4C3KA

Structure of mixed pii-adp complexes from s. elongatus
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
115
structure length
98
Chain Sequence
b'MKKIEAIIRPFKLDEVKIALVNAGIVGMTVSEVRGFEFLQKLKLEIVVEDAQVDTVIDKIVAAARTGEIGDGKIFVSPVDQTIRIRTGEKNADAISAW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NITROGEN REGULATORY PROTEIN P-II
publication title Structural Basis and Target-Specific Modulation of Adp Sensing by the Synechococcus Elongatus Pii Signaling Protein.
pubmed doi rcsb
source organism Synechococcus elongatus
molecule tags Transcription
total genus 22
structure length 98
sequence length 115
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2013-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00543 P-II Nitrogen regulatory protein P-II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.120 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4c3kA00
1P1LA 2CZ4A 3OPKA 1O5JA 3GSDA 3NCPA 4R25A 1OSCA 4NYPA 2ZOMA 4RWWA 2NUUG 4OZJA 1V3RA 3BZQA 4IYQA 4CO5A 5L9NA 1XK8A 2EG2A 4USHA 4E98A 3MHYA 1V9OA 2VD3A 4D3GA 2XG8A 3AHPA 2Z0GA 1QY7A 2GNKA 3CE8A 2ZFHA 3TA1A 4YB5A 4WK1A 2J9DA 2V5HG 5DS7A 5D4OA 2EG1A 3LF0A 3NCQA 4Y65A 4WK3A 1NH7A 2PIIA 3O8WA 2J9CA 2DCLA 3TA0A 1PILA 1UMJA 3AA8A 1VFJA 4CO1A 4ZK7M 5D4PA 2E66A 2GX8A 4CNZA 2GW8A 1V3SA 1H3DA 1J2VA 3HLUA 4YB6A 4OZLA 5D4LA 4CO3A 1NAQA 2O67A 1UL3A 1NH8A 1HWUA 1NZAA 1O51A 4USIA 4C3LA 2XULA 3DFEA 3M05A 4C3KA 2O66A 4RLEA 4CO0A 4CNYA 3O5TB 2XZWA 4RWXA 4USJC 3T9ZA 2J9EA 4AFFA 3TA2A 1Q1KA 2RD5C 3L7PA 1GNKA 3AA9A 1UFLA 4YB7A 1UKUA 2XBPA 3AH6A 2NUHA 4NYOA 4RX6A 5D4NA 4CO4A 1V6HA 2NS1B 3N5BA 1VHFA 2JJ4D 3NCRA 4Y6IA 2J9DE 4OZNA 3X3UA 5DRKA 1KR4A 4CO2A 4D3HA 4C3MA
chains in the Genus database with same CATH superfamily
1G2EA 2HQGA 5F41A 2DYAA 1VHIA 3MUVP 3WC0A 2EEYA 5J1EB 3A4TA 3SSQA 3M6VA 2C28A 5KFQA 3T19A 4E98A 4LFCJ 4ZLNA 1TKTA 4DG1A 4DL6A 4YB5A 1RTJB 1EZZB 3A3OB 3U27A 2KYZA 3PYFA 4PWDA 1WG4A 2XC9A 2MY7A 1SKWA 2VL1A 1LFPA 1P6TA 2V9WA 1TL7A 2KN4A 1Y11A 2NYIA 2E5LJ 1I51B 2RHSB 3PW0A 2K3KA 5AXKA 3KUHA 2CJ9A 1WOSA 4ZCKA 3PW2A 4Q8FA 1Z2LA 2XO6A 1K1QA 4N41A 4ZPCA 2DNYA 3K57A 3MM7A 4K4VA 4ECWA 4F4XA 4DX8H 1U45A 2RRAA 2FLNA 5M2UA 2BQRA 2ZOFA 3KLIA 1N8RT 4F0HA 2EI5A 2DKOB 1ZA2B 2MKSA 5E3RA 2BEFA 1Y00A 1N34J 1VRTA 3E51A 4OZJA 5F8IA 1B99A 2ZH4A 4CLYA 2FJAB 3HVTB 2R7UA 4FVCA 4NEZA 4J5OA 1IBMJ 2HWIA 3TA1A 3R7BB 3KJFB 4P71A 3E8OA 2AGQA 4P2SA 3OVAA 4LF9J 2ROEA 4BBYA 5HQMA 3A8IA 2XZDB 3NOGA 5BXIA 4A46A 4C2MA 2J9CA 4PR6A 5HJXA 3PYDA 2CQ3A 3GIRA 3WZ0A 4CO1A 1TMMA 2QZ8A 2YH1A 1W25A 4FYYB 3C6UB 3RYLA 1GK8A 2R8KA 3UDEA 1OY9A 1KC8T 2V34A 2Y0BB 1NK4A 4J9RA 3FQLA 5MAOA 2VKRA 3L9ZA 4ZPBA 1UVIA 2P8IA 1N88A 2Y8YA 2AJ1A 3RB6A 5KT3A 1MROA 3FZBA 5DQGA 3POTA 2AEFA 1R89A 4ZCIA 4DR3J 1C4CA 1PYSB 4Z7CA 3R5DA 2CPFA 5T41A 4M5KA 2YWKA 4DV3J 1LW0A 1FKOB 3V6DA 1RT4B 4RW8B 4OI6A 5LXRA 3Q89A 3L4BC 4L3NA 2QFJA 3FSIA 2BJDA 2E9TA 2PO4A 1JLEB 5DGAA 4P72A 5I3QA 4C8KA 1I94J 4ICLB 3MM8A 2MSTA 4LFCF 3FEZA 5A8KB 4WK3A 2XM3A 2LA4A 4E8UA 2FHKA 2O01C 3BGOP 4ECTA 4DUTA 4QIFA 2DVIA 2E5LF 3UD3P 2VG6A 3DC2A 4QU7A 4ZVGA 4ZCLA 2PMHA 2DGUA 1RTHB 3M7VA 3D4JA 3GWCA 1Q8LA 3BS9A 2RF2B 2NS1B 1U0SA 3N5BA 5I3UB 3QYYA 2CJXB 5ETVA 3TJ8A 4B9VA 1VQ8S 2LQ8A 2IA6A 4NCAA 3NMAA 1SJ1A 4DFJA 4KV8B 2Z57B 3A8KA 3GP9A 2DNRA 1KLMA 4NX9A 1VIOA 2HK3A 3EX7B 3K5PA 3HHLD 1N34F 2GMJA 4CIOA 3V81B 3EGZA 2MLZA 5ETLA 4U7CA 5HMWA 2G4BA 4V19X 1LK7A 1TKZA 2HHVA 4WE1B 1IBMF 1KONA 3KLFB 2V9KA 4MK8A 3LGMA 2R2TA 1VBXA 3EVMA 3DLEB 4LF9F 5EGYA 1S7HA 2UU9J 1RT3B 3MEEA 4ETXA 3G6ES 4EK2A 3Q0AA 3I9V9 4ED2A 4M5GA 1HNIB 3W62A 3OLAA 3CIZA 2J0XA 1WDTA 2B43A 4ECXA 4I7FB 1RT1B 5J2QA 4AXJA 3NAHA 2CJKA 1OYDA 1N48A 4QQBA 2JFDA 3GJRB 2ZH3A 2EFNA 2RJZA 3QAUA 2QA1A 3QNWB 4J9LA 1MMNA 2V6AA 1RWUA 3LP0A 1NK9A 4DR3F 5HI7A 4RUAA 3RRHA 3I82A 1M1GA 3R5CA 4U8VA 3TX8A 2FLPA 4H4MA 4DV3F 4F26A 1NHVA 1ELOA 2XMAA 1FJGJ 2CFXA 2ASYA 3MMCB 1FE4A 2AJ0A 1RT6B 4C48A 2C2ZB 2A2DA 4RKUC 4LUBA 2ZH1A 4P73A 1UCNA 1I94F 3H5SA 1KQFB 4TQSA 1JNRB 2CKWA 2FZKB 1BWVA 2A3JA 2MDAA 3CJ3A 1YITS 5IM0B 4LMZA 3M6XA 3NL0A 2EXUA 2EFGA 3KMQA 2HZVA 4LSZB 2R42A 2DR7A 2HGMA 1F9HA 1RWXB 2D41A 1D3WA 4P2XA 3HVWA 1YRXA 4L3KA 5ETRA 4DR1J 3EMTA 1QSYA 3CCRS 1JQGA 2P6TA 2FHJD 2MLYA 2XCPA 3CCZA 1WOOA 2F4VF 1VBYA 4NLVA 3SI8A 1OYEA 3MEGB 3C6TB 3BN7A 1RSCA 3D3BJ 2MLXA 2OPRB 2ZD1B 4ID5A 4WK1A 3MGJA 2VFUA 1BLUA 2KZZA 1EB0A 4UZBA 4LREA 2XMKA 4L6V3 1JLBA 2QYGA 1AYEA 4E0DA 3TA0A 2IIHA 3IN5A 1RISA 3TANA 2R7OA 2J6TA 1HHSA 3TQ1A 3VGSA 2BOAA 2B8QA 3AODA 2DH7A 1WNEA 1ULRA 3ZXWA 3G9CA 5F9NA 1B0VA 2UU9F 3D6FB 3GR1A 4M94A 1TKTB 4USKA 3FBFA 2VJUA 3MAQA 3RG6A 1XNQJ 1TAQA 3AT1B 5AXLA 4W98A 1TL7B 3I6PA 3DHXA 5EHHA 5DDOC 1RA6A 2IRXA 3WX8A 2FVRA 4I2QA 3O3LA 2DO4A 3CMES 2CUYA 3MM7B 2B56A 2RIJA 2JDJA 9RUBA 2LKZA 3RAQA 1R0BG 2OTJS 4B9LA 2YKNA 3V4IA 4QCLA 3RB3A 3KLIB 5KT6A 2QIFA 1RQ0A 3LA0A 4LFBJ 3K5NA 3HI9A 5CXTA 2ZC4A 1FJGF 1MWZA 1VQYA 3K2YA 4KIAA 2CJQA 2XYHB 3PJXA 1KOHA 4CLPA 1VRTB 5HN0A 4HKQA 1HW9A 1FRKA 2CPIA 1LKZA 5AE2A 5IC4B 1RHMB 1GH8A 4A4JA 5D6GA 1NMEB 1CC7A 1UFLA 2H48B 2DD8S 3ZZOA 2OPQA 4WIIA 4PXCA 1Q78A 2CRLA 