4C3JJ

Structure of 14-subunit rna polymerase i at 3.35 a resolution, crystal form c2-90
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
69
structure length
69
Chain Sequence
b'MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNPLEKR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-DIRECTED RNA POLYMERASE I SUBUNIT RPA190
publication title Crystal Structure of the 14-Subunit RNA Polymerase I
pubmed doi rcsb
molecule tags Transcription
total genus 13
structure length 69
sequence length 69
ec nomenclature
pdb deposition date 2013-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF01194 RNA_pol_N RNA polymerases N / 8 kDa subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 4c3jJ00
2NOGA 2DMNA 3BTJA 3JRFA 5EG0B 2R5YA 3BG9A 4DZJA 1UHSA 2XGDA 3W6VA 1H88C 3S14J 2DA6A 1SFOJ 4M3GA 4C3JJ 4MFDA 1HF0A 2CQXA 4A3EJ 4A69C 4X1EA 5F0CA 4GFBA 4D5FA 1DU6A 1QVTA 2XGCA 4UUSA 5C3EJ 2HQ5A 2M2EA 2XPUA 3ZQLA 2LR8A 5E3LA 5IYCJ 2MSYA 3JRBA 3RQIA 2LTPA 1D5YA 3HOZJ 5FKNA 1RKTA 4M3DA 2Y0SN 1WH7A 4CYCB 1RKWA 4MLOA 2AO9A 2HOAA 1A6IA 3G1OA 2DA3A 4BKXA 2K9SA 3LOCA 3HDDA 3C2BA 3MKLA 4Y52J 2VKVA 2M9HA 2EZHA 1B8IA 3S1MJ 1ORKA 2AHQA 1VI0A 1MSEC 1IGNA 3S1QJ 1FTZA 1F36A 2CU7A 2CUEA 3OSGA 2OF7A 1ZR2A 2PMZN 2ME6A 1JGGA 3GBGA 2DMQA 2W48A 1HLVA 1YRNA 4DYCA 4DYRA 4W1UA 1WH5A 1HOMA 5FKOA 4DW6A 2HYJA 3HKZN 3GTJJ 3GTPJ 3BTCA 3HOVJ 2WV1A 5FKLA 2NVQJ 2CUFA 2COBA 2L0KA 1VF9A 3H3VK 4FISA 2XRLA 2OPTA 5EDNA 3PO2J 3VPRA 2R5YB 3IV5A 5J1UA 1FEXA 1ETOA 4V2GA 4M3FA 5F04A 3HM5A 3HB9A 1Z77A 2Y2ZA 1K83J 3BT9A 3WHBA 2IEKA 3MVPA 5C4JJ 4D5CA 1ETQA 1ZGWA 4ABZA 2JWTA 1ZKGA 2DA7A 3JREA 1MNMC 1JKQC 3GTGJ 4UUSB 1Y1WJ 1T56A 5K7FA 5K7ZA 4XRSG 4QIWN 5J1RA 2X6OA 2Y30A 2XB0X 2HI3A 3O8HA 4V2FA 1MSFC 2JA5J 1E3OC 1JJ6C 1T33A 5F1JA 5EGOA 1MBHA 2TRTA 2ZB9A 1K61A 3I4MJ 3JRDA 4X6AJ 1B72A 2XSDC 1TC3C 5IYDJ 2EBIA 1IRZA 2JA8J 5E3NA 5F08A 1RETA 2MG4A 5IP7J 4D7MA 2E1OA 2FD5A 1JUMA 1P7JA 1B8IB 2XPVA 2ECCA 4B1RA 5IPAA 2FX0A 1XS9A 2HXOA 1O4XA 1LE8A 2KT0A 1TWHJ 2LFBA 3ZQHA 1NK3P 1UMQA 1JUPA 2ME0A 1H89C 4C3IJ 2E2JJ 3FISA 4A3BJ 2O7OA 2HXIA 1R9TJ 1APLC 1A5JA 4A3MJ 3RKQA 3FK6A 4IHVA 1I50J 3BR5A 3S17J 1WPKA 3LSGA 4A3LJ 1RPWA 4UUTA 2NS8A 1I3QJ 2K9NA 2TCTA 3OIOA 2O8KA 3BR2A 2DMTA 2LLKA 5EEAA 4JP0A 2X48A 3CQZJ 4J19A 5DS9A 3LNQA 2L7FP 2WB1N 3WHCA 2NVXJ 3HGGA 4EEFG 4B4CA 2E2HJ 3RZOJ 2DN0A 4DYQA 3OOUA 2ECBA 2EQRA 4A3KJ 3GTLJ 3Q0UA 3G1MA 1EF4A 3F0CA 1I6HJ 1JT6A 5EGOB 1MH3A 1VNDA 5E3OA 5IYBJ 5EZGA 1B72B 9ANTA 1U9NA 1U8BA 4G12A 5EZHA 2H1KA 3ZOBA 3BG5A 5J3LA 3HOUJ 3ZQIA 1SANA 1X2NA 1JT0A 3FK7A 2D5VA 3K7AJ 3OSFA 1XC5A 2NVYJ 5IOYA 2HDDA 2JJ7A 1OCTC 4LOCA 1GT0C 5FLVA 1X2MA 3BQZA 3JR9A 2H8RA 1IC8A 3BR3A 1ZR4A 3ZQCA 3S1RJ 4IHXA 1HDDC 3JRAA 2JK3A 3LSPA 3I4NJ 3TW6A 2GLOA 4A3IJ 4B3AA 2R93J 4XRMA 2R0QC 2HOSA 4MO7A 3S16J 2R92J 4BBSJ 2G0EA 4Y7NJ 4L5EA 1GVDA 5JLWA 3IH4A 5EYRA 5DTDA 4QTRA 3BR1A 3BQYA 3NAUA 1QPIA 1HDPA 3GTKJ 3HBLA 1GV5A 5C4XJ 3QPSA 2R7ZJ 2R5ZA 3TP0A 3LSRA 2N8GA 2JN6A 3A03A 4AYBN 1IV6A 3UKGA 3GTQJ 2JA6J 1AKHA 4JX4A 4RBOA 2IAIA 3Q0WA 1U78A 4XRSA 3TEDA 2O9LA 3S15J 2ELKA 3SDGA 2KDZA 1IDYA 4BBRJ 2EH3A 2XPWA 5M5XJ 2EZIA 3Q3SA 3BR0A 1TWGJ 2P81A 2LP0A 4D7NA 2CQQA 2DA2A 3DCFA 4XK4A 4BY7J 1ZQ3P 1ETXA 2DMUA 3A01A 4S0HB 1JKPC 4FE4A 2GM4A 2DMPA 4JYKA 5FKKA 1TWFJ 4BXXJ 2QF7A 4JX6A 2Y9ZA 3M3YJ 2E19A 2EZLA 1ETYA 3Q0VA 1BW5A 1MH4A 4CYCA 1YRNB 4IEJA 4AC0A 1JKOC 1X58A 1W0TA 2GBYA 4A93J 1ETVA 1OCPA 5J1YA 2YUSA 2ID6A 4M3EA 4MIMA 1FIAA 5E3MA 3S2DJ 2K40A 3FIWA 4XICA 2R5ZB 1WGXA 3LSJA 2VKEA 1OFCX 1MBEA 1IDZA 1TWAJ 3S2HJ 1BL0A 1AKHB 1W0UA 2LY9A 1VFCA 3GTOJ 5M3MJ 1P7IA 5EF6A 1H8AC 4MFEA 2DJNA 5IP6A 5GP9A 1ITYA 3BG3A 2M0CA 1S7EA 2JMWA 1DU0A 2M8GX 1Z0XA 4HNVA 3D1NI 2CJJA 2Y31A 3QPLA 3GTMJ 1WI3A 3A01B 4A3FJ 1AU7A 5HODA 2M34A 3JRHA 5M5WJ 3HEFA 1FIPA 1AHDP 2JA7J 1QRYA 1BA5A 1PUFA 3HOWJ 1LE8B 2WAQN 2Y9YA 4I6ZA 3PO3J 2XB5A 5GPAA 4W97A 3L1PA 1Q1VA 5GPCA 4BY1J 4A3DJ 1GV2A 2EZKA 4NDLA 1XG1A 3S1NJ 1U9OA 2LKXA 2E2IJ 3B6AA 3CDLA 2DTZA 3O8GA 3JRIA 1OJLA 1MBFA 1POGA 1LFBA 1QVUA 3M4OJ 1ETKA 2QCOA 5IP9J 3SFIA 5IOZA 2L7ZA 1FTTA 3IH2A 1TWCJ 3K2AA 3ZQFA 1CQTA 4I76A 3TP3A 4AUXA 1BW6A 1NK2P 2NVTJ 5M5YJ 2DA5A 1JTYA 1JKRC 1JTXA 3CMYA 3BR6A 1F43A 1IUFA 4C2MJ 1BJZA 1MBKA 5F27A 2IBDA 4FTHA 4A3GJ 3PM1A 4IHYA 2XGEA 5FLMJ 5JLXA 5EG0A 3JRCA 3CCYA 5K7HA 4XIDA 4RDUA 1ETWA 4IHWA 2DA4A 2FQ4A 2L7MP 5C44J 3SJMA 2MW8A 4FE7A 3RZDJ 2K9QA 3IH3A 3BTIA 1LFUP 4A3CJ 1RR7A 1MBJA 2DA1A 4A3JJ 1HCRA 2LK2A 3A02A 3FKIJ 1JJ8C 1IG7A 3HGYA 4M3BA 2LD5A 1GUUA 1FJLA 1ENHA 1G2HA 5F0HA 4C3HJ 1PUFB 2L9RA 3HOYJ 3G1LA 2YU9J 3B6CA 1JUSA 5BNGA 2NS7A 1ZTRA 3BTLA 3MN2A 1IJWC 2YS9A 1NTCA 1UG2A 2VPRA 2FJ1A 3TW7A 5F0FA 1Y1VJ 3HOXJ 3QQAA 2VUMJ 1RESA 4DZPA 2RAEA 2VI6A 4JX5A 4QSHA 2B63J 1MBGA 2LVSA 2ID3A 5FKMA 1ZK8A 1GDTA 2HOTA 2MGQA 3E7LA 3ZQGA 1WCMJ 2I10A 3NARA 2CRGA 4M6VA 2X9DA 3H0GJ 5FJ8J 3JRGA 5M3FJ 3DEWA 4FCYA
chains in the Genus database with same CATH superfamily
3KP7A 5EG0B 2VXZA 2VT3A 3BG9A 1UHSA 1WJAA 2VL8A 3W6VA 4C9YA 2KJBA 1TT0A 3S14J 3ABUA 5IT9Z 1Z91A 1FC3A 4C3JJ 2A05A 2CQXA 1XGSA 3EDPA 4A69C 4RAZA 4X1EA 3IWZA 2VODA 2KDOA 2M3AA 2JSCA 2MLKA 5LBQA 3OL3A 2OD5A 3V8JA 1YW9A 2HQ5A 5FO5A 5DUKA 4BJ6C 5IYCJ 1FSHA 1WJCA 2LTPA 1IN7A 1D5YA 2QYOA 3QP5A 4I98B 5L3FA 2HKOA 1QNTA 2BYVE 3MKZA 2Z3YA 2CW0F 4CYCB 1RKWA 1LDJA 3ESWB 3K6GA 4MLOA 3A1YA 1Y8QB 1VQMI 2HOAA 3DKYA 2K9SA 4BKXA 3F22A 5CKTA 3C2BA 1T0FC 3IL2A 2A3SA 3S1MJ 3SFZA 2AHQA 2VBYA 3IKVA 2GAUA 3DU5A 2CUEA 1XX5A 2O6GE 2ZCWA 3UNGC 4LLGF 1GHCA 1QA6A 1VQ4I 2PMZA 1Z7LA 1Z3YA 4PSXA 1FMWA 3QPHA 3SDBA 1VQPI 2P0WA 3BTCA 3VYSB 4KYWA 4GYIA 3WE3A 3FM3A 1X3WB 1Z05A 3HKZA 2EK5A 2UXXA 2XDVA 4HSTA 4P5OA 2NVQJ 1W4MA 3LA3A 2TDXA 3FXJA 3KP3A 1YIJI 2OPTA 4LK1F 2QWWA 2X1EA 1QZZA 1X3ZB 4KA4A 2HYGD 4ENNA 1FEXA 1ETOA 4M3FA 1TZLA 1T08B 2W7NA 2ZJRF 4BQOA 4M73A 3I54A 3PIPF 3K4CA 3MVPA 4D5CA 5C4JJ 4ZTJA 3R4KA 5CVVA 4RS8A 3LFUA 3BY6A 1ZKGA 2DA7A 5ICGA 4E7SA 1JKQC 4UUSB 1Y1WJ 1HXDA 2MC4A 2KRHA 4XRSG 4QIWN 1I3AA 3OV8A 2GWRA 2X6OA 1PVEA 5LEKA 1LNWA 4A12A 3O8HA 4V2FA 1MSFC 1E3OC 3G4SI 4XKCA 2IVMA 1T33A 4OAYA 2STTA 4KNYA 3BLYA 3RTRA 5DV5A 3X2QH 1X4OA 4GCVA 1K78A 1FYKA 3TMOA 1YOVB 1P7JA 1V54H 2JRTA 5J8FA 2VPLA 4YFXF 1ZRDA 1B8IB 4S04A 3J81Z 2FA5A 4ZYHA 3QWLA 4RB0A 3OS2A 1LE8A 1TWHJ 4LB5A 1I5ZA 1AA7A 1TQMA 3CTAA 4WXCA 1R4MB 5HS7A 2Z99A 2R7WA 5KCMA 1HSJA 3FISA 5KVRA 2D45A 4A3BJ 2HXIA 3CF5F 1FOYA 4LJZF 4A3MJ 1KA8A 5E1WA 1IXSB 3FK6A 3G3ZA 4IHVA 4JQFA 4YIFA 1SC7A 4E7LA 1WPKA 3KP6A 1FZPB 1YO5C 1QQIA 1F5TA 2TCTA 2O8KA 3BR2A 1RNLA 2FNPA 2L4MA 4XLEA 3F8FA 3OIQA 4HQEA 2V6CA 1QHHD 1WQ2A 2VE9A 2LLKA 4BDZA 3TO9A 2FF4A 3MCZA 3CCVI 3OR2C 3HTSB 2X1DA 2O3FA 5LGUA 4Y17A 3OYJA 2HDWA 3CQZJ 1DPUA 1H0MA 4Q48A 2ADUA 2GQQA 3ASNH 3R61A 3LNQA 2F5CA 3GFIA 2PI0A 1W5SA 3U2RA 4EEFG 2IS6A 1FOWA 2WB1A 2E2HJ 2DN0A 2ECBA 2DBBA 4IJAA 3Q0UA 5DCFA 1W36D 2KHMA 3ZXSA 4O6JA 2OCCH 1EF4A 1LEAA 2B7EA 4P9UA 5HNHA 1JT6A 5EGOB 3D0SA 1F1ZA 4KICA 3FXQA 3LAPA 9ANTA 5ILVA 1U9NA 2DK8A 5EZHA 3LFKA 5BQTA 5J3LA 3IAS2 3ZQIA 3FK7A 4MQ9F 1XC5A 2JJ7A 2BVMA 1J59A 3HTUA 5FLVA 4LK0F 3T0YA 2H8RA 3BR3A 1ZR4A 2IGKA 3JRAA 2R7TA 4P96A 2GLOA 1ZELA 4B3AA 2HOSA 3GLXA 1BN5A 1VQ7I 3QAHA 1D8KA 2QSFX 4FT8A 1SMTA 2L2OA 3I71A 5HDNA 1XSDA 3NAUA 1HDPA 1TT5B 4LIVA 1K6YA 2DPUA 2XF6A 1S3JA 2KFDA 4I7HA 3S32A 3JTHA 2R7ZJ 1SFKA 2NYXA 4BJTA 3TP0A 3LSRA 5LGNA 2XC7A 3WODF 3ZMDA 4WCGA 3F8NA 3A03A 1FMVA 3OWTA 3UKGA 4XSZF 1ZARA 5B1AH 2JA6J 3T8RA 2IAIA 1U78A 3I56I 3B73A 2PN6A 4XRSA 1AWCA 2EINH 1HBXG 4MTEA 4QWQA 1IDYA 4Q4ZF 6PAXA 3SQNA 1UELB 4A6EA 4HPQA 2QGUA 2WC2A 3FM5A 4P9FA 4A5MA 2H09A 3I64A 1JE8A 4FE4A 2YR2A 3OS0A 2GM4A 2Y69H 4JYKA 1YIOA 3H5NA 2H8WA 2LKPA 2O5RA 2ZFUA 1OR7A 3DKWA 4CZCA 3OYIA 2CW8A 2UWMA 3J80Z 1BR1A 2HWVA 4HX8A 2P6SA 4CUGA 3RJPA 2O8XA 4KUMA 3CC4I 3ASOH 2E19A 1ETYA 4AIHA 2KPMA 1FX7A 1YRNB 3V8KA 4IEJA 1CGPA 3RYRA 1ZGJA 2NVUB 1I39A 3CJTB 4BHPA 3ABKH 4EJWA 3OIPA 3BG7A 2Y48A 1TW3A 1X58A 1KU7A 1W0TA 1SD6A 3IUOA 2L3DA 2IS1A 3P7NA 4A93J 4UB6C 3H92A 5J1YA 2ID6A 1LVAA 4M3EA 1XPXA 1LFPA 4LITA 1FIAA 5E3MA 3S2DJ 1N77A 3CCUI 2GOXB 3LSIA 4M72A 3WTXC 3LSJA 4RB2C 1O3QA 2E1MC 2BGCA 1YX5A 2WA0A 1FWZA 1MBEA 2LF8A 1IDZA 3KYLA 2LNBA 1AKHB 4M9ZA 1O3TA 2K7LA 4ZYAA 2LY9A 4MQVA 1VFCA 3MZHA 5LRSA 4PDKA 3BZKA 1H8AC 2PX9A 1D0YA 2DJNA 2P5LC 4AVZA 4EM2A 5BS6A 1K7AA 5FLXK 2AS5F 3EUHA 3Q9VA 2M4GA 5BPDA 1XGMA 5HLIA 4F91B 2W57A 3D1NI 4MNUA 3IKTA 3SZPA 1R6RA 5E8IA 3A01B 1AU7A 1RC9A 3QP6A 3WTYC 5IY5H 1FIPA 2VBZA 2PJRB 1QRYA 1BA5A 3QRFF 4A0YA 3FMSA 3TDZC 3PO3J 2M8EA 3VODA 3MKWB 1LUJB 3L1PA 1Q1VA 2CV0A 2EZKA 3K70C 3E6MA 2KMUA 4YELA 1Z67A 2LKXA 5B66C 1A31A 3FXMA 3O8GA 2VOOA 1MBFA 3RPUD 3FWEA 5CYVA 3IWFA 1VQOI 2M7AA 3SFIA 3O2PE 