4C3KA

Structure of mixed pii-adp complexes from s. elongatus
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
115
structure length
98
Chain Sequence
MKKIEAIIRPFKLDEVKIALVNAGIVGMTVSEVRGFEFLQKLKLEIVVEDAQVDTVIDKIVAAARTGEIGDGKIFVSPVDQTIRIRTGEKNADAISAW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis and Target-Specific Modulation of Adp Sensing by the Synechococcus Elongatus Pii Signaling Protein.
pubmed doi rcsb
source organism Synechococcus elongatus
molecule tags Transcription
molecule keywords NITROGEN REGULATORY PROTEIN P-II
total genus 22
structure length 98
sequence length 115
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2013-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00543 P-II Nitrogen regulatory protein P-II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.120 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4c3kA00
1NZAA 4CO0A 1V3RA 4OZJA 1VHFA 1Q1KA 2CZ4A 3MHYA 1H3DA 4CNYA 1V6HA 5DRKA 2XZWA 2Z0GA 4NYOA 2XULA 4CO3A 4WK3A 4D3HA 1XK8A 2PIIA 2DCLA 2GX8A 1J2VA 3CE8A 1OSCA 5D4PA 2JJ4D 5D4OA 2GNKA 3X3UA 2ZFHA 4CO1A 2E66A 1P1LA 4USJC 1KR4A 1V9OA 3DFEA 2O67A 4YB5A 1VFJA 3T9ZA 4C3KA 1O51A 4RLEA 1UMJA 2EG2A 3GSDA 2EG1A 4RWXA 4OZNA 2GW8A 3TA2A 4NYPA 2ZOMA 4C3LA 4Y6IA 1NH8A 1UKUA 2VD3A 4AFFA 4YB6A 3HLUA 4RX6A 3LF0A 2J9DA 3L7PA 5D4LA 1NH7A 1UFLA 3O5TB 4CO2A 4E98A 5D4NA 2NS1B 2O66A 1V3SA 2J9DE 4OZLA 2V5HG 4USIA 2J9CA 1GNKA 4R25A 4USHA 4ZK7M 3AA9A 3BZQA 4WK1A 3NCRA 1NAQA 3NCPA 1UL3A 2J9EA 3O8WA 2NUHA 3AH6A 3TA1A 1HWUA 3AA8A 4YB7A 3AHPA 2RD5C 4IYQA 4Y65A 3N5BA 1QY7A 2NUUG 5L9NA 4CNZA 3OPKA 1O5JA 4CO5A 4CO4A 1PILA 4D3GA 4C3MA 3NCQA 4RWWA 3TA0A 3M05A 2XG8A 2XBPA 5DS7A
chains in the Genus database with same CATH superfamily
4MYUA 3WZ0A 2OD4A 3HHLD 4CO0A 1N34J 5LOQA 3D1QA 1PCAA 1KOHA 4I68A 2YPYA 3PG9A 5FLXU 3Q89A 4CLWA 4EWTA 2DHGA 2HAIA 1N32F 3KK3A 2D3O1 2AYBA 4CNYA 5J2QB 1V6HA 1KLMA 5DRKA 4RNHA 2OEKA 2BANA 3W5YA 3W8PA 2Y1JA 3PW4A 3A3PB 2P6SA 3KLIA 3L7OA 4YP3A 2YNIA 4ERDA 5ETOA 2IPOB 4DQIA 3HULA 5KFZA 3PEHA 4QW9A 2YBVA 1N8RT 1AXQA 1S9EA 2ROPA 3J81Y 2B56A 3TYTA 1MWYA 2U1AA 2ZEJA 2JJ4D 1FDBA 2OLWA 4XDCA 4LF9F 3MUTP 1KFSA 2VG7A 3MTJA 2MKSA 3KK1A 1FKOB 4NASA 5IM0A 2HWTA 2FLLA 1FRLA 4R8UA 5JUMA 3B4MA 4UTGA 2MQOA 3SI8A 4DR3J 4UQTA 3W8GA 1J5OA 3NG8A 1XMQJ 4OYAA 4OQJA 5KFQA 1KLNA 2MQLA 4W4MA 3JSMA 2O1PA 3BKTA 3BKFA 1H2UX 1KBRA 4HHHA 1BY9A 4I2QB 4ZVPB 4ZCKA 3FNNA 3G4SS 3R7BB 2VIHA 1KS2A 1T9TA 1EETB 1H6KX 3UDLA 3IS9A 4WXWA 4R5PA 4ECZA 3QT6A 5D3GA 3PIOQ 1N88A 1F0XA 5EN1A 3DHWC 2J5AA 5THWA 4YY3F 1LQ9A 1RAEB 2VQEF 2OPPB 3GCXP 4ECYA 3HK2A 1AFIA 4M5DA 5HROB 4HDGA 1GMWA 1RT7A 2R2SA 2DNKA 2G9OA 4CIOA 3Q8RB 2GMHA 5LSLA 2KI2A 2JRSA 2DJWA 2Y1RI 3KLEA 3CEDA 2ALZA 1I94J 3BGOP 3QYYA 4URQU 4L72B 4DUYF 3ZZOA 1VQPS 1RGVA 3DGPA 2A6OA 4CO2A 4C2MA 1L3SA 3VQTA 1HPZA 1S6UA 3R3TA 4ZJOA 4EEYA 4FF4A 2UXBF 2EBGA 3QNWB 3THVA 2V2QA 4NLSA 1XMQF 3OFFA 5A8KB 4DFPA 3GFZA 4AQYJ 4OYPA 5CYQB 4KGKA 2B5JB 2E5GA 2K7JA 5L1LA 4A8FA 4ECQA 5HBMB 5EWEA 3SIPB 3EZ5A 2MXYA 1S9FA 1OY6A 3KK2B 4X2BA 2MZSA 4DCOB 4ZCLA 4U8VA 2KVIA 4QZVB 5KFIA 1RHKB 2MKKA 3NAHA 1YDLA 2EFQA 5HSPA 1F60B 3D66A 3KG4A 3T1HF 1RWOB 3GQCA 3NCPA 3ENWA 2J8AA 4Q8FA 1YQHA 3O6QA 1N5TA 4W90B 3AH6A 1F5CA 2Q6BA 2MZQA 4WFXA 5H1SV 3MD3A 3KLGA 3CCUS 1X9WA 4BDPA 2MHEA 3E2EA 1FWKA 2YVSA 2JLEA 4OFZA 2A6MA 5IOLA 1Q7LB 1UTAA 2GAGC 3NWRA 3GV8B 3Q22A 4I2PB 2CG4A 2XMMA 4NYZA 5EHHA 2DR7A 1UEVA 2D3UA 1EJ7L 5D15A 3OPKA 3QT8A 4JI5F 3NP5A 1HNVB 2HS3A 4CCHA 2AMCB 1X4BA 2UVVA 3M2VB 2EFVA 1SC1B 2YWHA 3CMAS 3RAXA 2UV8A 1IR1A 2P9GA 5J1PA 2VKZG 4ZOSA 2HLTA 5F9LA 2BW2A 5G0RB 3BQ0A 3TAMB 2RRNA 3RU0A 2KFYA 2J6UA 2CQIA 4AT1B 3KK3B 2R7UA 1IQTA 4RL1A 1Q8KA 2IDEA 1VHFA 3SSQA 2VG5A 4AUKA 4DFKA 2AYGA 4WFBQ 2HZCA 3N6LA 1YZ7A 2WCXA 1D09B 2UU9J 1AROP 4X65F 4EFAC 3C19A 2KL8A 1RTJA 2WBRA 3BEGB 3LO3A 4DN0A 3OTCA 2LQ8A 1NK4A 3WC0A 4AXIA 4DPUA 1IN0A 3KTQA 2GHPA 3MURP 5A0YA 2GJ2A 5BR8J 2JFDA 4LF5J 4JI8J 3JTOA 3VAJA 1CPZA 1R3NA 3DCAA 3FQLA 3HFVA 5HVFA 1XK8A 5GAHI 1OWXA 4V19X 3IR6B 2QX0A 2BJ1A 1BUXA 2KRBA 4FS1A 1J2VA 5A6PA 2KTQA 2I1RA 3MAQA 4YY3J 5EWFA 3OR1A 4I6AA 4LR8A 3ZZRA 3CD0A 1TL5A 4WJBA 3K58A 3ZC4A 1B7YB 4Y28C 2DGWA 3MMAA 1R8HA 3GILA 1RWWB 1Q82T 3DFEA 1W7WA 1U09A 1NB2A 4CP5A 1ZH5A 1S49A 2W01A 8RUCA 4EO6A 1WOOA 2PFDA 2W4PA 3C14A 3W5ZA 1MU2A 5J1NA 3U1LA 4GKJF 2IBOA 1NHUA 2CQHA 2WOMB 1JKHB 3FK4A 3G9CA 4RW6A 2PA3A 4F36A 2FZGB 2C3UA 4WXOA 2POKA 4OYXA 2ASYA 3ICLA 1NSQA 5C42B 1KRPA 4QR1A 4ZVRB 4JI2F 2W7OA 2CZVC 4RW7A 4A4JA 5B0BA 3IBCB 3MMBA 2PI4A 2DR5A 4GKKJ 1UVKA 3DRXA 1UETA 4ZVHA 2Y8WA 5U47A 3OL6A 1VIXA 2DNQA 5D0HA 3HMJG 4OMFG 1RAGB 2OO4A 3RYLA 4YFUA 3CCSS 1FJ7A 2XMUA 2DH8A 4J90A 1K0VA 2WHOA 3FBBA 2AX0A 5IQQA 2RDJA 3JXOA 3LF0A 1SB6A 3HHLB 2R8HA 2J9DA 2YWKA 3BBFA 1FXDA 1XIQA 3N5FA 3JTPA 1NJYA 4WFAQ 1RWVB 3HX9A 1DHMA 2NXCA 3NEKA 2LFVA 3TEHB 3NS6A 2ACYA 1VK3A 4KHMA 1UWBA 3CJ8A 1C1BA 1VR6A 4MH8A 3UE2A 5GAEU 3CCQS 3IGNA 4FKXA 3VR1A 2AP6A 1N36J 3P45B 4FXWA 3CJ5A 3UNGC 2YX1A 3ZZPA 1CJKA 3IXQA 1O8BA 4MMOA 3TVYA 5T41A 2E5HA 4DOZA 3W5XA 4WYLA 1OO0B 4H4MA 2OTJS 5F8NA 4OHXA 1SIZA 3V6HA 1IKVA 