4C3KA

Structure of mixed pii-adp complexes from s. elongatus
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
115
structure length
98
Chain Sequence
MKKIEAIIRPFKLDEVKIALVNAGIVGMTVSEVRGFEFLQKLKLEIVVEDAQVDTVIDKIVAAARTGEIGDGKIFVSPVDQTIRIRTGEKNADAISAW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NITROGEN REGULATORY PROTEIN P-II
publication title Structural Basis and Target-Specific Modulation of Adp Sensing by the Synechococcus Elongatus Pii Signaling Protein.
pubmed doi rcsb
source organism Synechococcus elongatus
molecule tags Transcription
total genus 22
structure length 98
sequence length 115
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2013-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00543 P-II Nitrogen regulatory protein P-II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.120 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4c3kA00
4WK1A 3NCQA 2GNKA 4IYQA 3OPKA 3TA0A 2J9DA 5D4PA 5D4LA 5D4OA 2J9EA 3O8WA 4CNYA 4C3LA 1GNKA 4R25A 1NH8A 4OZJA 4CO5A 1VHFA 1XK8A 2XG8A 4RX6A 1KR4A 2VD3A 1J2VA 1VFJA 1H3DA 3DFEA 3X3UA 2PIIA 4C3KA 4RWXA 2EG1A 1V6HA 5DS7A 1QY7A 3TA2A 4YB5A 4CO0A 2Z0GA 3O5TB 5D4NA 4NYOA 1OSCA 3N5BA 3NCPA 1HWUA 2O66A 4CO4A 5L9NA 4ZK7M 2DCLA 2J9DE 1Q1KA 4RLEA 2EG2A 4E98A 1P1LA 4USJC 4C3MA 3AA8A 1O51A 2ZOMA 2GW8A 3M05A 3BZQA 4Y6IA 5DRKA 4OZNA 3NCRA 2NS1B 3LF0A 4AFFA 4YB7A 2E66A 1UL3A 4D3HA 1V9OA 1NH7A 3AA9A 4USIA 2NUHA 2ZFHA 4CO3A 1O5JA 1UFLA 4CNZA 2XBPA 2RD5C 4USHA 3AHPA 4Y65A 3MHYA 3L7PA 4NYPA 1NZAA 4CO1A 3T9ZA 2CZ4A 3HLUA 4RWWA 2J9CA 2V5HG 2GX8A 1V3SA 4CO2A 2XULA 1NAQA 2JJ4D 2XZWA 2NUUG 3CE8A 4YB6A 1V3RA 1UMJA 4D3GA 1UKUA 3AH6A 4OZLA 4WK3A 3GSDA 1PILA 2O67A 3TA1A
chains in the Genus database with same CATH superfamily
1IKYA 2UUBF 1AB8A 1S0NA 2HNZB 3G9CA 2GCFA 2H5JB 2IYIA 2Z2MA 2R7RA 3Q8QB 3LP2B 1S1VA 2VV5A 1O8BA 5SZTA 2ATCB 2HHSA 4NYZA 2MQLA 3ENAA 1HLWA 1VLYA 2OTJS 1ZTWA 4MFBB 2XSJA 2EXUA 1KEKA 2W4DA 3QJJA 5HVGA 2UVRA 2KRBA 3GILA 5K14B 2HFSA 4ED0A 2RRNA 4DV3F 1S59A 2BJDA 3D0HE 4KO0A 4UQGA 4TN2A 2AHOB 1BE4A 4WWSA 2G0CA 3JTNA 5IT0A 1VQ4S 2ZBPA 2YWKA 3CWJA 2CZ4A 4LF9J 4YP3A 2W9BA 4PAAA 2FVRA 3PR4A 2XULA 3W2WA 2HHQA 2IVMA 3QPIA 4Q45A 4NL5A 3HKWA 1S9GB 1HI1A 4ZPTR 2VASA 3NGTA 1U6ZA 4K4WA 2NPIA 3KJNB 1EQMA 2J6UA 3BO3A 3SCIE 4WBFA 1QTNB 1HR0J 1JLGA 1MLAA 4YB5A 2A0FB 2QFIA 2COLA 2GGPB 1N56A 1R27B 1M5OC 3IRXB 3LAKA 1Q86T 5A2QU 4A8FA 1QLNA 1JJCB 3GQCA 3C6TB 1TKZB 2E5JA 2LCWA 3IR7B 1FK9A 1P1LA 1WDDA 3DRRB 4B3OB 3H20A 4HT5A 2XO6A 5ETTA 4USKA 5RUBA 1PG5B 3G2XA 2EEYA 2W25A 2DNOA 1REVA 4KRWA 1J5OA 2CQPA 3FNNA 4CLLA 1J27A 2J0WA 4TLRA 4ZCLA 2D3OR 2AZ3A 3OTOF 2MZQA 2HHHJ 2KH9A 3HO1A 4NXMJ 3RYLA 2E44A 2DNRA 1FRLA 1XMOF 1VQSA 2VDIA 4Q2LA 4FF2A 1NK5A 3WBZA 1YJNS 1JKHB 4NLYA 4LF4F 1RAGB 1R89A 2CA9A 2CYYA 4U7UK 1BC6A 3P4UB 2LQJA 4RNOA 3ET6A 4P7VA 4IOCQ 4U95A 1GTHA 1WHXA 2CJ9A 3T6BA 4LSLB 4KFBA 3HT0A 3W66A 5AJ3F 2R2TA 4YR0A 4GRSA 2Y1RI 3TZYA 5LMNF 2GO9A 3HSDA 2DNZA 3RAXA 3PW5A 5HMYA 3HHLD 3RBZA 4M5NA 4GVLA 4J9MA 2VA2A 5DLFA 1NHVA 4J91A 3MEGB 4A4JA 1DARA 5J2MB 5ETNA 3I96A 4QIGA 5BYSA 4RWWA 2GQQA 4G1QA 4NLGA 2M2BA 5E7OB 3G6VA 5JVHQ 4WU3A 1RB0A 2WAQD 4IRCA 3VALA 2FGOA 4P2SA 3AB4B 2B6AB 4M5IA 1L5UA 1IUJA 5D15A 3NMAA 2W8KA 3MMBA 5E3QA 2EWHA 4QPXA 3D4JA 3C2PA 4DPXA 5K8MA 2FDNA 4DL2A 4OFZA 1VFJA 3HVWA 3MAAA 4PG5A 1NBEB 2ZD1A 5IQQA 5H9FJ 