3CDL A;  5F08 A;  1SAN A;  1WI3 A;  1IGN A;  3QPL A;  2NS7 A;  1AKH B;  2Y9Z A;  5FJ8 J;  4XID A;  2O8K A;  2X9D A;  2K9N A;  2VKE A;  4JX5 A;  1ETQ A;  3CQZ J;  3QQA A;  1ZGW A;  3I4M J;  2VUM J;  2EZK A;  2DJN A;  4BBS J;  3RZO J;  3B6A A;  3HEF A;  3IV5 A;  3RKQ A;  1ZR4 A;  2XPW A;  2DMQ A;  5F0C A;  1B8I A;  3HGG A;  3K2A A;  3S1N J;  3Q0V A;  2HXO A;  4DZJ A;  1OCT C;  4CYC A;  2M0C A;  2WAQ N;  3B6C A;  1TWG J;  5E3O A;  4L5E A;  4C3J J;  3HOZ J;  3BG3 A;  5GP9 A;  1FJL A;  2ME0 A;  2G0E A;  3OIO A;  4FE4 A;  1NK3 P;  1ETV A;  3GTJ J;  1HCR A;  2EH3 A;  1BW6 A;  5EZG A;  3LSG A;  2KT0 A;  2R7Z J;  5HOD A;  1BJZ A;  2JK3 A;  2ECB A;  3JRD A;  3ZQF A;  2NS8 A;  1H8A C;  3FIS A;  3IH4 A;  4W97 A;  9ANT A;  5JLW A;  4A3E J;  1X58 A;  2DA1 A;  2ID6 A;  2CQX A;  1WPK A;  5FKM A;  1BA5 A;  4BXX J;  2N8G A;  2ELK A;  3PO2 J;  1ZQ3 P;  2L7F P;  1GV5 A;  1RKW A;  3OSG A;  2R93 J;  4M3E A;  1K61 A;  2LFB A;  2I10 A;  3JRE A;  1IDZ A;  1Z0X A;  1T56 A;  4EEF G;  4QIW N;  1W0T A;  1PUF A;  1NTC A;  3BQY A;  3RQI A;  4M6V A;  3TP0 A;  2FX0 A;  2OF7 A;  2QCO A;  1MBF A;  2R92 J;  4BY7 J;  1X2M A;  2VKV A;  1D5Y A;  5M3M J;  1CQT A;  5FKK A;  3JRG A;  5GPC A;  3SJM A;  1K83 J;  4V2F A;  3BTJ A;  4A3M J;  3GTQ J;  4C3H J;  1HDP A;  5F1J A;  1F43 A;  3PM1 A;  1QVU A;  2DMP A;  5C44 J;  1ENH A;  5F0H A;  2M2E A;  2E2J J;  5EEA A;  1YRN B;  3TW7 A;  1DU6 A;  5J1R A;  1FTT A;  2K9S A;  1U78 A;  3H3V K;  1T33 A;  5IYC J;  5EDN A;  1TWA J;  2CQQ A;  1AHD P;  1F36 A;  4D7N A;  5EG0 B;  2FQ4 A;  2JA6 J;  1DU0 A;  1ETY A;  2WB1 N;  1OFC X;  1JTY A;  1ORK A;  2FJ1 A;  4J19 A;  5K7Z A;  2HOA A;  1FEX A;  4D5F A;  4UUS B;  4A3G J;  4S0H B;  2R5Z A;  4HNV A;  3HOY J;  2DA6 A;  2W48 A;  2TRT A;  3HDD A;  3S1M J;  1U9O A;  2GM4 A;  2MSY A;  4XIC A;  2CUE A;  5GPA A;  5K7F A;  2QF7 A;  2DMT A;  4V2G A;  1JKQ C;  2HQ5 A;  4DYR A;  4G12 A;  3F0C A;  3BR3 A;  4DYQ A;  2GBY A;  5M3F J;  2HXI A;  4JX4 A;  3S16 J;  1HOM A;  4FIS A;  4MLO A;  5FKO A;  1B8I B;  1BL0 A;  2E1O A;  1B72 B;  1MSE C;  2DA3 A;  2L7Z A;  1MBK A;  5FKL A;  4CYC B;  4AC0 A;  2DA5 A;  3O8G A;  1QVT A;  2D5V A;  3NAU A;  3DEW A;  5C4X J;  4B1R A;  2JJ7 A;  3G1M A;  1U8B A;  3BG9 A;  4IHX A;  3PO3 J;  2ID3 A;  1GT0 C;  3BR1 A;  5IP9 J;  5E3N A;  1QPI A;  3BR0 A;  5FLV A;  3JR9 A;  2COB A;  1JUS A;  2K9Q A;  3WHB A;  3L1P A;  2AHQ A;  5F04 A;  3HOU J;  3MN2 A;  1VI0 A;  1IC8 A;  1Z77 A;  4A3J J;  4FTH A;  1WH5 A;  3I4N J;  2HDD A;  2NVY J;  2TCT A;  1RET A;  4IEJ A;  2LTP A;  5M5X J;  4MIM A;  4D7M A;  4FCY A;  2WV1 A;  3TED A;  4RBO A;  5FKN A;  3FK6 A;  5K7H A;  2HOT A;  1H88 C;  3G1O A;  3JRC A;  5EYR A;  1FIP A;  3S17 J;  4Y7N J;  2E19 A;  2EBI A;  1Q1V A;  4ABZ A;  3LSJ A;  1G2H A;  3IH2 A;  3BTC A;  1GVD A;  2EZH A;  2XRL A;  1ZK8 A;  5F0F A;  2VI6 A;  4IHV A;  2OPT A;  3GBG A;  3HBL A;  4C2M J;  1SFO J;  2YU9 J;  1U9N A;  2H8R A;  5DTD A;  1A5J A;  1OCP A;  1JKP C;  3S15 J;  3UKG A;  4XRM A;  2P81 A;  3W6V A;  2XB5 A;  2XPV A;  2NVQ J;  1JT0 A;  4A3I J;  1XC5 A;  5IPA A;  3GTK J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...