2G2ZA 2HS4A 2YWFA 5KFKA 4UZCA 1YIJS 1QSYA 4B9SA 3G6VA 1TUVA 3AA9A 1N48A 2VL1A 5IQ6A 5DLFA 1H0HB 3TWZA 1SCJB 3KUHA 4DU8A 1QLNA 3I0SB 3DYAA 4C8NA 3SQGA 2XSJA 5J2PB 2QLBB 3PZPA 1WHVA 4I2PA 1U24A 2P5VA 3OTBA 3RR7A 2DNNA 3GP9A 3OTOF 2QFJA 3EX7B 2BW7A 4JI0J 1HNVA 4LFCF 2DRDA 1CJUB 3QZ8A 3W65A 2UUAJ 2DEJA 3H20A 3CD7A 2CIMA 4DR6J 3W61A 3VWSA 3RRKA 1ZS6A 3GPAA 3CC7S 2RIJA 1FX2A 4UY85 2AEJA 4CO4A 2WB1D 3MI7X 4JI6J 1A6LA 3VAKA 2UV8G 2HFZA 1CSJA 2DO0A 2XGQA 5J2PA 1S97A 1TVRA 4F3QA 5T14A 1BQMA 3KLHB 3R6GB 1LWFA 3LP2A 4DV4F 4N76A 2R2RA 2ZZMA 1XERA 1QAJA 1AYEA 2MLYA 3MD1A 2QZ8A 1D0EA 3AODA 1RT7B 1PYTA 1KD1T 3A8EA 4LSNB 1Y0HA 1Y5IB 4OYWA 4O0NA 4ZPBA 2MDAA 5K9FA 4L75A 5G4DA 2AEMA 1FA0A 4KGXB 4KJIA 5DG8A 5E33A 1XR5A 3ZZTA 5KFPA 2HFNA 2CPJA 1H3DA 4WP8A 4BWMA 5CD4A 3MFHA 5HP1B 1H7WA 2R8KA 1WKJA 3H8YA 3Q83A 9RUBA 3VALA 5KFEA 3RRGA 2G2OA 2XULA 2VQFF 1RT2A 1SV5B 3C66A 2KYXA 3R5CA 4GVLA 4HH0A 4P74A 1KEKA 3M8QB 4YS2A 4ANEA 1WD6A 4DL4A 3T19A 4LJMA 4TQRA 1UZHA 2Y3YA 1FRJA 2WRMA 3HD1A 4O23A 2D3OR 2EEYA 3MEEB 3KUGA 3DI6A 3DRPB 1NJWA 2AGQA 1U6FA 2F5GA 1X4AA 2XC9A 3H25A 1L3KA 5LXYA 4ECUA 3AB2B 1FEHA 1N34F 2DXFA 5KFJA 4OHZA 4ZVEA 4DN9A 2DRBA 2K2PA 1IKYB 1JLAB 2MHNA 4ALZA 4RNNA 3T5KA 4ILRA 2G1HA 2WW8A 1WWHA 2HAFA 1JLQB 1V5IB 1I51B 2CKWA 2H4WB 1NBEB 4JBCA 2AT1B 2DIUA 2HQIA 3H2LA 5E3QA 4IFYB 5BYQA 3UO0A 2R8GA 2IY5B 4DV7J 3V6DA 3VVUA 1ULRA 4RLEA 2UZAA 1RI7A 1RHMB 1T95A 1RTIB 4AXJA 3I87A 2V6AA 3EDQB 1X7VA 4IQMA 3OSNA 4PWDB 3O44A 1S9GA 2LEBA 4WTOB 3PV8A 2KKHA 5F3TA 2XZTB 4QCLA 1KN6A 4DMZA 1FFWB 3BPSP 4NMXA 4EYIB 4R5PB 2DB1A 2Z58B 1DTQB 2CPYA 2DY9A 2FZKB 1WEYA 4CLSA 4LBHA 1FK9A 1G2EA 1HHTP 4DR3F 1FO1A 2XCAA 3TAQA 3R5AA 2B7CB 1RSCA 1VLYA 2MPUA 3P8BB 3W60A 1S1VA 1HI0P 2FHJA 2LXFA 3AT1B 3ITHA 3TR5A 4ELVA 5A2QY 1W2BR 1HW9A 2QYCA 1N5YA 3HHLA 1XTZA 3D0GE 3FJ2A 2NR0A 2HHUA 1V3SA 2CQDA 2GVDB 3DLEB 5C5JA 1O0PA 2UU9F 3TZYA 2XY7A 1HWKA 2XEXA 4LF8J 1GNKA 1WEXA 4ECSA 5E3RA 3OR2A 1U45A 2E29A 2HEKA 1VBYA 2COLA 3T1YJ 2RVJA 3A8JA 2V0NA 2HQCA 3I9ZA 2B6AA 4FNHA 1MG7A 3OL9A 1AZSA 5CYQA 4LF4F 2JZ5A 4J5OA 4W92B 1PBUA 2V8VA 2IC3B 1SH3A 3DMJB 1EP4B 1U25A 2MMYA 3BM7A 5DJBA 1IBLJ 4PAAA 5KOXA 4XPCA 1Q8IA 3A3OB 4YB7A 3IBFB 5EX3A 3PVXA 3H5SA 3H5XA 3K0JA 3M1VA 3N9UC 2IVMA 3N6MA 1T05A 1G3OA 3M9MB 1KVIA 4DUZF 4J9KA 3N5BA 1JJHA 1DURA 4CNZA 1SBRA 2I8EA 3KDNA 2ZJPQ 1GH8A 4KGZB 1XJWB 4QIWD 3DLGB 2KT3A 2NSBA 1X9MA 3WC2A 3QGHA 1RAIB 3MEGA 3V5RA 1UFKA 1R8CA 5A8WA 1KQSR 3HP6A 2DGQA 1XWLA 3T1AA 1FVQA 2CPXA 3HZGA 4QR2A 4EUVA 2ZWPA 1GXTA 1NO8A 2VG6A 4EZ6A 3G86A 2WAQD 4B3OA 1P27B 4DHVA 4DU7A 1HNIB 1VISA 2BKPA 3P5TL 1IKXB 4J91A 7FD1A 3CULA 3Q8QB 5DZ7A 5LMUF 3GYGA 1Q1KA 1U1KA 2NREA 1R8BA 5C25A 4PG4A 3TZZA 3OXGA 1CLFA 4IR1A 2HW3A 2FVQA 2HNDA 2FQQB 4NMLA 5AT1B 1JK9B 1T03A 5SUHA 3EE3A 1HMVB 4M95A 1IVZA 3CIZA 4JYAJ 2FTRA 4NCGA 1R6VA 4RW8A 3FBFA 4R8UB 1GK8A 3G87A 4K4UA 2MY7A 3M1VB 3IO1A 1KHWA 3BBBA 3MM5B 2RILA 4YDXA 2X1GA 3RAMA 3H5YA 4EBDA 2J6SA 2OJ3A 4PUOA 5KT4A 3TQEA 4GC7A 1VBKA 3VGTA 4DR7F 2C42A 3TX0A 3CCMS 4O3RA 5KFMA 1JMTA 2M52A 4WP9A 3T1YF 3CDWA 3SCKE 4YHHF 2CPHA 3CJSA 4NLQA 2ZFHA 3L09A 4USWA 3SDEB 1B99A 3KOAA 2A2DA 2CWKA 3DLLQ 1KVKA 2IIHA 5AJ3J 2H5JB 4JI4F 4IOCQ 2KG1A 1UVMA 5HI7A 4ZPWR 5I3UA 3VGUA 2CJQA 4DL0C 1QUPA 3T5HA 1Y11A 4X64J 1T9YA 4IFVB 3MUMP 1NKEA 1I6JA 4KPYA 3O1LA 4YDDB 1VCTA 3G6YA 1FI4A 1K1QA 1JLEB 4J9NA 3QRQA 3S1TA 4HYKA 3MPYA 2L08A 1FE4A 1Q53A 3JTNA 4AD6A 3F0NA 2IVYA 4IG0B 5K8OA 3PW2A 3GG0A 4OZNA 4ED5A 2N3LA 3LOUA 4TLQA 2E1RA 4EZ9A 4ZLJA 1FERA 3KJVA 1Q7YT 2LEPA 8ATCB 4IRCA 2VD3A 4KFBB 2HRYA 1ROFA 2EFGA 4YB6A 2CQCA 5L38A 1VHIA 1T3NA 3D6HB 3PKMA 4X4NA 4C0HA 5L1JA 2H1YA 5F8HA 3NBPB 4N77A 1P6TA 1RP5A 1H2TZ 1UWAA 2KHCA 4P7VA 1U6ZA 4F7VA 2GJFA 4URSA 3L7PA 2OI2A 1RA7A 2RAQA 2XMJA 4CT8A 4B08A 2FYXA 4B9NA 4DR1F 2G4BA 4C0BA 2VF3A 2HHXA 1X4GA 1ZM4A 5DDPC 4I69A 2MB0B 1Z1ZA 3BGRB 1XNRJ 1BQNA 3LH2S 3DDIA 3CJKB 2HBQB 1FDAA 3E3XA 3N28A 1ZM3A 3EMTA 1FRXA 2B9EA 4WTYA 1UEKA 4J37A 4DZDA 5F41A 5B0GA 2RS2A 1K0TA 2XWYA 3EZUA 4C4WA 4ZK7M 4NLGA 4CQ1A 4PQAA 3ISZA 3QAUA 5DLGA 2F4FA 4FN5A 2IFXA 5MAOA 1WEZA 3MAHA 5GAGU 3BQ2A 3ILJA 3M4XA 1S12A 1MNEA 1NRKA 4FVMA 3CCES 1JJ4A 4PG6A 2BM1A 2KHDA 2J9EA 5CYJA 3MR6A 1QE1A 2VA3A 1VRUB 5LMUJ 4J9LA 3BO3A 1R0BG 3HDSA 3P5BP 1DTTA 4MFBB 2Z4PA 3KHRA 4RBUA 2G0IA 4RNOA 4LBIA 3RR8A 2BQUA 4U7UD 4ZPVR 5LSRA 1HWLA 2UXCF 2XHWA 4ECTA 2GHWA 2VG5B 1YKWA 5HK4A 2UP1A 4QU7A 4H4OB 3R5DA 4KQZA 4LMZA 4P75A 1CS4A 2HIQA 3PRVA 4WZMA 2XLIA 2W9CB 1DQ8A 3PTWA 1NK7A 5BYSA 1LFWA 3PRBA 2DKOB 3H7HB 2ZBPA 2BKNA 2VQEJ 1S6PB 1Q4RA 3MEDA 2AF6A 2VBWA 5D0EA 1U26A 1C2PA 2XYHB 5ITHA 2OPRA 3CW2C 2XS5A 2E44A 3UI3A 2WK4A 1LW2A 1LNQA 1T11A 4KC5A 3MFIA 1RCOB 4OI6A 5B0FA 3J7AN 1VGYA 3CJ0A 3NGTA 4DV1J 2HBRB 4X4SA 4LFCJ 1TKXA 2H65B 3DLKA 2JDJA 1ZAWA 4ATNA 1RZMA 3BB5A 2GZOA 3I4PA 1K73T 3AFGA 2V63A 3Q0AA 1V5VA 1SJRA 1RAOA 1RHUB 2JH3A 4ID5B 2DNPA 4PCQA 4ZIWA 3NS5A 3SCIE 3RBEA 1SJ3P 3LALA 3OL7A 3CCRS 3X1LB 4ER8A 2UXCJ 1VS3A 2YKQA 1VQ8S 2XS7A 1S1WB 4NA1A 3KHGA 2KXFA 4ED3A 3BDPA 5HBMA 4LFAF 1Y3KA 4DX8H 1I3OB 4C9DA 3SFGA 5I3UB 3UW1A 1LOUA 2GNKA 3D1HA 2AYEA 4A47A 3M2RB 2ASJA 4KHPJ 3K7RA 