2RKIA 1EHWA 3EVWA 2KTQA 2HRTA 3G8TA 3ILIA 2YNIA 4Y2KA 2ASLA 1S6QA 3W63A 3TP2A 2IHR1 2BE2A 3CNQP 4DPXA 4DR1F 3VVUA 2VG7A 4IR9A 2RDJA 3CJTA 3IBFB 2ZH6A 2V50A 3POTB 2RDDA 2C42A 1U1KA 1PSDA 1UEKA 1U6ZA 3L7UA 3DOLB 1RT7A 1GMUA 4DV2J 4JOUA 1IR0A 3FBEA 1TL1A 4H4OA 1LW0B 1KOOA 5ETQA 2AYBA 2W4DA 1LV5A 1JNZB 4JV5J 1DURA 3CCTA 4DR6J 1T05A 4OZ2A 2O67A 3PVXA 1E6VA 1HBUA 3MR6A 4OZ0A 3US5A 3UW1A 3MM8B 2AKWB 2GVDA 3D5MA 4DQPA 3FUYA 2GO8A 4YB7A 3OTBA 1IJFB 3CB4A 4CH0S 4DLEA 2B9XA 3K59A 2CQ2A 3BBBA 2RAQA 1XNQF 4LSLB 1XMQJ 3CMQA 1IBCB 2KT2A 4HHUA 4QR0A 4ZJOA 2KT3A 3J81Y 3JQMA 2VG6B 4KE5A 4JI4J 2IDEA 1X4CA 4WBFA 1KQGB 2XG8A 2XMJA 4O3QA 1FF2A 3KK1A 1SJRA 1XIQA 3UQSA 1S9FA 2HS3A 5GAHU 3Q22A 2ABYA 1JB0C 5K8MA 2XNQA 1KLMB 5KFHA 4XPCA 1C1BA 3H25A 2IMOA 4Q45A 5KFUA 3D0HE 3HHDA 2XSFA 2M3DA 3GIMA 1S0MA 5ETSA 4WWSA 2MKKA 1TKZB 3MECB 4U95A 1HWIA 4RX6A 3HHKA 2D3OR 1WG5A 2F8MA 4KAIA 5IFMA 5LSLA 1SJFA 2HHQA 3BSAA 4M63A 1U48A 2RH3A 2JVRA 3MEEB 3OL6A 1FRXA 3DGPA 5A8WA 2UVVA 1TELA 5C5JA 1Y0HA 4OX6A 2CIMA 1GTEA 1PBUA 2C2OB 4MMOA 5J2QB 2Q43A 3PR5B 1FFSB 3CJ8A 1T02A 1NEEA 1VQNS 3OV7A 3BKFA 2RQCA 4A8WA 2VJVA 4FKYA 3G8QA 3PHEA 5A76A 2QA4G 3UNGC 2QLWA 1G3OA 3LP0B 1AZSA 1K0VA 4F3QA 3OD2A 1VFJA 3N6MA 3N79A 4DV2F 2W9CA 3TO8A 1RBOB 1FEHA 4H4MB 2E1MC 4PWWA 3M2RA 2ZM6J 1SC6A 4K4YA 8ATCB 4A8MP 2CPZA 3IAM9 5HLFA 4RLEA 4JV5F 1B3TA 4B9SA 4DR6F 3BV8A 4FYXB 3GIJA 4NE9C 5KT4A 2E5IA 3OLBA 3JTOA 4YR0A 4LR8A 4MJKA 2OO4A 2EVZA 2PSZA 3VR1A 1S0OA 1IKWA 2G9OA 4QOTA 3R7SB 1XMQF 2Q79A 5C25A 6FDRA 4WFZA 3NNCA 2JL9A 1PKUA 5K8NA 2J8AA 1FFGB 4Y2IA 4HACA 2IBKA 2WBRA 2YPZA 4F67A 4JI4F 2EFPA 4ZIWA 2GMLA 4CZCA 4ZN1A 3OHAA 1R31A 3Q8RB 1KSPA 3CCUS 4BC7A 1N5TA 2UUTA 3H4BA 3TW0A 3BSOA 2QL9B 3MAAA 4AL5A 1XWLA 5D4LA 2PI5A 4O4RA 2WSEC 1BMQB 3TX0A 3NY0A 3KLHB 4F4YA 3N6LA 3KHLA 4FF4A 1WJ9A 4PXEA 3B6BA 3UDVA 2B7CB 3SCJE 2CPYA 5KFYA 3M4XA 1HNVA 2V4RA 1W2IA 1Y7PA 1U24A 1GFWB 1GXUA 1JKHA 3CIMA 2UUCJ 4QWEA 3SQGA 2QLJB 2A6MA 4A8YA 1U02A 2C2NA 2VPZB 2BKOA 5KFZA 4HL9A 1PC5A 2V5HG 3MMJA 4FYDA 3ZZPA 2E1RA 2CNKB 4Z2XA 3I32A 4Y2CA 5B0FA 2OSQA 3UD5A 1NSPA 5HSPA 2OPPB 2FPHX 2R7SA 1NDCA 1O0PA 2HYIB 4I2QB 2OPSB 2HEKA 5DQHA 2Q6BA 2N82B 2V8HA 1EIYB 4K4SA 1LFWA 3FMBA 2YKOA 4HTIA 4XIUA 3ULHA 2B9EA 2BACA 1J5OA 2DJWA 2CJBA 5KT2A 5HVGA 3W2WA 1RLDA 3M8SA 1FHTA 1VC0A 3ENVA 4XAKA 4XTTA 3P6YC 4NRTA 4X4OA 2LDIA 1UPMB 2BM0A 2LQBA 5JMNA 3J81j 3ZNJ1 1QTNB 2DRAA 1DARA 1H0HB 1HMVA 2PMZD 2B9YA 2MZRA 1BHNA 4OYWA 4DFPA 3T1YJ 4LBHA 1T9YA 2BVZA 1RWWB 4DV4J 2L9DA 3BR9A 3OJUA 2A1BA 1JJCB 1OJ4A 4NASA 4ZVPB 3E2EA 2QGFB 5ETOA 3CD7A 4Q43A 3JQJA 2W7AA 5A8RA 2OPQB 4LFAJ 3PG9A 2RKIB 1KFSA 1X4DA 1S1XA 2WB4A 2JRSA 2WHOA 1LOUA 3O8WA 2CQ1A 5B7WA 1P1TA 1B64A 4GRSA 1LWEB 2BE2B 1PCAA 2GX8A 3FKBA 2C2DA 1G6BA 3I55S 2IJRA 1YRTA 2VG7B 3QWPA 5I42A 2B0GA 2FQQB 1ZZFA 4QR1A 4C3LA 5KFDA 2DNOA 2DNLA 1S10A 1HKAA 3O2IA 2LCWA 2RU9A 1X60A 2J9EA 4O4GA 4U7UD 1WORA 3PX0A 5E5NA 5ETTA 1RT7B 3K5OA 1YBUA 5LXYA 1FE0A 1TL1B 7FD1A 4H4OB 1S9EA 5F8JA 2OSRA 1CQMA 5CD4H 1Y9OA 2MY8A 3BF4A 2ZE2B 4ZVQB 2F8EX 2ROPA 2YVSA 4TYAA 1SL0A 1T05B 2JX2A 3C15B 2DT9A 1HBUB 4NLPA 4IO9Q 2Y8WA 4IOBA 1JJHA 3FSYA 2GVDB 5J2MA 2CQ4A 4N5SA 2Y9HA 1PJ6A 4CP5A 2UUCF 4B9TA 2ZKTA 5ETPA 2BJ8A 2HQDA 3H5YA 1Y10A 3M9MB 3IS9B 2QLFB 3G71S 3KKFA 3NP5A 1RU2A 1JX4A 4KJIA 3HZGA 4EYHB 1K1SA 2ZBQA 3A8JA 1YJTA 2W24A 2XULA 3BH6B 3KK1B 2F1FA 3CJSA 5LT5A 2R2UA 1Q8BA 4RO0A 1KLNA 4EMDA 4GC7A 3LP2A 4URGA 2EC0A 2WW4A 1Q86T 1SH2A 4QIVA 2E7WA 2ZHOA 3SSRA 2WSFC 4IDKA 1C1BB 2VHGA 4ES1A 1VC6A 1PAEX 4ECUA 3AAWB 3T1HJ 3MPYA 2VICA 1HI0P 4ALZA 2CQCA 4YUDA 4J90A 1FT8A 1MU2A 4WPAA 3GV8B 3T1YF 3I5AA 4DV4F 3JQKA 4QU6A 4ZMMA 1NB7A 3LH2S 2DPIA 2RUSA 2NREA 3DGPB 4FP9A 4LFAF 1V5IB 5A6WA 5A8WB 3KK3A 2I8EA 1S1UA 5HMXA 2CPHA 1V5VA 2QE5A 3SDEA 3LO3A 1OO0B 4PG8A 1R8BA 1W7WA 3ZTPA 2IMWP 5DG7A 2FJWA 3O1LA 5CZXA 4DZ6A 3ENAA 1OQ6A 5ETNA 1TFYA 3M05A 2WVEA 4OHVA 1REVA 4DCPB 3D0IE 4PQUA 1H7WA 3LPEA 2QL7B 2CZVC 3DRPA 3TR5A 2XBPA 3GG0A 4DUZJ 1PC4A 4JBCA 2M5YA 1AZSB 2QX0A 4A8FA 4ZITA 2FHMA 1L5UA 4CT9A 4PG4A 2MKYA 2R8JA 1SBRA 2DNNA 4RWWA 1N5YA 4NMXA 3M2RB 2NUUG 2HNDA 2BV3A 1K47A 4UW2A 3MMAA 5HLFB 1S4FA 3MI7X 2QN6B 2FY8A 5KG6A 3ENQA 5D0GA 2ZJPQ 1P9QC 3QATA 4WZQA 3VGVA 2GHPA 5C2GA 4J9KA 1IKWB 1KDNA 4ZVTB 4IH7A 4MIAA 5JUMA 4OYIA 2RU3A 3M2VA 5K14A 3VAFA 2F8HA 3B82A 3ZTSA 1AFIA 2IVMA 3H42A 4EFAC 3HVAA 2Z2YB 3H2LA 2PC6A 3O44A 4WU2A 1EKRA 1N56A 3TAQA 1T3OA 4RWXA 2Y1LB 3LWLA 3LANA 2D69A 3G8SA 4GVBA 1JK9B 4DI6A 2F4FA 3DOKA 1F3FA 4MFBA 2L41A 4ZOSA 3IXQA 2DXDA 1WC6A 4DL5A 4KRWA 4RBTA 1QAYA 3Q8SB 1QUPA 2PD1A 3PX4A 3QJJA 2V68A 1KVKA 3RJMB 1JXLA 2Z56B 1IJEB 1F5BA 2DR9A 3MD3A 4IRCA 3SBMA 1CBKA 2JOQA 2HHTA 1FRMA 5A0YA 3T1HF 5L1KA 3CDAA 3VQSA 1NJZA 4O0NA 2QMUB 3Q8PB 4HDHA 3RBEA 3D68A 2UXBJ 2EK6A 2H4YB 3WIUA 4A8XA 3OR1A 3TI0A 1QAJA 4V19J 1JKHB 5L1JA 2P2CB 5F3ZA 5D0HA 3SQGB 3UCGA 2KFNA 3QO9A 4F04B 1Q81T 4NXMJ 2HHPA 4QIEA 4ZHRB 1FKAF 2GVZA 3HK2A 3TZZA 3CEDA 3OVSA 2EBGA 2YKMA 3ZZRA 2MHEA 1BQXA 4DUZF 2PMWA 3EPGA 3CDWA 3AD8C 3J7YU 3FBBA 3W2WB 2VD3A 3CCJS 4J9OA 5KFWA 2F63A 3RTVA 4QYZK 4F3OA 1WC0A 3ICLA 1HBMB 3GYGA 3RBDA 3CJ4A 3GILA 2FB0A 