4EJUA 5IOZA 3L2WA 1GXPA 3PIOF 3DBRB 1TWCJ 3IH2A 1YITI 4KIGA 4IHSA 1XGOA 4RM3A 1NK2P 4PSWA 2OBPA 3JSOA 3ECHA 1JKRC 4L9VA 3V7RA 1J75A 1DGRM 1A04A 3L2QA 3R60A 1LJ9A 1IUFA 2EJRA 3CCMI 5F27A 2JPCA 3VSKA 4Q5SF 4FTHA 1MMNA 5FD5A 3PM1A 2XGEA 3GFMA 4I0BA 2F4IA 3F8CA 3JRCA 2X1CA 3DXJF 2HFHA 2ZXWH 1TLHB 3BWGA 2FU4A 1MNDA 4NUBA 2V1XA 1YW8A 3SJMA 4BL0B 4UXNA 3RZDJ 3MFKA 2K9QA 3H1CA 4AD9A 1OYYA 4A3CJ 2DFEA 1HCRA 1G3YA 4ZYDA 3FKIJ 4II2A 4M3BA 2STWA 2NXNB 3ROUA 1FJLA 3K69A 2RKHA 2VT2A 1G2HA 1KU2A 2M45A 5F0HA 4PFPA 1HW2A 2L9RA 1X1BA 1UHWA 1BC8C 2X51A 1YHQI 5FRNA 1P92A 3OY9A 1QO0D 1ZYRF 4HOBA 2MLGA 3CZ6A 1JUSA 2Z9OA 2NS7A 3HPGA 1OR7C 2JRMA 4BHBA 1K6OA 1SFUA 1NTCA 3L9FA 4KIFA 3E1SA 2A6EF 1B9NA 4YFKF 3CD6I 1Y1VJ 2LY1A 2V9PA 5EEGA 2XAGA 4G94A 4JBAA 4KITB 2GIVA 3OOPA 1MMGA 2CW7A 1S7AA 2O03A 4QSHA 4BGDA 2R7OA 2IS2A 1IN4A 3FDYA 1ZK8A 2NNYA 2KP6A 3WG9A 4RLFA 2LSOA 2DU9A 3FXLA 1IXRC 4OOIA 1P2FA 3E7LA 2EFOA 3ZQ7A 5K1YA 3ELKA 3CO7C 1WCMJ 2I10A 3NARA 4UVAA 3ZP5A 5M3FJ 2X9DA 1SVOA 3CCEI 2M4KA 2VJIA 2H94A 3KFWX 1YJNI 4FCYA 2DMNA 3JRFA 4EJOA 2R5YA 3KCCA 1G3TA 4OU0A 1OPCA 4F93B 3I59B 4BAYA 4EGZA 4N9HA 4HDUA 2DA6A 3ZCOA 3BCBA 4HBLA 4A3EJ 2LBFA 1WRJA 3FXRA 1BR2A 3ZMVA 4CCOA 3W2AA 4C2UA 4PJLA 4D5FA 4U0WA 2EIKH 4BYYA 4LG0A 1DU6A 2CUZA 3EYYA 1QVTA 1HA8A 2QQBA 5C3EJ 4D9JA 1X4PA 4I99C 2JUGA 1XSVA 2FSWA 5E3LA 2M0MA 3HZJA 3CCLI 1RZ4A 1R5HA 2HTSA 3HOZJ 5FKNA 3GYHX 1RKTA 1STZA 2IA0A 2XROA 3CCRI 3ABMH 3F23A 1WH7A 4DOZA 5LFAA 4PFOA 2Y0SA 4XQFA 2Q2EB 2K9LA 2OAZA 2VKVA 1X1AA 5DCMB 2M9HA 2EZHA 3LQQA 3TGNA 4U7DA 1R71A 4KIBA 1O7LA 5AONA 2E1NA 1D0ZA 2OF7A 4H0EA 1BI3A 1DPRA 3F6VA 5K5RA 2BW3A 3M07A 5FGMA 2ME6A 3GBGA 5JHUA 2DMQA 5FFZA 2FQ3A 1S7OA 5FKOA 2K27A 4PGGA 3VWBA 3GTPJ 1TBXA 3HOVJ 5B3SH 2CV1A 3CUQA 2DT6A 3DPLC 1Y6IA 5TRDA 2L0KA 2COBA 4DNCA 1VF9A 3H3VK 3DF8A 1JHFA 2BY3A 2QZ8A 2OQRA 5CLSA 4KMUX 5DUIA 4BE1A 1R36A 2KQRA 4V2GA 2D1VA 1PJRA 3HB9A 5ICFA 2Q1ZB 1YQAA 4BNCA 1IRFA 5BMZA 3WHBA 4JK1X 1ETQA 2W85A 1ZGWA 3K1MA 2FUG2 1Y39A 3ZMUA 1U6GA 2J5OA 2ZMEC 3FZVA 3HJEA 1MNMC 3GTGJ 3KP4A 1A35A 3E5XA 1TNSA 4HX7A 5K7ZA 1ZN2A 2Z2SB 3HYIA 2BE5F 4J01A 4ON0A 4CHUA 4I2OA 4ESBA 3L09A 1MBHA 3GZNB 1USTA 3E6BA 3MWMA 1R1VA 2HPIA 5TISC 2P7CB 2DFHA 2XSDC 3WE2A 3PUBA 3CJRB 5F08A 1RETA 2CV2A 1W5CC 2DLLA 1H9TA 2MH2A 4D7MA 1LDDA 2E1OA 2EILH 4NQWA 5L3GA 1JUMA 2UV1A 1ZG3A 3HRUA 2CH0A 1TQIA 2XPVA 4LD5A 2ECCA 4G7HF 1OMIA 2FX0A 4B44A 2V4JC 2KT0A 1UG0A 3R6SA 1CF7A 2LFBA 3ZQHA 4YG2F 1UMQA 2JVGA 2W1OA 4L9NA 4CGZA 4KJZA 4RB1A 2P7VB 5HVQC 2E2JJ 2DOAA 2F5DA 2O7OA 2EWNA 4WX9A 3DLAA 1R9TJ 3K4BA 3HSEA 4OIOF 1VQ6I 2WADA 4CCMA 1I50J 3WG7H 4A3LJ 1B59A 1RPWA 3GZ5A 1KONA 4EM1A 3PSFA 2K9NA 5GTHC 2DMTA 3WTUC 2RQQA 2M30A 1Y0NA 1QHGA 2IJLA 4JP0A 4ASNA 1YW7A 2V26A 4NB5A 2A69F 3I3LA 4ENJA 5CQEA 1OQYA 5DS9A 3MMYB 1RUNA 1XGNA 2GOMA 1KU9A 3IRQA 2NVXJ 4L0ZB 2DK5A 4P55A 4B3XA 4IX7A 4B4CA 3OOUA 3BP8A 1YYVA 3IAM2 2DPDA 4KMFA 3G1MA 4Y3OA 2D1HA 1HSTA 3F0CA 1R23A 1WJDA 2MYSA 5JI6A 1I6HJ 5D6FA 3AG2H 1ERDA 2GA2A 5IYBJ 5EZGA 1S8NA 1EH8A 4KN7X 2H1KA 1K78B 4PGHA 3OSFA 3M7GA 2X0LA 4KFCA 4PK4A 2R7UA 3E0JB 1UZCA 3L7WA 4TV7A 1WKMA 1MDMA 3LWFA 2CFXA 2VBXA 3BQZA 1G59A 2R7SA 5GADJ 4N9IA 4XORA 2R7DA 3C1DA 4E7KA 2JK3A 2E5NA 3ZQCA 1R49A 4A3IJ 5AIQA 2R93J 3L00A 2K85A 2KZVA 2X4HA 3N05A 4XRMA 2R0QC 4RAGA 5L3CA 2Z5UA 4MO7A 2EIMH 3G71I 5J4YA 2JQ7A 3COAC 2DO7A 2JSPA 4MTDA 2QSHX 1LVKA 3U21A 2DCEA 2E1MB 5JLWA 3C2GA 1ZREA 3GTKJ 2XRNA 3HBLA 5H20A 3ERED 1DGWY 1S72I 3CUOA 4ZYGA 1W7PA 2OZUA 5FFXA 3M1CA 4OMZA 5C4XJ 3QPSA 2IPQX 3L2RA 3PUFA 5CPRB 4AYBN 1DDNA 4Z2YA 1OYWA 1ZG5A 3GTQJ 2M87A 2VOPA 2BEOA 4E70A 4JX4A 2IRFG 1UAAA 2W25A 2XKOA 4ZYEA 3AG3H 4EM0B 2KISA 2VASA 2IP2A 3HOTA 2KDZA 3CCQI 2CGPA 2XPWA 2DDBA 5DEQA 4AVPA 5A2QK 1TWGJ 1ZRFA 4D7NA 4HZFA 1ZQ3P 4XK4A 5ICCA 1ETXA 2HR3A 2CG4A 2DMUA 4Y15A 3CJNA 1HW5A 3LSKA 2HVQA 2HZDA 1R1TA 5FKKA 5D8LB 1MKMA 2RQPA 3WU1B 2ESHA 4JX6A 1WZ2A 4KISA 2Y9ZA 3JAMZ 5HDKA 1LPQA 2Z1DA 3U9GA 2QBYB 4UUVA 2L9NA 3H0DA 3Q0VA 1MH4A 4CYCA 2GXGA 3MD2A 3M8JA 1UHMA 1VQNI 1SMYF 1BIBA 3OYKA 2VJ4A 3CMEI 2VE8A 2CQNA 1G3WA 2X85A 3C7JA 3KPHA 3N4MA 3GWZA 2JTVA 4U88A 2IT0A 2GBYA 2DW4A 4S05A 1W5TA 2LH9A 4ZH4F 1D0XA 3GMEA 4CCKA 1PP7U 3HRMA 3HHGA 3NEUA 1VQ5I 3K10A 1R00A 5BPIA 3OYFA 3J7ZI 2XHKA 2CSOA 2J5PA 4XLNF 1MJ9A 4F55A 5IT9K 2FOWA 4G6DA 4IHTA 1YI2I 2WY7Q 3F3XA 3TOBA 4ESFA 1QBJA 1U2WA 2A61A 5M3MJ 5D4SA 1DQUA 5EF6A 1HKSA 4M6YA 1B1BA 3OYGA 5EEHA 1ITYA 3OYEA 3BG3A 1F4KA 1T2KA 1D5VA 2YU3A 1MJBA 3FX3A 2IGNA 2Y0MA 3VEPA 1Z0XA 4HNVA 2CJJA 1YG2A 1E0EA 3ZQQA 3QPLA 3GTMJ 1E3HA 1WI3A 1RRJA 2M34A 2LG4A 3HL2A 4MGRA 3WU0A 4G7ZF 1REPC 4EJTA 5HLGA 1J09A 2JA7J 3DEEA 3K1NA 4CSWA 3ZPLA 2LF7A 3P9KA 1HC8A 3HOWJ 2MBFA 5E18F 2GIZA 4D0PA 3DLLF 3OYMA 3BOQA 4I6ZA 1IF1A 1ODDA 4W97A 2WBMA 2DDAA 5GPCA 3NWSA 5J47A 2WAQA 1GV2A 4A3DJ 2IXSA 3GEZA 1LDKB 4MHGA 4NDLA 3W6KB 3S1NJ 1OYIA 2QVOA 3CCSI 3ZRGA 2E2IJ 1FBSA 3B6AA 2DTZA 3A4CA 3JRIA 1J9IA 1QVUA 2KIUA 3M4OJ 1SEUA 2CQKA 4XN3A 2L7ZA 1B6AA 1T98A 5DYMA 5TGTA 2K9MA 3RSNA 3TP3A 4AUXA 4HRIA 2BV6A 4HYEA 1W1WE 4YIRX 5M5YJ 2DA5A 5LEJA 2DAOA 1R58A 2IA1A 3CMYA 1F43A 2E5ZA 4F3QA 5F64A 2XV4S 3CMMA 2EIJH 1NHAA 4A3GJ 4XKVA 5JLXA 5B5EC 2PFBA 3RDIA 3K2ZA 2QA4I 2KRFA 4BQAA 1WI9A 1ZRCA 2VJJA 4IHWA 2EV5A 4QPQA 5GTIC 2E36A 2ZNYA 5FRMA 2R7XA 3IH3A 3T8TA 3CDIA 3QOPA 1RUOA 1H9GA 2DA1A 4XLHA 2L01A 4XKWA 3JW4A 2VLAA 3A02A 4RA2A 1JJ8C 3KEYA 3HGYA 1XCBA 2X6YA 3K4JA 2XAJA 3K70D 2LD5A 1GUUA 1J5YA 2KIFA 3HUGA 3DEUA 1MJAA 5DD8A 1P4WA 3M8FA 3HOYJ 1BR4A 5E1ZB 3L2VA 5LGTA 2K3PA 5LHHA 2XIGA 3WTTC 4PJ0C 2EB7A 3J81K 3TKYA 1O3RA 2Z16A 3PNYA 1ZTRA 2V1UA 3OMYA 3BTLA 4XLAA 3MN2A 1IJWC 4OIQF 2PBIA 1KYWA 1MMAA 2E35A 4LFUA 3BPVA 2HQAA 1Z1DA 2H1LA 3TBIA 3HOXJ 2E60A 3I4PA 1SVMA 4UVCA 2RAEA 2VI6A 1FYMA 4FASD 1ZLJA 4EV0A 5FKMA 5ED4A 4YRVA 3QYEA 2HOTA 2F48A 2VJ5A 3IP4B 1Z21A 3ZQGA 2RV8A 3SXYA 3GF2A 2DTRA 4D1QA 3H9JA 1XTAA 3DU6A 2HU9A 3DEWA 1IV8A 3FKJA 3EUAA 2NOGA 1FSEA 2RNGA 3TL4X 5D4RA 2V7FA 1EA3A 2M7BA 2ELJA 2UUZA 2ZMEB 1L0OC 3I58A 3I53A 5D8KB 1H88C 1XDUA 2HTJA 3L2CA 2ICWG 1SFOJ 4M3GA 3Q5FA 3RQ4A 2L02A 3WGGA 5F0CA 2BVLA 1YJ9I 5HDGA 3LSHA 2DJIA 3F8BA 3KZZA 4L5IA 3ABTA 4YIIA 1S9HA 2XGCA 1N78A 4L9JA 3CLOA 5HS8A 4XSXF 3GFLA 2LR8A 5HLHA 2ZO4A 1KU3A 2I5UA 4UHTA 2L7KA 3RQIA 2R7VA 2KJCA 2LDUA 2ZJQF 3A0HC 2F5EA 3GCMA 4M3DA 3TQNA 1O7FA 4HSRA 4LLNA 2I8DA 3EPZA 3P9CA 4O3MA 4HV6A 2L9SA 4U0VA 2FXAA 1A6IA 2DA3A 1SAUA 3LOCA 1OKRA 3H3ZA 1IAWA 5AIPA 4NC6A 1Q1HA 3VYTB 1ORKA 1MSEC 2NS0A 1IGNA 3S1QJ 3KLNA 1F36A 1FTZA 2CU7A 3M9AA 5J6XA 2HYFA 3DBHB 2PMZN 2L5QA 1ZR2A 2VN2A 2ZC2A 1JGGA 1XDSA 2W48A 1YRNA 2E7WA 2PJPA 1UB9A 3RKXA 4DYRA 1OCCH 2F5VA 4W1UA 1D1CA 1WH5A 3BCAA 3BJAA 4DW6A 2ZJ2A 3HKZN 3GTJJ 4E7HA 4U7BA 2WV1A 2MC3A 2R4GA 4XM3A 3ECOA 1IN5A 3ZN0A 4CICA 4XLFA 2B0LA 3G6EI 1YTYA 2HDCA 3PO2J 3VPRA 2JVHA 2R5YB 3WU2C 2XUBA 1WWXA 3H5AA 1WHUA 4OIRF 1YS6A 2ISYA 4BS9A 3KP5A 1Z77A 2LBFB 1K83J 3BT9A 2ZSIB 1MGTA 2IEKA 5L3DA 5E17F 2FBHA 3VYRB 4UNOA 4PUSA 1IRGA 2PQ8A 2VB6A 3PQKA 1K4TA 4ABZA 1U3EM 3O3KA 4OIPF 4LG0B 2UZKA 5CQGA 2QSGX 5CVJA 1T56A 2JT1A 3EYIA 3QU6A 2EPFA 5DDGA 5JVGF 1BM9A 2WV0A 2Y30A 3DPTA 2P4WA 2A07F 2OC6A 1U5TA 4ZJZA 4XOPA 5E8GA 4AM3A 3HSRA 2JA5J 4IQJA 5F1JA 3F72A 2ZB9A 2TRTA 3I4MJ 4ZDOA 3GVAA 3JRDA 4X6AJ 1B72A 1TC3C 1ZHFA 2JA8J 3PFIA 2MG4A 5KAIC 5KAFC 5KNLA 2K4JA 3J80K 3TDUC 4A5NA 1PYVA 2FD5A 4LLLA 2XAHA 4R79A 3C18A 3OYCA 2B9SA 2PJRA 2ZXJA 3PFYA 2HXOA 2RVCA 3E6CC 1O4XA 4GRIA 1K4SA 1KYZA 1NK3P 4UY8I 1JUPA 4IF4A 2ME0A 4Q47A 4C3IJ 3BJOA 2DYSH 3QU3A 4OAZA 2CYYA 2MD5A 3S3OA 3KX2A 1JXSA 3GX4X 1APLC 2HGCA 2VXDA 4IL6C 1BI2A 2H27A 5LHIA 1BC7C 5D5VB 3BR5A 3SEZA 1Z9CA 2GZWA 2LOOA 3OIOA 2V9KA 1UFMA 4GGGA 1I27A 3TOAA 2DFIA 3BROA 5GAEJ 3KZYA 2HOEA 5EEAA 4DJAA 2HKXA 2X48A 2ESNA 1NH3A 1YJWI 2WB1N 1PDNC 4KT5C 3LQRA 3HGGA 1UCRA 1J7KA 4UV9A 4LB6B 4DYQA 3EUHC 2EQRA 2X6XA 4A3KJ 3GTLJ 2DFFA 3DQVC 1JHHA 4IXAA 2EFWA 4U87A 3K0LA 2OV7A 4O5VA 2EA4A 1MH3A 1R22A 1VNDA 3G2BA 4QLCU 5E3OA 2XASA 4HG2A 2E71A 1S29A 3ZMSA 4KN4X 1FLIA 3BG5A 1USSA 1HW1A 1SANA 3ISPA 4IPAA 3TO6A 4EATA 4ZZDA 5JR3A 4BE0A 1JT0A 3LAJA 2D5VA 3I55I 3HXLA 1ON1A 5IOYA 4EQQA 1VQ9I 2HDDA 1MMDA 2X6WA 4B47A 1OCTC 4LOCA 1GT0C 1CF7B 1TP4A 1X2MA 3S8PA 2F4OB 2YX4A 1IC8A 4IHXA 1QZEA 4U0YA 3S1RJ 1FNNA 3DP7A 3F6OA 3QODA 3LSPA 3I4NJ 2KIMA 3CMAI 1X1PA 2XAFA 2A5WA 3AFHA 3S16J 2FMYA 4BBSJ 4ZTFA 2G0EA 4L5EA 1GVDA 3W2WA 4CDGA 3DWLE 4X0GA 1DP7P 3BQYA 4I01A 4ENMA 2MH9A 3FHNA 4LMYA 3SHFA 4PZJA 2GXAA 3S3MA 4PJNA 3QPTA 5IT3A 2R5ZA 1IUYA 3ZGKA 3H36A 2JN6A 1IO2A 1WJFA 4WXHA 4CZZA 2OCEA 3CF2A 1OISA 4WWCA 4OWRB 2JUCA 3FF5A 3Q0WA 4PCQA 1I6XA 3TEDA 5H6RA 2O9LA 2OUMA 2CO5A 2ACJA 5JFRA 1BBYA 3I59A 3RKWA 3SDGA 3C3WA 4DBRA 3PJRA 2EH3A 4BACA 