3WZ0A 1KKHA 3FBEA 3C6UA 1RUSA 3UNYA 3DDKA 2ZZNA 3RBEA 4I56A 3VVTA 2CIMA 4I7FB 4KH1B 2YNFB 2HFVA 3H40A 6FD1A 2W2NP 3TEHB 3G96A 2ZBCA 2HHVA 5F3TA 4NEZA 4RL1A 4DF8A 1RBOB 4Q43A 4DR5F 1OWXA 1UW9A 1UPPA 4DG1A 1GX5A 4FPIA 3OTBA 5FD1A 3HFZB 4DQPA 3QQCD 4EZ6A 4KR0B 2ZH9A 2HBQB 2A1BA 1YBUA 1Q0NA 2Z58B 1B7FA 1FHTA 3N9UC 3D68A 4WK1A 1QSLA 4RW9A 2OTLS 2EFQA 2VPWB 2XLKA 2OPQA 1S1WB 2J9EA 2M7SA 4LRAA 3B8HA 2MQNA 3QATA 1VHFA 2BW7A 1JLAB 2GMHA 1RT4A 2CVIA 3I5CA 4QQBA 5B08A 1SH2A 2JVRA 3GJRB 4Z37A 1OSCA 1U48A 1J5EF 4AT1B 4UUWA 7AT1B 4JI5F 2HS4A 2BKNA 2LYVA 2K2PA 4F4AA 3LP0A 3VAHA 1EZZB 2BXJA 2HHUA 4IH5A 1FCAA 5J1NA 5KFLA 2B9EA 2QYGA 3R7NB 4CLWA 2H9ZA 1WKJA 3J7ZT 3K5MA 3AJDA 3C46A 2GA7A 1U2CA 2AIRB 3O44A 1KN6A 4A46A 3W1YC 3EJMA 4ZPVR 2ZVIA 2VG6B 2OPPA 3U7JA 4OLPA 2J6SA 1XMQJ 4MH8A 4ECSA 4YOEA 5D78A 2EVZA 1WOSA 1AFIA 1LXNA 4B3SF 2ZE2A 1NU4A 3FMBA 1NK0A 4A8QA 4DN0A 2PEHA 2W4CA 2G13A 3ZZZA 2LQ9A 2K1RA 4FPRA 1HPZB 1Y10A 2BJEA 3SEOA 2ZHOA 4HI2A 3T5JA 1FDNA 3I9ZA 5L1KA 1E6VB 2P9CA 5AJ3J 1CJTA 1EKRA 5KG4A 4YMEA 1S6QB 3ZZTA 2D9OA 5DM6Q 4IR9A 1QUVA 3B4DA 2V8VA 5LMNJ 2J8SA 5J1EA 1KS2A 4B9VA 1NLKL 4GC7A 3FSIA 1RT3A 3KLGB 3P5TL 3CD0A 1MWZA 4F8RA 2HQCA 3HJFA 3DOKA 4J7CA 1HQEB 2HVZA 3G8TA 4ALZA 4R0EA 1FRIA 3DYAA 4X66F 1Y9OA 3LO3A 4MKVA 2DIVA 2FLPA 2L9DA 3CXCR 2ZOFA 3PO4A 2DR9A 3V4IB 5FIIA 1YQHA 4OYIA 3KUEA 2AX1A 2V4JB 2X3DA 2I38A 2VD3A 1VQYA 2K3IA 3PYFA 4CTAA 4JI8J 1RLDA 2OPRB 3A4TA 2D9PA 1H72C 2OEKA 2YWEA 4QOTA 1HD0A 2DCUB 4OJ1A 3BJYA 4I67A 2B3TB 3DRSB 1CJKA 3NAIA 1HYSA 2MEWA 4IDKB 2VG5A 2NXCA 1SJFA 2PGCA 3D0IE 5M2RA 3L4BC 3PYDA 4R0JA 1HBOA 2HLUA 2HNYB 4CNZA 2B56A 2KVIA 2JX2A 1FT8A 2B4PA 4YN3B 2MHNA 3SI8A 4DR5J 2N7YA 1L3KA 1Y5IB 1NPRA 4V19J 4A47A 4L72B 4WPAA 3M7VA 3CCRS 4CT9A 1FTCA 3TRGA 5L1IA 4J90A 3QZ7A 2CKWA 3RR8A 3DI6B 3GLJA 3P45B 1FJCA 3MM5B 4OJ3A 1I6JA 3MWBA 4LSNB 1VLOA 3GPAA 1YJVA 2V4QA 1SBRA 1H2TZ 2CQCA 4P10A 2WB1D 4ITSA 2VZ9A 5BJRA 3WQPA 1RAEB 4JI1F 4JI4F 4I2QB 3N5BA 5G0RA 3EGZA 6AT1B 4X4TA 2YQ1A 5KT6A 3QFHA 3AJ1A 3CMQA 5CYQB 1S12A 3DRPB 2V8PA 2ALZA 1WTFA 4JI5J 4DR3F 5K9FA 4YR2A 3PHEA 2MZJA 3MCSA 5J2QB 1E6YA 2CJAA 1B3TA 2RILA 1Y7PA 4ZVGA 1IBLF 2HZCA 1WC6A 2FJEB 2V68A 4MIBA 2UVUA 4F4KA 3OD2A 5EX3A 1X9SA 4U8VA 1S76D 3NS6A 1NK4A 1WSVA 1OSDA 3BV8A 2F4FA 3MFHA 1WG1A 3EWGA 4OJHA 1URRA 3DLHA 4V19X 1G1XA 4ZKAA 5JJBA 2AGPA 3KUHA 3QFWA 1S57A 4LVNP 1TKDA 3R8YA 3TYTA 3QLHB 3LPEA 4FKYA 4HR2A 3D6TB 2ZHBA 1S72S 2PEBA 1BQNA 3OR1A 1IR1A 3QGHA 2R9LA 1TL1A 3IBFB 4IFVA 5EX0A 1TL3B 2BR0A 1U2RA 5E0OA 4ZA1A 2HWHA 1C1CA 4ZVPB 2QFJA 5C24A 2AYGA 1ZPVA 1UWBB 2AJQA 1T7PA 2H48B 2HFNA 2IC3B 2C1EB 3OXFA 1SUQB 4AFFA 5DZ7A 2C2DA 2HMIB 3MUVP 2R7WA 5KG7A 1O5JA 4JI7F 3A3NB 3AHPA 4LR7A 3NOGA 5DDPC 3F56A 3VGVA 2E9TA 3B78A 3W60A 3CD6S 4TYBA 2DISA 4C2MA 4NXNF 3N01A 4PWWA 1Y00A 4JP8A 1DTTA 4OJGA 2OFHX 1JQGA 4F67A 3VQSA 4OYBA 3LGHA 4B3RF 2MY8A 2BYCA 1HBUB 2IRUA 4X66J 4DI6A 3ETMA 1WKKA 3CO9A 2VF3A 3EZUA 2V63A 1VJWA 2R7SA 4OV1A 4QW9A 3IG1B 2G1DA 5BR8F 3T9NA 5KFSA 1N36F 3SDEB 4YDXA 1VBXA 2DH9A 4ECRA 4NX9A 2F4VF 2MKJA 5GAHI 3KLFB 5KOXA 4WXWA 1EAYC 2HAFA 4KV8B 4DV4F 5BYQA 3RRKA 3M05A 3GYXB 1DRZA 2RRBA 4F50A 4FF4A 3I0SA 4LF5J 2XY6A 4Y34A 3HHEA 1SKSA 2JSXA 1GMVA 1ZAVA 4IQXA 2MLXA 1C0UA 3MEDB 3J81U 2VFTA 1KWMA 4P9SA 2L9NA 2AJ2A 2DNNA 5BYRA 2HW3A 1VK8A 4Y3CA 4QIFA 1FRHA 4ZHRA 2LXFA 3FBFA 4XDDA 3PRBA 4BC7A 1ZH5A 2J6TA 1LWCA 4FXVA 