4X64J 3NCQA 2HVEA 1HARA 1NH7A 2ZDPA 5F8LA 2R7QA 1NSKL 1XBWA 4E2FB 2ILYA 1KFDA 1HMVB 2A2CA 1N0VC 2VPWB 4CDIA 3HFVA 3J7Z5 3P5BP 4Y2AA 1RACB 3PX6A 4OZ5A 1QVFR 1OY8A 1EKSA 1FK9A 3ZZTA 1UVJA 3VGTA 5A8RB 1APSA 4FKXA 1JLQB 5IOLA 2DNHA 4ANDA 4MYTA 1S1XB 2XEXA 4F3MA 5ETMA 5H9FJ 4QZVB 4WXWA 3GFZA 3AJDA 4YR3A 2AEMA 1MG7A 4M5NA 2XLKA 4HT5A 1YDLA 4CQ1A 4ZS6A 1N0UA 4HR2A 2HG4A 3Q8VA 4YOEA 2R7XA 4FN5A 1UWBA 3HKWA 3LQVA 2VUGA 1RBAA 2NQPA 4ID8A 2M70A 4RNNA 1S9EB 3KJVA 3MM5A 3LF0A 5KFTA 4C9DA 3SFGA 3PW5A 3Q8QB 4JI8J 3JB9k 4Q0BA 1GMWA 3ZZZA 1CQNA 4PYAA 2RS8A 4WP3A 3KG0A 2CPXA 2OMOA 4ZPDA 2UXBF 5LJ5Y 1WG1A 2MPUA 1QSLA 4NA1A 1O51A 1IKYA 5J2MB 3PM9A 4UUXA 4MIWA 2CZ9A 4J9UE 1VQOS 4OI1A 1X9MA 1OQ3A 4AE5A 3AH6A 2WVCA 4NLSA 4DV1J 4NXMF 3GLJA 2K3IA 1IN0A 4EEYA 4X2BA 2R2RA 2G13A 3M32A 3DM2A 3DRXA 4AQYJ 2YH0A 2BYCA 4OJGA 1KS2A 1V3RA 2YBVA 3IBWA 2RRBA 5C7PA 2V8VA 1B0TA 3FEXB 4P10A 4DDFA 5D78A 4UY85 3C2PA 3L3CA 1NM2A 2E9RX 2BDPA 1CPZA 2EFOA 3AJ2A 3K7RA 2LQJA 1VI7A 5D3GA 4ED6A 2DGQA 4IDKB 3P96A 2VC0A 2WK4A 4X64F 4QWCA 3BGFA 1HI1A 4EO8A 3A12A 4N56A 4C8ZA 1MU2B 3Q2TC 1FDDA 2F65A 4USJC 3TRGA 1ZAWA 2RD5C 3SV4A 3PEHA 3KNAA 3KK3B 1FKPA 5K9FA 1S1UB 2NXNA 1OY6A 1H38A 3SEOA 1Q7YT 5JVGQ 4USMA 3GJQB 3HFZB 5HVFA 4MKYA 1IKXA 1F2GA 4WXOA 3FJ2A 2ALZA 2IFXA 3MZIA 4N77A 5HBMA 3HT0A 5D0EA 2D3UA 3LGNA 1REVB 4PQUB 4DQSA 2OMLA 2G0IA 3DRPB 3I96A 4O3SA 2WCXA 2Z2ZA 4RNHA 3S8SA 4JI0J 2DBBA 3S7RA 1NJXA 3TEGA 3CXCR 4GKJJ 5GAEU 2AYEA 4RU9A 5LJ3Y 1QUVA 1S57A 1YJ9S 1N5YB 4IOAQ 3MM9A 1CJKB 1RWOB 2JHEA 3H4DA 1QJHA 4PG5A 1N36J 4RW6A 4A48A 4JI8F 1I6JA 1UAWA 2Q66A 5E33A 1VQ9S 1CSJA 3HDSA 3W8PA 3HX9A 3NNHA 1KQSR 1NK8A 1QTMA 3PXGa 2FGCA 1CLFA 2CPJA 5GMEA 2XLIA 2MHNA 3M2VB 4F4KA 4DV1F 5KFBA 2GCFA 4DSKA 3TUPA 1VR6A 4EBCA 3AD7C 4FDFA 4AQYF 2VC1A 3V6JA 4CRJA 1JLAB 5C24A 2HFZA 5EN1A 4GC6A 4GVBB 3RRGA 2HNYA 1C4AA 3DOKB 1S12A 4MFBB 4DCOB 4ILMA 1R8AA 3CPWR 3AA8A 5DLFA 3CMAS 2RQ4A 2HFUA 2M88A 1WI8A 3BDPA 2BQ3A 4ECYA 1YJNS 2B4VA 1CC8A 3MMBA 4I4BA 5A0YB 2XY5A 3PNIA 4NLRA 5J1PA 3PZPA 3VGUA 4W90B 4OI2A 3OXLA 1H73A 2QYCA 1R8CA 2DIVA 3S1TA 2XHCA 3OR1B 2C3OA 3GSDA 1S6UA 4BWJA 3HSDA 5HJYA 2IM3A 5GMKa 2V4JB 3QO9B 3A1YG 4A8OA 2C2KB 4HT7A 5EWGA 1TK0A 2CG4A 1SB6A 1H2TZ 2HGLA 2DR5A 2X3DA 1RBLA 3M8QA 3IM9A 2GVZB 4NLYA 1HBOA 3AY0A 1GEHA 1DLOA 4I64A 1W2BR 1SPBP 1FRIA 3HVTA 2YKMB 2K7KA 4JI0F 4K5SA 4I56A 1YZ6A 1IM4A 1ZM4A 1BQNA 3V6KA 2Q1LA 4OLOA 4GKJF 2VASA 3UD4P 5BYSA 4DV6J 4OI3A 4V1Ak 2YNHB 4X65J 2Y0SD 1N36F 2Z30B 1VQ5S 3CD0A 1RP5A 1RKJA 3BQ1A 2PE8A 4RW9A 5CCLA 2AW0A 2ZOGA 5HQ8A 7FDRA 5C42A 4JI2J 3HJFA 3UI3A 3T6BA 1XMBA 1JJ2R 4QYZJ 3KYLA 4FXWA 1JWWA 3EGNA 3SXLA 1NNDA 2MQQA 3EGWB 1FK9B 4Q44A 4IUFA 1Y5IB 4OHXA 5EX3A 2NXUA 1MMDA 5BYQA 2HAIA 5GAHI 1ZETA 4C98A 4U7UK 2LQ5A 3ILOA 2C22A 3CUNA 2HIYA 4DF8A 4OYBA 3QZ7A 2V94A 1K0TA 2OELA 1SIWB 2Z8QA 3R6LB 1TQLA 3VWSA 5CAAA 3D2WA 2LLZA 4G6VB 2A0FB 2WVBA 4ICLA 1NSQA 5KT5A 5A8KA 4BDPA 1TZ0A 4O23A 4HVZA 1SV5B 4NLWA 4ECSA 3PTWA 2MSSA 1QLNA 1UWBB 1YQHA 4DV0J 1RCOB 4CLWA 5I3PA 3KJVB 3MM5B 2R8HA 2O5DA 1K44A 4NYOA 4JV1A 2NUHA 1QE1B 1D0EA 1U6BA 3BPDA 2NLWA 1DQ8A 5F8MA 1MSWD 3FNNA 3PR4A 1ZPVA 3K17A 3GCXP 1HL6A 1SQFA 1VQMS 3GIIA 3LAMA 3WDOA 3M8RA 3SYZA 1IKYB 2QC3A 3CC7S 1FRLA 2BJ3A 3CULA 1YK9A 1RAHB 5CA5A 5FIIA 1GMVA 2E1AA 3FC9A 4KGZB 3KLEB 1G1XA 3MCNA 2I38A 1D9AA 2UUBJ 2PIIA 4W92B 1KBRA 3M32B 1OS5A 2FJEB 3DM2B 3C16B 3QJPA 5FDLA 1WD6A 5E3PA 3OFHA 1P27B 3WHIA 2B5JA 2XGQA 3PIOQ 1SH3A 4FF2A 1WDDA 2G2ZA 2EKNA 2K1RA 4CO0A 1NXIA 3DDKA 2VA3A 4DV6F 3MUTP 3V4MA 4DSJA 3CDEA 4X65F 4RPFA 3MDFA 3QT8A 5KFPA 5GADU 4PUOB 2ZH8A 1XC9A 3C46A 4F8RA 2ZZNA 1IR2A 2UXDJ 2AZ1A 1RT1A 3QJLA 1KHWA 3FRZA 3W61A 4JI2F 1U1NA 3ISNC 5KFKA 2ZDOA 4F2RA 4FZVA 4WJBA 2GNKA 4FBUA 2AZ3A 2ZC3A 1DAXA 4B08A 3UDCA 1FKPB 3QWUA 5D77A 5CD4A 2IM2A 2AGPA 3KDNA 3THVA 1F5AA 4OI4A 4QWBA 2BBEA 2MZQA 1IKXB 2DRBA 3AOBA 1SC4B 1EJ7L 2MQPA 5IV4A 3CDUA 4YMEA 1NLKL 4ITSA 1NAQA 2DH8A 4M5MA 3NLCA 5KFAA 3HVRA 4DSLA 5A6PA 5EWEA 4OI0A 2HFNA 2J7UA 4N47A 2NYHA 1QD1A 1QAIA 4J9SA 3MXHP 1S1TA 1NDKA 2J8SA 3JYTA 4PQAA 4RL1A 1SVDA 3P45B 1UVNA 4OZ3A 4ZVUB 4DV0F 1HNXJ 3W66A 4ZCMA 2OJ3A 4KHMA 4NOHA 2ZNYA 2FVQA 4D3HA 2OAUA 3MM9B 4NEYA 3ISZA 3GYNA 3F73A 3RRKA 1U47A 1OSCA 3HCXA 1LQ9A 3AFGA 4L74A 3DXSX 5G4DA 2CDRB 1M90T 4RBVA 2QSFA 4KPCA 2POKA 1RDRA 4BCAA 4I6AA 3HSJA 2HBYB 5JVHQ 2C2EA 5M2RA 3BJYA 2N7YA 4TY9A 3MEGA 2ASJA 2E66A 5IS2A 2M0GB 3QLHB 2ZD1A 2UUBF 4LRBA 3B8HA 3BR8A 2ZBIA 3BSNA 3W2VA 5C24B 3PO5A 2HW3A 1JXEA 2W9AA 4TNOA 3K5LA 2HNYB 4M5JA 3DRSA 2DPJA 5FJ4A 1ZS6A 4YDXA 4LBIA 3W5XA 3N0VA 1EP4B 4LT6A 5CYQA 2H9ZA 4Y28C 4RNFA 3W9JA 1BWEA 4M5DB 1P1LA 2N3OA 2HRUA 4YQWA 5HO4A 3EXYA 4FYWB 3DU5A 1GXLA 3RB4A 2UVUA 1L3KA 3MMBB 2DXEA 1AFJA 1YRUA 2UXDF 1LWXA 4ECZA 1N54B 1B7YB 1YLXA 3V5RA 2HMIB 3CD6S 4NPOA 2PGCA 4UOGA 4JI3J 1MWQA 1LWCA 4A8KA 2LMIA 2AHOB 3DYAA 4G1QA 1URNA 1UL3A 2RT3A 3A13A 3HHEA 3IP0A 1DQ9A 1RYRA 1JLGA 1N5QA 2BJ7A 3M8QB 2IM1A 3CF5Q 1HBOB 2AMCB 3GYXB 2RILA 1BQMA 4CO4A 2ASDA 1DLOB 3PJWA 3FBCA 4K59A 2ZNZA 2KXNB 2CQHA 1BQNB 3I56S 2CJYB 2Z4PA 5B0CA 2KU7A 4IH5A 4NCGA 1M1HA 1HNXF 1F0XA 4LBPA 2W1BA 3Q8YA 2AGOA 2X7IA 1F1BB 