1KQ0A 5M5XJ 1O57A 2EZIA 3BR0A 2P81A 3O6BB 2LP0A 4FX0A 1RR8C 3DCFA 4BY7J 4OMYA 2YX7A 2VKDA 3CESA 4AIDA 1JKPC 4HF1A 2DMPA 3WTWC 1U5TC 4BH9A 2KRCA 3MZYA 1TWFJ 3A2KA 4BXXJ 1B9MA 1X1DA 2DI3A 2QF7A 4N4OB 2V9VA 5JHFA 2LC2A 4K2EA 3ZMZA 3FBIB 4ZZLA 2A68F 2FEZA 3M3YJ 3QYBA 4GYGA 1SVLA 3GXOA 3P5JA 4ANJA 3RI4A 3TO7A 3VYUB 4RMNA 3H3UA 2OQGA 3QYFA 1JKOC 1HQCA 2W00A 2FE3A 4IO9F 2LYCA 2LREA 4BDYA 5LRRA 1OCPA 5CVUA 3ZN1A 3NWTA 2K40A 4L5JA 5FROA 2DOEA 1W7PB 5D5XB 4A2UA 2HVRA 2ZXIA 3CC2I 3LL7A 2VKEA 1MD0A 4XLCA 3GUDA 2DQRA 1T95A 1C0WA 1TWAJ 3S2HJ 2VQLA 4CCNA 1W0UA 3V8LA 1FPQA 4II3A 4BEHA 1MMSA 5F1RA 3F8MA 4HAMA 1JGSA 2OTJI 2A6TA 4I0AA 5GP9A 3ABLH 4UVBA 1S7EA 2W82A 3BJ6A 2JMWA 3OR1C 1DU0A 5H2FC 2M8GX 5FB2A 4IQ4A 2O61A 4M71A 1SD4A 2Y31A 2ZNZA 4CCJA 1P4XA 4HV5A 4XOTA 3A0BC 3T5XA 1LEBA 3F9KA 2K02A 1RI7A 2GXBA 1P6RA 1PUFA 1GLNA 3H35A 1LE8B 2P5KA 2XB5A 5GPAA 4HQMA 1BI0A 2KZGA 2WTEA 4KT6A 1RIOH 2OA4A 2L9VA 3BZ6A 3Q9SA 4F92B 1ZG1A 1XG1A 1K79A 1U9OA 2ETHA 2NAZA 3CDLA 1OJLA 1PP8F 3EQLF 1POGA 3MZ8A 1LFBA 2LKSA 4N0BA 4WK8F 1FT9A 2QCOA 4H4KC 5IP9J 3OYLA 3J7YJ 3IRRA 1D8JA 3K2AA 2F4MB 3ML6A 5F6FA 2FNAA 4AIKA 3S2WA 3E97A 4I76A 1BW6A 5L3BA 1WSUA 2RDPA 4CA0A 4RGSA 2NVTJ 3CUQC 2G7HA 4XBFA 3KEOA 3CO6C 1JTXA 3K9TA 4GXOA 4G7OF 3D5LA 4RAYA 3D5SC 4R8HA 1M1EB 4M9XA 5E79C 4C2MJ 3EUKL 2LY2A 4E7IA 1MBKA 1R4NB 1S5LC 3PNTA 3VDXA 4M9SA 2WAEA 4IHYA 5FLMJ 4MEXF 1XMAA 5EG0A 2M1BA 2BZTA 3RIRA 4ZDLA 3WTSC 5K7HA 2EV0A 2VQHA 3ERMA 4XIDA 2OJED 2DA4A 2FQ4A 4Y33A 1EKEA 1S6LA 1Y56A 2ZSHB 3MAJA 4OINF 3MKYB 2L7MP 3HC7A 2MW8A 4FE7A 3DTKA 3E3VA 3L2UA 2HEOA 4NC8A 2L4AA 3S3NA 1LFUP 3WGHA 4G8XA 2F5FA 2VC0A 2LK2A 1J2XA 3VFZA 1WVRA 2C6YA 4IKFA 4JOMA 2QUFA 4LGWA 3AL0C 3FXKA 4C3HJ 1R5ID 1MIJA 3LSTA 1V5GA 4XL9A 3G1LA 3GW2A 4MEYF 4CO8A 2YU9J 4HEA2 4XONA 3KYCB 4RLQA 2NOJB 5BNGA 1YLFA 5L3EA 3GLLA 3OYBA 1UG2A 2F2EA 4BQQA 2FJ1A 1X3UA 4G9YA 3LSMA 3QQAA 3KEQA 2VUMJ 1KZHA 2EFPA 3K4NA 2KIQA 3VOEA 4AIJA 4ESJA 1W7PD 3LMMA 1XMKA 1BJAA 2B63J 1MBGA 1FBQA 3D5RC 2ID3A 3FBNB 3AAFA 4N4NB 5H6QA 1GDTA 2IGOA 1FP1D 2CMPA 5D5WB 1E2XA 2K5CA 2HPMA 2VONA 3BG6A 3JRGA 3PSIA 1ULYA 3BTJA 2R7FA 3EETA 2PLYA 2PMUA 4DZJA 4BXUA 2XGDA 3AG4H 2BOLA 2DQLA 2K4BA 5CVRA 1HF0A 3HPHA 4ITVA 4MFDA 4YFNF 1UJ8A 2IA2A 4RGXA 2QKLB 1LKXA 4PJJA 2NNNA 3HOSA 2HZTA 4GFBA 1SAXA 2CS3A 4LIUA 5FLXZ 2EV6A 4UUSA 2VBWA 2K86A 2M2EA 1QU3A 2XPUA 3ZQLA 4LG3A 4BE2A 1SD5A 1R5GA 3H9GA 2MSYA 3DFGA 4DQ2A 3JRBA 4C2TA 3J7AY 1R7JA 3HUGB 4G6TB 3K4KA 2Y0SN 1G4DA 3OS1A 3WTVC 1QPMA 1OCRH 1FOKA 2AO9A 2H6CA 1KQ8A 3G1OA 3GFJA 2Q8KA 4XRFA 2MFZA 3HDDA 3MKLA 4Y52J 3ZR8X 1B8IA 1P9QC 2VQCA 2VQGA 1VQKI 1VI0A 2FRHA 3FHZA 2DT5A 4F7ZA 2CFOA 3OSGA 2QBYA 3R0JA 4NHJA 4EJVA 2L54A 3CLQA 1VTNC 1HLVA 1QGPA 1YE9A 2DOFA 2IGMA 4M6XA 4DYCA 4BXFA 4HX4A 1HOMA 2HYJA 4KDPA 3HHHA 4HDVA 4IRIA 5FKLA 1A6QA 2CUFA 2F6CA 3FMRA 1ZGAA 2BY2A 2XRLA 4FISA 3CP8A 2HQRA 5EDNA 2AQFA 2E34A 4L0YB 1IN6A 3IV5A 2QLZA 5J1UA 2QEXI 5F04A 3HM5A 3KP2A 1VQLI 4FHTA 4CXFA 3ONQA 4CCLA 2Y2ZA 2CQ7A 1KQ9A 1OCZH 2GA1A 1R1UA 1V3FA 4P1WA 3KYDB 2JWTA 3JREA 1V5EA 2RNJA 3C2HA 3CP2A 5HLTA 5LD2C 5K7FA 2WAFA 2EFNA 3WGIA 2BBYA 2G9WA 3W2VA 1N75A 4R1HA 5J1RA 3RKYA 2XB0X 1IRXA 3IC7A 1E3PA 2HI3A 3GO5A 1E17A 3JCUC 3PL8A 1JJ6C 1XMXA 1ZAOA 3K1PA 5EGOA 1K61A 2AQEA 1GXQA 5KK1A 5CVIA 3ULQB 5IYDJ 2EBIA 3FXUA 1IRZA 5E3NA 2BY1A 2E1CA 3JAMK 3M1EA 5IP7J 1W36C 4RGRA 2ZJPF 4E7JA 4RB3C 2W4SA 5D6EA 3BC8A 5EJCA 4F52A 3J7AO 4B1RA 2P6TA 5IPAA 1XS9A 4A6DA 1T6SA 1H89C 2QM3A 2DYRH 3WTZA 1T39A 3QOEA 1MNEA 4J00A 1JI8A 2KLOA 4ENKA 1A5JA 1DP3A 3N97A 3RKQA 3RPUA 2H6BA 3E5UA 1ZH5A 3LA7A 1VZ0A 4HF0A 1LB2A 3S17J 4XLPF 3LSGA 1Z3XA 2PMHA 4UUTA 1WJ5A 2NS8A 1I3QJ 5FD6A 4HLXA 4M74A 1VQ8I 5E20A 3CJQB 1Y0UA 2ZKZA 4ETSA 1I1GA 1YX3A 5KHDA 2FMLA 4HA8A 2BHZA 2DXIA 2XVCA 3SEQA 1WFXA 4J19A 2QKMB 2V1NA 1NG6A 1G8XA 2L7FP 2RC4A 3WHCA 3DTIA 4AWXB 3RZOJ 1Y8RB 2XKPA 3U1DA 3DBLB 1IW7F 1QZYA 3PNVA 1U5TB 5DM7F 4IOCF 1SFXA 2BY0A 4E6KG 1B72B 1BIAA 4Y13A 1U8BA 4G12A 2QQAA 2JPBA 3ZOBA 3HOUJ 3SZTA 1X2NA 3HRSA 3P9IA 2AXTC 3OYNA 3K7AJ 4V19K 2NVYJ 2XF5A 4FETA 2CUJA 1X1CA 4RGUA 5CJ9A 3G73A 3I0TA 4BQNA 3JR9A 3W6JB 4DIQA 1HDDC 3TW6A 3W3CA 1IN8A 2E7XA 2OZ6A 3RCOA 1EJ9A 3B02A 2R92J 2WY8Q 2XGXA 4EMSA 2BXYA 5J8CA 4RM2A 4A0XA 4Y7NJ 2R7QA 4E7ZA 3CDHA 3IH4A 2V79A 4RAFA 5EYRA 3BR1A 5B1BH 5DTDA 4QTRA 1QPIA 1AOYA 1U8RA 2P8TA 3OYHA 1OCOH 4I09A 4XKBA 1A36A 1GV5A 5HOOA 4B48A 1NG7A 2N8GA 5BOXA 1EV7A 1FYLA 2YSRA 1IV6A 5HS9A 1BOBA 4AYBA 1AKHA 3OL4A 4FQGA 2V6EA 3KETA 4RBOA 4E4HA 3S15J 3KLOA 1TW2A 3KZIC 2ZMEA 3V7SA 2ELKA 4L18B 5ICEA 1D1BA 4BBRJ 3Q3SA 2WWYA 3E5QA 4XNFA 2Y75A 1XD7A 2CQQA 2DA2A 3NRVA 4BUPA 1FP2A 1GVJA 3E6DA 3A01A 1Z6TA 4S0HB 3HG9A 3F21A 1YS7A 2ISZA 3V4GA 1G3SA 1SFEA 1YFHA 1MW7A 2UXNA 4AU7A 2VKHA 3SZGA 4WXDA 2OU2A 2IW5A 3I9V2 4DGWB 2D2WA 2DT7B 4EVIA 2FOKA 2VIXA 5K5QA 3RPQA 2BW3B 2EZLA 1G6NA 1BOAA 4HLYA 1BW5A 1ONVA 1FY7A 4HNTA 5LLQA 5ERIA 4AC0A 4NC7A 3S93A 4BJ5C 3DTEA 4PJMA 2MA3A 3AKZA 3CUQB 2FBIA 5DD4A 3KE2A 3GZ6A 5TJJA 3K4LA 4YEJA 2M5WA 1ETVA 3DKXA 2LRDA 2YUSA 3V42A 3DV8A 1V5FA 1IXCA 4MIMA 5K5OA 3AG1H 1EH7A 3ZMTA 4GDFA 3FIWA 4XICA 2HNHA 2R5ZB 2OTLI 1WGXA 2HS5A 4Z6YA 1OFCX 2A6HF 4I02A 5GAHJ 1BL0A 1Z7UA 3JTGA 1D1AA 3SYTA 1F9NA 3GTOJ 1DUXC 3KIOA 3OYAA 1P7IA 2LMDA 4MFEA 4UB8C 5IP6A 4CH7A 2M0CA 5J40A 1XB4A 3AL0B 2YPRA 1EH6A 1PUEE 2MABA 4B8XA 2CWEA 4A3FJ 5HODA 3JRHA 2FBKA 2PEXA 4NQWB 4XMYA 5M5WJ 3HEFA 4A0ZA 2A5YB 1BI1A 2JZYA 4QPOA 4BHCA 1TTYA 3CC7I 1AHDP 1XCVA 3I5UA 1T0FA 3FXOA 1HKTA 4BU2A 2WAQN 2Y9YA 3FMQA 1N25A 1TNTA 4XN0A 2K3FA 1OLTA 1D3YA 1MZBA 4ZDPA 4BY1J 3RYPA 4Y4RA 1ON2A 3M8EA 2KKOA 2COMA 2O0YA 2ZFWA 4B43A 3BZCA 1TL8A 1KGSA 4UV8A 2PG4A 3NQOA 4CYDA 5GAGJ 2NRAC 1X19A 1J0RA 1ETKA 5LHGA 1FTTA 2W24A 3ZQFA 2R3SA 3R0AA 1CQTA 1Z6RA 1TQPA 1XN7A 4L9TA 5ILUA 2IS4A 4IVNA 1JTYA 4NNJA 5J4VA 3BR6A 1FOXA 1BJZA 2DODA 2ZBKA 3REOA 2QQ9A 5HNFA 1B4AA 4HW0A 2IBDA 5DM6F 1V55H 3PQJA 4GO1A 3CCYA 2XSJC 3H9QA 2RN7A 4BEHB 2AXLA 2P5VA 4RDUA 1ETWA 3UR3C 2KL4A 2XF7A 1IZ1A 3LA2A 1T38A 5C44J 4IRGA 1XSXA 3K4MA 1WJBA 3BDDA 1P4AA 3HIFA 3BPXA 3OYDA 3BTIA 2HQNA 4ZC3A 1RR7A 1MBJA 1SD7A 4A3JJ 5JVTA 2XAQA 3CCJI 4G6QA 4WF2A 5A2QZ 1IG7A 4FX4A 1WJEA 4XR6A 4IOAF 1ENHA 3HSFA 2Z33A 1PUFB 1MDMB 3VB2A 3IHUA 1ZLKA 1I1SA 4C30A 1FBUA 2G7UA 2EFQA 3B6CA 1T8IA 3HRTA 2Q2EA 2HVSA 4HF2A 5ILSA 2V1DA 2YS9A 3MQ0A 5DCMA 4EGYA 2ZXHA 5D5UB 1ACIA 2QQ8A 1U0JA 2JA2A 1V4RA 2Q0OA 4IRHA 2VPRA 1HKQA 2R7RA 4IZZA 2VC1A 5F0FA 3TW7A 2QENA 4DBQA 3DPUA 1RESA 2XAUA 4DZPA 4JX5A 3U1KA 3MEXA 5E1XA 2LVSA 2EA2A 2RGVA 1L3LA 3V7CA 3JSPA 2BXZA 1LQ1A 2MGQA 3T1BA 2MD0A 3H5RA 3VSLA 2BHYA 2CRGA 4M6VA 2ELHA 3H0GJ 2RREA 5FJ8J 1O3SA 4HNUA 4B09A 4NBQA 2W84A
chains in the Genus database with same CATH topology
2NOGA 2DMNA 3BTJA 3JRFA 5EG0B 2R5YA 3BG9A 4DZJA 1UHSA 2XGDA 3W6VA 1H88C 3S14J 2DA6A 1SFOJ 4M3GA 4C3JJ 4MFDA 1HF0A 2CQXA 4A3EJ 4A69C 4X1EA 5F0CA 4GFBA 4D5FA 1DU6A 1QVTA 2XGCA 4UUSA 5C3EJ 2HQ5A 2M2EA 2XPUA 3ZQLA 2LR8A 5E3LA 5IYCJ 2MSYA 3JRBA 3RQIA 2LTPA 1D5YA 3HOZJ 5FKNA 1RKTA 4M3DA 2Y0SN 1WH7A 4CYCB 1RKWA 4MLOA 2AO9A 2HOAA 1A6IA 3G1OA 2DA3A 4BKXA 2K9SA 3LOCA 3HDDA 3C2BA 3MKLA 4Y52J 2VKVA 2M9HA 2EZHA 1B8IA 3S1MJ 1ORKA 2AHQA 1VI0A 1MSEC 1IGNA 3S1QJ 1FTZA 1F36A 2CU7A 2CUEA 3OSGA 2OF7A 1ZR2A 2PMZN 2ME6A 1JGGA 3GBGA 2DMQA 2W48A 1HLVA 1YRNA 4DYCA 4DYRA 4W1UA 1WH5A 1HOMA 5FKOA 4DW6A 2HYJA 3HKZN 3GTJJ 3GTPJ 3BTCA 3HOVJ 2WV1A 5FKLA 2NVQJ 2CUFA 2COBA 2L0KA 1VF9A 3H3VK 4FISA 2XRLA 2OPTA 5EDNA 3PO2J 3VPRA 2R5YB 3IV5A 5J1UA 1FEXA 1ETOA 4V2GA 4M3FA 5F04A 3HM5A 3HB9A 1Z77A 2Y2ZA 1K83J 3BT9A 3WHBA 2IEKA 3MVPA 5C4JJ 4D5CA 1ETQA 1ZGWA 4ABZA 2JWTA 1ZKGA 2DA7A 3JREA 1MNMC 1JKQC 3GTGJ 4UUSB 1Y1WJ 1T56A 5K7FA 5K7ZA 4XRSG 4QIWN 5J1RA 2X6OA 2Y30A 2XB0X 2HI3A 3O8HA 4V2FA 1MSFC 2JA5J 1E3OC 1JJ6C 1T33A 5F1JA 5EGOA 1MBHA 2TRTA 2ZB9A 1K61A 3I4MJ 3JRDA 4X6AJ 1B72A 2XSDC 1TC3C 5IYDJ 2EBIA 1IRZA 2JA8J 5E3NA 5F08A 1RETA 2MG4A 5IP7J 4D7MA 2E1OA 2FD5A 1JUMA 1P7JA 1B8IB 2XPVA 2ECCA 4B1RA 5IPAA 2FX0A 1XS9A 2HXOA 1O4XA 1LE8A 2KT0A 1TWHJ 2LFBA 3ZQHA 1NK3P 1UMQA 1JUPA 2ME0A 1H89C 4C3IJ 2E2JJ 3FISA 4A3BJ 2O7OA 2HXIA 1R9TJ 1APLC 1A5JA 4A3MJ 3RKQA 3FK6A 4IHVA 1I50J 3BR5A 3S17J 1WPKA 3LSGA 4A3LJ 1RPWA 4UUTA 2NS8A 1I3QJ 2K9NA 2TCTA 3OIOA 2O8KA 3BR2A 2DMTA 2LLKA 5EEAA 4JP0A 2X48A 3CQZJ 4J19A 5DS9A 3LNQA 2L7FP 2WB1N 3WHCA 2NVXJ 3HGGA 4EEFG 4B4CA 2E2HJ 3RZOJ 2DN0A 4DYQA 3OOUA 2ECBA 2EQRA 4A3KJ 3GTLJ 3Q0UA 3G1MA 1EF4A 3F0CA 1I6HJ 1JT6A 5EGOB 1MH3A 1VNDA 5E3OA 5IYBJ 5EZGA 1B72B 9ANTA 1U9NA 1U8BA 4G12A 5EZHA 2H1KA 3ZOBA 3BG5A 5J3LA 3HOUJ 3ZQIA 1SANA 1X2NA 1JT0A 3FK7A 2D5VA 3K7AJ 3OSFA 1XC5A 2NVYJ 5IOYA 2HDDA 2JJ7A 1OCTC 4LOCA 1GT0C 5FLVA 1X2MA 3BQZA 3JR9A 2H8RA 1IC8A 3BR3A 1ZR4A 3ZQCA 