2W4CA 3QGPA 3CCVS 4CM2A 3T1HJ 2LXIA 1YI2S 3CJTA 1WSRA 4PWWA 3QZ7A 1SQEA 4DSIA 4ZLLA 1RUSA 2KRRA 3HJVA 5GMEA 3MCOA 3T5JA 3MM9A 4RUCA 2W7PA 4GVBB 1XC9A 3FMBA 5B09A 2GO9A 4Y2KA 2FD2A 3ZTQA 4F4AA 3OQ2A 1BE4A 3SSSA 1XR7A 4I6WA 2I6WA 2CVIA 2GV1A 1VQ4S 4O44A 1GEHA 2Q1LA 2D41A 1A9NB 2X7IA 3GJTB 3CPWR 4DV3J 2UUCJ 1RT2B 1SV5A 2BE7D 2J0XA 2ZITA 3W64A 4UY8T 2JEIA 4LVOP 4C3LA 2N82B 4JI8F 2FJWA 1RTIA 2DNOA 2GVZA 2B4VA 5IC4B 1RWNB 1MROB 3FRZA 4HT5A 5GMDA 3TRGA 1SL1A 1NJZA 2GAHC 3BGRA 3M8WA 1X5PA 3Q8UA 5K8MA 5HL7Q 1UZDA 4X4TA 3PFOA 2JSXA 3PCOB 3QT5A 3CSKA 2DR9A 2RDIA 1MMDA 1NHVA 3GG1A 4R0EA 5KFYA 1CC7A 2OUGA 1Z4UA 3JYTB 3HM9A 1WI8A 4IO9Q 4M8LA 5HQ8A 2OEMA 1HMVA 2B51A 4G1QB 1FEEA 4OZ5A 4DV4J 2XLJA 2ZH2A 4NLUA 3CCLS 2F4VF 2FIUA 2ZBRA 4ZLNA 5IZHA 1HBMA 4K4TA 4AL7A 4ANDA 2E5JA 3QGGA 4JV0A 1E6YB 4LFBJ 3D2WA 2MKJA 5B0AA 3CCJS 4FF1A 2BJ3A 2FGOA 2HZAA 4ZCIA 4C8ZA 4EO8A 3R97A 1HBNB 3JAMY 3THPA 3GJSB 3GFYA 1VBZA 3TZWA 1HBOB 3CWJA 5EUHA 4DF8A 4K4VA 2JEJA 4ELUA 3C2PA 1FVSA 4KHPF 2LQ5A 1FT8A 3F44A 3J7YU 3NWGA 5IM0B 4RW9B 2NZ4A 4IFVA 2BOPA 1HWUA 1U0HA 2J7UA 3K17A 5KG4A 3PKYA 3JSBA 5KFOA 2W9CA 5KTQA 2NCKL 3TQ1A 2V8PA 3KG0A 2K06A 1YGYA 1Y00A 2ZC4A 1QTNB 1TMJA 2MTLA 4AYBD 3OFHA 2VFUA 3ITHB 3FCWA 3GIRA 4KPCA 2ZDOA 1PILA 3CDEA 4NLDA 2GVDA 3DLEA 4LREA 1S6OA 5D8HB 4WYWA 1S57A 5GVQA 5HMXA 1N36F 2IYGA 3QO9A 3B6BA 2MYFA 3T3FA 1WC0A 1YBUA 4ED1A 1BQXA 2IJRA 4B3TF 3M8ZA 4N8OA 2FC9A 2YH0A 1NM2A 2IM3A 4P6QA 3CGIA 3JSMB 3QPIA 4U8YA 4DR2J 4A46A 2RH3A 3MEEA 1B7FA 2MZTA 4IKAA 2C1EB 3GLJA 2BVZA 2HBZB 5CCMA 1R0AA 2JL9A 2C2RA 1AW0A 3EXYA 4AL6A 4DXLA 4X4PA 1XNQJ 2A2CA 4FYYB 1UEUA 4RW4A 4L73A 4G65A 3OTDA 5I3QA 1NDKA 5LJ5Y 4Z7YA 5HANA 4JI7J 1SKWA 1X4FA 3H5UA 4NLYA 1C0UA 2VPXB 3K89A 1RT6B 4L76A 4U9RA 4ECVA 3ZTRA 2CNNB 3HHKA 5IFMA 5I4MA 1VQNS 3CE8A 1F2HA 4NCGB 2BE2A 4MYTA 3HSGA 4Z2XA 1S7HA 1H72C 2N4DA 4O3PA 3MEGB 2BYCA 4DSJA 5LSOA 4AQYF 2I5JA 2M7SA 4CI0B 4F67A 3B54A 2FVCA 3UR3C 4CYUA 4C48A 2OD6A 4RW6B 5D6GA 2XO6A 1S0OA 3QMQA 1HNWF 1S1TB 1PJ5A 1TK0A 1HNIA 2CADA 2RNEA 1Q86T 1YJRA 4MT1A 1RXOB 1HI8A 1RAFB 2Y0SD 2ZH9A 4JI0F 2P9EA 1U4BA 4DWIA 2DHSA 4OZ1A 4NA3A 2A3JA 1HI1A 1C1CB 5FDLA 4M5JA 3T9ZA 3G6ES 4DV6F 4EBEA 4OJ3A 1Z2LA 3GSDA 2HHTA 1SL2A 3FUYA 4ETZA 1NDPA 4C8OA 3VGSA 4MKBA 4XK8C 1GXUA 1JLCA 5KAKA 2QGFB 3MOJB 2DK2A 3LW5C 4CWBA 1KNZA 4MK9A 5C42A 1DFDA 3DM2A 1RLDA 1VJWA 3FDSA 4L3KA 2VJVA 1N32J 4MIAA 3D6TB 1OSDA 3R5JB 4O3OA 2M2BA 4RUBA 3Q8SB 4GO5X 2RQCA 1U1MA 1M5OC 2VDIA 4DSLA 1GFWB 1QM9A 4P2MA 3AQPA 1UA1A 3W63A 2BKOA 1S99A 2QLJB 2ZHBA 3MMJA 1HA1A 2R3VA 1JX4A 1OS5A 4OJ1A 3US5A 4DR2F 3B8HA 5D3GB 3M30A 2DGVA 2AZ3A 4ZP6A 2M70A 4ZJLA 3W66A 4NXMJ 4HR2A 1S59A 1NUEA 3FZ2A 3KMSA 1UW4A 3GIKA 1MWQA 3EGVA 2CNOB 4UOGA 1NDCA 4QIEA 4UOCA 4N7TA 2ZHAA 3NGUA 3SV3A 2SXLA 1L3UA 4OL8A 1YVFA 1T3OA 5CYMA 2VQFJ 4F4KA 4QYZK 3QGIA 4USKA 1FESA 4CLLA 2V4JA 2FJVA 2W2MP 2OFHX 3AXMA 1X8DA 2L9WA 1O6XA 4R25A 2JNJA 2E5LJ 1EHWA 2XSJB 5BR8F 5F0UA 2XHCA 1IBCB 2H4YB 2OHDA 3J7A1 4X4RA 3IRWP 4OIXA 2RRBA 1F9FA 1RABB 1GTEA 2HVZA 1NXIA 1FFGB 2H5EA 2WONB 3P4UB 3JQJA 2G0CA 4NRUA 2VU5A 3DM2B 4B17A 3O8WA 4LRAA 4PXEA 5KG1A 2KZMA 4ZVFA 5HQLA 1RAJA 4UZBA 4NZ6A 2V4JB 2VFSA 3ILOA 1SJ4P 2C2MB 1JLGB 1RWPB 2Q6CA 3KLIB 4FZVA 2JOQA 4WFYA 5D78A 2BV3A 2GO8A 1YRUA 2CXEA 3EJMA 3H2UB 5T7LB 1U47A 5ADZA 5CZVA 1ZAXA 1D9DA 1CULB 4OHWA 4PWDA 2FHKA 4NEYA 3VZHA 2MKYA 4U95A 2JLGA 3NCQA 5AXMA 2PDAA 4ZN3A 5KFSA 2IBKA 5CZXA 2HNYB 4PG5A 2WSCC 3UDCA 1NPKA 2DNRA 3ZTSA 5EGYA 4DUYJ 3V4IA 3DLBA 4JI2J 4ICLA 4X64F 2HRUA 2KT5A 4BBYA 1JJCB 4DS4A 5CH7B 3GMGA 4QWEA 2BE2B 2YX7A 4RPFA 1WACA 4ID8A 2Y1IA 4RBTA 3RJMB 3GYXB 3IG1A 1T9VA 4GO7X 2YKOA 4IDKB 3U1NA 2D3ZA 4DS5A 2C2NA 2EK6A 4R0JA 1KVJA 2EI5A 4TNOA 2HNZA 2Z0GA 1TELA 1LWEB 1DAXA 5B7WA 3R1LA 1IBLF 4NRTA 2OMLA 3GU0A 3NGSA 2DRAA 5L9XA 1VYAA 1ZOTA 2E1AA 3SMZA 1RK8A 1OSCA 4CYUB 1P8GA 1CS4B 2B8PA 2CJ9A 1DARA 1NHKL 3KFWX 4FNIA 4DQRA 5I42A 3RB3A 1C0UB 1WF0A 2RQKA 2K8GA 3X3UA 4ZP8A 2MJUA 4CO1A 3ADAC 3W7BA 2DYAA 2E9RX 4O4RA 1PBAA 3HI9A 2HS0A 2AV5A 3QIPB 2DHAA 3TUIC 4A8OA 2HYIB 2NYHA 1Y10A 4FPRA 4YB5A 4F2RA 4BCAA 5H9EJ 3ZO7A 3PRDA 1L3TA 2QEXS 1X60A 2Y8YA 3K5LA 3G2XA 2ACMA 4FPIA 3GR0A 2PSZA 2BQ3A 2QSWA 1UMJA 2PGCA 2EFPA 5I42B 2ZH1A 2Z2LA 1NEEA 2ATCB 5RUBA 4JV1A 1H7XA 4B3MF 1IBKF 4NL5A 2X51A 5HMWA 3V6DB 4C8LA 2K3KA 5A0YB 1TKZA 4C8YA 3R5GA 7AT1B 2HHHJ 3A4TA 5A8RA 3TUJC 1PAUB 3FCHA 5C2GA 3FZBA 4GRSA 3HLUA 3QLHB 2HGMA 1P1TA 2AZ1A 2B9YA 2R7OA 4RX6A 4RUHA 5J1EA 1UCNA 2C2DA 1NJXA 4UUXA 2MQ8A 2KFNA 5BXIA 1SUQB 3UD4P 2CQBA 4L3NA 4U96A 2Z2YB 1NH7A 5D4LA 1UFLA 2CQ2A 5J2QA 5GAHU 1L3VA 3GZ7A 3EGZA 1SKSA 4K2JA 1C4CA 3CNQP 3QWPA 3TJAA 5DQIA 4DFMA 5CHCB 1PGZA 1UVLA 3QJPA 1WSVA 1YRXA 2CQPA 4OJGA 4RO0A 1B64A 4M5KA 3ONQA 3PFEA 1OYEA 2BJ8A 3M2VA 4M5NA 2DIVA 3HO1A 3M8SA 3VV2B 3NMRA 3HXMA 2XB2D 5D0GA 4ZITA 2UUCF 1VLOA 2L3MA 3HSZA 3ZXWA 1SUQA 1N0UA 2KZZA 1SXLA 2DR6A 2VB6A 1OQ6A 5JXSA 2L41A 3RRHA 2HIYA 5LXRA 4F50A 4H4KA 1VQOS 4CLKA 3O3LA 1F5AA 4DZ6A 4YHHJ 1S1UA 4GKJJ 1LWCB 1WC5A 2QMWA 3MF5A 3QQCD 3NCRA 4G1QA 2C3PA 3BR9A 4B9LA 4NLWA 2DH9A 5JMNA 5HO4A 3TJ9A 3LWLA 1GMUA 3PACA 1LFPA 3HHDA 4RZRA 4DQPA 2N7CA 