4EBDA 2W8LA 1DZ5A 2BKNA 4RW7B 1HBNA 2E7VA 5BJRA 1DRZA 3CD5A 2IY5B 3DNCA 4RW9B 5KG2A 5C42B 2LYVA 3OR2A 3MTKA 1RUSA 5T7LB 2QG9B 5KFOA 2DCUB 3UN5A 2W7PA 2KHDA 2JNJA 3DOLA 1YG0A 1RWNB 3GPAA 3CJRA 2FGOA 3AQPA 3LWMA 4O0IA 4Q7AA 2VF3A 4CI0B 1U8WA 3F41A 3BEGB 1EX8A 2JEJA 3PRVA 4Y6IA 2DEJA 4O3NA 2J76E 1XERA 3IC1A 5DM7Q 2X1AA 5GVQA 3LP1A 2FZGB 1RJJA 5IT0A 3KG1A 1SJ3P 3CJQA 2ACYA 1YBTA 3AD9C 4OYZA 3MHYA 4ERDA 4ZLJA 3A3NB 4RNMA 1N33J 4MH8A 4LSLA 1X9SA 4ELVA 3HFKA 5F3TA 1VRQC 4X62J 1H6KX 2K06A 3MOZA 2HWTA 2PFDA 3B54A 3CT9A 3D0GE 1A6LA 4EYIB 4ES3A 2DGTA 4JI3F 3I5BA 1S1VB 2VPXB 4PPDA 2L08A 1NPPA 4OZLA 2W7OA 3KUGA 3UCZP 5F8HA 1VRUB 1ROFA 2OFHX 1YI2S 4PRFA 3EUNA 3CVKA 4X4UA 1SH0A 1Q1KA 3PFOA 4QW9A 1BC6A 3BREA 4LR9A 3NCRA 1UTAA 4ZPTR 4WFAQ 2DNPA 3TAMA 5FDLB 1VLYA 2FVSA 5HK4A 1B7FA 5HATA 3H20A 3TNVA 2B5JB 2OH2A 1ZM3A 3SMZA 3MECA 3D9BA 1C0UB 2R8GA 2V2QA 4DXLA 1RB0A 2DHXA 2G0CA 2K1RB 1JLFB 3GONA 2CQBA 3DKDA 1RXOB 4BHQA 1W26A 4ED5A 4OYXA 1T9UA 3RU0A 3ZNUA 2C2MB 1ZYQA 2BOPA 1IBKJ 3KFWX 3AJ1A 1X31C 2J0WA 2RDIA 3DMJA 3B4DA 2ADBA 4UOFA 2MQLA 2DCLA 2XYGB 1M5SA 1VK3A 4IKAA 1RK8A 4CLKA 4KGXB 2I6WA 3TUJC 4USVA 2B9WA 1D9FA 1TP7A 3IAS9 2GJIA 2DHSA 2AJ4A 3CCWA 2FYXA 2WZ1A 1X5OA 3OW2R 2HVIA 2Z58B 2M4MA 4KC5A 2LXIA 1LK5A 1FXLA 3QRPA 1VQLS 2BXJA 3QSYB 4XPEA 3ILLA 2BRLA 3R6GB 1AT1B 2VFSA 4TVAB 1BY9A 4DPOA 3IR7B 3NMRA 4OHYA 1LEOA 5IQ6A 3K58A 5HP1A 2YWGA 3BZQA 4IYQA 2DITA 1WKKA 1XN9A 1KP6A 3PCOB 4CTAA 4OX8A 1YGYA 1S1TB 3JYTB 1TKXA 1FXDA 3I9ZA 4LF1A 2FHOB 1NJIT 2JSXA 1NKBA 3SIPB 4X4NA 1N33F 2UV8A 5LMNJ 4X62F 3BPSP 4Y3CA 2XYPB 2Y3YA 1O6XA 2HS0A 4Q8EA 4K50A 2PA3A 1UVLA 2ZBPA 3S01A 2VONA 2HSEB 4RUBA 1S6PA 2YKPA 4DN9A 2VFTA 4QWAA 3C3LA 3JAMY 1X7VA 4DL0C 2AWZA 1CS4B 2WB1D 4LRAA 3IMQJ 2E1CA 1URRA 3Q2SC 4JV2A 3EDRB 2BABA 1T3NA 2GGPA 2LEBA 2XS5A 3H2VE 2XNRA 4QR2A 1R27B 1RAOA 3SCLE 4NXNJ 3WC2A 3M2UA 4R25A 2HLUA 1KWMA 3KLHA 1YTYA 3W2VB 1WC5A 3FFIB 3VAJA 2GA7A 4XDCA 3CCES 1NRKA 3FCVA 1Q8IA 4DOZA 1CJUB 2W2OP 3W60A 1OIAA 3DRSB 2AIRB 2JLEA 2N4CA 4ELUA 2GHVC 4OFZA 1IR1A 2Q3PA 2UV8G 5CYQB 5HROA 3EYZA 4PEOA 4IFVA 1IBKF 4Q2LA 2B4OA 3TVKA 5KG0A 3OQ2A 4TYBA 2FC9A 2XMWA 4UZCA 4LIWA 5CYMA 4X4SA 3TZYA 4LR7A 2VH7A 2IJNA 1XMOJ 2OPPA 3BBCA 5THWA 2PDAA 2JWNA 4KGMA 2OPSA 3GZ7A 4URQU 1LWCB 2F40A 1KD1T 1MWYA 3CSKA 4P75A 2YX1A 3THTA 3CGIA 3MF5A 4KB7A 2R7TA 3DYAB 1J5EJ 4G1QB 4IG3A 4KFBB 3KOAA 2LXUA 3NGUA 3DLHA 2RE1A 5DG9A 1JLGB 1ZBTA 2DNZA 1VCTA 4WP8A 5DLGA 5IWAJ 4KHRA 1Z4UA 4MKAA 1U4BA 4AT1B 3QGHA 1BQMB 1ZPWX 4AD6A 5CYJA 3E01A 4LF7J 1PYTA 5DJBA 1FDAA 4DPUA 3W9IA 1YJVA 2GFFA 4NCGB 2P5VA 2E9ZA 2BUNA 1FRJA 2GIFA 3M8ZA 1LWFB 5LMNF 1RGVA 4KBIA 3G2XA 3DDNA 3OBIA 2YTCA 2VOPA 1HBNB 1S49A 4QW8A 3DFEA 3QGGA 1FJ7A 1A0OB 5KT7A 1LWEA 3PIPQ 4K0KJ 1PO6A 3UN3A 4MTPA 4ETZA 3M6UA 3OR2B 4PABA 1U1QA 4ECRA 2LEPA 4Y0FA 3NS6A 2VFRA 3J7AN 4KQZA 3PW4A 4P7VA 4TKTA 2IAJA 4NXNF 4K4UA 2J5AA 3D1QA 3OSNA 3BO4A 1R7IA 2ZE2A 3MFHA 2W4CA 2KH9A 3HMJG 1M5HA 2I5JB 1F9EB 5DS7A 1YWXA 2RRNA 4N8OA 3C15A 4ILLA 3LP1B 2XTJP 4BLGA 3HF5A 4EZ9A 3C66A 2F3JA 4P52A 4C0OC 1H3DA 1X4HA 4RW4B 3FK4A 4CO3A 1H72C 1V3ZA 1H98A 1VBKA 3SQOP 2O66A 1RI7A 4XK8C 4HYKA 1XNRJ 3MWBA 2F7VA 1S1WA 3IS9A 3FQKA 1OWXA 3J81U 4O3OA 5KG3A 1XMOF 4B3SJ 4MT1A 4WFYA 4L75A 2VQFJ 5DM6Q 3J7A1 1BE4A 2YNFA 4JI5J 3JSYA 3MM6A 5CZVA 1M1KT 2BW7A 1X4BA 3P4UB 2LA6A 1X4EA 2OKQA 3I87A 3BO3A 1J5EF 4D3GA 1YJWS 3D6HB 3VV2B 2APOA 1VQKS 3IR6B 4J9QA 1RT2A 4BWMA 4LFBF 1VK8A 3H0PA 5GAEI 2OFGX 1T8EA 2MEWA 2I2YA 3W3SA 2NXJA 3RW7A 4K4TA 3NXZA 5KG5A 4Y2MA 3TAMB 3LTOA 4L76A 5BYRA 2KYXA 2ZBCA 4C0HA 2GQCA 1Y3KA 2XCAA 2FC8A 3AXMA 4LF7F 4DR4J 2LEAA 1H2VZ 1SQEA 4QYRA 4CWBA 2YNGA 4DSEA 3MR5A 2I0XA 2YX4A 2KRBA 4R5PA 2CVIA 2AD9A 1TL3A 4USTA 3O5TB 3AB2B 2ACMA 2K8GA 3DMJB 4EU0A 1WHWA 4IR1A 2HQIA 1FXRA 3GTYX 1HWLA 1X8DA 1MN7A 4Y00A 1GX6A 4K0KF 1I5OB 3TUZC 1EETB 3BDEA 2ZOMA 3C8YA 4OYPA 2EW9A 5K5MA 2CNLB 4JP8A 2CVEA 3OL7A 2ZUAA 3Q8UA 3CC2S 1FFWB 1AXQA 2AX1A 2ZKUA 2N4DA 2Z2LA 2L3MA 1RHQB 3FEYB 3THPA 1U7LA 1FNXH 2W2PP 2GS8A 1Q5YA 4IFYA 3DI6A 2RMLA 5FD1A 4HI2A 3QT5A 4PKDB 1H2UX 2DIUA 5DDQC 1Z2ZA 5HP1B 4YN3B 2KJVA 3R5JB 2MQOA 3RBXA 1NH8A 4CTAB 5HMZA 4F4ZA 1FCAA 1TKXB 4C3KA 4X4PA 5K8OA 3QGPA 4P9SA 1WEZA 3R1LA 2YWEA 5EWFA 2QV6A 2FUG9 1XNRF 4H54A 3UWTA 2V8GA 1TMJA 2BJ1A 1KR4A 4ED8A 4B3SF 5KTQA 2HHSA 2VQFF 2VIHA 4YFUA 1S76D 1S6PB 2HWHA 3N28A 4JI5F 1SXLA 5IV3A 1UEUA 3R1HA 3ZFVA 3VAHA 2KI2A 4FXVA 1VS3A 3JS9A 5B0BA 1HQ2A 2XSJA 1GXTA 2QT7A 2HFVA 4G3IA 5KFSA 2DY1A 2GGPB 2HZCA 3MOJB 3PW7A 3MPWA 3WX4A 1WI6A 4GVLA 4DF4A 4IQMA 2QTWA 2F5GA 2AU0A 1LW2B 3M2UB 2KKHA 4I2PA 2HAFA 3QIPA 4IRDA 1HFEL 3UNYA 1DHMA 1Y5LB 3CCQS 3EZ5A 2H5JB 4DR4F 3IGVA 4J9VA 1QAXA 4ZJQA 1SKSA 2VFVA 2MB0B 1HYSB 2KFZA 3EDQB 3DN9A 4PG6A 3CCVS 2VBZA 5HROB 3VALA 3CW2C 2XHWA 3OHBA 4IFVB 3SFUA 2LQ9A 3BH7B 1PJ7A 2IYIA 4NMLA 3B78A 4HH0A 4ZPVR 1TTHB 2LP4A 1E6YA 5CYMB 2B6AA 5E41A 1S59A 3NWRA 3D54A 1IQTA 2KB2A 3IA0A 4ZHRA 4X4RA 2J7KA 4QJVA 2J0SD 4CM0A 2AP6A 2Z0GA 3UFCX 3DXBA 2AF6A 2U2FA 4F7VA 2WONA 4R8UA 4HH1A 4DPTA 2FTRA 2J7WA 4KKOA 5DZ6A 1SJQA 3HPOA 3D6MB 3W9HA 1UJ4A 3W8GA 3GV5B 2CNNB 2UVRA 4P2MA 3OJSA 1RADB 3CCMS 4GO7X 