3S1RJ 4IHXA 1HDDC 3JRAA 2JK3A 3LSPA 3I4NJ 3TW6A 2GLOA 4A3IJ 4B3AA 2R93J 4XRMA 2R0QC 2HOSA 4MO7A 3S16J 2R92J 4BBSJ 2G0EA 4Y7NJ 4L5EA 1GVDA 5JLWA 3IH4A 5EYRA 5DTDA 4QTRA 3BR1A 3BQYA 3NAUA 1QPIA 1HDPA 3GTKJ 3HBLA 1GV5A 5C4XJ 3QPSA 2R7ZJ 2R5ZA 3TP0A 3LSRA 2N8GA 2JN6A 3A03A 4AYBN 1IV6A 3UKGA 3GTQJ 2JA6J 1AKHA 4JX4A 4RBOA 2IAIA 3Q0WA 1U78A 4XRSA 3TEDA 2O9LA 3S15J 2ELKA 3SDGA 2KDZA 1IDYA 4BBRJ 2EH3A 2XPWA 5M5XJ 2EZIA 3Q3SA 3BR0A 1TWGJ 2P81A 2LP0A 4D7NA 2CQQA 2DA2A 3DCFA 4XK4A 4BY7J 1ZQ3P 1ETXA 2DMUA 3A01A 4S0HB 1JKPC 4FE4A 2GM4A 2DMPA 4JYKA 5FKKA 1TWFJ 4BXXJ 2QF7A 4JX6A 2Y9ZA 3M3YJ 2E19A 2EZLA 1ETYA 3Q0VA 1BW5A 1MH4A 4CYCA 1YRNB 4IEJA 4AC0A 1JKOC 1X58A 1W0TA 2GBYA 4A93J 1ETVA 1OCPA 5J1YA 2YUSA 2ID6A 4M3EA 4MIMA 1FIAA 5E3MA 3S2DJ 2K40A 3FIWA 4XICA 2R5ZB 1WGXA 3LSJA 2VKEA 1OFCX 1MBEA 1IDZA 1TWAJ 3S2HJ 1BL0A 1AKHB 1W0UA 2LY9A 1VFCA 3GTOJ 5M3MJ 1P7IA 5EF6A 1H8AC 4MFEA 2DJNA 5IP6A 5GP9A 1ITYA 3BG3A 2M0CA 1S7EA 2JMWA 1DU0A 2M8GX 1Z0XA 4HNVA 3D1NI 2CJJA 2Y31A 3QPLA 3GTMJ 1WI3A 3A01B 4A3FJ 1AU7A 5HODA 2M34A 3JRHA 5M5WJ 3HEFA 1FIPA 1AHDP 2JA7J 1QRYA 1BA5A 1PUFA 3HOWJ 1LE8B 2WAQN 2Y9YA 4I6ZA 3PO3J 2XB5A 5GPAA 4W97A 3L1PA 1Q1VA 5GPCA 4BY1J 4A3DJ 1GV2A 2EZKA 4NDLA 1XG1A 3S1NJ 1U9OA 2LKXA 2E2IJ 3B6AA 3CDLA 2DTZA 3O8GA 3JRIA 1OJLA 1MBFA 1POGA 1LFBA 1QVUA 3M4OJ 1ETKA 2QCOA 5IP9J 3SFIA 5IOZA 2L7ZA 1FTTA 3IH2A 1TWCJ 3K2AA 3ZQFA 1CQTA 4I76A 3TP3A 4AUXA 1BW6A 1NK2P 2NVTJ 5M5YJ 2DA5A 1JTYA 1JKRC 1JTXA 3CMYA 3BR6A 1F43A 1IUFA 4C2MJ 1BJZA 1MBKA 5F27A 2IBDA 4FTHA 4A3GJ 3PM1A 4IHYA 2XGEA 5FLMJ 5JLXA 5EG0A 3JRCA 3CCYA 5K7HA 4XIDA 4RDUA 1ETWA 4IHWA 2DA4A 2FQ4A 2L7MP 5C44J 3SJMA 2MW8A 4FE7A 3RZDJ 2K9QA 3IH3A 3BTIA 1LFUP 4A3CJ 1RR7A 1MBJA 2DA1A 4A3JJ 1HCRA 2LK2A 3A02A 3FKIJ 1JJ8C 1IG7A 3HGYA 4M3BA 2LD5A 1GUUA 1FJLA 1ENHA 1G2HA 5F0HA 4C3HJ 1PUFB 2L9RA 3HOYJ 3G1LA 2YU9J 3B6CA 1JUSA 5BNGA 2NS7A 1ZTRA 3BTLA 3MN2A 1IJWC 2YS9A 1NTCA 1UG2A 2VPRA 2FJ1A 3TW7A 5F0FA 1Y1VJ 3HOXJ 3QQAA 2VUMJ 1RESA 4DZPA 2RAEA 2VI6A 4JX5A 4QSHA 2B63J 1MBGA 2LVSA 2ID3A 5FKMA 1ZK8A 1GDTA 2HOTA 2MGQA 3E7LA 3ZQGA 1WCMJ 2I10A 3NARA 2CRGA 4M6VA 2X9DA 3H0GJ 5FJ8J 3JRGA 5M3FJ 3DEWA 4FCYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NOG A;  2DMN A;  3BTJ A;  3JRF A;  5EG0 B;  2R5Y A;  3BG9 A;  4DZJ A;  1UHS A;  2XGD A;  3W6V A;  1H88 C;  3S14 J;  2DA6 A;  1SFO J;  4M3G A;  4C3J J;  4MFD A;  1HF0 A;  2CQX A;  4A3E J;  4A69 C;  4X1E A;  5F0C A;  4GFB A;  4D5F A;  1DU6 A;  1QVT A;  2XGC A;  4UUS A;  5C3E J;  2HQ5 A;  2M2E A;  2XPU A;  3ZQL A;  2LR8 A;  5E3L A;  5IYC J;  2MSY A;  3JRB A;  3RQI A;  2LTP A;  1D5Y A;  3HOZ J;  5FKN A;  1RKT A;  4M3D A;  2Y0S N;  1WH7 A;  4CYC B;  1RKW A;  4MLO A;  2AO9 A;  2HOA A;  1A6I A;  3G1O A;  2DA3 A;  4BKX A;  2K9S A;  3LOC A;  3HDD A;  3C2B A;  3MKL A;  4Y52 J;  2VKV A;  2M9H A;  2EZH A;  1B8I A;  3S1M J;  1ORK A;  2AHQ A;  1VI0 A;  1MSE C;  1IGN A;  3S1Q J;  1FTZ A;  1F36 A;  2CU7 A;  2CUE A;  3OSG A;  2OF7 A;  1ZR2 A;  2PMZ N;  2ME6 A;  1JGG A;  3GBG A;  2DMQ A;  2W48 A;  1HLV A;  1YRN A;  4DYC A;  4DYR A;  4W1U A;  1WH5 A;  1HOM A;  5FKO A;  4DW6 A;  2HYJ A;  3HKZ N;  3GTJ J;  3GTP J;  3BTC A;  3HOV J;  2WV1 A;  5FKL A;  2NVQ J;  2CUF A;  2COB A;  2L0K A;  1VF9 A;  3H3V K;  4FIS A;  2XRL A;  2OPT A;  5EDN A;  3PO2 J;  3VPR A;  2R5Y B;  3IV5 A;  5J1U A;  1FEX A;  1ETO A;  4V2G A;  4M3F A;  5F04 A;  3HM5 A;  3HB9 A;  1Z77 A;  2Y2Z A;  1K83 J;  3BT9 A;  3WHB A;  2IEK A;  3MVP A;  5C4J J;  4D5C A;  1ETQ A;  1ZGW A;  4ABZ A;  2JWT A;  1ZKG A;  2DA7 A;  3JRE A;  1MNM C;  1JKQ C;  3GTG J;  4UUS B;  1Y1W J;  1T56 A;  5K7F A;  5K7Z A;  4XRS G;  4QIW N;  5J1R A;  2X6O A;  2Y30 A;  2XB0 X;  2HI3 A;  3O8H A;  4V2F A;  1MSF C;  2JA5 J;  1E3O C;  1JJ6 C;  1T33 A;  5F1J A;  5EGO A;  1MBH A;  2TRT A;  2ZB9 A;  1K61 A;  3I4M J;  3JRD A;  4X6A J;  1B72 A;  2XSD C;  1TC3 C;  5IYD J;  2EBI A;  1IRZ A;  2JA8 J;  5E3N A;  5F08 A;  1RET A;  2MG4 A;  5IP7 J;  4D7M A;  2E1O A;  2FD5 A;  1JUM A;  1P7J A;  1B8I B;  2XPV A;  2ECC A;  4B1R A;  5IPA A;  2FX0 A;  1XS9 A;  2HXO A;  1O4X A;  1LE8 A;  2KT0 A;  1TWH J;  2LFB A;  3ZQH A;  1NK3 P;  1UMQ A;  1JUP A;  2ME0 A;  1H89 C;  4C3I J;  2E2J J;  3FIS A;  4A3B J;  2O7O A;  2HXI A;  1R9T J;  1APL C;  1A5J A;  4A3M J;  3RKQ A;  3FK6 A;  4IHV A;  1I50 J;  3BR5 A;  3S17 J;  1WPK A;  3LSG A;  4A3L J;  1RPW A;  4UUT A;  2NS8 A;  1I3Q J;  2K9N A;  2TCT A;  3OIO A;  2O8K A;  3BR2 A;  2DMT A;  2LLK A;  5EEA A;  4JP0 A;  2X48 A;  3CQZ J;  4J19 A;  5DS9 A;  3LNQ A;  2L7F P;  2WB1 N;  3WHC A;  2NVX J;  3HGG A;  4EEF G;  4B4C A;  2E2H J;  3RZO J;  2DN0 A;  4DYQ A;  3OOU A;  2ECB A;  2EQR A;  4A3K J;  3GTL J;  3Q0U A;  3G1M A;  1EF4 A;  3F0C A;  1I6H J;  1JT6 A;  5EGO B;  1MH3 A;  1VND A;  5E3O A;  5IYB J;  5EZG A;  1B72 B;  9ANT A;  1U9N A;  1U8B A;  4G12 A;  5EZH A;  2H1K A;  3ZOB A;  3BG5 A;  5J3L A;  3HOU J;  3ZQI A;  1SAN A;  1X2N A;  1JT0 A;  3FK7 A;  2D5V A;  3K7A J;  3OSF A;  1XC5 A;  2NVY J;  5IOY A;  2HDD A;  2JJ7 A;  1OCT C;  4LOC A;  1GT0 C;  5FLV A;  1X2M A;  3BQZ A;  3JR9 A;  2H8R A;  1IC8 A;  3BR3 A;  1ZR4 A;  3ZQC A;  3S1R J;  4IHX A;  1HDD C;  3JRA A;  2JK3 A;  3LSP A;  3I4N J;  3TW6 A;  2GLO A;  4A3I J;  4B3A A;  2R93 J;  4XRM A;  2R0Q C;  2HOS A;  4MO7 A;  3S16 J;  2R92 J;  4BBS J;  2G0E A;  4Y7N J;  4L5E A;  1GVD A;  5JLW A;  3IH4 A;  5EYR A;  5DTD A;  4QTR A;  3BR1 A;  3BQY A;  3NAU A;  1QPI A;  1HDP A;  3GTK J;  3HBL A;  1GV5 A;  5C4X J;  3QPS A;  2R7Z J;  2R5Z A;  3TP0 A;  3LSR A;  2N8G A;  2JN6 A;  3A03 A;  4AYB N;  1IV6 A;  3UKG A;  3GTQ J;  2JA6 J;  1AKH A;  4JX4 A;  4RBO A;  2IAI A;  3Q0W A;  1U78 A;  4XRS A;  3TED A;  2O9L A;  3S15 J;  2ELK A;  3SDG A;  2KDZ A;  1IDY A;  4BBR J;  2EH3 A;  2XPW A;  5M5X J;  2EZI A;  3Q3S A;  3BR0 A;  1TWG J;  2P81 A;  2LP0 A;  4D7N A;  2CQQ A;  2DA2 A;  3DCF A;  4XK4 A;  4BY7 J;  1ZQ3 P;  1ETX A;  2DMU A;  3A01 A;  4S0H B;  1JKP C;  4FE4 A;  2GM4 A;  2DMP A;  4JYK A;  5FKK A;  1TWF J;  4BXX J;  2QF7 A;  4JX6 A;  2Y9Z A;  3M3Y J;  2E19 A;  2EZL A;  1ETY A;  3Q0V A;  1BW5 A;  1MH4 A;  4CYC A;  1YRN B;  4IEJ A;  4AC0 A;  1JKO C;  1X58 A;  1W0T A;  2GBY A;  4A93 J;  1ETV A;  1OCP A;  5J1Y A;  2YUS A;  2ID6 A;  4M3E A;  4MIM A;  1FIA A;  5E3M A;  3S2D J;  2K40 A;  3FIW A;  4XIC A;  2R5Z B;  1WGX A;  3LSJ A;  2VKE A;  1OFC X;  1MBE A;  1IDZ A;  1TWA J;  3S2H J;  1BL0 A;  1AKH B;  1W0U A;  2LY9 A;  1VFC A;  3GTO J;  5M3M J;  1P7I A;  5EF6 A;  1H8A C;  4MFE A;  2DJN A;  5IP6 A;  5GP9 A;  1ITY A;  3BG3 A;  2M0C A;  1S7E A;  2JMW A;  1DU0 A;  2M8G X;  1Z0X A;  4HNV A;  3D1N I;  2CJJ A;  2Y31 A;  3QPL A;  3GTM J;  1WI3 A;  3A01 B;  4A3F J;  1AU7 A;  5HOD A;  2M34 A;  3JRH A;  5M5W J;  3HEF A;  1FIP A;  1AHD P;  2JA7 J;  1QRY A;  1BA5 A;  1PUF A;  3HOW J;  1LE8 B;  2WAQ N;  2Y9Y A;  4I6Z A;  3PO3 J;  2XB5 A;  5GPA A;  4W97 A;  3L1P A;  1Q1V A;  5GPC A;  4BY1 J;  4A3D J;  1GV2 A;  2EZK A;  4NDL A;  1XG1 A;  3S1N J;  1U9O A;  2LKX A;  2E2I J;  3B6A A;  3CDL A;  2DTZ A;  3O8G A;  3JRI A;  1OJL A;  1MBF A;  1POG A;  1LFB A;  1QVU A;  3M4O J;  1ETK A;  2QCO A;  5IP9 J;  3SFI A;  5IOZ A;  2L7Z A;  1FTT A;  3IH2 A;  1TWC J;  3K2A A;  3ZQF A;  1CQT A;  4I76 A;  3TP3 A;  4AUX A;  1BW6 A;  1NK2 P;  2NVT J;  5M5Y J;  2DA5 A;  1JTY A;  1JKR C;  1JTX A;  3CMY A;  3BR6 A;  1F43 A;  1IUF A;  4C2M J;  1BJZ A;  1MBK A;  5F27 A;  2IBD A;  4FTH A;  4A3G J;  3PM1 A;  4IHY A;  2XGE A;  5FLM J;  5JLX A;  5EG0 A;  3JRC A;  3CCY A;  5K7H A;  4XID A;  4RDU A;  1ETW A;  4IHW A;  2DA4 A;  2FQ4 A;  2L7M P;  5C44 J;  3SJM A;  2MW8 A;  4FE7 A;  3RZD J;  2K9Q A;  3IH3 A;  3BTI A;  1LFU P;  4A3C J;  1RR7 A;  1MBJ A;  2DA1 A;  4A3J J;  1HCR A;  2LK2 A;  3A02 A;  3FKI J;  1JJ8 C;  1IG7 A;  3HGY A;  4M3B A;  2LD5 A;  1GUU A;  1FJL A;  1ENH A;  1G2H A;  5F0H A;  4C3H J;  1PUF B;  2L9R A;  3HOY J;  3G1L A;  2YU9 J;  3B6C A;  1JUS A;  5BNG A;  2NS7 A;  1ZTR A;  3BTL A;  3MN2 A;  1IJW C;  2YS9 A;  1NTC A;  1UG2 A;  2VPR A;  2FJ1 A;  3TW7 A;  5F0F A;  1Y1V J;  3HOX J;  3QQA A;  2VUM J;  1RES A;  4DZP A;  2RAE A;  2VI6 A;  4JX5 A;  4QSH A;  2B63 J;  1MBG A;  2LVS A;  2ID3 A;  5FKM A;  1ZK8 A;  1GDT A;  2HOT A;  2MGQ A;  3E7L A;  3ZQG A;  1WCM J;  2I10 A;  3NAR A;  2CRG A;  4M6V A;  2X9D A;  3H0G J;  5FJ8 J;  3JRG A;  5M3F J;  3DEW A;  4FCY A; 
#chains in the Genus database with same CATH topology