1QUVA 1NK0A 3HJFA 3ETOA 1J27A 4Y65A 2GGPB 2CPZA 2UUWA 4TU7A 2WB4A 2NUUG 1VJQA 3ENQA 3IS9B 5B0EA 3D4JA 3AY0A 3QAEA 2DCUB 2E5IA 2PN6A 4O0IA 4RU9A 4ZDNA 2XLKA 4TKTA 4QPTA 4CH7A 1N33J 4B3MJ 1TKTB 3OSPA 1I5OB 2ILYA 2L9NA 3IFEA 3AXKA 3FMWA 3TNVA 1SC3B 3HHEA 2G1DA 2JLFA 4FBTA 5K8NA 5KT5A 3PJ9A 3QWUA 1HHQA 4LR9A 3IMQJ 3T6JA 4QWDA 3HCXA 4TLRA 2YKPA 3DNCA 3PY8A 5DGAA 3B4DA 3IM9A 1LK7A 3M30B 2W9BA 1S1WA 4DL5A 3IC1A 3ZZUA 3G82A 1Q79A 3I31A 3Q2TC 3MPWA 4Y3CA 4EU0A 2CJYB 3VQSA 5HVGA 2W8LA 1YRTA 2RSQA 4ZVQB 1M1GA 2LECA 2ZH5A 5CYMB 2XY5A 1D3WA 1M1KT 3PX0A 3W3SA 2J0SD 2FLNA 2AJFE 4WK3A 2RF2A 1WDDA 3MUVP 4Y2MA 1MSWD 1WF1A 1VQYA 3BSCA 1YX2A 4IRKA 3MCSA 2E9ZA 4WFNQ 3KHLA 3PW5A 4LVNP 2ZM6F 3DLJA 3UR0A 1FXLA 3THTA 3PYFA 1WG4A 2JX2A 1XEZA 5L46A 3OTOJ 2OPQA 5KT7A 4P52A 5KFHA 1HBUA 2FVRA 2RUSA 4OZ2A 1XN9A 4KKOA 4B3RJ 5HJXA 4WKYA 3PR4A 2ZC3A 2ZNYA 5DO2A 4H4KC 1TL4A 3HZEA 2AYMA 4A8WA 2ZZTA 3OT9A 2E1PA 1WTFA 3L9ZA 3LWMA 1M5SA 3KLGB 4PXBA 2MSTA 4DV5F 1ICEB 4WU2A 2J7WA 1IQZA 2V68A 3SYZA 4CLPA 2KM8B 4OV6A 1L5UA 4P9SA 1CG2A 1ZBTA 1XR6A 2NXEA 4ZKAA 2ZH7A 4A8QA 2GCFA 2R4FA 4KR0B 1U1QA 4G6VB 3IWNC 2ADBA 1M1HA 3BYRA 1HHSA 2CRLA 3MECB 9ATCB 1T8EA 2OPRB 5HMYA 3HFZB 1VBXA 2QMUB 2YKMB 1URNA 4WIIA 1S6PA 4ED7A 2KB2A 3DDNA 4IH6A 1HNZF 2RQMA 3BR8A 2EC2A 3MPDA 4M5HA 1BMQB 4ITSA 1RTHA 4ZCMA 4NZ0A 1Z2ZA 4CTAB 1R7IA 2OPSB 4DV6J 2ZOGA 2QA4S 1HYSA 1JLQA 2AJ2A 1WELA 5M2RA 2X3DA 2RRAA 2Z57B 4ZVUB 4K50A 1TL3B 1FWPA 1DTQA 1CJVB 2FDNA 2QYGA 4PR6A 3PX6A 1VIOA 4LF7J 4DL7A 4TN2A 5DG7A 2N4CA 2A18A 4X4VA 2ZH3A 4I6YA 4JYAF 2UVUA 5J2MA 2CQGA 3MM6A 3OR1B 5D0RA 1C4AA 1WG5A 1X0PA 1URRA 4DSEA 2KXNB 1YTYA 1S10A 1UJ6A 4KV8B 3H40A 2WVDA 4FF2A 4J9PA 2QA4G 3DLHA 4TYAA 2W8KA 1OQ3A 3HHLC 2XMKA 3MMAB 3G96A 3BPDA 1E6VB 3N0VA 4NOHA 1NMEB 2B9XA 3CTRA 1MROA 2F9JA 4F04B 2LMIA 2FVSA 1W2IA 2OGUA 4IG3B 2JC1A 4LSLB 1T0TV 4DG1B 1RTHB 1HARA 1N5QA 2VPYB 1KC8T 2VONA 5AXLA 3I9V9 5AJ3F 4IQXA 2DNZA 1AFJA 3KLFA 1GMWD 3F41A 2HFOA 4M1KA 3DRSB 3J7Z5 3R5BA 2HLUA 4A48A 2IAJB 1PKUA 2QLFB 4LSNA 3WHIA 5KFUA 1HBMB 4J9UE 3W2VB 2HHQA 1U2CA 3CMQA 2D9OA 1UA0A 1WC3A 1SPBP 4ED4A 3NRBA 3AJ2A 3NGDA 4LFBF 3AAWB 3HVTA 3EWGA 3TVKA 2P2CB 4K4YA 3SXLA 4X62F 1TQLA 4OI1A 2BR0A 5IS2A 3M7VA 4MKYA 2WONA 1N56A 2IM0A 4IOAQ 1J5EF 1FKPB 1V3ZA 1RTZA 5AE2A 1S6QB 2XY6A 5JVGQ 2FPHX 3CO9A 3J7YI 1FJCA 2IYIA 3U1MA 3EUNA 3UWTA 1VI7A 4E0DA 2HFSA 1UPPA 1ZYQA 1FNXH 1YBAA 2AWZA 1RBLA 2OPQB 3BH6B 1S76D 1KP6A 3DXBA 4ZMMA 3OL8A 1FX4A 4DV2F 2DCLA 4DX5A 2OSRA 2H5IB 5HVHA 3CJ3A 1RU1A 4ZHRA 5A2QU 1TUGB 3MCNA 4EYHB 4OYMA 4X66J 5K20B 4RBVA 4BHQA 3J81j 5D4OA 3DRSA 1RACB 3LAMA 2UVWA 2ASLA 4NCAA 2BJDA 4QYRA 3D0HE 2E66A 4RJVA 4C6AA 3OJUA 4OX9J 4B3OB 5DDOC 4C98A 2VPWB 4USMA 2V34A 1B70B 3IR5B 3TANA 1ELOA 5HMZA 2YWWA 3QIDA 1YJ7A 3CXCR 1JXVA 3PX4A 1UVJA 1DJ0A 1O51A 3M32A 1WF2A 1U8WA 2I9SA 4KH0B 5GADU 2UUAF 1U2RA 3FSYA 1WDTA 1SKUB 2YNHB 3KLEB 2VPZB 3U7JA 1WKKA 3NY0A 3BS9A 4HI1A 1OMSA 1N4LA 4LF7F 2ZDPA 2NXNA 1QVFR 4RW8B 2DH7A 2FHOB 1I1GA 4JUZA 1HPZB 2PI5A 3JSYA 1RYRA 2WSFC 3JSRA 2VHGA 1HWIA 3ENVA 3H2VE 4ZPAA 5J2NA 3PO5A 1KFDA 4KSEB 2W2QP 4LIWA 2DGSA 4LRFA 5ETVA 2HFVA 3Q8YA 2KU7A 2Y0BB 2W2PP 5DDQC 3HT3A 1PIEA 4QWAA 1UWBB 1R0CB 1F9HA 3SCLE 1TKXB 2ZH6A 5HLFB 2GVZB 3BKUA 3CIMA 3RB4A 3GYNA 4LT6A 5KFNA 3W9IA 3UFCX 2ZJQQ 1DQ9A 1GT8A 4K5SA 2H9ZA 3VAIA 4F02A 3PYGA 3RUBL 2O3DA 3K5MA 5J2MB 4ED0A 2RKIB 3JQKA 4WKRA 5A8WB 1WORA 2CNKB 3HVWA 4NLVA 1ZA1B 3DOMB 3K2YA 4DV1F 1NB7A 1NLKL 2RB7A 4YR2A 2J9CA 2B6AB 1B0PA 1PC4A 1RT4A 2PMHA 1MW7A 3V4IB 1A0OB 1EETA 1F9EB 1YJTA 3AD7C 1FDNA 2YNHA 3PHTA 4PXDA 2CJBA 5LM7E 5KFTA 5F3ZA 5KFCA 1T05B 1C0TA 1UVNA 2IA6A 3D5MA 3DOKB 2OAUA 4QBUA 4ANCA 2VBXA 1IUJA 1LW2B 3EICA 4ZPCA 5KT2A 3QJLA 2VJUA 4RR5A 3ISNC 5J2NB 3MM6B 5KFFA 4Z37A 4Q8EA 1RBAA 5KG0A 3A8KA 4C8MA 3H0PA 2NZCA 1RT1B 2DXEA 1JXEA 1ZM9A 4TY9A 4QJVA 3A1YG 3FBCA 4XIUA 3GR1A 3QRPA 2QFIA 2XO7A 2A0FB 2LLZA 1X0FA 1SH0A 5GADI 4NLTA 4LUBA 2QLXA 1WI6A 1PYOB 2CQ3A 4DV0J 3VAGA 4KIAA 1U1RA 2VFRA 2IRXA 2LQJA 2YPZA 4P71A 3R2DJ 4HI2A 4F0HA 4KT0C 4DUTA 2EC0A 1APSA 3C6TA 4YB1P 3NNCA 2FUG9 3IM8A 1WHWA 4MK8A 1UVIA 3R7NB 2HHPA 3B78A 3CCTA 2QN6B 3R7SB 1FKPA 1YLXA 1IWGA 1Y3JA 1VC0A 5MLCV 1UAWA 3EYZA 2CA9A 2E7XA 3PIPQ 3FSXA 2CZ4A 2C2EA 1KONA 1Y9OA 1IBKJ 5LJ3Y 4K59A 2VV5A 2OELA 1HNXJ 4URGA 1KTQA 3K8VA 1FRHA 4AL5A 1NZ8A 4TYBA 4ZS6A 3FEYB 1IM6A 3HKWA 2EW9A 4HDHA 4K2XA 4CH0S 3RBDA 3KJVB 1ITPA 2KVQE 4UOHA 1FNMA 1FFSB 2X1BA 2X3GA 3OD2A 4V1Ak 3Q8PB 4IH5A 2GX8A 1IKYA 1JLAA 3S7RA 1ZZFA 4WFZA 2VFVA 3VVTA 1Q8BA 3I6PA 4LF2A 1IWAA 2QL5B 1Y5NB 2HQFA 3DU6A 2YKNB 3POTB 4B9VA 4K5RA 1CVJA 4QPXA 4B02A 4X84A 4LSZB 4YOEA 2QIFA 3QFWA 1E6VA 1KR4A 1GX6A 3C8YA 3D28A 1FNOA 4C11A 3GIMA 2HZVA 1U0HB 2CG8A 4Q2MA 3QSYB 2M3DA 2RF2B 3AJDA 1HL6A 4LRDA 2BJ9A 1YJWS 1NKBA 1IBMF 2RE1A 2XQCA 1HR0J 3M6VA 4LR7A 1VC5A 3NOCA 1LXNA 4YN3B 5E3AA 2D9PA 3KLFB 4A8YA 5F8LA 2CAJA 4F26A 4DQSA 1Q8LA 2R8IA 5E3CA 2J7KA 2KXHA 2B4PA 3CVKA 3FRYA 5IWAJ 1AB8A 3OUYB 3DRYA 2EG1A 2YKNA 4K4SA 5HLFA 3M2RA 3LP1A 1WNEA 2BM0A 1RT5A 2QE5A 2QLWA 4Q0BA 2DEIA 5JJBA 3TUPA 1JWWA 3BREA 4JV2A 1RWUA 2UUTA 1LW0A 1WG1A 4ELTA 1S0NA 3R8YA 1Y7PA 2AQ4A 2G0JA 