1KVIA 4IG3B 2LFVA 4PWUA 2QMXA 1HHTP 2ZM6F 1PAUB 1HBMA 2X1BA 2DK2A 4OHZA 1HWUA 5HANA 2VKZG 1TUWA 1QDUB 3SV3A 1TV6A 3TJ9A 2XS7A 3KMSA 4ZJLA 2NPIA 1FO1A 3E01B 1CEZA 3CCLS 4RUHA 2XB2D 2CQPA 1IQZA 1YZ7A 4B02A 3OXFA 1F5CA 2CQ0A 2IDLA 2MZSA 4ZLLA 3RAXA 2R7RA 2OEMA 4ECVA 1FDNA 4I0WA 3ZTOA 4O3RA 4F02A 1JLQA 3TQEA 1ZAXA 1NPRA 4EZ6A 4NLUA 5J2PA 4X84A 1RKIA 3QFHA 3RZAA 5L38A 3W5ZA 3ZZ0A 3DGVA 2H51B 4X66J 3MCOA 2GIQA 4Y65A 3T5LA 1HLWA 4NLDA 3W65A 3WBZA 3QRRA 1X4FA 1UJ6A 1UJ5A 4CLLA 3KDOA 1WTFA 4ZVRB 4KPYA 5KOWA 1LXJA 2IAJB 2V2VA 3PYGA 4TLQA 4MIBA 2UXCJ 1IWAA 4JYAJ 4NL5A 4YHHJ 4K4WA 1X9WA 1M0SA 3FGVA 5MLCV 5GADI 2EFQA 2B8PA 2ROGA 4KTQA 5D4NA 2CADA 3BN4A 1DFDA 3H8YA 5KG4A 1WF0A 2AV5A 4ZVOB 2HVHA 3CO0P 4O3PA 1X5TA 2W2MP 1VQSA 1AUDA 4ES2A 4DV7J 1FX2A 3U1NA 2EK1A 3IO1A 4C7QA 1Z1ZA 2F4VJ 1RYSA 1S1WB 2J9DA 4AYBD 2JC1A 4CH1A 4PPZA 3KLVA 2E29A 2VQEJ 1JMTA 2YNFB 1HR0J 1SUQA 3MM6B 5GAGU 1X0FA 4MKVA 3KWMA 1P8GA 2DTJA 2P9GA 4IRKA 1C2PA 1L3UA 3CJ0A 4B3OA 2BANA 3EZOA 3TOQA 1RT2B 2AX0A 4EO6A 3ITHA 1DBDA 4CYUB 4DX6A 3PO4A 2C3UA 2GIRA 1R0AA 3HSGA 3OSPA 1UKUA 1WEXA 3C19A 4WU3A 2OLWA 4W4MA 2AJFE 2VBYA 4NYZA 3HD2A 5IC6B 4R0JA 3G6VA 2YNGB 1HWKA 5HVHA 4LVOP 4K2XA 2M8DB 3ISND 1XJWB 4R5PB 1PGZA 1TL3B 1RWPB 2V4QA 2IJFA 5T14A 4CLTA 1S48A 1HI8A 3ETOA 1SKRA 3JSMB 3CTRA 3BGUA 2EC2A 3P5TL 2DNKA 2MKIA 2VOOA 1RA7A 4X66F 3OTOJ 3DDIA 3IG1B 1UVKA 4CLUA 1J27A 3UVJB 3GJTB 3H40A 2IBOA 1GMWD 3G6XA 3BO2A 4C4WA 2W2NP 2FVPA 3Q83A 4G1PA 2BJ9A 3N9UC 5SUHA 3H5XA 4ER8A 2RSQA 3TAPA 1IBLJ 1CJVA 2MKJA 5JJBA 5KFXA 2MQMA 2UXCF 4IFYB 4JYAF 4YHHF 3DI6B 1CJKA 4ILRA 1D8YA 3CO9A 2GJFA 3ZO7A 3KK2B 2FJVA 3DLLQ 2W8KA 2ZWOA 4CM2A 2X1FA 3BBFA 4CO5A 4DQQA 1EAYC 2G2OA 2P6SA 3P8BB 3EXCX 1R3NA 5KFJA 3MCMA 4ATNA 4DJBA 3LOUA 4G65A 2Z2MA 2J0QD 4DV7F 2OUGA 3KHRA 4RU2A 1R0CB 2HIQA 3JXOA 3R97A 3GG1A 2GQQA 2I1RA 2DH9A 3M8PB 1CJTA 4C8OA 3Q24A 3T9NA 1JLAA 2O1PA 3AQOA 2KVQE 4DR5J 3J7ZT 2VQEF 2MZTA 1HR0F 3HP6A 4USUA 2KM8B 3D67A 1QVGR 2XSJB 3L95X 4KGKA 5EX0A 5ETKA 1NJWA 2KL8A 2RB7A 1DY3A 4WTOB 3DU6A 4BS2A 4DPYA 4FVMA 1KNZA 4J91A 3BGLA 4DR7J 2BW2A 3BB5A 4HEA9 4C0BA 1S7IA 4I2PB 4DG1B 3QIPB 1PYOB 2HPUA 1UP1A 2RVJA 3QPIA 2B51A 3IR5B 3M8WA 4K7QA 4P6QA 1ZAVA 4PWDB 4DS4A 4DFMA 3JSBA 3OL8A 3CJ5A 1HHQA 4ED1A 2QO3A 4DQIA 2ZFHA 3NGDA 5D4OA 5L1LA 3UR0A 1VMBA 3HZEA 4U6PA 1XQIA 5LL6d 2V4JA 3R27A 3NGRA 5CHCB 1HNZJ 1E6YB 2VB6A 2B6AB 2HBZB 1SKUB 3QT7A 3I31A 2XGPA 4P74A 3HLUA 5LSRA 2IVYA 1FJCA 2HFOA 3OTOF 4J9PA 2PT0A 2W25A 2PEBA 3KNGA 3VCDA 2M8HA 2R8IA 4AUKA 4ZVSB 2WONB 4I1TA 4R8UB 3QFWA 4KKOB 2RHQB 3H7HB 4DX5A 3VAMA 3LPYA 5KG7A 1IBLF 2NCKL 2DHAA 5F0UA 2YNHA 5B0EA 4MAKA 4WKYA 1RTIA 1RLCL 4HTJA 4C3MA 5KOXA 5C2CA 3H59A 1OSDA 2H65B 3HHLA 1RU1A 2QRRA 1T9VA 1VDHA 2ZJRQ 4UY8T 1TV6B 1HWJA 3ONQA 4ZIVA 1JLCA 3WIVA 4NA3A 5B09A 2XI2A 1ICEB 2KM8C 1ITPA 3UCUP 2X3GA 3DCAA 1UA1A 2Y1JA 2EG1A 3RBZA 3OT9A 2XQCA 4P7TA 2J6UA 2CNOB 2IM0A 1MROB 1CVJA 3MD1A 2KVIA 2MJNA 4YB6A 2VG5A 2ADCA 1ZM9A 2C1EB 5J2PB 2NZCA 2DR6A 3O6QA 4P2FA 4QBUA 1AROP 4DR5F 3UR3C 3F56A 4LVNP 3GQCA 3V6DB 2G0JA 3T6JA 3Q86A 1SCJB 1FWPA 1SC1B 4JI6J 3D7SB 1Q8KA 3JTPA 2NR0A 5L1IA 2VODA 1NHKL 2D9PA 1KTQA 1F9FA 1SV5A 2H1YA 5U47A 4DR7F 3QMQA 1HNWJ 1NK5A 4DSIA 4OMFG 2B4UA 1XK8A 4GO5X 1QE1A 3U7JA 1U1MA 4WCEQ 2FJBB 1S99A 1VQPS 5E0OA 4YS2A 2HGNA 2V63A 4USWA 1FERA 5IZHA 3PKMA 1F6TA 3OTDA 4DR2J 1ZZNA 4K4XA 1RE1B 3EWGA 1T7PA 2G2YA 2JH3A 1VJWA 1WC1A 2ZVIA 3MPUB 2CPEA 3QSIA 2ILZA 3KLEA 3UE2A 1UZHA 1SI9A 5E3QA 2CWKA 3M6WA 3LGHA 1HNZF 2K7JA 2GAHC 2XMTA 1NCLA 2KFYA 4ENOA 2JVOA 3FVYA 4WP9A 3C16A 1X5SA 2GV1A 4OX7A 7AT1B 4LRDA 3L7PA 3NRBA 1U2FA 1H7XA 1UW4A 2COLA 1VC5A 1KTVA 1SUQB 4YP3A 2J9DE 5KFRA 1FWLA 4I6WA 2IRYA 2FHJA 4QWDA 1KVJA 4NA2A 4B3OB 2ZUGA 5KG1A 1IM6A 2BANB 2FJXA 2JLFA 1NSAA 4DMZA 2HFSA 3TYTA 1RHKB 3ITHB 1V9OA 3L7OA 4PUOA 4X4QA 5ITHA 1R0AB 3N6NA 3MPDA 3QRQA 2CAJA 1U1PA 4FXDA 2E5HA 4UOHA 3GFYA 2KO1A 2DGSA 4OHWA 5SZTA 2EKYA 3KXDA 2FD2A 5LSOA 3BYRA 4LF2A 3TZXA 1J2VA 1T9XA 1MW7A 3TEHB 1HQUA 3AB4B 4ZP7A 3QBCA 2FJDB 1KN6A 2BE9B 2VPYB 2GZOA 1Q4RA 3GR0A 4AFFA 1XR5A 2V8DA 2W4PA 1WUUA 5FLXY 1WACA 4DZDA 2DNMA 5FLXU 5EDWA 3ET6A 1BUXA 4NZ7A 4CO2A 4JI6F 5I4MA 3OTEA 4CH7A 1RHRB 2Y1RI 2CQGA 4N7TA 5M2PA 4ZN3A 1S0VA 5JXSA 4QPTA 5KFGA 2O3DA 1CJVB 4DL4A 4OYOA 2XLJA 2CPDA 3R7NB 1HNWF 1Q5VA 2LECA 2BM1A 3ADAC 3MR7A 1FTCA 4B9NA 1KKHA 1U49A 4XDDA 3MUMP 1RZMA 1PILA 3P3DA 3NOCA 4RR5A 3OFFA 5F8GA 4DR2F 1F3VA 1VISA 1VYAA 2HQ3A 4NI2A 4IOCQ 1FDBA 2KT5A 3HO1A 1K9MT 1TAUA 3GIKA 4Z37A 1UFWA 5AXNA 3QLHA 1A9NB 4WFXA 3RR8A 1CJTB 3R3TA 2MJUA 4ID5B 2ATCB 2HK2A 1RWMB 2DNGA 1NHUA 4TY8A 4DCJB 3HJVA 3H2UB 5E2QA 1JLBB 5H9EK 2EG2A 3F0NA 2HHWA 4C97A 1EP4A 4IO1A 5K20B 1TK8A 3LW5C 3FSXA 4M5DA 4ZP6A 4PAAA 1WHVA 2RUGA 2QL5B 1TUVA 3UPFA 1U1LA 1MLAA 4NLTA 3D1HA 3K5MA 4F4AA 3PDNA 5DDRC 2WTFA 3GV7B 1TVRA 2JZ5A 2HQCA 2MTLA 3BSCA 2HMIA 2KDOA 2PEHA 2FVCA 4WFNQ 1SJ4P 2BRKA 4RBUA 4DL2A 3DRRA 4H4KA 1WSVA 3QAEA 3EGVA 4C8LA 1NKEA 3N5FA 1V6HA 1I3OB 4DHVA 4ED0A 1TU0B 1S0NA 1N5SA 4N76A 3DLKA 5DRKA 2YKNB 3V4IB 3V6HA 1KQKA 1NDPA 3OXGA 2VBWA 2LVWA 3OPKA 3HXMA 2CXEA 4LQ9A 4GMKA 2ALYB 3VAKA 1S72S 3QT6A 4LRFA 2MXYA 