1T05A 3GIIA 4OX9F 1KSPA 2NPFA 1CQMA 2DNPA 1R0CB 1RTHB 3HXMA 3KHHA 2CQGA 4LQ3A 4JUZA 4OX7A 2K7KA 5KFUA 2AP6A 3MURP 4H4MB 3HVTB 3GV8B 2I1RA 2LDIA 3X3UA 3PCOB 1SV5A 3E2EA 1I3OB 2ILYA 3CD5A 3ZTQA 1VC0A 2CDQA 2R7XA 3EX7B 1H6KX 4ATNA 4JI1J 1K1QA 2AD9A 3FVYA 3M32B 2VIHA 2XLJA 5JXSA 4CLSA 2AYBA 2VFSA 2HQIA 1GMWA 1WG4A 2MLYA 4K4SA 1W2IA 4YB7A 3W7BA 3OL8A 4WFNQ 2V67A 3M30B 2QLJB 4DR3J 2UUCJ 2FJXA 3KNGA 3FRZA 5B7WA 3VTIA 3NLCA 3NRBA 3BQ2A 3WC0A 1OIAA 3RBDA 2UXCF 1SC6A 3Q8YA 1YX2A 1HNZF 4PR6A 2ZDOA 1S0MA 1D3WA 2RKIA 4HLBA 2FLLA 2D74B 3MPVA 2Z56B 4ICLA 3E3XA 4C3LA 2HQFA 4O4GA 1VRTA 3MUMP 2MQPA 2PDAA 3GMGA 5D0RA 3H5UA 1UCNA 3ILLA 1L3UA 2Q3PA 3R6LB 1SJRA 1UEKA 2JDJA 1URNA 3DDIA 2WOMB 2M8DB 2VQEF 3FEZA 3GZ7A 2YNIB 3QO9B 2XLIA 5IT9U 3MEKA 4DS4A 5GADI 2CQ4A 4MAKA 5HANA 2AT1B 1UVIA 4WE1B 3KNAA 2QLBB 4L75A 2GV1A 5I3UA 1VQMS 3TAMB 3HCXA 4WZMA 1KD1T 2ZOGA 2DHXA 1B7YB 4ZP9A 1FEEA 1GMUA 3GIRA 1F0XA 5AE2A 4DV7F 5BXIA 2EW9A 1X5PA 5L46A 4NXNJ 4TYAA 2FJVA 3H8YA 3E01B 3UCUP 3CF5Q 4B3RJ 2IAJA 1EX8A 1NK6A 1X0PA 4WP9A 1Q81T 3T41A 4DPUA 2JL9A 1Q8LA 2M4MA 2OI2A 4WF9Q 5BR8J 2VICA 2OPSB 3JQKA 1WHVA 1NSKL 3KHRA 5AXLA 4QWBA 5GAHU 1VDHA 2IHR1 3F44A 1RDRA 4TU9A 3P5BP 3FK4A 4RKUC 4HVZA 4FZVA 2IMWP 3Q8VA 4PUOA 1SB6A 1JNZB 1OYEA 3E51A 3NY0A 5KFMA 2LQ8A 4CO2A 1RCXB 2XZWA 2BJ8A 4TY9A 2UXDJ 2PSZA 1VRQC 1RISA 3AXKA 4I2PB 1RHQB 2RRAA 1UKUA 1DTQB 1EETA 2Q43A 4RU9A 4EI2A 4I69A 3OVSA 4LFCF 1IKXB 3VGTA 2C3PA 1UJ4A 2DHHA 2PIIA 2YH0A 4U7CA 4QBUA 1PC5A 1VRUA 5D4NA 4USWA 3J81Y 2D3ZA 4H4KC 2GMLA 2MZRA 5K8PA 3N79A 2V8GA 2N4DA 4WZQA 2V2QA 5J2PB 1WUUA 4J9NA 2Y0BB 3DU6A 4H54A 4DPWA 3A1YG 4NYPA 2XMWA 1FKOA 1R0AB 2JFKA 1VHIA 1VQ8S 2ZH8A 2J5AA 5HQLA 5J1PA 3FBCA 2BABA 5GAEI 3AOCA 3GSDA 3VAMA 3OTDA 4HH1A 4DV0F 2PMHA 1U1MA 5DG7A 2P6TA 5KFBA 1S7IA 4JV1A 4JV2A 4QW8A 4P71A 1HA1A 2JHEA 3I9V9 1NDLA 2HWTA 4KQZA 3RU0A 3AD7C 1PYTA 2VH7A 1F5CA 2PE8A 3HHLC 1RHJB 2A6MA 2E5HA 2XS2A 1GXLA 3I5AA 3HP6A 2HWIA 1HW9A 2QG9B 3SCKE 5C42A 3KHGA 1U26A 3D2WA 3S7RA 3M6WA 1HW8A 4FF1A 2DT9A 2E1AA 5HJXA 1N4LA 3H7HB 4WTYA 1M0SA 3LAMA 2LVWA 2CPYA 3O2IA 3D3CJ 1R8AA 1EARA 4USIA 1DLOB 5ETVA 1F1BB 3FQKA 2DGWA 1T9VA 3DLKB 4IG0B 3I4HX 4R8UA 4F4WA 3MD3A 2V5HG 3R2DJ 3UW1A 2C42A 2UV8G 4Q2MA 3NNAA 4ZCIA 1IKYB 1S5ZA 1H38A 2EC2A 3PEHA 3CCVS 5AE3A 1KQKA 2DXEA 1NJIT 3QJLA 2YKNA 2DHAA 3DMJA 2IDLA 2DR6A 2HVEA 3TI0A 2YWWA 5KFQA 1OPZA 3BKUA 2PT0A 4IOBA 2FY1A 1NCLA 1S0OA 4DV7J 3IBWA 4L3KA 2AYMA 3TNVA 2HS0A 1UVLA 2C2RA 1TL5A 2Y8YA 5IT9Y 5K20B 4DR1J 2XS7A 2J9DE 2XZTB 2AJ0A 1TK8A 4O0IA 4PXBA 1RAIB 3M1VA 4KO0B 1Z2ZA 3BBFA 1KBRA 1YJRA 2F8HA 5CD4A 1YRTA 2APOA 1GEHA 3K8VA 5B09A 2BA9A 1RWXB 1HHSA 2A10A 3AA9A 1ZZFA 2ZFHA 2JRSA 2W9BB 3W2WB 2QL7B 1BWEA 1JIHA 2A2CA 1IKVB 4X4OA 4IKAA 3CJ8A 2ZKUA 1RADB 2JH3A 3D28A 3MF5A 3JTPA 1L3VA 1VIOA 2A2DA 1NEEA 2BE7D 1XJWB 1JLGB 4RW7A 3ZO7A 4AXJA 1XR5A 1T95A 3QMQA 1ZS6A 1J2VA 1H2UX 4RBTA 1QY7A 3QIPA 4LFCJ 5KFRA 3HVAA 2HG4A 4R5PA 3C3LA 1FK9B 1SIWB 3NP5A 4PWUA 2AEMA 2VFVA 4QWCA 4ID5A 3ZZ0A 1JLBA 3PDNA 2UVWA 1HFEL 1K0TA 1REVB 4PWDA 2ZJQQ 1J5OB 1N88A 4ZJLA 1PYSB 1HARA 1TTHB 1W2BR 1KOOA 1NH7A 2H5IB 1OYDA 3SMZA 4DCJB 2RU9A 4FYVB 1BHNA 2BJ3A 3M9NB 2J9CA 3CUNA 1BD6A 3OJUA 3C14A 2Y1JA 1P9QC 2ACYA 2G9OA 2WW8A 1DBDA 4CLUA 4ECZA 2KZZA 1XNRF 5K8NA 2UUTA 4I1TA 4A8MP 4OZLA 4DJBA 4OHZA 4LFBF 3ET6B 1NUEA 4LVOP 4KFBB 4DL5A 2VBYA 2PA8D 4DV0J 3N5FA 2O3DA 4I6YA 