3N4WA 2GC8A 1KQGB 3DN9A 1N5SA 3BF4A 2ZKUA 3PW7A 2YTCA 3MTKA 5GMKa 2R7XA 1TTHB 2LEAA 3E01B 1Q5YA 2HNDB 4FVCA 1YWXA 2BRLA 4L74A 4LRBA 3BO4A 1S79A 3VGVA 3ZNUA 4C11B 4ZP7A 4DV5J 4K7QA 1GAOA 2HMIA 3CJQA 2PMWA 4WPAA 3MECA 2ABYA 2O66A 3BV8A 3MM5A 2NXUA 5DM6Q 5ETNA 3MM9B 4F3OA 1VQ5S 2JWNA 2B43A 2QV6A 1D8ZA 2XGPA 4DV0F 4DX7A 3MPVA 1VQSA 1U6BA 2YNIB 5CQGA 4Y00A 3A13A 2XMAA 2GIQA 3HSDA 4O44B 2EXUA 2L9DA 5IWAF 4KHRA 4LF9J 2R9LA 4DCPB 3KYLA 5ETQA 1NSKL 2F65A 3IBWA 4WK1A 1HNZJ 4Y2CA 3RW7A 2VOOA 4BWJA 4I7FA 3ETMA 4OV1A 4ZP9A 3QJJA 5H9FK 2GS8A 5E0OA 1RQ0A 3NOGA 2NUHA 2V2VA 3OXLA 4NWBA 1DY3A 1FTCA 3AHPA 1YJVA 2BA9A 1DRZA 3UQSA 2OTLS 1IBMJ 1Y4ZB 2QTWA 1QSLA 4H4MB 1VQ7S 3J80U 4ZA1A 3M9NB 1FE0A 5L9NA 1YBTA 2GIFA 1NSAA 1T02A 3EZOA 2Z2MA 3V81B 1EKRA 1FRMA 4CO5A 4CT9A 2EK1A 3BGFA 3SQOP 3H90A 4FDFA 4P72A 5IT4A 4C3MA 3DRRB 1T9WA 5B0CA 2Z56B 1X31C 5IV4A 1RYSA 4HACB 1WC6A 4HHJA 1PC5A 1UPMB 2BQRA 2DO4A 1JLCB 4KKOB 5F9NA 2ZD1B 3G6XA 3L95X 2V9KA 2YKAA 1YG0A 3WIVA 2XWXA 2MEWA 3K5OA 5SZTA 1HD1A 2F8HA 2GMLA 4OYOA 3MZIA 5DS7A 6AT1B 3EXCX 1NZAA 1F5BA 1S72S 2GJIA 4HTJA 2HWIA 2X1FA 2DGXA 2LKZA 3CCZA 1I94F 3J81U 2KO1A 4DLGA 4PRFA 1Q78A 3MHYA 4OYIA 5DQGA 4NLOA 4I1TA 4PZVA 4BLGA 5A6WA 2HURA 2VASA 1Q16B 2VBZA 4K4WA 2VC1A 4QW8A 1DZ5A 4LF6J 1RT4B 1PJ7A 3D54A 3D3BJ 2HFUA 2J76E 3KJNB 2B4UA 3M2UB 4JI6F 2YQ1A 2HQDA 1RTJB 4U6PA 4EI2A 1PG5B 1FF2A 1LWEA 2EWHA 4IOBA 2R2TA 4DLEA 1WJ9A 5H9EK 4I56A 5E41A 3EVMA 1IKWB 4MK7A 4UW2A 1IXKA 1BD6A 2KDOA 3UDEA 3K5NA 3IR7B 4ECWA 1EZZB 5DM7Q 3IN5A 1UJ4A 2QG9B 3BYPA 2UUBJ 2QO3A 1NPRA 4RW4B 2FY8A 1RT5B 3F56A 2DISA 5K5MA 1SIWB 2MQPA 4TU8A 4TU9A 1DTTB 1JLEA 4MFBA 2QJ3A 3CUNA 2IJFA 3M8QA 1BXNA 5KFVA 1VQKS 3OUYA 1HQ2A 3CJ2A 1TL3A 3CD6S 4DCJB 4FKYA 1XNQF 1FDDA 1HWJA 4C3KA 4U7UK 1TL1B 5C2CA 3H4DA 1CJTA 1OIAA 1NSPA 2Q43A 4J9QA 2V9WA 2M8HA 1S77D 2GGPA 2ERRA 1RTDB 3MGJA 4MTPA 5E3PA 2KH9A 3D0IE 1JLFA 2D69A 1XMOJ 2WVBA 4B3TJ 2OMOA 4PWUA 4DV2J 3PYDA 2LXUA 3ET6A 4PXCA 3LGNA 4EBCA 5AXKA 2LYVA 2BJ7A 3OW2R 1TKTA 3SSRA 1N5YB 2HG4A 1U1LA 1WOSA 1WC4A 3RAQA 3LAKA 2FZCB 2HNYA 3T9NA 4C0OC 4ES2A 1XQIA 2M9KA 2HVEA 2Q3PA 3HD2A 1FXRA 3M32B 4P73A 3ZNJ1 3HPOA 1EQ0A 2ZKTA 5H9FJ 4UT4A 3ELHA 2B4OA 3NXZA 3H4BA 3TO8A 2CDQA 2C3OA 3GSIA 2MQQA 2H48B 2WW4A 1B0VA 5DETA 1RJJA 2DNLA 1VRTA 3MPUB 2RHSB 4WE1B 2NPIA 4C97A 4WCEQ 3BGLA 5C24A 4E8UA 3G82B 4RU2A 3MR7A 2ZH8A 2DHHA 2AD9A 4PG7A 3EVOA 3KHHA 2KN4A 2YNFA 3OFEA 4HTIA 2V5HG 1AA1B 1B0TA 1LKZA 1C1CA 3DOLA 3NGRA 4J7CA 2HVIA 2RUGA 4LSLA 4DPTA 2B7BB 4N5SA 3K59A 2QMXA 3DYAB 4RNFA 2MKCA 2N3OA 5DG9A 3IRXA 5K14A 4Q43A 3NLCA 2DD8S 2ROEA 5LMNF 1HBUB 1MWZA 1QE1B 1X4CA 5KFAA 2HQ3A 1NK5A 4MIWA 3DLGA 2JC0A 3POTA 4A8MP 1R89A 2MLZA 1REVB 4M5DB 4F4YA 3AQOA 2EBEA 4PG8A 1RHQB 1BQMB 4UF4A 3KLHA 1JKHA 3RBXA 3IGVA 2F4VJ 1YK9A 2VUGA 2R7WA 3JB9k 1RAHB 5A76A 5EDWA 3CF5Q 1K1SA 3I4HX 3ILLA 2DGOA 3LP1B 4X66F 1U1OA 3MMBB 4P2FA 2MKHA 3EPIA 5JVHQ 3OHAA 4F2SA 3K8WA 1CJUA 4B9UA 7FDRA 4AE5A 4CLZA 4ILLA 1SJQA 1TR0A 1CBKA 1CJVA 1TU0B 3HF5A 4XPEA 3BO2A 3OLBA 5ETTA 2C22A 2HHVA 2PT0A 2PEHA 3EDRB 4ECXA 4F4ZA 1SJFA 4OI2A 3OJSA 3DRRA 2EPIA 1R8AA 1S1TA 3MR2A 1C0TB 4JI4J 3LGHA 4N8NA 2RHQB 3KJQB 1NU4A 4O4GB 3MDFA 5GAEI 4OZJA 2GHVC 4JV5F 4FXVA 2M5YA 1HKAA 4P2SA 1RWXB 1T9XA 2JVOA 2C2KB 1HYSB 2ATLA 4B9TA 2XMWA 3LPEA 3MM8B 2I2YA 3MMCB 4IG0A 4DR4J 3S8SA 1EKSA 4DL3A 1RBOB 1N0VC 4OI3A 4OZ3A 5HP1A 5F0WA 3D3CJ 3KG1A 3QLHA 5J1EB 2YH1A 3HFKA 3WIUA 2EKNA 3TUZC 2CUYA 2CFXA 4LQ9A 5KFWA 4OX9F 1CEZA 2DPIA 1ZM2A 1M5PC 4ED2A 4B3SF 4QWCA 2GFFA 3CDBA 1YJNS 4OHYA 2HNZB 4F0KA 1P1LA 4DBQA 2EFNA 2XYGB 4XAKA 5KFRA 2ADCA 2B8QA 3FVYA 5DZ6A 5KFLA 4OYBA 2PEBA 1Q0NA 2HK3A 4FYVB 3PM9A 1JXLA 4ZN1A 1AUSL 1N6QB 2NXJA 3GE9A 4KO0B 2ZJRQ 3I5CA 5IT9U 4K4XA 4TXSA 4NEZA 1EQMA 1QAXA 2D1CA 4NLPA 3SEOA 2VODA 2ZH4A 1OY8A 3CDAA 2PC6A 3LQVA 3OVBA 1TK8A 4IUFA 1VDHA 2WOMA 3M6UA 1RWMB 4HACA 1N33F 1AT1B 1RTDA 1VMBA 2BJEA 3BBCA 3TA2A 4JI1J 1XMBA 2C3YA 4DR4F 2YQ0A 4Y6IA 3RTVA 1M90T 1NH8A 5LMNJ 3VAHA 1IM4A 2IAJA 4P7TA 3C16A 4OZ0A 3QO9B 3TJ8A 1U02A 2NLWA 4QIVA 3S01A 2CDRB 3UCGA 1U1NA 3CJRA 2AKWB 3Q86A 1QD1A 5GAGI 3KJFB 2KG0A 1WHYA 3UD5A 2W9BB 1JLGA 2D74B 2BUNA 4CLUA 4NXNJ 1KQFB 4S0MA 4M94A 3SDEA 1DLOA 3BGUA 3O5TB 4PABA 3FBEA 1BWVA 1OPZA 3CJ4A 3HKZD 5IC6B 5B0DA 4DDFA 3WX4A 4ZPDA 1Q5VA 6FD1A 2MZ1A 3Q24A 4DR5J 1YSJA 4IR9A 2KFZA 2AJQA 5D4NA 1S6QA 2V67A 3KUEA 3M6WA 2F9DA 1KHVA 4WIQA 2W2NP 3W1YC 3WQPA 1PO6A 4KV8A 1N5VA 2AU0A 1UP1A 2OSQA 2W24A 4USHA 3I0RB 1DLOB 1D9AA 4FYWB 2W4DA 1IJEB 1RHRB 2CWXA 3D9BA 4M5LA 1XBWA 3R9LA 3MEKA 2E1MC 3Q8VA 4MJKA 3D67A 1HQEA 2ZWOA 4RUAA 3DI6B 3DRPA 3AD8C 1IKWA 2GMJA 4TQSA 4O3NA 4ED6A 3T5LA 3D1OA 2ILZA 4K8RA 2L48A 1B4SA 3WX8A 4IFYA 4JV5J 1N52B 3UCZP 5G0RA 2MZRA 2CVEA 3M8RA 4DR1J 3JAMU 2GA7A 1CC8A 2RD5C 2VG6B 2QA2A 2YX4A 2IDLA 2QC3A 3GJQB 4B3RF 3MAAA 4YQWA 2MJNA 4KB7A 3CB4A 3LGMA 4DSFA 1EARA 3P3DA 3TEGA 4ZJQA 1JB0C 3IWLA 2FJBB 2PA8D 3A3NB 5CD4H 4D3GA 1QTMA 2ZHOA 4J9VA 2EKYA 3OVAA 5FJ4A 2B9WA 3DHXA 3MM7B 4MKVA 3GIIA 1D9FA 1F6TA 4Y34A 4UQGA 4DQQA 4JI1F 3R1HA 1ZPVA 2UVRA 1FK9B 1SI9A 4UOFA 2CJXB 1X4DA 3I0RA 4J9RA 2FGCA 2MKIA 3JQMA 3T41A 2C2OB 4WF9Q 2JFKA 3FFIB 