1EARA 2WBMA 3ZTRA 1AW0A 3VHQA 4FPIA 3GU0A 3IWXA 3CWJA 1UFKA 1TKDA 5H9FK 3M9NB 3HD1A 4BC9A 3OTCA 3R2DJ 3A8EA 1R8HA 4JI1J 1RTIB 1XR6A 2LXFA 3G6YA 4Q5VA 2HS4A 5B0GA 2H5IB 4R0EA 2IRUA 4RW7A 4PYDA 1K73T 4EBEA 3HHLB 2GW8A 4NLOA 1T03A 3G87A 3T5KA 2LU2A 1D09B 1JLCB 2H4WB 1HA1A 3MCSA 2YNIB 3HM9A 3U1MA 4CLSA 1S6QB 3TVZA 4DN0A 3PFEA 5T7LA 2XWYA 1ZM2A 2X51A 3KUEA 4UTGA 2D7SA 6AT1B 2YX7A 1U0HA 2CZ4A 3PRBA 2VG5B 2PN6A 3FMWA 1VOMA 1JIHA 4AL6A 2YQ3A 5HQLA 1RAGB 1RWKB 1U25A 4F36A 3DLGA 3F44A 1Q79A 2FIUA 4UQGA 4U96A 5B0AA 1OPIA 1NJYA 2DGWA 2ZZMA 3W64A 1AA1B 1E6VB 4PZVA 4DL3A 2W01A 5AXMA 3VVTA 2C3MA 2P9EA 2RNEA 2XO7A 1U09A 4YDDB 2HHUA 5F9LA 3H5UA 2N7CA 5A2QY 5KFLA 5A2QU 4C6AA 3GMGA 5B0DA 4LF4J 1K8AT 3R5AA 4ELTA 2DY9A 1NU4A 4OJ1A 2XI3A 2G1DA 1S4EA 1S1VA 2HKEA 2AT1B 3DOMA 1TK5A 4ECQA 1VRUA 2B7BB 1FNMA 1RHUB 1HW8A 4LF8J 4Y34A 1O5JA 5KFVA 1RAJA 2V0NA 2WOMA 1PBAA 2UUWA 1CULA 2U1AA 3HHLC 1WF2A 2BMBA 4HHHA 2Q6CA 4LF5J 3I4HX 2R2SA 4HLBA 3NNAA 2YXLA 1WSRA 4O44A 2V8PA 2YQ0A 4Z7YA 3IM8A 1JXVA 1C0UA 4KO0A 4OZ1A 3RB0A 2BQUA 3CDBA 4ZDNA 1JLFA 2QMWA 1R8PA 1QM9A 1VJQA 4HDGA 2NXEA 2OTLS 5CABA 1HD0A 4CNZA 4JI1F 4C8YA 3GFXA 2JEGA 1NPKA 2GHWA 4B3RJ 2MQ8A 1FX4A 2EFVA 3DLJA 4MK7A 2OGUA 2EWHA 3GB0A 5D15A 1G4CA 4PCQA 1GNKA 3UN2A 2A6OA 2HBRB 4B9UA 2WW8A 2VA2A 4M95A 2FLOA 2HRYA 1ZOTA 1B4SA 4JB8B 4NYPA 2HBQB 1HQUB 3CJKA 2UVWA 1UW9A 3RUBL 1L3TA 2IA0A 1VIXA 3KHHA 2W9CB 3KHGA 1Q16B 1BD6A 2BE7D 1ZH5A 5LM7E 3ET6B 4RUCA 5B08A 3WQPA 2M7SA 3PY8A 3EE3A 4NLXA 4Q2MA 2PFFB 2QSWA 3HT3A 4NLQA 4NLGA 2CA9A 2GO9A 3SCIE 2NSCA 4ZPAA 4ED3A 1NUEA 5C25B 4LF4F 4X4VA 2CQDA 4DBQA 4FPRA 1U2CA 2CDQA 3W1YC 4WKRA 2DGOA 5KFNA 4HACB 5DETA 4OJ3A 1CS4A 3V2UC 3R8YA 4NI2B 4NZ6A 1M5KC 1WELA 1UZDA 2IYGA 2VBXA 5L9NA 4LF8F 4DL7A 1FEEA 3VQTA 2YKQA 2MGZA 1RAEB 3BGRA 3PYEA 2E5GA 3MAAB 4TXSA 2D9OA 3MEKA 3BKUA 3FFIA 4LF5F 4JI7J 4TY8B 1CJUA 3NWGA 5BR8J 8RUCA 3MFIA 3M1VA 4L73A 3MPVA 2HURA 4EUVA 3TUIC 3R5BA 5KFMA 1PG5B 3OFEA 4B17A 2K2PA 4M5LA 3W5YA 2SXLA 3OUYA 1HNVB 3IRXA 4K4ZA 1YX2A 4B3RF 3KLGA 1RABB 3MEDA 1C1CA 2IC3A 1ZTWA 1F2HA 5J1NA 2WVDA 1TR0A 2IVFB 4KH0B 5H9EJ 4FNIA 3HKZD 4GKKJ 1R6YA 1DTQA 1RWVB 3T5JA 3IWNC 1H74A 1IXKA 3EPIA 1TVRB 2QLBB 4S0MA 1T11A 5L46A 3TZWA 4DV5J 1FD2A 3I5CA 1SL2A 2BZ2A 4MK9A 1RAFB 3DRRB 1U6FA 1IUJA 3KG4A 5KFIA 2VDHA 4MYUA 1S5ZA 4DUYJ 4PXBA 5D0RA 1NKCA 3MR3A 4KFBA 3BM7A 2QEXS 2OHDA 3DLKB 4DWIA 3TARA 1J5OB 2LDYA 4A47A 3G96A 3GFHA 4DU8A 2OD6A 4ZA1A 2X1GA 4ANEA 2AJQA 3N4WA 4KSEB 2V67A 1RAAB 1WC4A 1A7GE 1AB8A 5E7OB 4OV6A 2JLGA 2XMUA 4ZKAA 1N6QA 1DJ0A 2JEFA 1N5VA 2VZ9A 3BYPA 1CG2A 2GAGC 4JV0A 1RAIB 2BA9A 1HPZA 3C14A 1RT5A 6FD1A 4IG0A 1LWFA 3M9OB 3VZIA 1F60B 2C3PA 4OZNA 1FJEB 1MN9A 3VAGA 4FF1A 3LALA 4YY3J 5J2NA 4YB1P 1T03B 3I0RA 1G7CB 1XTZA 3GJSB 2XZTB 3G82A 4M5HA 4M5IA 1M5VC 2JFKA 2VDIA 2V69A 5GMDA 3CE8A 1FRHA 2R7VA 5GAGI 3B4MA 5I42B 2GC8A 1KEKA 4JUZA 1DTTA 4FS1A 1SQGA 4RJVA 1U0HB 1UPPA 4O4GB 2ZH5A 4ZP9A 3J80Y 3T3FA 1S6OA 3J80U 2I5JA 4JI7F 1RTDA 3I0SA 4C11A 5BR8F 3DLGB 1NZAA 3BKTA 8AT1B 5CH7B 2AJ2A 1XEZA 3MAHA 4RZRA 3R5GA 2NPFA 4CNYA 4UOCA 3TA2A 1OPZA 5KFCA 2CWXA 3RR7A 1PIEA 4H4KC 4RW4A 4ZVEA 4TN2A 2MYFA 1NO8A 1D8ZA 3EM1A 1WKJA 5KFEA 3E3XA 1Y4ZB 2D1CA 2WAQD 3UDLA 1YHQS 4GKKF 1QSSA 1VGYA 3NKYA 1KRPA 2HHHJ 3A3PB 1QY7A 3CJ2A 1JJ4A 2A10A 4DV5F 2VV5A 1X0PA 5L9XA 2M52A 4F4WA 1ZA1B 3QZ8A 3H98A 3KJQB 3DOMB 2DR8A 1C0TA 1N32J 4OYAA 4DUYF 5HAOA 1L3SA 2ZBRA 1FNOA 3T5HA 2GJ2A 4ZK7M 4OX9J 5D4PA 4LRCA 3FCHA 3M30A 1N4LA 1TL4A 1BGXT 3L09A 2WOMB 3LP2B 3MURP 1CULB 1LXNA 2W2QP 4CLFA 1WOPA 2MKHA 4FS2A 2QJ3A 3D28A 4QIGA 4KGVB 2AEJA 3NGKA 1HQEA 3T9ZA 2UUAJ 4HI1A 5IT9Y 4PG7A 1NDLA 5IT9U 4DX7A 4O44B 1Q82T 3TWZA 1ACMB 5G0RA 2CJAA 4KO0B 1RTZA 1VLOA 2IPOB 2OIHA 1BXNA 3HSZA 2EPIA 2KXHA 4NCBA 3QGIA 3K8VA 3ZZYA 4OYMA 3KJNB 3UO0A 2RS2A 2W9BA 4FBTA 2FLLA 5L39A 5DO2A 1ZTTA 2AYGA 3GSIA 1YSJA 3VZHA 3NGSA 4YY3F 4M1KA 1IKVA 2MZJA 4K2JA 4CCHA 2ZH2A 3SDEB 1X5PA 2N3LA 2DRDA 4OQJA 1Q53A 1EETA 2YPYA 2F9DA 4FF3A 3K89A 3QIDA 3RAMA 4ZVHA 2H54B 5K8PA 5HMYA 5AE1A 4A8SA 4C8NA 2B3TB 2WVFA 4RNOA 3CJKB 2HVZA 5E3CA 3G4SS 1GX5A 2UZAA 2E44A 3AOCA 3OFGA 2PI4A 1WF1A 2HNDB 4KHPJ 3AA9A 4B9MA 1FESA 3MMAB 1FA0A 1S79A 2E5JA 1S9GA 4MKBA 1YJUA 1TFWA 4CT8A 4OLPA 3AOAA 1SC3B 4QPXA 3U02A 2EBEA 4FNHA 4URSA 2L48A 1MNEA 4G1IA 4OJHA 3I4PA 4KT0C 2HNZA 3G86A 2M2BA 2C2RA 2FZCB 1HD1A 5K14B 1P9YA 4LSNA 2DEIA 2HHHF 2QLXA 3PV8A 3DLBA 4L72B 4LQ3A 3M8YA 2L9NA 3TVYA 4B3MJ 2A18A 4EI2A 3JAMU 4XO0A 3T1AA 2C3YA 2XMVA 4ED7A 3KTQA 3NBPA 1MMLA 1N32F 5F8NA 1S77D 4U8YA 2XMMA 2KHCA 3PHTA 5J1EA 4NRUA 4OX9F 5HL7Q 2MGZB 4AL7A 1FVQA 1SL1A 3BGRB 3J7YI 3BQ2A 1NK0A 5AE3A 2B4PA 1LW2A 4KYZA 4DLGA 4QIWD 1O8BA 5L8RC 2XY6A 1RTJA 2H3EB 3VF0B 4DPWA 2JJ4D 3NAIA 3X3UA 2UUAF 1TL5A 3M1VB 1AUSL 5H1SV 4EGLA 4ANCA 1TUGB 2HHXA 3PJ9A 2RQKA 3ZC4A 1WKLA 1HYSA 4YEAA 1UEVA 3ZZUA 4USHA 3OUYB 3DHWC 2OP5A 3IRXB 3KLGB 2DGXA 2CYYA 1YIJS 2E7XA 2KG0A 1LNQA 3SZ2A 4YR2A 1U8SA 1WHYA 2DGVA 3MEDB 1C1CB 3SSSA 2IC3B 3CCSS 4DSFA 9ATCB 1DTQB 2PA8D 4AXIA 4WF9Q 3D3CJ 4HHJA 1YJ7A 4PXDA 4UUWA 1U1OA 4ZVFA 1EQMA 1M5OC 3ILJA 3P49B 2HLTA 3SCKE 2ZJQQ 5CQGA 1YVFA 5AT1B 1Y3JA 3W7BA 1M5PC 