3TJAA 1WG5A 1HIYA 4DX8H 3THTA 3MPDA 4RBUA 3TR5A 1H74A 2YWGA 1U7LA 5KOWA 2BJ1A 4HHJA 2C3UA 8ATCB 4IO1A 2ZJRQ 1NMEB 1N8RT 2E1CA 3NS5A 4DUYF 2KFNA 3KJQB 1TUGB 1PAUB 3ONQA 1SQFA 4OHWA 3FCVA 3M8ZA 2LLZA 2XY5A 4G1QB 3U27A 3BO4A 1NSQA 4DN9A 3R7SB 2BDPA 1S1XA 4ZP8A 5F8MA 4X2BA 2IJFA 5DLGA 3NBPA 3GFZA 3LANA 3PY8A 1R7IA 2V8DA 1S1TA 1ZOTA 1H73A 3NAHA 4OZ1A 2E5IA 3H5SA 2PMZD 3MMBB 3Q8UA 3PO5A 2HHWA 4DR6J 4F2SA 3KXDA 3GIKA 3W8PA 4L76A 3MAAB 2ZD1B 3FCWA 3EVOA 1RWNB 3C6UB 2CG8A 2C2NA 1WF2A 3ZNUA 4IOAQ 3VZHA 1NKBA 1KQGB 4A8KA 4FXDA 2CPHA 2MJUA 3DFEA 4TQRA 4M5LA 3AOAA 1IM6A 5EN1A 4QU7A 1NB7A 3MR2A 1HNIB 4F0HA 4OI3A 2V9KA 4E98A 4UW2A 1GMWD 3IM8A 1U0SA 4Y6IA 2FVQA 1B70B 5C7PA 4JV0A 3S1TA 1JNRB 4DG1B 4KGXB 2PI4A 4UY85 3W61A 2M88A 4O3PA 3KOAA 3PV8A 4K4TA 2B9WA 3UDCA 3T1YF 4NLUA 2KHCA 3S6EA 3KDOA 3V81A 3FC9A 1GQEA 2G0IA 4PG4A 2LU1A 3HFVA 1N33J 1Q78A 2NUUG 2M8HA 5E3CA 1V3RA 4RW9B 4WU2A 5D3GA 2DGSA 1VQ7S 3MM6A 2OPQB 4BWMA 5F9NA 4DZ6A 1NK9A 3AOBA 3CDBA 3K89A 3ISNC 1M90T 1RT4B 2CPXA 2DTJA 1T0TV 4X62J 1RAOA 4NZ7A 3KFWX 1XK8A 2IA6A 2KM8C 2EG1A 4UTGA 3N6LA 3LQVA 4C0BA 1H7WA 3LP0B 3RAMA 5L39A 5F8JA 2GZOA 4NRTA 1X9WA 3CIZA 4ZP6A 4AXIA 4M5KA 4EEYA 3D1OA 2KG1A 3RR7A 2HGNA 2VFUA 1TKXA 1WF0A 4UQTA 4DX7A 4ELVA 3EE3A 2LQ5A 3PYEA 1V9OA 3MM7A 4MIWA 5E33A 4DSKA 5DDOC 1CJVA 3H59A 3AB2B 5HJYA 2ZDPA 4M63A 4USUA 3WIVA 3WC2A 1NDPA 2OPPB 2HYIB 3PJXA 4KHPF 4I0WA 4RNNA 2QL9B 4YDDB 2EFOA 3M8SA 1F2GA 1F9HA 3I56S 4EBDA 1PBAA 3GYGA 1N34F 1RP5A 2ZE2B 2FC8A 2EKYA 1XN9A 1RTJA 3HHDA 3G82A 4PABA 1TUVA 1KLMA 2YY3A 4ZVUB 1FNXH 4FVMA 1UVJA 5CYMA 4OZJA 1FNMA 2K1RB 3US5A 1UFWA 1SH0A 3ELHA 2RT3A 1N54B 2EFVA 5KT2A 2W9AA 1CJTB 4AUKA 4EWTA 2DEIA 3CCSS 1R8PA 4IRKA 2V6AA 4S0MA 1RHUB 2IRYA 4H4KA 2NLWA 1PJ7A 2UU9F 3KLEB 2E7WA 4UUXA 4DHVA 2ACMA 1FNOA 1RT3B 1W26A 4M8LA 2I9SA 2K8GA 2JNJA 2MHEA 1X5SA 4K59A 5AE1A 4J9SA 3DOKB 4OI0A 1NZAA 4DPYA 5ETMA 5T7LA 1TK0A 3PTWA 4F4YA 1UZDA 2DIUA 3N6MA 1DZ5A 2OAUA 3NGSA 3DYAB 3GIMA 2BRLA 2DPIA 4DV2F 1HI8A 3OTEA 3CE8A 3MEEA 4K2XA 1T3NA 2KJVA 3U1MA 2G2OA 1CULA 3SCLE 3K0JA 2GHPA 4C8KA 3QGIA 3G71S 8AT1B 1IBMF 3TA0A 5GMEA 1JXEA 2MKIA 3AD8C 1U0HB 2HGLA 1QSSA 3JB9k 1SVDA 2XC9A 2VC1A 4CTAB 2RMLA 2C3YA 1AROP 3RRGA 1BQXA 1H3DA 4Z7CA 2CDRB 4RUCA 1N32F 2GAHC 3HHLA 4C8OA 4CH0S 4LF6J 1CJKB 4FBUA 1AUSL 4HACA 5L8RC 1HYSB 2VG5B 4ZP7A 4MKYA 5KFAA 3HM9A 1RT2A 3AA8A 1LWFA 1HBOB 3QT6A 4A8WA 2HGMA 1WORA 2Z2YB 2EPIA 2QO3A 2MZSA 1D0EA 2RU3A 2CQBA 4RNFA 4XDCA 5GMDA 3IMQJ 2D7SA 5E41A 5IZHA 2YBVA 4EO6A 3HSZA 1HQ2A 4NPOA 3GIJA 2QA4S 2YKQA 5B0CA 4DV5F 1RTDA 3OFGA 3PKMA 2WBMA 3T1YJ 1C4AA 3PVXA 3AD9C 3GFHA 3FJ2A 2F9DA 1GNKA 3EYZA 4R25A 4DZDA 3KLIA 2XCAA 1XIQA 1NKEA 5G0RB 5LSLA 1RI7A 3U02A 1RU2A 2AYEA 3I4PA 1Z1ZA 3GTYX 4X4VA 1RXOB 2B8PA 2SXLA 2YNHA 4ES1A 3R5DA 4LF7F 5KFEA 2IA0A 4ZITA 2DRBA 2BE2A 1E6YB 1LXJA 4UZCA 4NLXA 3ZFVA 3QSYB 2LA6A 2RS2A 4WIIA 4CCHA 1FXDA 2ZITA 4JYAF 1X4CA 2MPUA 1JLQA 1R6VA 1FRJA 5IWAF 2J0QD 1XBWA 4BDPA 1NHKL 4NASA 1FE4A 5DO2A 2XCPA 2FQQB 2K7JA 5H9EK 4GO7X 3DHXA 3OPKA 1BQNB 3OR1B 3MCOA 1N34J 2FYXA 2GHWA 2MYFA 1Y0HA 1TL1B 4DX6A 4K4YA 5DGAA 2ZM6F 2D3UA 4GKJJ 3EPIA 3BYPA 1A9NB 1C1CB 4QR1A 3UD4P 3PXGa 5C24B 5CABA 4X4UA 2ROPA 3OL9A 4WXOA 4CLYA 1TZ0A 3IWNC 2WB4A 1LWXA 4QYZJ 2JEFA 2FZCB 3CVKA 1QM9A 1RTIA 2DXDA 3L7OA 3L7UA 4U6PA 1VC6A 2JLEA 1ZA2B 4DEZA 1SL0A 3IC1A 4DSEA 3QJPA 3LPYA 4KKOA 4P52A 1H7XA 4L73A 2W01A 