1S1UB 3EM1A 4J9MA 4L6V3 5C24B 2G2YA 3MR5A 4HLBA 3W2WA 2Z2ZA 3FEZA 2K7KA 3FCVA 2ZBCA 5M2PA 4FP9A 4NXMF 2HHSA 2FY1A 3TW0A 1TFWA 1F2GA 2OFGX 1OJ4A 4NYOA 3V2UC 3BN7A 4YEAA 5B08A 4DR5F 3SZ2A 1TKDA 1G1XA 1S4EA 3GB0A 2F8MA 4DI6A 4DX6A 1ZETA 3VCDA 4F0MA 1K44A 5CAAA 5KG5A 4QYZJ 2ZBIA 3GCWP 2LQ9A 2DR8A 2C2ZB 5KG7A 3N01A 2DVIA 4KO0A 5D4PA 4ECRA 1RE1B 1TV6A 3TX8A 4GKKF 3QIPA 4OYZA 2BDPA 2HVHA 2V8HA 1U49A 1LV5A 3AOBA 4NPOA 5HATA 1FD8A 4OX7A 1NNDA 4MIBA 1SVDA 3TAMA 4I2QA 1V9OA 5L39A 1U48A 4PQUB 5HN0A 4NXNF 2YQ3A 2MQNA 3NAIA 3UN3A 3NL0A 4DG1A 1BHNA 1KDNA 1EAYC 1MN7A 1PAEX 4QR0A 2EVZA 4ES1A 4A8SA 2FHMA 1FKOA 4DUZJ 2CQ0A 3D6MB 5K8PA 2V4QA 2O5DA 2FJAB 4CZCA 3B82A 3G8SA 1M5HA 2Q79A 4M63A 3TVZA 3DLKB 1M5VC 1FRKA 3KDOA 2CPEA 3C15B 2JEGA 2IRYA 1WTBA 3CO0P 3CT9A 1VQLS 4G1IA 3W9HA 3C6TB 4A8XA 4CM0A 4RNMA 3VAFA 2DITA 1JNRB 2IM2A 4U67Q 2VBYA 2LVWA 2DGTA 4OI4A 5HQMA 1JLFB 2RT3A 4I64A 4GC6A 4M5GA 2XMVA 2R42A 3C3LA 1LXJA 2HGNA 5AE3A 1R31A 3U02A 3G71S 4O4GA 2R2UA 4E2FB 1S1XA 2MSSA 1ZA2B 4KAIA 1M0SA 2FVPA 1HQEB 2UXDJ 3RB6A 2HRTA 1BGXT 3T6BA 2FJDB 3RW6A 2LDIA 1BWEA 1HIYA 2HVDA 4TY8A 1JLBB 4GMKA 2M0GB 4FS2A 3O2IA 3PDNA 2BANB 5IV3A 2OH2A 1RISA 2YKMA 2QA1A 1TP7A 4USIA 2KYZA 3AOAA 3UVJA 2LDYA 2ZUGA 3AD9C 2RQ4A 2DXDA 3N6NA 4KGVB 3DDKA 4XDDA 4ZVOB 4DFJA 3PW0A 1J5OB 4BC9A 3PO4A 2B3TB 4ZHRB 1UFWA 1KSPA 1KWMA 3TP2A 2CPIA 1WKLA 2MGZB 2NYIA 1R27B 2PD1A 3AJ1A 1YHQS 4IRDA 4F4WA 4HKQA 4WZQA 2UXBJ 3MAAB 1NAQA 3IRXB 5K14B 4JI3F 1TVRB 2V94A 2VG7B 3C14B 1X9SA 2R7TA 2YY3A 3PHEA 3MM7A 3GV5B 3TA1A 5KT6A 5ETPA 3GV7B 1LK5A 3DC2A 2K1RB 2V2ZA 2LA6A 3BSAA 3CCWA 3I5AA 1HR0F 2F7VA 3ISND 3ULHA 2ZM6J 1QY7A 3ILIA 1H98A 1RT3B 1S9EB 2P8IA 3I32A 3QBCA 4ZVTB 3CDUA 5F8JA 4U7CA 3D6FB 2RU3A 1FWLA 2R7SA 4C7QA 4QWBA 2LA4A 2XMTA 4RWWA 1REVA 5F8IA 5T7LA 4CRJA 3TZXA 2QT7A 3R6LB 3TI0A 1QVGR 2UUBF 2HHHF 4NA2A 3KK1B 4V19J 1CULA 5A8RB 4O3SA 3Q23A 3LP0B 2AEFA 4Q7AA 4YR0A 1NDLA 1K47A 4DPOA 2VDHA 1A7GE 4Y2IA 3C6UA 1TL7A 1IKVB 1U8SA 1VK8A 2W7AA 3FKBA 1RT3A 3HVAA 3KWMA 1T94A 1IR0A 2CJAA 1CJTB 2RS8A 1NK8A 4MAKA 2CNLB 2DNGA 3GONA 3QT7A 3M8YA 3ZTOA 1WOPA 1ZTWA 4DV7F 2XZWA 3W2VA 3NKYA 2YXLA 3UDVA 1C1BB 1TUWA 2LU1A 3LP0A 1PYSB 3H59A 2K1RA 4OJHA 3W2WB 4CO3A 2V4RA 4D3HA 2WVEA 4KY3A 5A8KA 3I56S 1TK5A 5HROA 1FKAF 3RBZA 1TL1A 2QL7B 4NLRA 3RGIA 4ID5A 4CLFA 4I67A 1H2VZ 1T03B 3IP0A 3AOCA 3KNGA 2RJZA 4Q45A 1BLUA 2DNMA 1SKRA 3LPYA 5E7OB 1GX5A 4USJC 4O3QA 4QQBA 1P9YA 2O67A 4FYDA 4I0WA 2AGPA 2VC0A 2AHOB 3QRRA 2WVFA 2V69A 4LF4J 3UCUP 4X4OA 2UXDF 1ACMB 4IH7A 4H54A 3V81A 1IR2A 2CYYA 2VICA 1S5ZA 4YUDA 2ZZNA 3G8TA 2GQQA 2ZVSA 1MU2B 1HFEL 1QAYA 3KK2A 1F3VA 3VZIA 1QDUB 1N6QA 4I4BA 1S48A 3GJRB 4G1PA 4USVA 1JQGA 1LWFB 4OI0A 2IMOA 2WSEC 2ZD1A 1GMVA 2YWGA 2E5LF 4F3MA 1UKUA 4HH1A 5KFGA 4EMDA 5F8GA 4CTAA 3OV7A 2BX6A 2IM1A 5FDLB 2JEFA 1H73A 1VOMA 4LF5F 4PYDA 4WP3A 3UN2A 4IG3A 1K8AT 4UUWA 1UW9A 3LUYA 4KRWA 2ASDA 2R8JA 1FD2A 3KNAA 1TKZB 4N47A 5IT0A 2F8EX 2B0GA 2Y9HA 2LQBA 1U0SA 1X5TA 3N79A 1DQAA 4LF6F 2GQ2A 2F40A 4ZPTR 5CXTA 1F3FA 2YWEA 2HMIB 2M8DB 1YITS 2BMBA 1HNXF 1TV6B 3P6YC 4K0KF 3DKDA 4I7FB 3HHNB 2JHEA 4LFAJ 3MWBA 5LT5A 3ET6B 3K5PA 1S9GB 1CJKB 4PKDB 1VC6A 2AX1A 2DT9A 2EFOA 3L4BC 4HHUA 2WZ1A 4PPDA 2RDDA 1VQMS 1JNZB 2XTJP 4XTTA 4Y0FA 1UL3A 1RB0A 3LTOA 3MOZA 4Q2LA 2DNYA 3OLAA 2PFFB 1HBOA 4OX6A 5HAOA 4JI3J 2B5JA 3NGKA 3PJXA 4FYXB 2R7VA 2CZ9A 2IJNA 2LU2A 3FQKA 3E8OA 4OHVA 3QFHA 2ROGA 2N7YA 3DOKA 3FEXB 5ETSA 4DEZA 1VRUA 2ALYB 1SQFA 4CH1A 1Y5LB 1NCLA 3UN5A 1O5JA 3IAS9 8AT1B 2V2KA 4QIFA 2CPDA 3DOMA 5F8MA 3TA0A 1LW0B 3MMCA 2MZJA 2MLXA 3KMQA 4Q0BB 4FXDA 1FCAA 4BC7A 1U1PA 1PJ6A 2DBBA 1RKJA 2DNHA 4F8RA 2E9TA 3E01A 4OX8A 4J9OA 1KLMB 3HVRA 1V3RA 4K0KJ 4P10A 1KKHA 2AIRB 2HPUA 3A8IA 2CPFA 5I3PA 1YJ9S 3JYTA 1PSDA 3W62A 2HHWA 1R8PA 5IT9Y 4NZ7A 3P96A 2FB0A 4HEA9 4ZVGA 4DF4A 2IHR1 3GTYX 3J7ZT 2XNQA 1HLWA 2LCWA 1D1UA 1S0MA 2IA0A 1LEOA 2HSEB 1VQ9S 4QU6A 3PNIA 3GFXA 4PPZA 1UJ5A 5ETMA 2PIIA 2HGLA 2I5JB 2FHJD 5L8RC 5EWGA 3ZTPA 1M5KC 3FC9A 3KLVA 2APOA 1ZAVA 4JI5J 4TVAB 2FLPA 5CA5A 1FRIA 4A8KA 2GQCA 3QSIA 5DDRC 3V6KA 1RT6A 4ED8A 1BC6A 1LWXA 2BEFA 5ETRA 1EP4A 5BYRA 3PR5B 2DGUA 4QOTA 2K3IA 3CC2S 5IXUA 3CC4S 2BE9B 2PMZD 4ENOA 4NCBA 2P9CA 1VFJA 1EB0A 1S4FA 1BQNB 3V6JA 6FDRA 3C16B 1MMLA 4NX9A 1FTRA 1GQEA 1WUUA 2E7VA 1TZ0A 3L7UA 3VHQA 1NKCA 4LQ3A 3NMAA 3VF0B 1RLCL 4P2XA 5ETLA 2M4MA 1XNRF 2EG2A 2DTJA 3S6EA 4RWXA 3NS7B 4WBFA 5LL6d 4EGLA 4X65J 2YNGA 4F25A 4X4UA 1Q95G 2GW8A 1T9UA 3BDEA 4XO0A 1N54B 4NYPA 2AW0A 2PO4A 4Z7CA 1HQUA 3L3CA 2E1CA 2V8DA 1RDRA 5DQHA 3BJYA 1X5OA 2HBYB 4CLYA 3QATA 3U27A 3OFGA 3SV4A 2IVFB 5L1KA 1OY9A 3TARA 5FIIA 2QSFA 4ZIVA 2NSCA 1AUDA 2C3MA 1EIYB 1HNWJ 1TL7B 2KT2A 2R7RA 4DPYA 1HW8A 4RKUC 4ZVSB 3OTEA 2ZVIA 1WHXA 2F1FA 3ZZ0A 3FSIA 2G13A 1NK6A 2BZ2A 4DL2A 3JS9A 2MY8A 5KOWA 5CCLA 1HQUB 5AE1A 1LWCA 2OIHA 2CQ4A 3M2UA 5D77A 3H98A 1TAQA 1MMNA 2J9DE 3R27A 5C7PA 3TAPA 2WVCA 1KQKA 3M9OB 4LBPA 4WE1A 3IA0A 5KFXA 2Q66A 1K9MT 4NE9C 1RA6A 2OP5A 4DPXA 3SFUA 1KOOA 1OPIA 3I96A 2FJXA 2DHXA 5HJYA 4J9SA 4ZLPA 1S1XB 3Q2SC 1G4CA 2F63A 3RB0A 4B9MA 4NI2B 2WBMA 2XS2A 2W25A 1TAUA 1HD0A 1NPPA 1SQGA 1E6YA 1S7IA 4KBIA 1R43A 2ZE2A 