1X4AA 4KH1B 1NZ8A 4NZ0A 1T95A 2YWHA 1U1RA 1N52B 1PJ5A 2R7WA 3NEKA 4DQRA 1RHJB 1VHFA 3GCWP 1REGX 1YJRA 2ATLA 5IT4A 1VQ4S 4KHPF 2KG1A 1IVZA 3LUYA 1WWHA 3C6UA 1N6QB 1L3VA 3NG8A 3OVBA 3BQ0A 3HULA 2ZWPA 1FD8A 5RUBA 1Q0NA 3K8WA 2KRRA 2YKAA 2D74B 1FTRA 2DNQA 2L9WA 1HPZB 3DRYA 3C14B 1IWGA 4DEZA 4F25A 4F50A 3ELHA 1RT5B 3AXKA 4IG0B 2E1PA 4KR0B 2KXFA 3ENWA 4UQTA 5DZ7A 2CG8A 5J2NB 4I67A 5CCMA 3I0RB 2ZHBA 3ETMA 3G82B 4ZP8A 2KJWA 2V2ZA 1V3SA 4B3MF 1FKOA 1RT4A 4CLZA 2YY3A 3D1OA 4RW8A 2DB1A 4TU9A 5DGBA 2JC0A 2ZVSA 2MMYA 4C8MA 2ZH9A 1KHVA 2NXCA 2NZ4A 2XY7A 2HVDA 1R43A 1JLEA 1YBAA 4X4TA 4FYVB 3FCWA 1DTTB 1UWAA 2DO0A 4LIRA 2YQ1A 1Y5NB 2JEIA 3R2CJ 4J7CA 5LOQA 1GAOA 3PACA 2OD4A 4IH6A 5F0WA 5KAKA 3N01A 1WEYA 5DDPC 3NCPA 1U2RA 1RTDB 3D66A 3I0SB 3K0JA 4J9NA 2I9SA 4C11B 1EQ0A 2QFIA 1Q95G 1I1GA 5EUHA 2Y1IA 4ED4A 2WSCC 4Q0BB 5ADZA 4LF6J 1SIZA 2R3VA 3QQCD 2J6SA 4N8NA 2UP1A 2R9LA 3X1LB 4F2SA 1RTHA 1GT8A 2FY1A 2ERRA 1NK7A 1VQ6S 3R9LA 2RF2A 4DU7A 4F0KA 1GQEA 5I3UA 4DS5A 5IXUA 5DQIA 2FDNA 4WFBQ 4WIQA 1Q7LB 2DHGA 5IQQA 3ZTQA 4I6YA 1NB2A 4B3TJ 4KV8A 1RCXB 3PRDA 3IGNA 1VBZA 4NWBA 5AJ3J 4WYWA 2AQ4A 4OL8A 2OEJA 5LMUJ 1B70B 4J37A 1D9DA 4IQXA 2YWWA 4U9RA 3V81A 2D3O1 3EJMA 1WC3A 1C0TB 3IRWP 3EICA 3NS5A 5KFFA 1D1UA 1UA0A 3VAIA 4K5RA 4WE1A 3NS7B 2HQFA 3M30B 1GTHA 2LU1A 2BJEA 4UF4A 3KLFA 4TLRA 2GQ2A 3DLEA 1WHXA 4CYUA 2P9CA 5D3GB 1RT3A 2MQNA 4OV1A 1VQ7S 5IWAF 1X4GA 2ZEJA 5D8HB 2BR0A 1HNIA 1HQEB 3AHPA 1R6VA 1YKWA 1DQAA 1HIYA 3U1LA 2CQIA 2GMHA 3RGIA 2BKPA 4I68A 5G0RB 3PKYA 4I7FA 3PEJA 3EZUA 1FWKA 2OI2A 1NK6A 1NBEB 1FVSA 2W9BB 2V2KA 1UMJA 2XWXA 2MKCA 2YWFA 3RW6A 2HZAA 4EWTA 2QA2A 2D3ZA 1IKVB 2DXFA 3JSMA 4USIA 1OMSA 4TQRA 3T41A 4I69A 2M9KA 3NGTA 2XZWA 2RQMA 1U26A 3IG1A 3UVJA 3OL9A 1WTBA 3MMCA 5HBMB 2XS2A 3S6EA 3LAKA 1RT6A 2F9JA 1XR7A 2OEKA 4F0MA 3IWLA 4OIXA 1UVMA 2DISA 2R4FA 4TU7A 2ZH7A 3VTIA 4A8QA 4ZPWR 3JTNA 1T0TV 5IM0A 4WYLA 4KY3A 2G1HA 5E3AA 3KK2A 2H5EA 2AYMA 2ZZTA 3IFEA 4U67Q 1S9GB 4DFKA 1S97A 4RW6B 2DHHA 4LF6F 3H90A 2QA4S 2KZMA 4WTYA 3CC4S 1T9TA 3TJAA 1FI4A 3EVOA 2MZ1A 2WRMA 3Q23A 2VU5A 5DG8A 3FDSA 2HNZB 4M8LA 3IBCB 4WZMA 3M8PA 4B3TF 3D6TB 1T94A 3FZ2A 4LSNB 4J9MA 4TU8A 3C6TA 1B0PA 1UETA 2OPRA 2BX6A 5AJ3F 5LMUF 4UT4A 3MR2A 4ZLPA 2ZITA 4LJMA 2NSBA 3JSRA 3FRYA 3GE9A 4K8RA 2ZHAA 3MTJA 1T9WA 3HHNB 3NBPB
chains in the Genus database with same CATH topology
3SCLE 4TY8A 1G2EA 3Q8SB 1QUPA 2PD1A 3WC2A 3H2UB 5E2QA 3M2UA 4R25A 2HLUA 5F41A 3KLHA 3PX4A 3MUVP 3WC0A 1YTYA 3QJJA 5J1EB 1JLBB 3SSQA 3M6VA 3W2VB 2C28A 2EG2A 3FFIB 5KFQA 3T19A 1JXLA 3VAJA 2GA7A 2HHWA 4E98A 4XDCA 3CCES 4C97A 1NRKA 1IJEB 1Q8IA 4DOZA 1F5BA 2DR9A 1EP4A 3MD3A 4IRCA 1OIAA 4IO1A 1TKTA 2JOQA 1TK8A 3DRSB 4DG1A 3LW5C 4DL6A 1FRMA 4YB5A 2HHTA 5A0YA 2JLEA 2N4CA 4ELUA 1RTJB 3FSXA 4M5DA 3T1HF 4ZP6A 2GHVC 3U27A 1WHVA 4OFZA 2RUGA 5L1KA 2KYZA 3CDAA 3VQSA 4PWDA 1NJZA 1WG4A 2XC9A 2MY7A 2Q3PA 1SKWA 2UV8G 5CYQB 1TUVA 3UPFA 2VL1A 1LFPA 1P6TA 3Q8PB 1U1LA 2V9WA 4HDHA 2KN4A 4NLTA 5HROA 3EYZA 3D1HA 3RBEA 2NYIA 3K5MA 2EK6A 4IFVA 3PW0A 1IBKF 2K3KA 3PDNA 4Q2LA 2B4OA 5DDRC 5AXKA 3TVKA 2WTFA 3GV7B 5KG0A 2CJ9A 4A8XA 3OQ2A 4TYBA 4ZCKA 2FC9A 3PW2A 1TVRA 3OR1A 2JZ5A 2XMWA 3TI0A 4Q8FA 1QAJA 1Z2LA 3BSCA 4V19J 2HMIA 4LIWA 5CYMA 4X4SA 1JKHB 1K1QA 2KDOA 5F3ZA 5L1JA 2PEHA 2FVCA 2VH7A 4N41A 3SQGB 3UCGA 4WFNQ 4ZPCA 2KFNA 2DNYA 3QO9A 2IJNA 3K57A 1SJ4P 3MM7A 2OPPA 2BRKA 4RBUA 5THWA 3DRRA 4H4KA 4ECWA 4F4XA 4DL2A 1Q81T 4K4VA 2PDAA 3QAEA 2HHPA 2JWNA 4QIEA 4DX8H 1U45A 4KGMA 2RRAA 4C8LA 2OPSA 4ZHRB 1NKEA 3GZ7A 3N5FA 4URQU 1LWCB 1V6HA 2F40A 1FKAF 2FLNA 5M2UA 4DHVA 2BQRA 2ZOFA 3KLIA 1KD1T 4ED0A 1MWYA 3HK2A 1N8RT 3CSKA 1S0NA 1N5SA 4N76A 3DLKA 5DRKA 3CEDA 2EI5A 3OVSA 2YKNB 3V4IB 2YX1A 3V6HA 3THTA 3CGIA 2MKSA 1KQKA 2EBGA 5E3RA 3MF5A 4KB7A 2YKMA 2R7TA 3DYAB 2MHEA 1BQXA 3OXGA 3ZZRA 4DUZF 1Y00A 2VBWA 4G1QB 4IG3A 2LVWA 3OPKA 4KFBB 3HXMA 3KOAA 1VRTA 3E51A 2LXUA 4LQ9A 4GMKA 3EPGA 3DLHA 3CDWA 4OZJA 5F8IA 3J7YU 3VAKA 2RE1A 1S72S 2ZH4A 2MXYA 2FJAB 3HVTB 3W2WB 2R7UA 5DG9A 2VD3A 4FVCA 3CCJS 1JLGB 4J9OA 2WBMA 1ZBTA 2DNZA 5KFWA 5DLGA 4J5OA 4KHRA 1Z4UA 3RTVA 1AW0A 4MKAA 1U4BA 2HWIA 3TA1A 4F3OA 3ICLA 3E8OA 3QGHA 2AGQA 4P2SA 1HBMB 1BQMB 3OVAA 1ZPWX 3IWXA 3RBDA 2ROEA 3CWJA 4BBYA 3CJ4A 3GILA 1TKDA 2FB0A 3M9NB 4BC9A 5CYJA 3OTCA 3NCQA 3A8EA 1R8HA 3E01A 1HARA 1NH7A 1RTIB 1XR6A 2ZDPA 2LXFA 4A46A 5F8LA 4C2MA 3G6YA 2R7QA 2J9CA 5DJBA 4Q5VA 1XBWA 4PR6A 2HS4A 1FDAA 2CQ3A 2ILYA 5B0GA 1KFDA 1HMVB 3WZ0A 1YJVA 4CO1A 2GFFA 4R0EA 4NCGB 2A2CA 2IRUA 4RW7A 2P5VA 2YH1A 2QZ8A 1K73T 4EBEA 3HHLB 2E9ZA 1W25A 2BUNA 1N0VC 3C6UB 2VPWB 1FRJA 2GW8A 4NLOA 3RYLA 1T03A 1LWFB 3J7Z5 2R8KA 5LMNF 4Y2AA 3T5KA 1RGVA 1KC8T 3PX6A 4KBIA 4OZ5A 1NK4A 1QVFR 4J9RA 2LU2A 3DDNA 3FQLA 3OBIA 5MAOA 2VKRA 1JLCB 2YTCA 2VOPA 1HBNB 1S49A 1FK9A 4ZPBA 3ZZTA 1HA1A 4QW8A 3DFEA 3MCSA 1UVJA 1UVIA 2YNIB 5A8RB 3QGGA 3HM9A 3U1MA 1N88A 1FJ7A 1APSA 1S6QB 2AJ1A 3RB6A 3TVZA 5KT3A 1JLQB 2DNHA 1MROA 4MYTA 3FZBA 4DN0A 5DQGA 3PFEA 1S1XB 3POTA 5T7LA 5KT7A 1LWEA 2XEXA 1ZM2A 2XWYA 4F3MA 1R89A 4ZCIA 1C4CA 2X51A 5H9FJ 3PIPQ 4QZVB 4WXWA 3R5DA 1PO6A 3GFZA 4MTPA 2CPFA 2D7SA 5T41A 4ETZA 3M6UA 3OR2B 2YX7A 4YR3A 