 3KP7 A;  5EG0 B;  2VXZ A;  2VT3 A;  3BG9 A;  1UHS A;  1WJA A;  2VL8 A;  3W6V A;  4C9Y A;  2KJB A;  1TT0 A;  3S14 J;  3ABU A;  5IT9 Z;  1Z91 A;  1FC3 A;  4C3J J;  2A05 A;  2CQX A;  1XGS A;  3EDP A;  4A69 C;  4RAZ A;  4X1E A;  3IWZ A;  2VOD A;  2KDO A;  2M3A A;  2JSC A;  2MLK A;  5LBQ A;  3OL3 A;  2OD5 A;  3V8J A;  1YW9 A;  2HQ5 A;  5FO5 A;  5DUK A;  4BJ6 C;  5IYC J;  1FSH A;  1WJC A;  2LTP A;  1IN7 A;  1D5Y A;  2QYO A;  3QP5 A;  4I98 B;  5L3F A;  2HKO A;  1QNT A;  2BYV E;  3MKZ A;  2Z3Y A;  2CW0 F;  4CYC B;  1RKW A;  1LDJ A;  3ESW B;  3K6G A;  4MLO A;  3A1Y A;  1Y8Q B;  1VQM I;  2HOA A;  3DKY A;  2K9S A;  4BKX A;  3F22 A;  5CKT A;  3C2B A;  1T0F C;  3IL2 A;  2A3S A;  3S1M J;  3SFZ A;  2AHQ A;  2VBY A;  3IKV A;  2GAU A;  3DU5 A;  2CUE A;  1XX5 A;  2O6G E;  2ZCW A;  3UNG C;  4LLG F;  1GHC A;  1QA6 A;  1VQ4 I;  2PMZ A;  1Z7L A;  1Z3Y A;  4PSX A;  1FMW A;  3QPH A;  3SDB A;  1VQP I;  2P0W A;  3BTC A;  3VYS B;  4KYW A;  4GYI A;  3WE3 A;  3FM3 A;  1X3W B;  1Z05 A;  3HKZ A;  2EK5 A;  2UXX A;  2XDV A;  4HST A;  4P5O A;  2NVQ J;  1W4M A;  3LA3 A;  2TDX A;  3FXJ A;  3KP3 A;  1YIJ I;  2OPT A;  4LK1 F;  2QWW A;  2X1E A;  1QZZ A;  1X3Z B;  4KA4 A;  2HYG D;  4ENN A;  1FEX A;  1ETO A;  4M3F A;  1TZL A;  1T08 B;  2W7N A;  2ZJR F;  4BQO A;  4M73 A;  3I54 A;  3PIP F;  3K4C A;  3MVP A;  4D5C A;  5C4J J;  4ZTJ A;  3R4K A;  5CVV A;  4RS8 A;  3LFU A;  3BY6 A;  1ZKG A;  2DA7 A;  5ICG A;  4E7S A;  1JKQ C;  4UUS B;  1Y1W J;  1HXD A;  2MC4 A;  2KRH A;  4XRS G;  4QIW N;  1I3A A;  3OV8 A;  2GWR A;  2X6O A;  1PVE A;  5LEK A;  1LNW A;  4A12 A;  3O8H A;  4V2F A;  1MSF C;  1E3O C;  3G4S I;  4XKC A;  2IVM A;  1T33 A;  4OAY A;  2STT A;  4KNY A;  3BLY A;  3RTR A;  5DV5 A;  3X2Q H;  1X4O A;  4GCV A;  1K78 A;  1FYK A;  3TMO A;  1YOV B;  1P7J A;  1V54 H;  2JRT A;  5J8F A;  2VPL A;  4YFX F;  1ZRD A;  1B8I B;  4S04 A;  3J81 Z;  2FA5 A;  4ZYH A;  3QWL A;  4RB0 A;  3OS2 A;  1LE8 A;  1TWH J;  4LB5 A;  1I5Z A;  1AA7 A;  1TQM A;  3CTA A;  4WXC A;  1R4M B;  5HS7 A;  2Z99 A;  2R7W A;  5KCM A;  1HSJ A;  3FIS A;  5KVR A;  2D45 A;  4A3B J;  2HXI A;  3CF5 F;  1FOY A;  4LJZ F;  4A3M J;  1KA8 A;  5E1W A;  1IXS B;  3FK6 A;  3G3Z A;  4IHV A;  4JQF A;  4YIF A;  1SC7 A;  4E7L A;  1WPK A;  3KP6 A;  1FZP B;  1YO5 C;  1QQI A;  1F5T A;  2TCT A;  2O8K A;  3BR2 A;  1RNL A;  2FNP A;  2L4M A;  4XLE A;  3F8F A;  3OIQ A;  4HQE A;  2V6C A;  1QHH D;  1WQ2 A;  2VE9 A;  2LLK A;  4BDZ A;  3TO9 A;  2FF4 A;  3MCZ A;  3CCV I;  3OR2 C;  3HTS B;  2X1D A;  2O3F A;  5LGU A;  4Y17 A;  3OYJ A;  2HDW A;  3CQZ J;  1DPU A;  1H0M A;  4Q48 A;  2ADU A;  2GQQ A;  3ASN H;  3R61 A;  3LNQ A;  2F5C A;  3GFI A;  2PI0 A;  1W5S A;  3U2R A;  4EEF G;  2IS6 A;  1FOW A;  2WB1 A;  2E2H J;  2DN0 A;  2ECB A;  2DBB A;  4IJA A;  3Q0U A;  5DCF A;  1W36 D;  2KHM A;  3ZXS A;  4O6J A;  2OCC H;  1EF4 A;  1LEA A;  2B7E A;  4P9U A;  5HNH A;  1JT6 A;  5EGO B;  3D0S A;  1F1Z A;  4KIC A;  3FXQ A;  3LAP A;  9ANT A;  5ILV A;  1U9N A;  2DK8 A;  5EZH A;  3LFK A;  5BQT A;  5J3L A;  3IAS 2;  3ZQI A;  3FK7 A;  4MQ9 F;  1XC5 A;  2JJ7 A;  2BVM A;  1J59 A;  3HTU A;  5FLV A;  4LK0 F;  3T0Y A;  2H8R A;  3BR3 A;  1ZR4 A;  2IGK A;  3JRA A;  2R7T A;  4P96 A;  2GLO A;  1ZEL A;  4B3A A;  2HOS A;  3GLX A;  1BN5 A;  1VQ7 I;  3QAH A;  1D8K A;  2QSF X;  4FT8 A;  1SMT A;  2L2O A;  3I71 A;  5HDN A;  1XSD A;  3NAU A;  1HDP A;  1TT5 B;  4LIV A;  1K6Y A;  2DPU A;  2XF6 A;  1S3J A;  2KFD A;  4I7H A;  3S32 A;  3JTH A;  2R7Z J;  1SFK A;  2NYX A;  4BJT A;  3TP0 A;  3LSR A;  5LGN A;  2XC7 A;  3WOD F;  3ZMD A;  4WCG A;  3F8N A;  3A03 A;  1FMV A;  3OWT A;  3UKG A;  4XSZ F;  1ZAR A;  5B1A H;  2JA6 J;  3T8R A;  2IAI A;  1U78 A;  3I56 I;  3B73 A;  2PN6 A;  4XRS A;  1AWC A;  2EIN H;  1HBX G;  4MTE A;  4QWQ A;  1IDY A;  4Q4Z F;  6PAX A;  3SQN A;  1UEL B;  4A6E A;  4HPQ A;  2QGU A;  2WC2 A;  3FM5 A;  4P9F A;  4A5M A;  2H09 A;  3I64 A;  1JE8 A;  4FE4 A;  2YR2 A;  3OS0 A;  2GM4 A;  2Y69 H;  4JYK A;  1YIO A;  3H5N A;  2H8W A;  2LKP A;  2O5R A;  2ZFU A;  1OR7 A;  3DKW A;  4CZC A;  3OYI A;  2CW8 A;  2UWM A;  3J80 Z;  1BR1 A;  2HWV A;  4HX8 A;  2P6S A;  4CUG A;  3RJP A;  2O8X A;  4KUM A;  3CC4 I;  3ASO H;  2E19 A;  1ETY A;  4AIH A;  2KPM A;  1FX7 A;  1YRN B;  3V8K A;  4IEJ A;  1CGP A;  3RYR A;  1ZGJ A;  2NVU B;  1I39 A;  3CJT B;  4BHP A;  3ABK H;  4EJW A;  3OIP A;  3BG7 A;  2Y48 A;  1TW3 A;  1X58 A;  1KU7 A;  1W0T A;  1SD6 A;  3IUO A;  2L3D A;  2IS1 A;  3P7N A;  4A93 J;  4UB6 C;  3H92 A;  5J1Y A;  2ID6 A;  1LVA A;  4M3E A;  1XPX A;  1LFP A;  4LIT A;  1FIA A;  5E3M A;  3S2D J;  1N77 A;  3CCU I;  2GOX B;  3LSI A;  4M72 A;  3WTX C;  3LSJ A;  4RB2 C;  1O3Q A;  2E1M C;  2BGC A;  1YX5 A;  2WA0 A;  1FWZ A;  1MBE A;  2LF8 A;  1IDZ A;  3KYL A;  2LNB A;  1AKH B;  4M9Z A;  1O3T A;  2K7L A;  4ZYA A;  2LY9 A;  4MQV A;  1VFC A;  3MZH A;  5LRS A;  4PDK A;  3BZK A;  1H8A C;  2PX9 A;  1D0Y A;  2DJN A;  2P5L C;  4AVZ A;  4EM2 A;  5BS6 A;  1K7A A;  5FLX K;  2AS5 F;  3EUH A;  3Q9V A;  2M4G A;  5BPD A;  1XGM A;  5HLI A;  4F91 B;  2W57 A;  3D1N I;  4MNU A;  3IKT A;  3SZP A;  1R6R A;  5E8I A;  3A01 B;  1AU7 A;  1RC9 A;  3QP6 A;  3WTY C;  5IY5 H;  1FIP A;  2VBZ A;  2PJR B;  1QRY A;  1BA5 A;  3QRF F;  4A0Y A;  3FMS A;  3TDZ C;  3PO3 J;  2M8E A;  3VOD A;  3MKW B;  1LUJ B;  3L1P A;  1Q1V A;  2CV0 A;  2EZK A;  3K70 C;  3E6M A;  2KMU A;  4YEL A;  1Z67 A;  2LKX A;  5B66 C;  1A31 A;  3FXM A;  3O8G A;  2VOO A;  1MBF A;  3RPU D;  3FWE A;  5CYV A;  3IWF A;  1VQO I;  2M7A A;  3SFI A;  3O2P E;  4EJU A;  5IOZ A;  3L2W A;  1GXP A;  3PIO F;  3DBR B;  1TWC J;  3IH2 A;  1YIT I;  4KIG A;  4IHS A;  1XGO A;  4RM3 A;  1NK2 P;  4PSW A;  2OBP A;  3JSO A;  3ECH A;  1JKR C;  4L9V A;  3V7R A;  1J75 A;  1DGR M;  1A04 A;  3L2Q A;  3R60 A;  1LJ9 A;  1IUF A;  2EJR A;  3CCM I;  5F27 A;  2JPC A;  3VSK A;  4Q5S F;  4FTH A;  1MMN A;  5FD5 A;  3PM1 A;  2XGE A;  3GFM A;  4I0B A;  2F4I A;  3F8C A;  3JRC A;  2X1C A;  3DXJ F;  2HFH A;  2ZXW H;  1TLH B;  3BWG A;  2FU4 A;  1MND A;  4NUB A;  2V1X A;  1YW8 A;  3SJM A;  4BL0 B;  4UXN A;  3RZD J;  3MFK A;  2K9Q A;  3H1C A;  4AD9 A;  1OYY A;  4A3C J;  2DFE A;  1HCR A;  1G3Y A;  4ZYD A;  3FKI J;  4II2 A;  4M3B A;  2STW A;  2NXN B;  3ROU A;  1FJL A;  3K69 A;  2RKH A;  2VT2 A;  1G2H A;  1KU2 A;  2M45 A;  5F0H A;  4PFP A;  1HW2 A;  2L9R A;  1X1B A;  1UHW A;  1BC8 C;  2X51 A;  1YHQ I;  5FRN A;  1P92 A;  3OY9 A;  1QO0 D;  1ZYR F;  4HOB A;  2MLG A;  3CZ6 A;  1JUS A;  2Z9O A;  2NS7 A;  3HPG A;  1OR7 C;  2JRM A;  4BHB A;  1K6O A;  1SFU A;  1NTC A;  3L9F A;  4KIF A;  3E1S A;  2A6E F;  1B9N A;  4YFK F;  3CD6 I;  1Y1V J;  2LY1 A;  2V9P A;  5EEG A;  2XAG A;  4G94 A;  4JBA A;  4KIT B;  2GIV A;  3OOP A;  1MMG A;  2CW7 A;  1S7A A;  2O03 A;  4QSH A;  4BGD A;  2R7O A;  2IS2 A;  1IN4 A;  3FDY A;  1ZK8 A;  2NNY A;  2KP6 A;  3WG9 A;  4RLF A;  2LSO A;  2DU9 A;  3FXL A;  1IXR C;  4OOI A;  1P2F A;  3E7L A;  2EFO A;  3ZQ7 A;  5K1Y A;  3ELK A;  3CO7 C;  1WCM J;  2I10 A;  3NAR A;  4UVA A;  3ZP5 A;  5M3F J;  2X9D A;  1SVO A;  3CCE I;  2M4K A;  2VJI A;  2H94 A;  3KFW X;  1YJN I;  4FCY A;  2DMN A;  3JRF A;  4EJO A;  2R5Y A;  3KCC A;  1G3T A;  4OU0 A;  1OPC A;  4F93 B;  3I59 B;  4BAY A;  4EGZ A;  4N9H A;  4HDU A;  2DA6 A;  3ZCO A;  3BCB A;  4HBL A;  4A3E J;  2LBF A;  1WRJ A;  3FXR A;  1BR2 A;  3ZMV A;  4CCO A;  3W2A A;  4C2U A;  4PJL A;  4D5F A;  4U0W A;  2EIK H;  4BYY A;  4LG0 A;  1DU6 A;  2CUZ A;  3EYY A;  1QVT A;  1HA8 A;  2QQB A;  5C3E J;  4D9J A;  1X4P A;  4I99 C;  2JUG A;  1XSV A;  2FSW A;  5E3L A;  2M0M A;  3HZJ A;  3CCL I;  1RZ4 A;  1R5H A;  2HTS A;  3HOZ J;  5FKN A;  3GYH X;  1RKT A;  1STZ A;  2IA0 A;  2XRO A;  3CCR I;  3ABM H;  3F23 A;  1WH7 A;  4DOZ A;  5LFA A;  4PFO A;  2Y0S A;  4XQF A;  2Q2E B;  2K9L A;  2OAZ A;  2VKV A;  1X1A A;  5DCM B;  2M9H A;  2EZH A;  3LQQ A;  3TGN A;  4U7D A;  1R71 A;  4KIB A;  1O7L A;  5AON A;  2E1N A;  1D0Z A;  2OF7 A;  4H0E A;  1BI3 A;  1DPR A;  3F6V A;  5K5R A;  2BW3 A;  3M07 A;  5FGM A;  2ME6 A;  3GBG A;  5JHU A;  2DMQ A;  5FFZ A;  2FQ3 A;  1S7O A;  5FKO A;  2K27 A;  4PGG A;  3VWB A;  3GTP J;  1TBX A;  3HOV J;  5B3S H;  2CV1 A;  3CUQ A;  2DT6 A;  3DPL C;  1Y6I A;  5TRD A;  2L0K A;  2COB A;  4DNC A;  1VF9 A;  3H3V K;  3DF8 A;  1JHF A;  2BY3 A;  2QZ8 A;  2OQR A;  5CLS A;  4KMU X;  5DUI A;  4BE1 A;  1R36 A;  2KQR A;  4V2G A;  2D1V A;  1PJR A;  3HB9 A;  5ICF A;  2Q1Z B;  1YQA A;  4BNC A;  1IRF A;  5BMZ A;  3WHB A;  4JK1 X;  1ETQ A;  2W85 A;  1ZGW A;  3K1M A;  2FUG 2;  1Y39 A;  3ZMU A;  1U6G A;  2J5O A;  2ZME C;  3FZV A;  3HJE A;  1MNM C;  3GTG J;  3KP4 A;  1A35 A;  3E5X A;  1TNS A;  4HX7 A;  5K7Z A;  1ZN2 A;  2Z2S B;  3HYI A;  2BE5 F;  4J01 A;  4ON0 A;  4CHU A;  4I2O A;  4ESB A;  3L09 A;  1MBH A;  3GZN B;  1UST A;  