5CABA 1F1BB 3H42A 2P6TA 3OHBA 4TY8B 3EPGA 2QRRA 3BSNA 2E7WA 2CJKA 4KTQA 2WTFA 4ETXA 5KG2A 2ZNZA 2H51B 3I55S 3AA8A 3UVJB 5M2UA 2MGZA 3MEDB 3M8PB 1ZTTA 4IYQA 4WU3A 1DBDA 1IJFB 2HKEA 1JIHA 2D7SA 4ILMA 4Q44A 3DMJA 4IO1A 1G7CB 3PYEA 2NQPA 3G8QA 3RG6A 2BXJA 1D8YA 2F3JA 1RAAB 2ZE2B 2W9AA 2GIRA 2KJVA 4ICLB 4DR7J 1RU2A 1JLBA 1KTVA 2MQMA 2FC8A 2XI3A 2FJEB 2A1BA 3KKFA 3KXDA 2DY1A 3M05A 3CJKA 3OVSA 2XG8A 5KG6A 4M5IA 2XBPA 4PQUA 2KJWA 2J8SA 3NBPA 3GWCA 3IAM9 1RHJB 3IG1B 4IDKA 1SC6A 2BBEA 2VFTA 4DV3F 3MM8A 2JVRA 1WC1A 2XZDB 3AB4B 1P9QC 1REGX 1W25A 2R7QA 4M5MA 1QSSA 2XNRA 2OKQA 3IWXA 3C15A 2RKIA 1GXLA 1GTHA 1S1VB 5ETKA 4DJBA 3DGVA 2W2OP 5KT3A 3J80Y 1X4HA 2CQ1A 1B3TA 1CQMA 3LANA 2XM3A 3VAMA 2VA2A 1TMMA 5E5NA 3W9JA 3DOLB 3PEJA 3CD5A 5KG3A 3K57A 4DR6F 2V50A 4USTA 3DU5A 2HWHA 1NJIT 1S0VA 3PXGa 4B3SJ 1AZSB 3CMES 1R0AB 1QJHA 3ZFVA 1ZZNA 4C8KA 4PYAA 3BH7B 5DGBA 3TOQA 3E51A 2IMWP 2M88A 1VRTB 3EGNA 3LP2B 4YR3A 1FJGF 4CDIA 3FGVA 2HQGA 4N56A 2AJ4A 2RMLA 5BJRA 3GIJA 3C6UB 3BQ1A 3I5BA 2ZBQA 4HVZA 4LF8F 4JB8B 5L1IA 4CLTA 2YNFB 4F4XA 3FFIA 3D7SB 4YMEA 1NK9A 2H3EB 1MLAA 5E2QA 1JJ2R 1VRQC 4OLPA 3MXHP 2RU9A 4KFBA 3SCJE 4Q5VA 1FJEB 2A10A 2U2FA 3OXFA 3HT0A 1HBNA 5AXNA 1RADB 3MR3A 1U7LA 2VKRA 2ZOMA 3SBMA 3UPFA 4W98A 4WWSA 3EVWA 3I0SA 3SQGB 3EGWB 3UD3P 4AFFA 3F73A 2YNGB 2VOPA 1IKXA 3P49B 4RW9A 5KFDA 2AGOA 2XYPB 2ZOFA 5C25B 2J6TA 2I0XA 1ZPWX 2OPPA 4DPWA 3DXSX 3OBIA 1R6YA 3PJWA 4JP8A 4KE5A 1FJGJ 2PE8A 4KH1B 4E98A 1FHTA 1SJ1A 3RZAA 1RCXB 5FD1A 2FLOA 1CQNA 2NS1B 2J0QD 1X4EA 2H54B 4OZLA 2O01C 2Z30B 4Y2AA 2NPFA 2C28A 1VQ6S 2ZUAA 1YZ6A 1J5EJ 3C46A 1H38A 4LRCA 2XCPA 4NLXA 3GFHA 3M8PA 2IRUA 2BACA 3ZZZA 5FLXY 4KYZA 1RKIA 4ES3A 4X4QA 4PUOB 1YJUA 3HVTB 1OYDA 2BRKA 2AJ1A 3D68A 2VZ9A 3DGPB 4HL9A 5EX0A 2I38A 1EX8A 2OEJA 3ZZYA 2XSFA 4G3IA 2XI2A 3BZQA 4DL6A 1G6BA 4FBUA 2Z8QA 3WBZA 2V8GA 4LF1A 4LIRA 2X1AA 4K4ZA 2VH7A 4EK2A 4NI2A 4MKAA 4X62J 3R2CJ 3UNYA 3HSJA 3M6XA 4GVBA 4USUA 1Q81T 4H4OA 1XMOF 4FF3A 1SC4B 2W1BA 3VTIA 3I82A 2QL9B 2HK2A 1SH2A 1SL0A 1TFYA 3A12A 4QIGA 3BN4A 2BOAA 1H74A 3WDOA 2AJ0A 2BABA 3V4MA 4HT7A 2J0WA 2OPSA 2DPJA 4BS2A 1U2FA 4N41A 4JI7F 3MCMA 1QAIA 3NNHA 1X5SA 1RWKB 3ENAA 1T7PA 2IC3A 1W26A 5KFBA 4RW7B 2KM8C 4DSKA 1RT1A 2LP4A 4OLOA 3OR2B 3LA0A 4KGMA 4PEOA 1MN9A 3NNAA 2Y1LB 4JOUA 3BSOA
chains in the Genus database with same CATH topology
4MYUA 3WZ0A 2OD4A 3HHLD 4CO0A 3D1QA 1KOHA 4I68A 4EWTA 2DHGA 2HAIA 1N32F 3KK3A 2AYBA 4CNYA 5J2QB 1V6HA 1KLMA 5DRKA 4RNHA 2BANA 2Y1JA 3PW4A 2P6SA 3KLIA 3L7OA 4YP3A 2YNIA 4ERDA 4DQIA 5KFZA 3PEHA 4QW9A 1N8RT 1AXQA 1S9EA 2ROPA 3J81Y 2B56A 3TYTA 1MWYA 2U1AA 2JJ4D 1FDBA 2OLWA 4XDCA 4LF9F 3MUTP 1KFSA 2VG7A 3MTJA 2MKSA 3KK1A 1FKOB 5IM0A 2HWTA 2FLLA 1FRLA 4R8UA 5JUMA 3B4MA 2MQOA 3SI8A 4UQTA 1KLNA 3NG8A 4OQJA 5KFQA 2MQLA 3JSMA 2O1PA 4DFJA 4I2QB 1H2UX 4ZCKA 1BY9A 3FNNA 3G4SS 1KS2A 1EETB 1H6KX 3UDLA 3IS9A 4WXWA 4R5PA 4ECZA 5D3GA 3PIOQ 1N88A 1F0XA 5EN1A 3DHWC 2J5AA 5THWA 4YY3F 1LQ9A 2VQEF 2OPPB 4ECYA 3HK2A 1AFIA 4M5DA 5HROB 4HDGA 2R2SA 1RT7A 2DNKA 2G9OA 4CIOA 3Q8RB 2GMHA 5LSLA 2KI2A 2JRSA 2DJWA 2Y1RI 3KLEA 3CEDA 2ALZA 3QYYA 4URQU 4L72B 4DUYF 1VQPS 1RGVA 3DGPA 4CO2A 4C2MA 1L3SA 3VQTA 1HPZA 1S6UA 3R3TA 4EEYA 4FF4A 2EBGA 3THVA 1XMQF 4NLSA 3OFFA 5A8KB 4DFPA 3GFZA 5CYQB 4KGKA 2B5JB 2E5GA 2K7JA 5L1LA 4A8FA 4ECQA 5HBMB 5EWEA 3EZ5A 1S9FA 2MXYA 3KK2B 4X2BA 2MZSA 4ZCLA 2MKKA 2KVIA 4QZVB 5KFIA 3NAHA 2EFQA 1F60B 3KG4A 3T1HF 3GQCA 3NCPA 3ENWA 2J8AA 4Q8FA 1YQHA 3O6QA 1N5TA 4W90B 3AH6A 1F5CA 2Q6BA 2MZQA 4WFXA 5H1SV 3MD3A 3KLGA 3CCUS 1X9WA 4BDPA 2MHEA 3E2EA 2YVSA 2JLEA 4OFZA 1Q7LB 3GV8B 3Q22A 4I2PB 2CG4A 2XMMA 4NYZA 5EHHA 2DR7A 1UEVA 2D3UA 3OPKA 4JI5F 3NP5A 1HNVB 2HS3A 4CCHA 1X4BA 2UVVA 3M2VB 2EFVA 2YWHA 3CMAS 3RAXA 2UV8A 2P9GA 5J1PA 2VKZG 4ZOSA 2HLTA 5F9LA 2BW2A 5G0RB 3BQ0A 3TAMB 2RRNA 3RU0A 2KFYA 2J6UA 2CQIA 3KK3B 2R7UA 4DFKA 1VHFA 3SSQA 2VG5A 4AUKA 2AYGA 4WFBQ 2HZCA 3N6LA 2WCXA 1AROP 4X65F 4EFAC 2WBRA 1RTJA 3BEGB 3LO3A 4DN0A 3OTCA 1NK4A 3WC0A 4AXIA 3KTQA 1IN0A 2GHPA 3MURP 5A0YA 2GJ2A 2JFDA 3JTOA 3VAJA 1CPZA 1R3NA 3DCAA 3FQLA 1XK8A 5GAHI 1OWXA 4V19X 3IR6B 2KRBA 4FS1A 1J2VA 5A6PA 2KTQA 2I1RA 3MAQA 5EWFA 3OR1A 4I6AA 3ZZRA 3CD0A 1TL5A 4WJBA 3K58A 3ZC4A 4Y28C 2DGWA 3MMAA 1R8HA 3GILA 1Q82T 3DFEA 1U09A 1ZH5A 1S49A 4EO6A 2W4PA 1MU2A 5J1NA 3U1LA 4GKJF 1NHUA 2CQHA 2IBOA 2WOMB 1JKHB 3G9CA 4RW6A 2PA3A 2C3UA 4WXOA 2POKA 2ASYA 3ICLA 5C42B 1KRPA 4QR1A 4JI2F 2W7OA 2CZVC 4RW7A 4A4JA 5B0BA 3MMBA 2PI4A 2DR5A 1UVKA 3DRXA 1UETA 4ZVHA 5U47A 3OL6A 1VIXA 2DNQA 3HMJG 4OMFG 3RYLA 2OO4A 4YFUA 3CCSS 1FJ7A 2XMUA 2DH8A 1K0VA 2WHOA 2AX0A 5IQQA 2RDJA 3LF0A 1SB6A 3HHLB 2R8HA 2J9DA 2YWKA 1FXDA 3N5FA 1NJYA 3JTPA 4WFAQ 3HX9A 1DHMA 3NS6A 2ACYA 1VK3A 4KHMA 1UWBA 1C1BA 4MH8A 3UE2A 5GAEU 3CCQS 3IGNA 3VR1A 2AP6A 4FXWA 3CJ5A 3UNGC 2YX1A 3ZZPA 3IXQA 1O8BA 4MMOA 3TVYA 5T41A 2E5HA 4DOZA 2OTJS 4WYLA 1OO0B 4H4MA 1IQTA 5F8NA 4OHXA 1SIZA 3V6HA 1IKVA 2YWFA 2HS4A 5KFKA 1YIJS 4B9SA 1QSYA 3G6VA 1TUVA 3AA9A 1N48A 2VL1A 5IQ6A 5DLFA 1H0HB 1QLNA 3I0SB 3DYAA 4C8NA 3SQGA 2XSJA 5J2PB 3PZPA 1WHVA 4I2PA 1U24A 2P5VA 3OTBA 3RR7A 2DNNA 3OTOF 2QFJA 3EX7B 1HNVA 4LFCF 3QZ8A 