4USHA 5D77A 3KJFB 2ROGA 1K73T 3RGIA 2P8IA 1C2PA 2BRKA 3IO1A 1DTTB 4CM0A 4MYUA 4L74A 5T41A 1SH3A 3SQGA 2ZUGA 3VF0B 2NXJA 2OEMA 4B3OA 1UA0A 1JLFA 2RUSA 1PILA 4N8NA 2QLWA 2DGUA 2FZGB 5HL7Q 4Y2MA 4NOHA 1QUPA 1SL2A 4N77A 2WSFC 1RWVB 3VR1A 2CNOB 4CLKA 2UVVA 2RF2A 4RW8A 1WSRA 4J9PA 2OELA 1V3ZA 1CJUA 3SXLA 4AL7A 1NB2A 3T1HJ 2UUAF 3Q86A 2BANA 5CCMA 3IS9A 1UTAA 1JKHA 1N32J 2PI5A 3I0SB 5DG9A 2IBOA 4FYDA 2L08A 2Y8WA 4K5RA 1C0UB 3QZ8A 3TZXA 3QRRA 3H25A 3E8OA 2ZH7A 4MK9A 3EGNA 3C16A 3B54A 2GQ2A 1WEZA 4OI6A 1H2VZ 4JI2F 1NXIA 1XWLA 4ZHRB 4YHHF 2E5LJ 1BQMA 2FVSA 1L3TA 2DY9A 1OY6A 2DXFA 3VV2B 1LWCB 1T05B 3K5LA 5FDLA 4M5GA 3CCWA 1VQKS 2B4UA 1X31C 1WC3A 1K44A 3IAS9 5M2UA 1AYEA 3FCHA 4KBIA 3MUTP 3KLHA 4HHHA 1I51B 3QIDA 1MROA 1FWPA 1WDTA 1Q8IA 3AODA 3CO0P 1SV5B 4NA1A 3THPA 1F5BA 3BH6B 5K5MA 4JI3F 2NZ4A 2V8HA 3KK2B 5I3QA 3RUBL 4C98A 3RRHA 2Z0GA 2ERRA 1FKPA 3CJKB 3Q8SB 2WVEA 2F40A 1JMTA 1MW7A 1WD6A 1G6BA 3QGPA 4PPZA 4N76A 4OYMA 2DK2A 4DUTA 4MIAA 5A8KA 4NZ6A 1BMQB 4LF7J 3ZTPA 4KAIA 2KO1A 2RQMA 2BUNA 5A6PA 2C3MA 2L9WA 4N5SA 4DSFA 1SC4B 2PO4A 3CCTA 4DV6J 3TAPA 4FVCA 2XZDB 3OJSA 3IBCB 2VQFF 3W63A 2IFXA 2Z2ZA 2R2UA 4X84A 1BGXT 2RKIB 1S9EA 4ES2A 2XTJP 4M94A 1Q7LB 4WYWA 4ICLB 1VQ5S 3UDEA 2MB0B 4O4GB 5KFPA 3BBCA 1VRTB 3FZ2A 3UCGA 5FJ4A 4ZS6A 5IM0A 1LNQA 3DU5A 5I4MA 2O1PA 2O01C 3DOMA 3FMWA 3NCPA 1ULRA 4ZK7M 2XMAA 3QRQA 2AJ1A 4PG6A 2KHDA 4OV6A 4DR4F 2W8LA 4C3MA 3W9JA 2OJ3A 4WYLA 2QYCA 4DFKA 4TVAB 1EJ7L 4Q7AA 4PRFA 5I3UB 1FX4A 4IH6A 4ILMA 4PXCA 2ZNYA 4NCBA 4ZIVA 7FD1A 2J76E 4CLPA 1S7HA 3CSKA 5EGYA 3G86A 1UMJA 2FTRA 1LQ9A 2D41A 3CCJS 4U8YA 3A3OB 1WF1A 3BO2A 4P75A 3TUZC 1B0TA 1X4HA 1VCTA 1KVIA 2ZH5A 1YBTA 1WWHA 2MZTA 1LFPA 4ZCMA 3N4WA 3H2VE 3O6QA 2POKA 1RK8A 6FDRA 1CG2A 2ZBQA 2VG6A 4Y2CA 1OQ6A 4C0HA 1UP1A 4YB1P 3H0PA 1XR7A 2CVEA 2XQCA 3EXYA 3HJVA 1EQ0A 1K1SA 1KDNA 1U02A 2M9KA 4RPFA 5DQHA 3H42A 1B4SA 2J7WA 2AMCB 4DBQA 4PUOB 4Y2IA 3JQMA 1UAWA 3W3SA 3L7PA 1CQNA 3G6XA 4NMXA 3MCNA 5KTQA 3EVMA 1YVFA 1EETB 3K5OA 4G1PA 2IJRA 1IBKJ 4YHHJ 1FD8A 1KVKA 4F36A 5B0BA 3GE9A 4FDFA 2H5EA 3KTQA 2GMJA 1U6BA 3KK1A 4ZPCA 3JSBA 5IC6B 1FDDA 2R8JA 2HQ3A 1M5SA 4YEAA 2RVJA 4J9VA 1VRUB 2Y1LB 3OSPA 4ES3A 2GJIA 1ZA1B 2HFUA 1RWWB 3UN3A 5KFOA 3RW6A 3PX6A 2YKPA 4TU8A 1TAUA 5C25A 1FESA 2XMVA 1SIZA 3HMJG 5ETKA 3JSRA 3BKFA 5D0GA 1M5HA 1FJGF 1MN7A 2WVDA 1R31A 3MR7A 1HD1A 1UPMB 2MLZA 2JC1A 3ZTOA 3EZ5A 3D1QA 2Z2LA 2CPIA 1FKOB 3AT1B 2RAQA 4DOZA 3RAQA 2OD4A 4HH0A 2RD5C 3OL6A 1RWPB 4J9RA 2E1PA 3UD5A 2BKPA 3W8GA 4CIOA 4GVBA 5A8WA 2V69A 3NGKA 4DU8A 5ETSA 3O3LA 1RYRA 4P2XA 4A8OA 4WFZA 3MECA 3ADAC 2P2CB 2CQ0A 2JEJA 4F2RA 3D6FB 4HEA9 1P9YA 1FD2A 1U1KA 2NXNA 2HRTA 4KGKA 4PXEA 1MU2A 1U1PA 2KT3A 3HI9A 1WOPA 3ILJA 4FYXB 4OYZA 4LFAF 2FLNA 3LGMA 2VPXB 4QR0A 3VHQA 4RX6A 4G65A 2U1AA 4JOUA 4Q5VA 5IFMA 5C42B 5LMUF 2XHWA 1T03A 3RB4A 2O66A 3HD2A 1CSJA 3GU0A 2EFNA 4FP9A 1YTYA 1SQEA 4OZNA 3BEGB 4NWBA 4ED7A 2Q79A 4D3HA 1Y3KA 3NNCA 4R8UB 3LWMA 4K4ZA 2UV8A 3IWLA 1SQGA 2HBRB 2MY7A 4NLSA 1ZZNA 1PSDA 1TP7A 2LA4A 3MOJB 4MTPA 2GFFA 1D1UA 2YKNB 1YRUA 3DMJB 4UZBA 2UUBJ 4JI6F 3WHIA 2HIQA 4RJVA 1CBKA 4RZRA 4RNMA 1LW2A 4LF2A 3KJVA 2I5JA 2FJBB 3NCQA 2VBXA 2HAIA 5D4PA 3PW4A 1AXQA 2VOPA 4ILLA 1U4BA 3OTCA 1TU0B 4A8SA 2XG8A 1VC5A 3N28A 1HWIA 4DL7A 4RWXA 2FIUA 3EGVA 2FVPA 2E5GA 4N7TA 2GO8A 3R2CJ 3PACA 3M1VB 2W4PA 1S4FA 3I0RA 2CPZA 5B0FA 1F60B 3POTA 4DV3J 2M70A 3IWXA 