1U1QA 2YWKA 4ECRA 2LEPA 1LW0A 4Y0FA 2CZ4A 1FKOB 3NS6A 2VFRA 3V6DA 3PRBA 1RT4B 2XLKA 2VG5B 4HT5A 4KQZA 2PN6A 3PW4A 4CQ1A 4ZS6A 1N0UA 4RW8B 4OI6A 3FMWA 1VOMA 1JIHA 4P7VA 4AL6A 5LXRA 2HG4A 2YQ3A 4TKTA 2IAJA 4L3NA 2QFJA 4NXNF 3FSIA 4K4UA 1U25A 2BJDA 2J5AA 3D1QA 3DLGA 3F44A 1Q79A 2E9TA 3OSNA 3BO4A 2FIUA 2PO4A 1JLEB 2R7XA 4FN5A 5DGAA 4UQGA 1R7IA 2ZE2A 5I3QA 4C8KA 3MFHA 2W4CA 2KH9A 4ICLB 1UWBA 3MM8A 2MSTA 5B0AA 1OPIA 3HKWA 1M5HA 2I5JB 3LQVA 3HMJG 2VUGA 1NJYA 2NQPA 4ID8A 4LFCF 5DS7A 2DGWA 3FEZA 1YWXA 2RRNA 2M70A 4RNNA 5A8KB 1S9EB 2ZZMA 3KJVA 3MM5A 3LF0A 1E6VB 4DL3A 4N8OA 5AXMA 4ILLA 4WK3A 2LA4A 5KFTA 2C3MA 4C9DA 2P9EA 2RNEA 2XO7A 3LP1B 1U09A 3SFGA 3HF5A 4EZ9A 3PW5A 4E8UA 3C66A 4YDDB 2F3JA 2FHKA 2O01C 3Q8QB 2HHUA 4C0OC 4ECTA 3JB9k 4Q0BA 3ZZZA 1CQNA 5F9LA 4QIFA 3H5UA 2N7CA 2RS8A 1H3DA 1X4HA 3KG0A 2DVIA 4RW4B 2CPXA 2OMOA 4ZPDA 2UXBF 2E5LF 5A2QY 5LJ5Y 1WG1A 5KFLA 2MPUA 4CO3A 3UD3P 1QSLA 4NA1A 1O51A 3GMGA 5B0DA 1IKYA 2VG6A 3DC2A 5J2MB 4QU7A 1V3ZA 1H98A 3PM9A 4UUXA 4ZVGA 1K8AT 4ZCLA 2O66A 3R5AA 4ELTA 1RI7A 4XK8C 1NU4A 4MIWA 4HYKA 4OJ1A 2XI3A 2PMHA 2G1DA 2DGUA 3MWBA 2F7VA 1RTHB 1S1WA 3GWCA 3IS9A 1Q8LA 1VQOS 4OI1A 3BS9A 1OQ3A 1X9MA 3FQKA 4AE5A 1OWXA 3AH6A 1S1VA 4O3OA 5KG3A 2RF2B 2NS1B 1XMOF 3N5BA 4NLSA 5I3UB 3QYYA 4WFYA 3DOMA 1TK5A 4NXMF 4ECQA 2K3IA 1IN0A 1VRUA 4EEYA 2B7BB 4B9VA 1VQ8S 5DM6Q 2IA6A 3J7A1 2YNFA 4NCAA 3NMAA 1FNMA 1SJ1A 4X2BA 3JSYA 1HW8A 3MM6A 2R2RA 2G13A 3M32A 5CZVA 1M1KT 3DM2A 4DFJA 3DRXA 4KV8B 2YH0A 4Y34A 2DNRA 1O5JA 1KLMA 4NX9A 5KFVA 1VIOA 2BYCA 4OJGA 1RAJA 1KS2A 3EX7B 1V3RA 1X4BA 2V0NA 3IBWA 2LA6A 2WOMA 2RRBA 1X4EA 2V8VA 2UUWA 3K5PA 3HHLD 2OKQA 1B0TA 3FEXB 2U1AA 3I87A 3BO3A 1J5EF 4DDFA 4D3GA 1N34F 2GMJA 1YJWS 5D78A 4UY85 4CIOA 3HHLC 3V81B 1WF2A 3C2PA 2APOA 3L3CA 1VQKS 3IR6B 4J9QA 1RT2A 3EGZA 2Q6CA 4BWMA 4LFBF 2E9RX 2BDPA 1VK8A 5GAEI 4U7CA 2OFGX 3I4HX 2R2SA 5HMWA 1T8EA 1CPZA 2EFOA 2I2YA 2G4BA 3AJ2A 3W3SA 3K7RA 4HLBA 3RW7A 1LK7A 4K4TA 4V19X 3NNAA 1TKZA 2LQJA 1VI7A 5D3GA 4O44A 2HHVA 4WE1B 5KG5A 4Y2MA 3TAMB 4ED6A 1IBMF 1C0UA 4KO0A 5BYRA 4OZ1A 2DGQA 1KONA 2KYXA 4IDKB 2ZBCA 4C0HA 2V9KA 4MK8A 3P96A 3KLFB 3RB0A 2BQUA 3LGMA 2R2TA 3CDBA 1VBXA 4ZDNA 4LF9F 3DLEB 1JLFA 2GQCA 2VC0A 2WK4A 5EGYA 2QMWA 1S7HA 1Y3KA 4X64F 1R8PA 1QM9A 1RT3B 4HDGA 2FC8A 2XCAA 3MEEA 4ETXA 4QWCA 3BGFA 2OTLS 4LF7F 1HI1A 1HD0A 4CNZA 3G6ES 4JI1F 4C8YA 3GFXA 3Q0AA 2LEAA 1H2VZ 1SQEA 2XB2D 2JEGA 4QYRA 4EO8A 3I9V9 2YNGA 2GHWA 4ED2A 4DSEA 1HNIB 4N56A 4C8ZA 3OLAA 3MR5A 2I0XA 1MU2B 2YX4A 2EFVA 2KRBA 3CIZA 2J0XA 3DLJA 4MK7A 4R5PA 3Q2TC 2CVIA 2B43A 2EWHA 1TL3A 3GB0A 2AD9A 4ECXA 4I7FB 1FDDA 1RT1B 3O5TB 4AXJA 5J2QA 3AB2B 4USJC 3NAHA 4PCQA 3TRGA 2K8GA 1ZAWA 2RD5C 3SV4A 1GNKA 1TK0A 2CJKA 3DMJB 4EU0A 1WHWA 4IR1A 3PEHA 1N48A 2HQIA 1FXRA 1HWLA 4QQBA 3KNAA 1X8DA 2JFDA 3KK3B 2ZH3A 4B9UA 1FKPA 5K9FA 1S1UB 2EFNA 4Y00A 2RJZA 3QAUA 2WW8A 2QA1A 1GX6A 1H38A 3SEOA 4J9LA 2VA2A 1Q7YT 1MMNA 1RWUA 3LP0A 1NK9A 4DR3F 5JVGQ 4M95A 2FLOA 4K0KF 2HRYA 4MKYA 1ZOTA 1IKXA 3TUZC 1F2GA 1EETB 5HI7A 4RUAA 3RRHA 3BDEA 2ZOMA 4NYPA 3C8YA 4WXOA 3I82A 1HQUB 3CJKA 2UVWA 3R5CA 3FJ2A 2EW9A 5K5MA 3TX8A 2ALZA 2FLPA 2IFXA 3MZIA 4N77A 5HBMA 4H4MA 4DV3F 2CVEA 2D3UA 3LGNA 4F26A 1REVB 1NHVA 3OL7A 1L3TA 3CC2S 4PQUB 1AXQA 4DQSA 2IA0A 2AX1A 1ELOA 1VIXA 2OMLA 3DRPB 2CFXA 2ZKUA 3I96A 4O3SA 2WCXA 2N4DA 3KHHA 2W9CB 2ASYA 3KHGA 3MMCB 2Z2LA 4RNHA 2L3MA 3S8SA 3FEYB 1FE4A 1Q16B 2AJ0A 1RT6B 1BD6A 2DBBA 3THPA 1U7LA 3S7RA 1NJXA 1FNXH 2A2DA 3CXCR 4RKUC 4IFYA 1ZH5A 3DI6A 4LUBA 4RUCA 2ZH1A 5GAEU 2RMLA 5FD1A 1I94F 3H5SA 4HI2A 4PKDB 2AYEA 4RU9A 1KQFB 1H2UX 2DIUA 5LJ3Y 1QUVA 4TQSA 1JNRB 5B08A 1YJ9S 2CKWA 5DDQC 2M7SA 3PY8A 1Z2ZA 1N5YB 2A3JA 5HP1B 4IOAQ 2MDAA 3MM9A 3CJ3A 4NLXA 1YITS 4Q2MA 2JHEA 2KJVA 5IM0B 3H4DA 4LMZA 1QJHA 4PG5A 3M6XA 3NL0A 2PFFB 2QSWA 2EFGA 4RW6A 1NH8A 2MQOA 3HT3A 3KMQA 4A48A 4JI8F 4CTAB 5HMZA 4NLQA 4NLGA 4F4ZA 1FCAA 1I6JA 1UAWA 1TKXB 4C3KA 2Q66A 5E33A 1VQ9S 2GO9A 1CSJA 3HDSA 4X4PA 3SCIE 2NSCA 3HX9A 5K8OA 3NNHA 4ZPAA 2DR7A 3QGPA 2HGMA 1KQSR 1NK8A 1QTMA 4ED3A 1WEZA 3PXGa 2FGCA 5C25B 3R1LA 4LF4F 2YWEA 4X4VA 2D41A 1CLFA 2CPJA 2CQDA 4DBQA 4FPRA 1D3WA 5EWFA 2QV6A 2CDQA 2FUG9 3HVWA 1XNRF 1YRXA 2XLIA 4H54A 3UWTA 4WKRA 2V8GA 2DGOA 5KFNA 1KR4A 2MHNA 4ED8A 3M2VB 5DETA 4OJ3A 1QSYA 3V2UC 3CCRS 4F4KA 4DV1F 4B3SF 5KTQA 2HHSA 2P6TA 2VQFF 5KFBA 2FHJD 4NZ6A 4YFUA 2GCFA 1WELA 1M5KC 1S76D 4DSKA 1S6PB 2IYGA 4EBCA 2HWHA 2XCPA 3CCZA 2F4VF 2VBXA 3N28A 5L9NA 4JI5F 4LF8F 4DL7A 1VBYA 4NLVA 1FEEA 1SXLA 3SI8A 1UEUA 4AQYF 3R1HA 2VC1A 3MEGB 3ZFVA 3VAHA 3C6TB 3V6JA 2KI2A 4FXVA 1VS3A 3BN7A 3VQTA 1JLAB 2YKQA 5B0BA 2XSJA 2MGZA 5C24A 1GXTA 2QT7A 4ID5A 2OPRB 2ZD1B 3BGRA 4WK1A 3MGJA 4G3IA 2HFZA 2VFUA 1BLUA 5EN1A 5KFSA 2KZZA 2E5GA 2GGPB 2HZCA 4GC6A 3MOJB 3PW7A 3MPWA 3RRGA 2XMKA 2HNYA 3WX4A 1C4AA 2D9OA 3DOKB 1WI6A 4L6V3 4TXSA 4MFBB 3MEKA 1JLBA 4E0DA 4DF4A 3FFIA 4LF5F 4IQMA 3TA0A 4ILMA 3IN5A 1RISA 4TY8B 3TANA 2R7OA 1R8AA 3CPWR 2AU0A 2J6TA 1LW2B 3AA8A 3M2UB 1HHSA 2KKHA 3NWGA 3MFIA 3M1VA 4I2PA 3TQ1A 3QIPA 5DLFA 3CMAS 2DH7A 3MPVA 1WNEA 4IRDA 1ULRA 1HFEL 3G9CA 2RQ4A 4EUVA 2M88A 3TUIC 5F9NA 3R5BA 1WI8A 5KFMA 3BDPA 1B0VA