3H20A 3CD7A 2CIMA 3VWSA 3RRKA 3CC7S 2RIJA 4UY85 4CO4A 2WB1D 3MI7X 1A6LA 3VAKA 2UV8G 2HFZA 1CSJA 2DO0A 2XGQA 5J2PA 1S97A 1TVRA 4F3QA 5T14A 1BQMA 3KLHB 4DV4F 1LWFA 3LP2A 4N76A 2ZZMA 2R2RA 1XERA 1QAJA 3MD1A 2QZ8A 1D0EA 1RT7B 1KD1T 3A8EA 4LSNB 1Y0HA 1Y5IB 4ZPBA 2MDAA 5K9FA 5G4DA 4KJIA 1FA0A 5DG8A 5E33A 1XR5A 3ZZTA 5KFPA 2HFNA 2CPJA 1H3DA 4BWMA 3MFHA 5HP1B 1RTDA 2R8KA 1H7WA 3RRGA 3H8YA 3VALA 5KFEA 2XULA 2VQFF 1RT2A 1SV5B 3C66A 2KYXA 3R5CA 4HH0A 1KEKA 2KXNB 4DL4A 3M8QB 1NK5A 1WD6A 3T19A 4LJMA 4TQRA 1FRJA 2WRMA 4O23A 2D3OR 3MEEB 3DI6A 3DRPB 1NJWA 2AGQA 1U6FA 3H25A 1X4AA 2XC9A 1L3KA 5LXYA 4ECUA 3AB2B 1FEHA 1N34F 5KFJA 4OHZA 4ZVEA 4DN9A 2DRBA 2K2PA 2MHNA 1IKYB 1JLAB 4ALZA 4RNNA 3T5KA 4ILRA 2WW8A 2R7SA 1WWHA 1JLQB 2CKWA 4JBCA 5BYQA 3H2LA 2DIUA 2HQIA 5E3QA 2R8GA 4IFYB 3V6DA 1ULRA 4RLEA 2UZAA 1RI7A 1T95A 1RTIB 4AXJA 3I87A 4IQMA 1X7VA 3OSNA 4PWDB 3O44A 1S9GA 2LEBA 3PV8A 2KKHA 5F3TA 4QCLA 1KN6A 4DMZA 4EYIB 4R5PB 2DB1A 1DTQB 2CPYA 1WEYA 1FK9A 1G2EA 1HHTP 4DR3F 1FO1A 2XCAA 3TAQA 3R5AA 2B7CB 1VLYA 2MPUA 1S1VA 1HI0P 2FHJA 2LXFA 3ITHA 3TR5A 4ELVA 5A2QY 1W2BR 1HW9A 2QYCA 1N5YA 3HHLA 1XTZA 3D0GE 3FJ2A 2NR0A 2HHUA 1V3SA 2CQDA 3DLEB 5C5JA 1O0PA 2UU9F 2XY7A 1HWKA 2XEXA 1GNKA 1WEXA 4ECSA 5E3RA 3OR2A 1U45A 2E29A 1VBYA 2COLA 2RVJA 2V0NA 3I9ZA 2B6AA 4FNHA 3OL9A 5CYQA 4LF4F 2JZ5A 4J5OA 4W92B 2V8VA 2IC3B 1SH3A 3DMJB 1EP4B 1U25A 2MMYA 3BM7A 5DJBA 5KOXA 4XPCA 1Q8IA 4YB7A 5EX3A 3PVXA 3K0JA 3H5SA 3H5XA 3M1VA 3N9UC 2IVMA 3N6MA 1T05A 1G3OA 3M9MB 1KVIA 4DUZF 3N5BA 1JJHA 1DURA 4CNZA 1SBRA 2I8EA 2ZJPQ 1GH8A 4QIWD 4M95A 3DLGB 2KT3A 2NSBA 1X9MA 3WC2A 3QGHA 3V5RA 3MEGA 1KQSR 5A8WA 1R8CA 3HP6A 2DGQA 1XWLA 3T1AA 1FVQA 2CPXA 3HZGA 4QR2A 4EUVA 1GXTA 1NO8A 2VG6A 4EZ6A 3G86A 2WAQD 4B3OA 1P27B 4DHVA 1HNIB 3P5TL 3CULA 7FD1A 1IKXB 3Q8QB 5LMUF 1Q1KA 1U1KA 2NREA 1R8BA 5C25A 4PG4A 3OXGA 1CLFA 4IR1A 2HW3A 2FVQA 2HNDA 4NMLA 1T03A 1JK9B 5SUHA 1HMVB 3CIZA 2FTRA 4NCGA 4RW8A 4K4UA 4R8UB 2MY7A 3M1VB 3IO1A 1KHWA 3MM5B 3RAMA 2RILA 4YDXA 2X1GA 3H5YA 4EBDA 2J6SA 2OJ3A 4PUOA 5KT4A 4GC7A 2C42A 3CCMS 4O3RA 5KFMA 1JMTA 2M52A 3T1YF 3CDWA 3SCKE 4YHHF 2CPHA 4NLQA 2ZFHA 3L09A 3SDEB 3KOAA 2A2DA 3DLLQ 4IOCQ 2KG1A 1UVMA 5HI7A 4ZPWR 5I3UA 2CJQA 4DL0C 1QUPA 3T5HA 1NKEA 1I6JA 3MUMP 4IFVB 4F2RA 4KPYA 3O1LA 4YDDB 3G6YA 1K1QA 1JLEB 4J9NA 3S1TA 4HYKA 3MPYA 2L08A 1FE4A 1Q53A 3JTNA 2IVYA 4IG0B 5K8OA 3PW2A 3GG0A 4OZNA 4ED5A 2N3LA 3LOUA 4TLQA 2E1RA 4EZ9A 1FERA 3KJVA 1Q7YT 2LEPA 4IRCA 2VD3A 4KFBB 2HRYA 1ROFA 2EFGA 4YB6A 2CQCA 5L38A 1T3NA 4X4NA 3PKMA 4C0HA 5L1JA 5F8HA 3NBPB 4N77A 1P6TA 1RP5A 1H2TZ 4P7VA 2KHCA 1U6ZA 4URSA 3L7PA 1RA7A 2XMJA 4CT8A 4B08A 4B9NA 4DR1F 2G4BA 4C0BA 2HHXA 1X4GA 1ZM4A 5DDPC 4I69A 2MB0B 1Z1ZA 3BGRB 1BQNA 3LH2S 3CJKB 1FDAA 3E3XA 3N28A 1ZM3A 1FRXA 4WTYA 4J37A 2RS2A 5F41A 5B0GA 1K0TA 2XWYA 3EZUA 4C4WA 4ZK7M 4NLGA 4CQ1A 4PQAA 3ISZA 3QAUA 5DLGA 5MAOA 4FN5A 2IFXA 1WEZA 3MAHA 5GAGU 3BQ2A 3M4XA 3CCES 1MNEA 1NRKA 4FVMA 1JJ4A 4PG6A 2BM1A 2KHDA 2J9EA 5CYJA 3MR6A 1QE1A 2VA3A 1VRUB 4J9LA 3BO3A 3HDSA 1DTTA 4MFBB 2Z4PA 3KHRA 4RBUA 4RNOA 3RR8A 2BQUA 4ZPVR 5LSRA 1HWLA 2UXCF 2XHWA 4ECTA 2GHWA 2VG5B 2UP1A 4H4OB 3R5DA 4KQZA 4LMZA 2HIQA 4WZMA 2XLIA 2W9CB 1DQ8A 1NK7A 5BYSA 1LFWA 3PRBA 1S6PB 1Q4RA 3MEDA 2AF6A 2VBWA 5ITHA 1U26A 1C2PA 2OPRA 2XS5A 2E44A 3UI3A 2WK4A 1LW2A 4KC5A 3MFIA 4OI6A 5B0FA 1VGYA 3CJ0A 4X4SA 1TKXA 3DLKA 2JDJA 1ZAWA 4ATNA 3BB5A 3I4PA 1K73T 3Q0AA 1SJRA 2JH3A 4PCQA 4ID5B 2DNPA 3RBEA 3NS5A 3SCIE 1SJ3P 3LALA 3OL7A 3CCRS 3X1LB 1VS3A 2YKQA 1VQ8S 2XS7A 1S1WB 4NA1A 3KHGA 2KXFA 4ED3A 3BDPA 5HBMA 4LFAF 1Y3KA 4DX8H 4C9DA 3SFGA 5I3UB 3UW1A 1LOUA 2GNKA 3D1HA 2AYEA 4A47A 3M2RB 2ASJA 3K7RA 2W4CA 3QGPA 3CCVS 2LXIA 1YI2S 3QZ7A 4DSIA 1SQEA 2KRRA 3T5JA 3MM9A 4RUCA 2W7PA 1XC9A 3FMBA 5B09A 2GO9A 4Y2KA 2FD2A 3OQ2A 3SSSA 1XR7A 4I6WA 2CVIA 2GV1A 1VQ4S 4O44A 2Q1LA 2D41A 1A9NB 3CPWR 1RT2B 1SV5A 2J0XA 2ZITA 4UY8T 2JEIA 4LVOP 4C3LA 2N82B 4JI8F 2FJWA 1RTIA 2DNOA 2B4VA 1MROB 3FRZA 4HT5A 3TRGA 1SL1A 1NJZA 3BGRA 5K8MA 1X5PA 1J5OA 5HL7Q 4X4TA 3HJFA 3PFOA 2JSXA 3CSKA 2DR9A 2RDIA 1MMDA 1NHVA 3GG1A 4R0EA 5KFYA 1CC7A 1Z4UA 3JYTB 3HM9A 1WI8A 4IO9Q 4M8LA 5HQ8A 1HMVA 2B51A 4G1QB 1FEEA 4OZ5A 2XLJA 2ZH2A 4NLUA 3CCLS 2FIUA 4K4TA 5IZHA 4QU7A 1HBMA 4AL7A 2E5JA 3QGGA 4JV0A 1E6YB 3D2WA 2MKJA 5B0AA 3CCJS 4FF1A 2FGOA 4ZCIA 4C8ZA 4EO8A 1HBNB 3JAMY 3THPA 3GFYA 1VBZA 1HBOB 3CWJA 5EUHA 4DF8A 4K4VA 2JEJA 4ELUA 3C2PA 1FVSA 4KHPF 2LQ5A 1FT8A 3F44A 3J7YU 3NWGA 5IM0B 4RW9B 2NZ4A 4IFVA 2BOPA 1HWUA 2J7UA 5KG4A 3PKYA 3JSBA 5KFOA 2W9CA 5KTQA 3TQ1A 3KG0A 1YGYA 1Y00A 2ZC4A 4AYBD 3OFHA 2VFUA 3ITHB 2ZDOA 1PILA 3CDEA 4NLDA 3DLEA 5D8HB 1S6OA 4WYWA 5GVQA 5HMXA 1N36F 2IYGA 3QO9A 3T3FA 2MYFA 4ED1A 1BQXA 4B3TF 4N8OA 2FC9A 2YH0A 2IM3A 4P6QA 3CGIA 3JSMB 3QPIA 4A46A 2RH3A 3MEEA 1B7FA 2MZTA 4IKAA 5CCMA 2BVZA 1R0AA 2JL9A 2C2RA 1AW0A 3EXYA 4AL6A 4X4PA 2A2CA 1UEUA 4RW4A 3OTDA 5I3QA 5LJ5Y 1SKWA 1X4FA 3H5UA 4NLYA 1C0UA 2VPXB 1RT6B 4ECVA 4U9RA 3HHKA 5IFMA 5I4MA 1VQNS 3CE8A 4NCGB 2BE2A 4MYTA 4Z2XA 1S7HA 2N4DA 4O3PA 3MEGB 2BYCA 4DSJA 5LSOA 4AQYF 2I5JA 2M7SA 4CI0B 4F67A 2FVCA 3UR3C 2OD6A 4RW6B 5D6GA 1S0OA 3QMQA 1S1TB 1TK0A 1HNIA