3W5YA 2ZZMA 1RU1A 2FB0A 3FDSA 4NLRA 3GCWP 4HL9A 1RT1A 3DXSX 3PZPA 1F3VA 2AEJA 4CO3A 3C15A 1V5VA 4LMZA 2FJAB 2CRLA 4P72A 1T8EA 2B7BB 5EDWA 5KFZA 1VBKA 4LR9A 1SUQA 1PGZA 3MM8A 1S0VA 2HBZB 4LIWA 4X4SA 4RW7B 4J9LA 2KXFA 2LXUA 3R5JB 5AXMA 4WFYA 3Q89A 4LBHA 1I5OB 4IG3A 4RO0A 1T9XA 1OO0B 3H98A 1VK3A 3I82A 1ZBTA 4R5PB 1ITPA 3R27A 2F7VA 3KG1A 4C3KA 2XMUA 2BW2A 2CPFA 5A76A 1Q8BA 4OX8A 4P6QA 3P3DA 4ID5B 4F3OA 4PWDB 1IKWA 4DCPB 2DHGA 4URSA 2OO4A 1VS3A 3IP0A 2DO4A 5KG3A 5K8OA 3AJ2A 2CQIA 1KTVA 4USMA 4FNIA 1FJGJ 4DR7F 5CZXA 2NUHA 2H1YA 3OTOJ 2VB6A 1P27B 1UFLA 5KFWA 4DL6A 2F3JA 3C14B 4AL5A 2GAGC 3DXBA 4IUFA 1YIJS 1DQ8A 1RE1B 4O3NA 3N6NA 4EK2A 1RT7A 4DFJA 1XMOJ 4EFAC 3JSYA 1KFSA 1PCAA 2BQUA 3ICLA 4LF4J 4J37A 3P49B 1QAYA 2IM0A 4IR1A 1S48A 1HQUA 3LALA 4CQ1A 4GKKF 4BWJA 4MK7A 2WSEC 3CMAS 2H3EB 2YWHA 1N5VA 2HPUA 3MMCA 3TOQA 4N47A 3B82A 2QLXA 2FD2A 4FYWB 1XTZA 5L1JA 3TA2A 2OKQA 4O44A 2ZH6A 4OZ5A 4RNHA 3GG1A 2DNYA 2B0GA 2QC3A 3GFXA 5EWFA 4O0NA 3BKTA 4ZVQB 1R3NA 4P74A 3DLGA 3ISZA 1QVGR 2CNLB 1UWAA 3GP9A 3QYYA 1NJYA 1S1XB 4NLPA 2N82B 2KFZA 2HLTA 4RW4A 3M2RA 4AYBD 3NBPB 1K0VA 1S1TB 3RTVA 3QBCA 2V0NA 2BV3A 3CJTA 3BSOA 1G2EA 4Q44A 1A7GE 3AFGA 5HATA 2DGOA 3J81j 2WW4A 2J8AA 1EIYB 4WK3A 1LFWA 4B08A 4X65F 1JK9B 5HVHA 2K3KA 3B6BA 2FZKB 3CCES 3BPDA 4JI6J 4YY3F 5F0UA 1U8SA 1RHMB 3CC4S 1D8ZA 1EB0A 2QMWA 1WI8A 2HHTA 4OYXA 3OFFA 3OLAA 2HFOA 3C19A 2Y0SD 2WONA 1S4EA 1WEYA 3TP2A 3K8WA 5I3PA 3R1HA 3GR0A 4ZLLA 1DURA 2YKMA 1A6LA 3GONA 2MGZA 2R8KA 2NXEA 2AQ4A 4UT4A 5LOQA 1C1BA 2KB2A 3ZNJ1 3HD1A 2ADCA 4I6AA 4KJIA 3JQJA 2HK3A 3CC7S 2AZ1A 1OMSA 3V81B 1ZPWX 1SJQA 2VUGA 1ACMB 4LF8F 5ETLA 1HWKA 5D3GB 2E7VA 3MM6B 2B9XA 2JJ4D 4DQSA 3W2VA 3JAMU 4ETZA 2YNIA 3QO9A 1G4CA 5KG6A 3V5RA 5DDQC 3GCXP 3NKYA 4WCEQ 3I55S 3UFCX 3T5LA 3ISND 1JLCA 2QN6B 3MR5A 3HSJA 3NG8A 3DHWC 1J5EJ 2KT5A 3SCJE 4CYUA 4OYWA 4J9QA 4ENOA 4XPEA 2CQ3A 1HBMA 1TKXB 3DGVA 2BEFA 3MM7B 4JI0F 1OY9A 2OFGX 1T94A 1VQ9S 1X60A 3MR3A 1CJVB 3AY0A 1AZSA 3BGOP 1D9FA 1RLCL 3K57A 3QRPA 5LXRA 1BWVA 3J80U 3BH7B 3W9HA 1X9MA 4UOHA 2BJ9A 1RT6A 4JB8B 4NCGA 4C48A 5CH7B 3K58A 1RA6A 1WC0A 2AGOA 1RTJB 3G82B 2GIFA 1WHWA 2RUGA 2N7CA 1XR6A 3CJ0A 4OYOA 4B3SJ 5FLXU 5KFTA 4QIEA 1TUWA 3OFEA 4K4XA 5CYMB 2B5JA 1RYSA 2YPZA 1LKZA 2I8EA 2BKOA 4NA3A 3RBXA 1JB0C 2V2ZA 4ECUA 4GKKJ 5U47A 3CJ4A 4PG8A 4BCAA 4EYIB 1S6PA 1PJ6A 2HRUA 3ZZUA 3JXOA 2XNRA 2KTQA 1NJXA 2C2MB 4W4MA 3L9ZA 2M5YA 2DPJA 1R8HA 2MJNA 1O51A 2BMBA 2DGVA 2ZH1A 5F8IA 2DBBA 2RQ4A 5JVGQ 3EICA 1Q7YT 2QA1A 3H4BA 4F0MA 3C66A 2EFGA 1Q5YA 5T7LB 4PCQA 3BF4A 4CLZA 3RB6A 2ZWPA 2QSFA 4LRBA 3I5BA 4DDFA 3MEEB 4QR2A 3VAIA 3BYRA 1CULB 1U25A 1NDKA 2ZC3A 1RABB 4KE5A 2VKRA 2K06A 2H65B 4NXMF 1SKUB 2PA3A 3W64A 3T6JA 1FRKA 2C2KB 1QE1A 1ICEB 5KFXA 1U49A 2GS8A 1XC9A 2B4OA 3M8PA 4M5HA 3OR2A 2HQDA 3QT5A 3KHLA 3M8YA 1R0AA 4OIXA 3RZAA 4LJMA 3HHLB 1HNWF 3HKZD 4DUZF 4DSIA 2C2EA 4J5OA 2JLFA 4HACB 4YY3J 1N0VC 3FBBA 4LR8A 4P2MA 2RE1A 4LRCA 1KQSR 4URQU 4QCLA 1RT2B 2DCLA 1LWFB 5KFIA 4PQAA 3D6MB 1WOOA 3IR5B 3TJ9A 4CZCA 4YS2A 3CCMS 3M2UA 4Z2XA 2LXIA 4HT7A 2OSQA 3TUPA 2E66A 1Q79A 1RAJA 2HS3A 1YJTA 3W62A 2ABYA 4ZIWA 3V6DA 1X4DA 1NRKA 2DHSA 4O3QA 5ETOA 2WSCC 2AEFA 1RTDB 1ZM4A 4CI0B 1YI2S 3PR5B 3VGSA 3KKFA 1S79A 2DRDA 3BR9A 4ANDA 4OQJA 5CAAA 2HIYA 2LEBA 5KAKA 1FFGB 3HVRA 2RQKA 1FEHA 3KLIB 4ZPAA 4PZVA 3SFGA 1NJWA 1T02A 2R8IA 1C0TA 1CVJA 4XO0A 3GV7B 4U7UD 3FKBA 4JI4J 