3E6B A;  3MWM A;  1R1V A;  2HPI A;  5TIS C;  2P7C B;  2DFH A;  2XSD C;  3WE2 A;  3PUB A;  3CJR B;  5F08 A;  1RET A;  2CV2 A;  1W5C C;  2DLL A;  1H9T A;  2MH2 A;  4D7M A;  1LDD A;  2E1O A;  2EIL H;  4NQW A;  5L3G A;  1JUM A;  2UV1 A;  1ZG3 A;  3HRU A;  2CH0 A;  1TQI A;  2XPV A;  4LD5 A;  2ECC A;  4G7H F;  1OMI A;  2FX0 A;  4B44 A;  2V4J C;  2KT0 A;  1UG0 A;  3R6S A;  1CF7 A;  2LFB A;  3ZQH A;  4YG2 F;  1UMQ A;  2JVG A;  2W1O A;  4L9N A;  4CGZ A;  4KJZ A;  4RB1 A;  2P7V B;  5HVQ C;  2E2J J;  2DOA A;  2F5D A;  2O7O A;  2EWN A;  4WX9 A;  3DLA A;  1R9T J;  3K4B A;  3HSE A;  4OIO F;  1VQ6 I;  2WAD A;  4CCM A;  1I50 J;  3WG7 H;  4A3L J;  1B59 A;  1RPW A;  3GZ5 A;  1KON A;  4EM1 A;  3PSF A;  2K9N A;  5GTH C;  2DMT A;  3WTU C;  2RQQ A;  2M30 A;  1Y0N A;  1QHG A;  2IJL A;  4JP0 A;  4ASN A;  1YW7 A;  2V26 A;  4NB5 A;  2A69 F;  3I3L A;  4ENJ A;  5CQE A;  1OQY A;  5DS9 A;  3MMY B;  1RUN A;  1XGN A;  2GOM A;  1KU9 A;  3IRQ A;  2NVX J;  4L0Z B;  2DK5 A;  4P55 A;  4B3X A;  4IX7 A;  4B4C A;  3OOU A;  3BP8 A;  1YYV A;  3IAM 2;  2DPD A;  4KMF A;  3G1M A;  4Y3O A;  2D1H A;  1HST A;  3F0C A;  1R23 A;  1WJD A;  2MYS A;  5JI6 A;  1I6H J;  5D6F A;  3AG2 H;  1ERD A;  2GA2 A;  5IYB J;  5EZG A;  1S8N A;  1EH8 A;  4KN7 X;  2H1K A;  1K78 B;  4PGH A;  3OSF A;  3M7G A;  2X0L A;  4KFC A;  4PK4 A;  2R7U A;  3E0J B;  1UZC A;  3L7W A;  4TV7 A;  1WKM A;  1MDM A;  3LWF A;  2CFX A;  2VBX A;  3BQZ A;  1G59 A;  2R7S A;  5GAD J;  4N9I A;  4XOR A;  2R7D A;  3C1D A;  4E7K A;  2JK3 A;  2E5N A;  3ZQC A;  1R49 A;  4A3I J;  5AIQ A;  2R93 J;  3L00 A;  2K85 A;  2KZV A;  2X4H A;  3N05 A;  4XRM A;  2R0Q C;  4RAG A;  5L3C A;  2Z5U A;  4MO7 A;  2EIM H;  3G71 I;  5J4Y A;  2JQ7 A;  3COA C;  2DO7 A;  2JSP A;  4MTD A;  2QSH X;  1LVK A;  3U21 A;  2DCE A;  2E1M B;  5JLW A;  3C2G A;  1ZRE A;  3GTK J;  2XRN A;  3HBL A;  5H20 A;  3ERE D;  1DGW Y;  1S72 I;  3CUO A;  4ZYG A;  1W7P A;  2OZU A;  5FFX A;  3M1C A;  4OMZ A;  5C4X J;  3QPS A;  2IPQ X;  3L2R A;  3PUF A;  5CPR B;  4AYB N;  1DDN A;  4Z2Y A;  1OYW A;  1ZG5 A;  3GTQ J;  2M87 A;  2VOP A;  2BEO A;  4E70 A;  4JX4 A;  2IRF G;  1UAA A;  2W25 A;  2XKO A;  4ZYE A;  3AG3 H;  4EM0 B;  2KIS A;  2VAS A;  2IP2 A;  3HOT A;  2KDZ A;  3CCQ I;  2CGP A;  2XPW A;  2DDB A;  5DEQ A;  4AVP A;  5A2Q K;  1TWG J;  1ZRF A;  4D7N A;  4HZF A;  1ZQ3 P;  4XK4 A;  5ICC A;  1ETX A;  2HR3 A;  2CG4 A;  2DMU A;  4Y15 A;  3CJN A;  1HW5 A;  3LSK A;  2HVQ A;  2HZD A;  1R1T A;  5FKK A;  5D8L B;  1MKM A;  2RQP A;  3WU1 B;  2ESH A;  4JX6 A;  1WZ2 A;  4KIS A;  2Y9Z A;  3JAM Z;  5HDK A;  1LPQ A;  2Z1D A;  3U9G A;  2QBY B;  4UUV A;  2L9N A;  3H0D A;  3Q0V A;  1MH4 A;  4CYC A;  2GXG A;  3MD2 A;  3M8J A;  1UHM A;  1VQN I;  1SMY F;  1BIB A;  3OYK A;  2VJ4 A;  3CME I;  2VE8 A;  2CQN A;  1G3W A;  2X85 A;  3C7J A;  3KPH A;  3N4M A;  3GWZ A;  2JTV A;  4U88 A;  2IT0 A;  2GBY A;  2DW4 A;  4S05 A;  1W5T A;  2LH9 A;  4ZH4 F;  1D0X A;  3GME A;  4CCK A;  1PP7 U;  3HRM A;  3HHG A;  3NEU A;  1VQ5 I;  3K10 A;  1R00 A;  5BPI A;  3OYF A;  3J7Z I;  2XHK A;  2CSO A;  2J5P A;  4XLN F;  1MJ9 A;  4F55 A;  5IT9 K;  2FOW A;  4G6D A;  4IHT A;  1YI2 I;  2WY7 Q;  3F3X A;  3TOB A;  4ESF A;  1QBJ A;  1U2W A;  2A61 A;  5M3M J;  5D4S A;  1DQU A;  5EF6 A;  1HKS A;  4M6Y A;  1B1B A;  3OYG A;  5EEH A;  1ITY A;  3OYE A;  3BG3 A;  1F4K A;  1T2K A;  1D5V A;  2YU3 A;  1MJB A;  3FX3 A;  2IGN A;  2Y0M A;  3VEP A;  1Z0X A;  4HNV A;  2CJJ A;  1YG2 A;  1E0E A;  3ZQQ A;  3QPL A;  3GTM J;  1E3H A;  1WI3 A;  1RRJ A;  2M34 A;  2LG4 A;  3HL2 A;  4MGR A;  3WU0 A;  4G7Z F;  1REP C;  4EJT A;  5HLG A;  1J09 A;  2JA7 J;  3DEE A;  3K1N A;  4CSW A;  3ZPL A;  2LF7 A;  3P9K A;  1HC8 A;  3HOW J;  2MBF A;  5E18 F;  2GIZ A;  4D0P A;  3DLL F;  3OYM A;  3BOQ A;  4I6Z A;  1IF1 A;  1ODD A;  4W97 A;  2WBM A;  2DDA A;  5GPC A;  3NWS A;  5J47 A;  2WAQ A;  1GV2 A;  4A3D J;  2IXS A;  3GEZ A;  1LDK B;  4MHG A;  4NDL A;  3W6K B;  3S1N J;  1OYI A;  2QVO A;  3CCS I;  3ZRG A;  2E2I J;  1FBS A;  3B6A A;  2DTZ A;  3A4C A;  3JRI A;  1J9I A;  1QVU A;  2KIU A;  3M4O J;  1SEU A;  2CQK A;  4XN3 A;  2L7Z A;  1B6A A;  1T98 A;  5DYM A;  5TGT A;  2K9M A;  3RSN A;  3TP3 A;  4AUX A;  4HRI A;  2BV6 A;  4HYE A;  1W1W E;  4YIR X;  5M5Y J;  2DA5 A;  5LEJ A;  2DAO A;  1R58 A;  2IA1 A;  3CMY A;  1F43 A;  2E5Z A;  4F3Q A;  5F64 A;  2XV4 S;  3CMM A;  2EIJ H;  1NHA A;  4A3G J;  4XKV A;  5JLX A;  5B5E C;  2PFB A;  3RDI A;  3K2Z A;  2QA4 I;  2KRF A;  4BQA A;  1WI9 A;  1ZRC A;  2VJJ A;  4IHW A;  2EV5 A;  4QPQ A;  5GTI C;  2E36 A;  2ZNY A;  5FRM A;  2R7X A;  3IH3 A;  3T8T A;  3CDI A;  3QOP A;  1RUO A;  1H9G A;  2DA1 A;  4XLH A;  2L01 A;  4XKW A;  3JW4 A;  2VLA A;  3A02 A;  4RA2 A;  1JJ8 C;  3KEY A;  3HGY A;  1XCB A;  2X6Y A;  3K4J A;  2XAJ A;  3K70 D;  2LD5 A;  1GUU A;  1J5Y A;  2KIF A;  3HUG A;  3DEU A;  1MJA A;  5DD8 A;  1P4W A;  3M8F A;  3HOY J;  1BR4 A;  5E1Z B;  3L2V A;  5LGT A;  2K3P A;  5LHH A;  2XIG A;  3WTT C;  4PJ0 C;  2EB7 A;  3J81 K;  3TKY A;  1O3R A;  2Z16 A;  3PNY A;  1ZTR A;  2V1U A;  3OMY A;  3BTL A;  4XLA A;  3MN2 A;  1IJW C;  4OIQ F;  2PBI A;  1KYW A;  1MMA A;  2E35 A;  4LFU A;  3BPV A;  2HQA A;  1Z1D A;  2H1L A;  3TBI A;  3HOX J;  2E60 A;  3I4P A;  1SVM A;  4UVC A;  2RAE A;  2VI6 A;  1FYM A;  4FAS D;  1ZLJ A;  4EV0 A;  5FKM A;  5ED4 A;  4YRV A;  3QYE A;  2HOT A;  2F48 A;  2VJ5 A;  3IP4 B;  1Z21 A;  3ZQG A;  2RV8 A;  3SXY A;  3GF2 A;  2DTR A;  4D1Q A;  3H9J A;  1XTA A;  3DU6 A;  2HU9 A;  3DEW A;  1IV8 A;  3FKJ A;  3EUA A;  2NOG A;  1FSE A;  2RNG A;  3TL4 X;  5D4R A;  2V7F A;  1EA3 A;  2M7B A;  2ELJ A;  2UUZ A;  2ZME B;  1L0O C;  3I58 A;  3I53 A;  5D8K B;  1H88 C;  1XDU A;  2HTJ A;  3L2C A;  2ICW G;  1SFO J;  4M3G A;  3Q5F A;  3RQ4 A;  2L02 A;  3WGG A;  5F0C A;  2BVL A;  1YJ9 I;  5HDG A;  3LSH A;  2DJI A;  3F8B A;  3KZZ A;  4L5I A;  3ABT A;  4YII A;  1S9H A;  2XGC A;  1N78 A;  4L9J A;  3CLO A;  5HS8 A;  4XSX F;  3GFL A;  2LR8 A;  5HLH A;  2ZO4 A;  1KU3 A;  2I5U A;  4UHT A;  2L7K A;  3RQI A;  2R7V A;  2KJC A;  2LDU A;  2ZJQ F;  3A0H C;  2F5E A;  3GCM A;  4M3D A;  3TQN A;  1O7F A;  4HSR A;  4LLN A;  2I8D A;  3EPZ A;  3P9C A;  4O3M A;  4HV6 A;  2L9S A;  4U0V A;  2FXA A;  1A6I A;  2DA3 A;  1SAU A;  3LOC A;  1OKR A;  3H3Z A;  1IAW A;  5AIP A;  4NC6 A;  1Q1H A;  3VYT B;  1ORK A;  1MSE C;  2NS0 A;  1IGN A;  3S1Q J;  3KLN A;  1F36 A;  1FTZ A;  2CU7 A;  3M9A A;  5J6X A;  2HYF A;  3DBH B;  2PMZ N;  2L5Q A;  1ZR2 A;  2VN2 A;  2ZC2 A;  1JGG A;  1XDS A;  2W48 A;  1YRN A;  2E7W A;  2PJP A;  1UB9 A;  3RKX A;  4DYR A;  1OCC H;  2F5V A;  4W1U A;  1D1C A;  1WH5 A;  3BCA A;  3BJA A;  4DW6 A;  2ZJ2 A;  3HKZ N;  3GTJ J;  4E7H A;  4U7B A;  2WV1 A;  2MC3 A;  2R4G A;  4XM3 A;  3ECO A;  1IN5 A;  3ZN0 A;  4CIC A;  4XLF A;  2B0L A;  3G6E I;  1YTY A;  2HDC A;  3PO2 J;  3VPR A;  2JVH A;  2R5Y B;  3WU2 C;  2XUB A;  1WWX A;  3H5A A;  1WHU A;  4OIR F;  1YS6 A;  2ISY A;  4BS9 A;  3KP5 A;  1Z77 A;  2LBF B;  1K83 J;  3BT9 A;  2ZSI B;  1MGT A;  2IEK A;  5L3D A;  5E17 F;  2FBH A;  3VYR B;  4UNO A;  4PUS A;  1IRG A;  2PQ8 A;  2VB6 A;  3PQK A;  1K4T A;  4ABZ A;  1U3E M;  3O3K A;  4OIP F;  4LG0 B;  2UZK A;  5CQG A;  2QSG X;  5CVJ A;  1T56 A;  2JT1 A;  3EYI A;  3QU6 A;  2EPF A;  5DDG A;  5JVG F;  1BM9 A;  2WV0 A;  2Y30 A;  3DPT A;  2P4W A;  2A07 F;  2OC6 A;  1U5T A;  4ZJZ A;  4XOP A;  5E8G A;  4AM3 A;  3HSR A;  2JA5 J;  4IQJ A;  5F1J A;  3F72 A;  2ZB9 A;  2TRT A;  3I4M J;  4ZDO A;  3GVA A;  3JRD A;  4X6A J;  1B72 A;  1TC3 C;  1ZHF A;  2JA8 J;  3PFI A;  2MG4 A;  5KAI C;  5KAF C;  5KNL A;  2K4J A;  3J80 K;  3TDU C;  4A5N A;  1PYV A;  2FD5 A;  4LLL A;  2XAH A;  4R79 A;  3C18 A;  3OYC A;  2B9S A;  2PJR A;  2ZXJ A;  3PFY A;  2HXO A;  2RVC A;  3E6C C;  1O4X A;  4GRI A;  1K4S A;  1KYZ A;  1NK3 P;  4UY8 I;  1JUP A;  4IF4 A;  2ME0 A;  4Q47 A;  4C3I J;  3BJO A;  2DYS H;  3QU3 A;  4OAZ A;  2CYY A;  2MD5 A;  3S3O A;  3KX2 A;  1JXS A;  3GX4 X;  1APL C;  2HGC A;  2VXD A;  4IL6 C;  1BI2 A;  2H27 A;  5LHI A;  1BC7 C;  5D5V B;  3BR5 A;  3SEZ A;  1Z9C A;  2GZW A;  2LOO A;  3OIO A;  2V9K A;  1UFM A;  4GGG A;  1I27 A;  3TOA A;  2DFI A;  3BRO A;  5GAE J;  3KZY A;  2HOE A;  5EEA A;  4DJA A;  2HKX A;  2X48 A;  2ESN A;  1NH3 A;  1YJW I;  2WB1 N;  1PDN C;  4KT5 C;  3LQR A;  3HGG A;  1UCR A;  1J7K A;  4UV9 A;  4LB6 B;  4DYQ A;  3EUH C;  2EQR A;  2X6X A;  4A3K J;  3GTL J;  2DFF A;  3DQV C;  1JHH A;  4IXA A;  2EFW A;  4U87 A;  3K0L A;  2OV7 A;  4O5V A;  2EA4 A;  1MH3 A;  1R22 A;  1VND A;  3G2B A;  4QLC U;  5E3O A;  2XAS A;  4HG2 A;  2E71 A;  1S29 A;  3ZMS A;  