2W9CA 2PC6A 2YNHB 4OZ2A 1X0FA 5AXNA 2LMIA 1S6UA 1LEOA 2BE2B 2RQCA 1RAAB 4DQRA 2Y9HA 2EKNA 1ZAXA 1H0HB 3MMJA 4ZVFA 1CEZA 4ZJOA 1IBLJ 1YJ9S 2IY5B 2YNGA 2XI2A 1HWJA 1JLQB 5LL6d 3JAMY 4AQYF 1ZETA 3HULA 1X4AA 3BGRA 5A6WA 3T5HA 4QJVA 4USTA 4JI0J 2KRRA 3JSMA 1U09A 1IR2A 2LU2A 5E3RA 3UDLA 1V3SA 3DOLA 2MDAA 1Y3JA 3FSYA 1SL1A 3TO8A 4D3GA 1YGYA 2CWXA 3CGIA 2ADBA 1DY3A 2P9EA 2LKZA 2H51B 2HZAA 4LIRA 2DNLA 3I32A 3UQSA 2F63A 2E9RX 3ZTSA 4HDHA 4TY8A 1IKVA 5GAGI 3BQ1A 3KG4A 2DD8S 3J80Y 3VAGA 1RTIB 2KZMA 1JLEA 4DX5A 1FDAA 1TAQA 4TXSA 2E29A 1FXRA 4KKOB 3M6VA 1VQ6S 3ITHB 3DM2B 4JI7J 3PW0A 5HBMA 4HHUA 3DRXA 3SZ2A 3M9MB 2KN4A 1UA1A 3QWPA 4BBYA 3F73A 5FLXY 5F3ZA 3HHKA 3SQGB 4NLTA 3NNHA 4OHVA 4UOGA 2QT7A 1FVQA 1JLFB 5DZ6A 3CJ2A 2H4YB 3NOCA 1UW4A 1DFDA 5I42A 1U47A 1NDCA 4ELUA 2YKAA 3OL7A 3W5XA 5KFJA 4ID8A 2JEIA 3M9OB 3FQLA 4UOCA 3TA1A 1XMQF 2CQHA 2VG7A 4HDGA 4CNYA 5HMWA 2RF2B 4RW8B 5JMNA 4DS5A 1N36J 5DQIA 1FA0A 1P1TA 4DPTA 1CJUB 4FYYB 3ENVA 2Q6CA 1B64A 2F4VJ 2BANB 3IS9B 3TVZA 5M2PA 5DGBA 3BPSP 4TLQA 4NZ0A 1TVRA 3LGNA 1HNWJ 3EZOA 1QAXA 2JWNA 4DV4J 2AWZA 4DUZJ 5HLFA 3MMAA 2HHPA 3MI7X 2KU7A 3C16B 3ZXWA 2ASDA 2F1FA 1U8WA 4DLEA 5ITHA 1UFKA 1BQMB 2Z8QA 4KIAA 2OUGA 2R7QA 5FDLB 1RTZA 4KH0B 3VGUA 2VL1A 2EC0A 3HLUA 5HSPA 2OSRA 3JS9A 3GV5B 2AJFE 1WEXA 4OX9J 2J7UA 3FEYB 1KONA 3KLHB 1TFYA 1MROB 2AX0A 1YZ7A 2RDDA 3A12A 4A48A 3OQ2A 2G0JA 2QRRA 7FDRA 1N52B 2NXUA 5ETRA 2JFDA 2ZBRA 3Q2SC 1GXUA 2OH2A 3D54A 3ZZYA 2BM1A 1FKPB 4ZVOB 3U1LA 2BOPA 5DS7A 1YJ7A 1EP4A 4C6AA 1IJFB 1M5VC 5E2QA 5LSRA 4OI2A 4RW6A 5L9NA 3HT3A 3GFYA 2QE5A 2B43A 4JI8F 5A8KB 4Y0FA 3PKYA 1HNVA 2XMTA 3OSNA 4QYRA 2X1GA 2HNDA 2IVFB 2YWFA 5SUHA 1YK9A 3G6ES 2CJQA 1APSA 2GIRA 1KLNA 1XEZA 1TV6B 2JZ5A 1U45A 1U1LA 2B4VA 1T11A 2XSFA 2XMMA 1MG7A 3KK3A 2UXCJ 4AQYJ 1S9EB 1HNIA 3UVJA 4OI1A 1HNZJ 2U2FA 3CPWR 4DSJA 1HMVB 1XMBA 2MZ1A 1U1OA 3J7A1 5IM0B 3QT7A 2QLFB 2HHXA 2KM8B 1GFWB 1F2HA 4KTQA 3DOMB 4QWDA 3SIPB 4FS1A 1S97A 5CQGA 4M5DA 3ILIA 1P8GA 5A0YA 2BZ2A 3K17A 3R5AA 3CTRA 1MSWD 2VQEJ 5GAGU 2QL5B 4ZVTB 1PJ5A 5GVQA 3KUGA 5GADU 3UN5A 3T19A 2VPZB 1YZ6A 5AXKA 1KC8T 2WVCA 2CWKA 1KVJA 4ILRA 1REGX 3NGRA 1X4EA 3N0VA 1QAJA 1FTRA 2FPHX 1S1VB 4PKDB 1U2FA 4I4BA 3PX0A 2M3DA 4XIUA 2GHVC 2H4WB 3HZGA 1U1RA 2XSJB 3M4XA 1WC1A 4K7QA 3IGNA 2F8MA 4DV1F 2F9JA 1V5IB 5D4LA 2BX6A 5MAOA 1KHVA 2I2YA 2IM3A 3MCMA 5HN0A 4J9UE 1KFDA 1LWEA 1TR0A 5A8RA 5KFCA 5LJ3Y 3HK2A 1YSJA 3NS7B 3SBMA 3RG6A 3L09A 5A2QY 1IBCB 1VI7A 1R0BG 4AL6A 4J9OA 4BHQA 4DSLA 2IJNA 2VHGA 2IPOB 1CLFA 2KDOA 4O4RA 1VGYA 1IR0A 2XGQA 1UEVA 2CPJA 1TQLA 2DR5A 2ROEA 1PIEA 1S77D 1B99A 4URGA 2CG4A 5HAOA 4XAKA 1X4GA 3QT8A 2YQ0A 4HTJA 4X4RA 5HP1A 4XTTA 3KLEA 5H9FK 1S49A 4YFUA 1SKRA 1SJ1A 4B9TA 2XYPB 3KK1B 1Q82T 3OBIA 5DDRC 4ED8A 2BQ3A 1GTEA 2CPDA 2Y3YA 1N6QA 2VPYB 4P7TA 3CD7A 3BDEA 1HWLA 1X8DA 1S9FA 1HBNA 3PEJA 1I1GA 1ZM2A 1EHWA 2DRAA 5C2CA 3QAEA 5C25B 4O23A 3MM9A 3TEGA 4CO0A 3R7BB 3GSIA 4F04B 3VAKA 3PG9A 1FXLA 4HI1A 4KSEB 2FHJA 2OHDA 3ZZRA 1U0HA 2ASYA 1TK5A 1RWMB 4OHYA 1RHRB 1WC4A 3LF0A 4DQIA 3Q22A 2XB2D 4F3QA 3KDNA 9RUBA 2XMKA 5KFKA 3GJQB 4PYAA 4ED2A 2WVBA 4LF5F 4GVBB 2KI2A 1RT5A 5A8WB 2HSEB 3RW7A 3D6HB 1NPPA 2VDHA 2NREA 3TQ1A 3SV3A 2YH1A 3MECB 2L3MA 1NO8A 1OQ3A 4N41A 1TL7A 4C8LA 3VVUA 5GAEU 1CPZA 1RJJA 1RZMA 3ENQA 4WFXA 1MU2B 5GMKa 3TARA 1GAOA 5KT4A 2KG0A 2L41A 4EZ9A 3LP1A 4YUDA 4OHXA 2GVDA 3HF5A 4G1IA 1T03B 1IXKA 