4KN4 X;  1FLI A;  3BG5 A;  1USS A;  1HW1 A;  1SAN A;  3ISP A;  4IPA A;  3TO6 A;  4EAT A;  4ZZD A;  5JR3 A;  4BE0 A;  1JT0 A;  3LAJ A;  2D5V A;  3I55 I;  3HXL A;  1ON1 A;  5IOY A;  4EQQ A;  1VQ9 I;  2HDD A;  1MMD A;  2X6W A;  4B47 A;  1OCT C;  4LOC A;  1GT0 C;  1CF7 B;  1TP4 A;  1X2M A;  3S8P A;  2F4O B;  2YX4 A;  1IC8 A;  4IHX A;  1QZE A;  4U0Y A;  3S1R J;  1FNN A;  3DP7 A;  3F6O A;  3QOD A;  3LSP A;  3I4N J;  2KIM A;  3CMA I;  1X1P A;  2XAF A;  2A5W A;  3AFH A;  3S16 J;  2FMY A;  4BBS J;  4ZTF A;  2G0E A;  4L5E A;  1GVD A;  3W2W A;  4CDG A;  3DWL E;  4X0G A;  1DP7 P;  3BQY A;  4I01 A;  4ENM A;  2MH9 A;  3FHN A;  4LMY A;  3SHF A;  4PZJ A;  2GXA A;  3S3M A;  4PJN A;  3QPT A;  5IT3 A;  2R5Z A;  1IUY A;  3ZGK A;  3H36 A;  2JN6 A;  1IO2 A;  1WJF A;  4WXH A;  4CZZ A;  2OCE A;  3CF2 A;  1OIS A;  4WWC A;  4OWR B;  2JUC A;  3FF5 A;  3Q0W A;  4PCQ A;  1I6X A;  3TED A;  5H6R A;  2O9L A;  2OUM A;  2CO5 A;  2ACJ A;  5JFR A;  1BBY A;  3I59 A;  3RKW A;  3SDG A;  3C3W A;  4DBR A;  3PJR A;  2EH3 A;  4BAC A;  1KQ0 A;  5M5X J;  1O57 A;  2EZI A;  3BR0 A;  2P81 A;  3O6B B;  2LP0 A;  4FX0 A;  1RR8 C;  3DCF A;  4BY7 J;  4OMY A;  2YX7 A;  2VKD A;  3CES A;  4AID A;  1JKP C;  4HF1 A;  2DMP A;  3WTW C;  1U5T C;  4BH9 A;  2KRC A;  3MZY A;  1TWF J;  3A2K A;  4BXX J;  1B9M A;  1X1D A;  2DI3 A;  2QF7 A;  4N4O B;  2V9V A;  5JHF A;  2LC2 A;  4K2E A;  3ZMZ A;  3FBI B;  4ZZL A;  2A68 F;  2FEZ A;  3M3Y J;  3QYB A;  4GYG A;  1SVL A;  3GXO A;  3P5J A;  4ANJ A;  3RI4 A;  3TO7 A;  3VYU B;  4RMN A;  3H3U A;  2OQG A;  3QYF A;  1JKO C;  1HQC A;  2W00 A;  2FE3 A;  4IO9 F;  2LYC A;  2LRE A;  4BDY A;  5LRR A;  1OCP A;  5CVU A;  3ZN1 A;  3NWT A;  2K40 A;  4L5J A;  5FRO A;  2DOE A;  1W7P B;  5D5X B;  4A2U A;  2HVR A;  2ZXI A;  3CC2 I;  3LL7 A;  2VKE A;  1MD0 A;  4XLC A;  3GUD A;  2DQR A;  1T95 A;  1C0W A;  1TWA J;  3S2H J;  2VQL A;  4CCN A;  1W0U A;  3V8L A;  1FPQ A;  4II3 A;  4BEH A;  1MMS A;  5F1R A;  3F8M A;  4HAM A;  1JGS A;  2OTJ I;  2A6T A;  4I0A A;  5GP9 A;  3ABL H;  4UVB A;  1S7E A;  2W82 A;  3BJ6 A;  2JMW A;  3OR1 C;  1DU0 A;  5H2F C;  2M8G X;  5FB2 A;  4IQ4 A;  2O61 A;  4M71 A;  1SD4 A;  2Y31 A;  2ZNZ A;  4CCJ A;  1P4X A;  4HV5 A;  4XOT A;  3A0B C;  3T5X A;  1LEB A;  3F9K A;  2K02 A;  1RI7 A;  2GXB A;  1P6R A;  1PUF A;  1GLN A;  3H35 A;  1LE8 B;  2P5K A;  2XB5 A;  5GPA A;  4HQM A;  1BI0 A;  2KZG A;  2WTE A;  4KT6 A;  1RIO H;  2OA4 A;  2L9V A;  3BZ6 A;  3Q9S A;  4F92 B;  1ZG1 A;  1XG1 A;  1K79 A;  1U9O A;  2ETH A;  2NAZ A;  3CDL A;  1OJL A;  1PP8 F;  3EQL F;  1POG A;  3MZ8 A;  1LFB A;  2LKS A;  4N0B A;  4WK8 F;  1FT9 A;  2QCO A;  4H4K C;  5IP9 J;  3OYL A;  3J7Y J;  3IRR A;  1D8J A;  3K2A A;  2F4M B;  3ML6 A;  5F6F A;  2FNA A;  4AIK A;  3S2W A;  3E97 A;  4I76 A;  1BW6 A;  5L3B A;  1WSU A;  2RDP A;  4CA0 A;  4RGS A;  2NVT J;  3CUQ C;  2G7H A;  4XBF A;  3KEO A;  3CO6 C;  1JTX A;  3K9T A;  4GXO A;  4G7O F;  3D5L A;  4RAY A;  3D5S C;  4R8H A;  1M1E B;  4M9X A;  5E79 C;  4C2M J;  3EUK L;  2LY2 A;  4E7I A;  1MBK A;  1R4N B;  1S5L C;  3PNT A;  3VDX A;  4M9S A;  2WAE A;  4IHY A;  5FLM J;  4MEX F;  1XMA A;  5EG0 A;  2M1B A;  2BZT A;  3RIR A;  4ZDL A;  3WTS C;  5K7H A;  2EV0 A;  2VQH A;  3ERM A;  4XID A;  2OJE D;  2DA4 A;  2FQ4 A;  4Y33 A;  1EKE A;  1S6L A;  1Y56 A;  2ZSH B;  3MAJ A;  4OIN F;  3MKY B;  2L7M P;  3HC7 A;  2MW8 A;  4FE7 A;  3DTK A;  3E3V A;  3L2U A;  2HEO A;  4NC8 A;  2L4A A;  3S3N A;  1LFU P;  3WGH A;  4G8X A;  2F5F A;  2VC0 A;  2LK2 A;  1J2X A;  3VFZ A;  1WVR A;  2C6Y A;  4IKF A;  4JOM A;  2QUF A;  4LGW A;  3AL0 C;  3FXK A;  4C3H J;  1R5I D;  1MIJ A;  3LST A;  1V5G A;  4XL9 A;  3G1L A;  3GW2 A;  4MEY F;  4CO8 A;  2YU9 J;  4HEA 2;  4XON A;  3KYC B;  4RLQ A;  2NOJ B;  5BNG A;  1YLF A;  5L3E A;  3GLL A;  3OYB A;  1UG2 A;  2F2E A;  4BQQ A;  2FJ1 A;  1X3U A;  4G9Y A;  3LSM A;  3QQA A;  3KEQ A;  2VUM J;  1KZH A;  2EFP A;  3K4N A;  2KIQ A;  3VOE A;  4AIJ A;  4ESJ A;  1W7P D;  3LMM A;  1XMK A;  1BJA A;  2B63 J;  1MBG A;  1FBQ A;  3D5R C;  2ID3 A;  3FBN B;  3AAF A;  4N4N B;  5H6Q A;  1GDT A;  2IGO A;  1FP1 D;  2CMP A;  5D5W B;  1E2X A;  2K5C A;  2HPM A;  2VON A;  3BG6 A;  3JRG A;  3PSI A;  1ULY A;  3BTJ A;  2R7F A;  3EET A;  2PLY A;  2PMU A;  4DZJ A;  4BXU A;  2XGD A;  3AG4 H;  2BOL A;  2DQL A;  2K4B A;  5CVR A;  1HF0 A;  3HPH A;  4ITV A;  4MFD A;  4YFN F;  1UJ8 A;  2IA2 A;  4RGX A;  2QKL B;  1LKX A;  4PJJ A;  2NNN A;  3HOS A;  2HZT A;  4GFB A;  1SAX A;  2CS3 A;  4LIU A;  5FLX Z;  2EV6 A;  4UUS A;  2VBW A;  2K86 A;  2M2E A;  1QU3 A;  2XPU A;  3ZQL A;  4LG3 A;  4BE2 A;  1SD5 A;  1R5G A;  3H9G A;  2MSY A;  3DFG A;  4DQ2 A;  3JRB A;  4C2T A;  3J7A Y;  1R7J A;  3HUG B;  4G6T B;  3K4K A;  2Y0S N;  1G4D A;  3OS1 A;  3WTV C;  1QPM A;  1OCR H;  1FOK A;  2AO9 A;  2H6C A;  1KQ8 A;  3G1O A;  3GFJ A;  2Q8K A;  4XRF A;  2MFZ A;  3HDD A;  3MKL A;  4Y52 J;  3ZR8 X;  1B8I A;  1P9Q C;  2VQC A;  2VQG A;  1VQK I;  1VI0 A;  2FRH A;  3FHZ A;  2DT5 A;  4F7Z A;  2CFO A;  3OSG A;  2QBY A;  3R0J A;  4NHJ A;  4EJV A;  2L54 A;  3CLQ A;  1VTN C;  1HLV A;  1QGP A;  1YE9 A;  2DOF A;  2IGM A;  4M6X A;  4DYC A;  4BXF A;  4HX4 A;  1HOM A;  2HYJ A;  4KDP A;  3HHH A;  4HDV A;  4IRI A;  5FKL A;  1A6Q A;  2CUF A;  2F6C A;  3FMR A;  1ZGA A;  2BY2 A;  2XRL A;  4FIS A;  3CP8 A;  2HQR A;  5EDN A;  2AQF A;  2E34 A;  4L0Y B;  1IN6 A;  3IV5 A;  2QLZ A;  5J1U A;  2QEX I;  5F04 A;  3HM5 A;  3KP2 A;  1VQL I;  4FHT A;  4CXF A;  3ONQ A;  4CCL A;  2Y2Z A;  2CQ7 A;  1KQ9 A;  1OCZ H;  2GA1 A;  1R1U A;  1V3F A;  4P1W A;  3KYD B;  2JWT A;  3JRE A;  1V5E A;  2RNJ A;  3C2H A;  3CP2 A;  5HLT A;  5LD2 C;  5K7F A;  2WAF A;  2EFN A;  3WGI A;  2BBY A;  2G9W A;  3W2V A;  1N75 A;  4R1H A;  5J1R A;  3RKY A;  2XB0 X;  1IRX A;  3IC7 A;  1E3P A;  2HI3 A;  3GO5 A;  1E17 A;  3JCU C;  3PL8 A;  1JJ6 C;  1XMX A;  1ZAO A;  3K1P A;  5EGO A;  1K61 A;  2AQE A;  1GXQ A;  5KK1 A;  5CVI A;  3ULQ B;  5IYD J;  2EBI A;  3FXU A;  1IRZ A;  5E3N A;  2BY1 A;  2E1C A;  3JAM K;  3M1E A;  5IP7 J;  1W36 C;  4RGR A;  2ZJP F;  4E7J A;  4RB3 C;  2W4S A;  5D6E A;  3BC8 A;  5EJC A;  4F52 A;  3J7A O;  4B1R A;  2P6T A;  5IPA A;  1XS9 A;  4A6D A;  1T6S A;  1H89 C;  2QM3 A;  2DYR H;  3WTZ A;  1T39 A;  3QOE A;  1MNE A;  4J00 A;  1JI8 A;  2KLO A;  4ENK A;  1A5J A;  1DP3 A;  3N97 A;  3RKQ A;  3RPU A;  2H6B A;  3E5U A;  1ZH5 A;  3LA7 A;  1VZ0 A;  4HF0 A;  1LB2 A;  3S17 J;  4XLP F;  3LSG A;  1Z3X A;  2PMH A;  4UUT A;  1WJ5 A;  2NS8 A;  1I3Q J;  5FD6 A;  4HLX A;  4M74 A;  1VQ8 I;  5E20 A;  3CJQ B;  1Y0U A;  2ZKZ A;  4ETS A;  1I1G A;  1YX3 A;  5KHD A;  2FML A;  4HA8 A;  2BHZ A;  2DXI A;  2XVC A;  3SEQ A;  1WFX A;  4J19 A;  2QKM B;  2V1N A;  1NG6 A;  1G8X A;  2L7F P;  2RC4 A;  3WHC A;  3DTI A;  4AWX B;  3RZO J;  1Y8R B;  2XKP A;  3U1D A;  3DBL B;  1IW7 F;  1QZY A;  3PNV A;  1U5T B;  5DM7 F;  4IOC F;  1SFX A;  2BY0 A;  4E6K G;  1B72 B;  1BIA A;  4Y13 A;  1U8B A;  4G12 A;  2QQA A;  2JPB A;  3ZOB A;  3HOU J;  3SZT A;  1X2N A;  3HRS A;  3P9I A;  2AXT C;  3OYN A;  3K7A J;  4V19 K;  2NVY J;  2XF5 A;  4FET A;  2CUJ A;  1X1C A;  4RGU A;  5CJ9 A;  3G73 A;  3I0T A;  4BQN A;  3JR9 A;  3W6J B;  4DIQ A;  1HDD C;  3TW6 A;  3W3C A;  1IN8 A;  2E7X A;  2OZ6 A;  3RCO A;  1EJ9 A;  3B02 A;  2R92 J;  2WY8 Q;  2XGX A;  4EMS A;  2BXY A;  5J8C A;  4RM2 A;  4A0X A;  4Y7N J;  2R7Q A;  4E7Z A;  3CDH A;  3IH4 A;  2V79 A;  4RAF A;  5EYR A;  3BR1 A;  5B1B H;  5DTD A;  4QTR A;  1QPI A;  1AOY A;  1U8R A;  2P8T A;  3OYH A;  1OCO H;  4I09 A;  4XKB A;  1A36 A;  1GV5 A;  5HOO A;  4B48 A;  1NG7 A;  2N8G A;  5BOX A;  1EV7 A;  1FYL A;  2YSR A;  1IV6 A;  5HS9 A;  1BOB A;  4AYB A;  1AKH A;  3OL4 A;  4FQG A;  2V6E A;  3KET A;  4RBO A;  4E4H A;  3S15 J;  3KLO A;  1TW2 A;  3KZI C;  2ZME A;  3V7S A;  2ELK A;  4L18 B;  5ICE A;  1D1B A;  4BBR J;  3Q3S A;  2WWY A;  3E5Q A;  4XNF A;  2Y75 A;  1XD7 A;  2CQQ A;  2DA2 A;  3NRV A;  4BUP A;  1FP2 A;  1GVJ A;  3E6D A;  3A01 A;  1Z6T A;  4S0H B;  3HG9 A;  3F21 A;  1YS7 A;  2ISZ A;  3V4G A;  1G3S A;  1SFE A;  1YFH A;  1MW7 A;  2UXN A;  4AU7 A;  2VKH A;  3SZG A;  4WXD A;  2OU2 A;  2IW5 A;  3I9V 2;  4DGW B;  2D2W A;  2DT7 B;  4EVI A;  2FOK A;  2VIX A;  5K5Q A;  3RPQ A;  2BW3 B;  2EZL A;  1G6N A;  1BOA A;  4HLY A;  1BW5 A;  1ONV A;  1FY7 A;  4HNT A;  5LLQ A;  5ERI A;  4AC0 A;  4NC7 A;  3S93 A;  4BJ5 C;  3DTE A;  4PJM A;  2MA3 A;  3AKZ A;  3CUQ B;  2FBI A;  5DD4 A;  3KE2 A;  3GZ6 A;  5TJJ A;  3K4L A;  4YEJ A;  2M5W A;  1ETV A;  3DKX A;  2LRD A;  2YUS A;  3V42 A;  3DV8 A;  1V5F A;  1IXC A;  4MIM A;  5K5O A;  3AG1 H;  1EH7 A;  3ZMT A;  4GDF A;  3FIW A;  4XIC A;  2HNH A;  2R5Z B;  2OTL I;  1WGX A;  2HS5 A;  4Z6Y A;  1OFC X;  2A6H F;  4I02 A;  5GAH J;  1BL0 A;  1Z7U A;  3JTG A;  1D1A A;  3SYT A;  1F9N A;  3GTO J;  1DUX C;  3KIO A;  3OYA A;  1P7I A;  2LMD A;  4MFE A;  4UB8 C;  5IP6 A;  4CH7 A;  2M0C A;  5J40 A;  1XB4 A;  3AL0 B;  2YPR A;  1EH6 A;  1PUE E;  2MAB A;  4B8X A;  2CWE A;  4A3F J;  5HOD A;  3JRH A;  2FBK A;  2PEX A;  4NQW B;  4XMY A;  5M5W J;  3HEF A;  4A0Z A;  2A5Y B;  1BI1 A;  2JZY A;  4QPO A;  4BHC A;  1TTY A;  3CC7 I;  1AHD P;  1XCV A;  3I5U A;  1T0F A;  3FXO A;  1HKT A;  4BU2 A;  2WAQ N;  2Y9Y A;  3FMQ A;  1N25 A;  1TNT A;  4XN0 A;  2K3F A;  1OLT A;  1D3Y A;  1MZB A;  4ZDP A;  4BY1 J;  3RYP A;  4Y4R A;  1ON2 A;  3M8E A;  2KKO A;  2COM A;  2O0Y A;  2ZFW A;  4B43 A;  3BZC A;  1TL8 A;  1KGS A;  4UV8 A;  2PG4 A;  3NQO A;  4CYD A;  5GAG J;  2NRA C;  1X19 A;  1J0R A;  1ETK A;  5LHG A;  1FTT A;  2W24 A;  3ZQF A;  2R3S A;  3R0A A;  1CQT A;  1Z6R A;  1TQP A;  1XN7 A;  4L9T A;  5ILU A;  2IS4 A;  4IVN A;  1JTY A;  4NNJ A;  5J4V A;  3BR6 A;  1FOX A;  1BJZ A;  2DOD A;  2ZBK A;  3REO A;  2QQ9 A;  5HNF A;  1B4A A;  4HW0 A;  2IBD A;  5DM6 F;  1V55 H;  3PQJ A;  4GO1 A;  3CCY A;  2XSJ C;  3H9Q A;  2RN7 A;  4BEH B;  2AXL A;  2P5V A;  4RDU A;  1ETW A;  3UR3 C;  2KL4 A;  2XF7 A;  1IZ1 A;  3LA2 A;  1T38 A;  5C44 J;  4IRG A;  1XSX A;  3K4M A;  1WJB A;  3BDD A;  1P4A A;  3HIF A;  3BPX A;  3OYD A;  3BTI A;  2HQN A;  4ZC3 A;  1RR7 A;  1MBJ A;  1SD7 A;  4A3J J;  5JVT A;  2XAQ A;  3CCJ I;  4G6Q A;  4WF2 A;  5A2Q Z;  1IG7 A;  4FX4 A;  1WJE A;  4XR6 A;  4IOA F;  1ENH A;  3HSF A;  2Z33 A;  1PUF B;  1MDM B;  3VB2 A;  3IHU A;  1ZLK A;  1I1S A;  4C30 A;  1FBU A;  2G7U A;  2EFQ A;  3B6C A;  1T8I A;  3HRT A;  2Q2E A;  2HVS A;  4HF2 A;  5ILS A;  2V1D A;  2YS9 A;  3MQ0 A;  5DCM A;  4EGY A;  2ZXH A;  5D5U B;  1ACI A;  2QQ8 A;  1U0J A;  2JA2 A;  1V4R A;  2Q0O A;  4IRH A;  2VPR A;  1HKQ A;  2R7R A;  4IZZ A;  2VC1 A;  5F0F A;  3TW7 A;  2QEN A;  4DBQ A;  3DPU A;  1RES A;  2XAU A;  4DZP A;  4JX5 A;  3U1K A;  3MEX A;  5E1X A;  2LVS A;  2EA2 A;  2RGV A;  1L3L A;  3V7C A;  3JSP A;  2BXZ A;  1LQ1 A;  2MGQ A;  3T1B A;  2MD0 A;  3H5R A;  3VSL A;  2BHY A;  2CRG A;  4M6V A;  2ELH A;  3H0G J;  2RRE A;  5FJ8 J;  1O3S A;  4HNU A;  4B09 A;  4NBQ A;  2W84 A; 
#chains in the Genus database with same CATH homology
 2NOG A;  2DMN A;  3BTJ A;  3JRF A;  5EG0 B;  2R5Y A;  3BG9 A;  4DZJ A;  1UHS A;  2XGD A;  3W6V A;  1H88 C;  3S14 J;  2DA6 A;  1SFO J;  4M3G A;  4C3J J;  4MFD A;  1HF0 A;  2CQX A;  4A3E J;  4A69 C;  4X1E A;  5F0C A;  4GFB A;  4D5F A;  1DU6 A;  1QVT A;  2XGC A;  4UUS A;  5C3E J;  2HQ5 A;  2M2E A;  2XPU A;  3ZQL A;  2LR8 A;  5E3L A;  5IYC J;  2MSY A;  3JRB A;  3RQI A;  2LTP A;  1D5Y A;  3HOZ J;  5FKN A;  1RKT A;  4M3D A;  2Y0S N;  1WH7 A;  4CYC B;  1RKW A;  4MLO A;  2AO9 A;  2HOA A;  1A6I A;  3G1O A;  2DA3 A;  4BKX A;  2K9S A;  3LOC A;  3HDD A;  3C2B A;  3MKL A;  4Y52 J;  2VKV A;  2M9H A;  2EZH A;  1B8I A;  3S1M J;  1ORK A;  2AHQ A;  1VI0 A;  1MSE C;  1IGN A;  3S1Q J;  1FTZ A;  1F36 A;  2CU7 A;  2CUE A;  3OSG A;  2OF7 A;  1ZR2 A;  2PMZ N;  2ME6 A;  1JGG A;  3GBG A;  2DMQ A;  2W48 A;  1HLV A;  1YRN A;  4DYC A;  4DYR A;  4W1U A;  1WH5 A;  1HOM A;  5FKO A;  4DW6 A;  2HYJ A;  3HKZ N;  3GTJ J;  3GTP J;  3BTC A;  3HOV J;  2WV1 A;  5FKL A;  2NVQ J;  2CUF A;  2COB A;  2L0K A;  1VF9 A;  3H3V K;  4FIS A;  2XRL A;  2OPT A;  5EDN A;  3PO2 J;  3VPR A;  2R5Y B;  3IV5 A;  5J1U A;  1FEX A;  1ETO A;  4V2G A;  4M3F A;  5F04 A;  3HM5 A;  3HB9 A;  1Z77 A;  2Y2Z A;  1K83 J;  3BT9 A;  3WHB A;  2IEK A;  3MVP A;  5C4J J;  4D5C A;  1ETQ A;  1ZGW A;  4ABZ A;  2JWT A;  1ZKG A;  2DA7 A;  3JRE A;  1MNM C;  1JKQ C;  3GTG J;  4UUS B;  1Y1W J;  1T56 A;  5K7F A;  5K7Z A;  4XRS G;  4QIW N;  5J1R A;  2X6O A;  2Y30 A;  2XB0 X;  2HI3 A;  3O8H A;  4V2F A;  1MSF C;  2JA5 J;  1E3O C;  1JJ6 C;  1T33 A;  5F1J A;  5EGO A;  1MBH A;  2TRT A;  2ZB9 A;  1K61 A;  3I4M J;  3JRD A;  4X6A J;  1B72 A;  2XSD C;  1TC3 C;  5IYD J;  2EBI A;  1IRZ A;  2JA8 J;  5E3N A;  5F08 A;  1RET A;  2MG4 A;  5IP7 J;  4D7M A;  2E1O A;  2FD5 A;  1JUM A;  1P7J A;  1B8I B;  2XPV A;  2ECC A;  4B1R A;  5IPA A;  2FX0 A;  1XS9 A;  2HXO A;  1O4X A;  1LE8 A;  2KT0 A;  1TWH J;  2LFB A;  3ZQH A;  1NK3 P;  1UMQ A;  1JUP A;  2ME0 A;  1H89 C;  4C3I J;  2E2J J;  3FIS A;  4A3B J;  2O7O A;  2HXI A;  1R9T J;  1APL C;  1A5J A;  4A3M J;  3RKQ A;  3FK6 A;  4IHV A;  1I50 J;  3BR5 A;  3S17 J;  1WPK A;  3LSG A;  4A3L J;  1RPW A;  4UUT A;  2NS8 A;  1I3Q J;  2K9N A;  2TCT A;  3OIO A;  2O8K A;  3BR2 A;  2DMT A;  2LLK A;  5EEA A;  4JP0 A;  2X48 A;  3CQZ J;  4J19 A;  5DS9 A;  3LNQ A;  2L7F P;  2WB1 N;  3WHC A;  2NVX J;  3HGG A;  4EEF G;  4B4C A;  2E2H J;  3RZO J;  2DN0 A;  4DYQ A;  3OOU A;  2ECB A;  2EQR A;  4A3K J;  3GTL J;  3Q0U A;  3G1M A;  1EF4 A;  3F0C A;  1I6H J;  1JT6 A;  5EGO B;  1MH3 A;  1VND A;  5E3O A;  5IYB J;  5EZG A;  1B72 B;  9ANT A;  1U9N A;  1U8B A;  4G12 A;  5EZH A;  2H1K A;  3ZOB A;  3BG5 A;  5J3L A;  3HOU J;  3ZQI A;  1SAN A;  1X2N A;  1JT0 A;  3FK7 A;  2D5V A;  3K7A J;  3OSF A;  1XC5 A;  2NVY J;  5IOY A;  2HDD A;  2JJ7 A;  1OCT C;  4LOC A;  1GT0 C;  5FLV A;  1X2M A;  3BQZ A;  3JR9 A;  2H8R A;  1IC8 A;  3BR3 A;  1ZR4 A;  3ZQC A;  3S1R J;  4IHX A;  1HDD C;  3JRA A;  2JK3 A;  3LSP A;  3I4N J;  3TW6 A;  2GLO A;  4A3I J;  4B3A A;  2R93 J;  4XRM A;  2R0Q C;  2HOS A;  4MO7 A;  3S16 J;  2R92 J;  4BBS J;  2G0E A;  4Y7N J;  4L5E A;  1GVD A;  5JLW A;  3IH4 A;  5EYR A;  5DTD A;  4QTR A;  3BR1 A;  3BQY A;  3NAU A;  1QPI A;  1HDP A;  3GTK J;  3HBL A;  1GV5 A;  5C4X J;  3QPS A;  2R7Z J;  2R5Z A;  3TP0 A;  3LSR A;  2N8G A;  2JN6 A;  3A03 A;  4AYB N;  1IV6 A;  3UKG A;  3GTQ J;  2JA6 J;  1AKH A;  4JX4 A;  4RBO A;  2IAI A;  3Q0W A;  1U78 A;  4XRS A;  3TED A;  2O9L A;  3S15 J;  2ELK A;  3SDG A;  2KDZ A;  1IDY A;  4BBR J;  2EH3 A;  2XPW A;  5M5X J;  2EZI A;  3Q3S A;  3BR0 A;  1TWG J;  2P81 A;  2LP0 A;  4D7N A;  2CQQ A;  2DA2 A;  3DCF A;  4XK4 A;  4BY7 J;  1ZQ3 P;  1ETX A;  2DMU A;  3A01 A;  4S0H B;  1JKP C;  4FE4 A;  2GM4 A;  2DMP A;  4JYK A;  5FKK A;  1TWF J;  4BXX J;  2QF7 A;  4JX6 A;  2Y9Z A;  3M3Y J;  2E19 A;  2EZL A;  1ETY A;  3Q0V A;  1BW5 A;  1MH4 A;  4CYC A;  1YRN B;  4IEJ A;  4AC0 A;  1JKO C;  1X58 A;  1W0T A;  2GBY A;  4A93 J;  1ETV A;  1OCP A;  5J1Y A;  2YUS A;  2ID6 A;  4M3E A;  4MIM A;  1FIA A;  5E3M A;  3S2D J;  2K40 A;  3FIW A;  4XIC A;  2R5Z B;  1WGX A;  3LSJ A;  2VKE A;  1OFC X;  1MBE A;  1IDZ A;  1TWA J;  3S2H J;  1BL0 A;  1AKH B;  1W0U A;  2LY9 A;  1VFC A;  3GTO J;  5M3M J;  1P7I A;  5EF6 A;  1H8A C;  4MFE A;  2DJN A;  5IP6 A;  5GP9 A;  1ITY A;  3BG3 A;  2M0C A;  1S7E A;  2JMW A;  1DU0 A;  2M8G X;  1Z0X A;  4HNV A;  3D1N I;  2CJJ A;  2Y31 A;  3QPL A;  3GTM J;  1WI3 A;  3A01 B;  4A3F J;  1AU7 A;  5HOD A;  2M34 A;  3JRH A;  5M5W J;  3HEF A;  1FIP A;  1AHD P;  2JA7 J;  1QRY A;  1BA5 A;  1PUF A;  3HOW J;  1LE8 B;  2WAQ N;  2Y9Y A;  4I6Z A;  3PO3 J;  2XB5 A;  5GPA A;  4W97 A;  3L1P A;  1Q1V A;  5GPC A;  4BY1 J;  4A3D J;  1GV2 A;  2EZK A;  4NDL A;  1XG1 A;  3S1N J;  1U9O A;  2LKX A;  2E2I J;  3B6A A;  3CDL A;  2DTZ A;  3O8G A;  3JRI A;  1OJL A;  1MBF A;  1POG A;  1LFB A;  1QVU A;  3M4O J;  1ETK A;  2QCO A;  5IP9 J;  3SFI A;  5IOZ A;  2L7Z A;  1FTT A;  3IH2 A;  1TWC J;  3K2A A;  3ZQF A;  1CQT A;  4I76 A;  3TP3 A;  4AUX A;  1BW6 A;  1NK2 P;  2NVT J;  5M5Y J;  2DA5 A;  1JTY A;  1JKR C;  1JTX A;  3CMY A;  3BR6 A;  1F43 A;  1IUF A;  4C2M J;  1BJZ A;  1MBK A;  5F27 A;  2IBD A;  4FTH A;  4A3G J;  3PM1 A;  4IHY A;  2XGE A;  5FLM J;  5JLX A;  5EG0 A;  3JRC A;  3CCY A;  5K7H A;  4XID A;  4RDU A;  1ETW A;  4IHW A;  2DA4 A;  2FQ4 A;  2L7M P;  5C44 J;  3SJM A;  2MW8 A;  4FE7 A;  3RZD J;  2K9Q A;  3IH3 A;  3BTI A;  1LFU P;  4A3C J;  1RR7 A;  1MBJ A;  2DA1 A;  4A3J J;  1HCR A;  2LK2 A;  3A02 A;  3FKI J;  1JJ8 C;  1IG7 A;  3HGY A;  4M3B A;  2LD5 A;  1GUU A;  1FJL A;  1ENH A;  1G2H A;  5F0H A;  4C3H J;  1PUF B;  2L9R A;  3HOY J;  3G1L A;  2YU9 J;  3B6C A;  1JUS A;  5BNG A;  2NS7 A;  1ZTR A;  3BTL A;  3MN2 A;  1IJW C;  2YS9 A;  1NTC A;  1UG2 A;  2VPR A;  2FJ1 A;  3TW7 A;  5F0F A;  1Y1V J;  3HOX J;  3QQA A;  2VUM J;  1RES A;  4DZP A;  2RAE A;  2VI6 A;  4JX5 A;  4QSH A;  2B63 J;  1MBG A;  2LVS A;  2ID3 A;  5FKM A;  1ZK8 A;  1GDT A;  2HOT A;  2MGQ A;  3E7L A;  3ZQG A;  1WCM J;  2I10 A;  3NAR A;  2CRG A;  4M6V A;  2X9D A;  3H0G J;  5FJ8 J;  3JRG A;  5M3F J;  3DEW A;  4FCY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...