1FJ7A 1Z2LA 2W7PA 1IQZA 5MLCV 3LTOA 4TKTA 4P2FA 2VJUA 4GO5X 2XYHB 1UEUA 1Y5NB 2XI3A 5IQ6A 1MN9A 3BR8A 3DGPA 3JYTA 2W2MP 3PIPQ 1C4CA 1QSYA 4Q0BA 2GQCA 5LT5A 4QIVA 3FSXA 1WNEA 2ZNZA 3PFOA 5HMXA 4NLVA 3OVAA 2UUCF 3OHBA 1G7CB 1RA7A 3F0NA 2E1MC 1LW2B 2MTLA 4H4OA 1VQLS 3KJVB 2I5JB 5EHHA 4KGMA 2DNKA 4O3RA 4MKBA 2FVCA 2YTCA 5CD4H 2G1HA 2RIJA 1WHYA 2V9WA 4ZDNA 1D9DA 4ZPWR 1NH8A 1T3OA 4KHMA 2X1BA 4DV1J 1PC4A 3I0RB 1R8CA 3CCLS 1UJ6A 2XMJA 4C11A 4I68A 3O5TB 3POTB 4KY3A 2QV6A 5HI7A 5HO4A 2XGPA 5F41A 5CHCB 3K7RA 1BY9A 1RT1B 2Q1LA 4USJC 1VOMA 3OUYA 1IM4A 3BZQA 3C15B 1S10A 2CQ2A 2ASJA 3BB5A 4CM2A 4QZVB 3A8KA 1RKIA 2VODA 4X4NA 3S01A 3MDFA 4Y65A 4HYKA 3LOUA 2OMOA 1PAEX 3MM8B 2VKZG 3TUJC 2OGUA 3L95X 4OYAA 4IG3B 2WHOA 4E8UA 2X1FA 3UR3C 1KRPA 4FS2A 3I31A 4ECXA 2H54B 3M8QA 4HTIA 4M95A 2HK2A 1TKTA 4ZMMA 1RWOB 5HK4A 3R5GA 3KG0A 2XO7A 3BDPA 1Q16B 2V50A 4E2FB 1IKWB 3M2VA 3DCAA 2CUYA 2DGTA 1U24A 1NSPA 4CO4A 2FJDB 2E9ZA 5DJBA 3T1AA 3D9BA 1M5PC 4MMOA 1PBUA 2ZH4A 4LSZB 3PIOQ 2QJ3A 1RHKB 2E7XA 3CCQS 4CDIA 1FRXA 8RUCA 5J2NA 5IV4A 4ED5A 3EDRB 2FHOB 1CS4A 3TVYA 2FGCA 1RT7B 3DN9A 3T3FA 3BS9A 1MWYA 3SSSA 2I0XA 1XNRJ 4OZ3A 2BM0A 3M8RA 2R7OA 1Y11A 5ADZA 1RKJA 3EUNA 1HQUB 4LFBJ 2QTWA 1KNZA 4WFAQ 2UXDF 3MMCB 2D3O1 1RQ0A 3PW2A 3UE2A 2W24A 2NCKL 4NI2A 1Q95G 2DJWA 3EXCX 2CJXB 4O44B 4P73A 2MQOA 3DLBA 5J1EB 2F5GA 4X4QA 2PFDA 1RWKB 3UNGC 4IFYA 2FC9A 2GVZA 5H9EJ 3GYNA 1HWUA 4TNOA 2DVIA 3DLGB 3BN7A 3FFIA 3PHTA 2DITA 4C8MA 4DUYJ 1F6TA 4ECTA 5ETPA 5KFYA 1N5YA 4ZCKA 4Y28C 4FNHA 3RJMB 4RW4B 3DLEA 3M2RB 3KK2A 2RNEA 4X64F 1HHQA 2LQBA 3Q8PB 3DC2A 2XM3A 2R7TA 2IMOA 4C9DA 3CJKA 1DQAA 1IWGA 3KWMA 3D7SB 4B3MF 2AW0A 4ED1A 1S1UA 1R43A 2VC0A 4B3TF 5KG1A 1ZAWA 3OW2R 2O67A 3A13A 4OX6A 2WTFA 2YXLA 4NLOA 3O8WA 1SJ3P 2IYGA 1VJQA 1CC8A 4PQUA 2WONB 2J7KA 3EGWB 2LEPA 4B9SA 2YKMB 2MGZB 2A6OA 1XNQF 4DR2F 5HMZA 1UETA 1B0PA 2WBRA 5HROA 1C1BB 4DLGA 3R1LA 2CPEA 4O3OA 3EM1A 1F9EB 1MNEA 2HBYB 4A8YA 3TVKA 3BSNA 1ZM9A 1WACA 2QGFB 2UZAA 2XBPA 2IVYA 3S8SA 4BC9A 4B9LA 2G4BA 4RR5A 3W2VB 1G3OA 1RAFB 3K2YA 3MZIA 4KC5A 3SYZA 4WP8A 3FUYA 4PPDA 2KYZA 2CADA 1TL4A 1HKAA 3M8WA 2V2VA 3ZZPA 3DDNA 1WC5A 5F8LA 3CJ3A 1LW0A 1JLCB 4Q8EA 2KVQE 4LUBA 2X3GA 2CQDA 1D9AA 4FXWA 2OLWA 3H2LA 2BE9B 5LXYA 3ILOA 2GIQA 1ZYQA 2MKSA 4DL0C 2PMWA 3MOZA 4CYUB 1BXNA 2HNZA 1WJ9A 3DKDA 2ILZA 4RU2A 1HBMB 4C7QA 3LP2A 2LECA 4NRUA 3Q2TC 4ZLNA 3BSAA 1YKWA 4DR1F 1AZSB 2XYGB 4ZVHA 4MFBA 3AQOA 3CDEA 2ZOMA 2PD1A 3M6UA 1I94F 5T14A 2MQQA 1JWWA 4DL3A 1IVZA 4ER8A 4EMDA 5K14A 5AT1B 1RT6B 4KHPJ 5EUHA 2MKKA 4E0DA 4ECVA 1FERA 4NCGB 3VWSA 3TQEA 4F4ZA 3R9LA 3MTKA 1YJUA 5CYJA 1JXVA 2EFPA 4U96A 4ZVRB 1AT1B 4W90B 4IFVB 1XERA 4K0KF 2B5JB 2ZH2A 1RBLA 1YWXA 2W7OA 2JLGA 3U1NA 5D4OA 3ULHA 5IS2A 4NCAA 2YKOA 1S9GA 4U67Q 2A18A 3GG0A 1BUXA 1S6PB 1Q8KA 2KYXA 4N8OA 1KR4A 3FEXB 2NQPA 3CNQP 2QEXS 4QWAA 1T9YA 3CJRA 3VAJA 3VAFA 2UU9J 2EBEA 3AXMA 2GGPA 2Z4PA 3IRXA 1QJHA 4I64A 3CEDA 3MTJA 3C6TA 1TKZA 2CNNB 4EYHB 1UL3A 4NLQA 2DNGA 5THWA 2HVDA 2CJYB 3DRRA 2MSTA 2I6WA 5KT3A 3BM7A 4G3IA 3MHYA 2B51A 3D0GE 1H98A 4DV2J 3OT9A 2OD6A 4X64J 4FF3A 2P5VA 4RUAA 4ZPDA 1IBMJ 1QE1B 4ECYA 3A8IA 5KFVA 3M8PB 4B3MJ 3OR2B 1FX2A 4B3TJ 1FWLA 1OY8A 3PW7A 3MPWA 3D3BJ 4LREA 4ECQA 3D67A 4YR3A 1NSAA 4MKAA 1V6HA 5DG8A 4MK8A 2P9GA 3W9IA 2WCXA 5B0DA 3ZZOA 2OEJA 4WTOB 4CH7A 4EU0A 4LSLA 3R97A 2FHJD 3M2UB 4CT8A 4WP3A 3IRWP 1XNQJ 2VONA 4F02A 4ZLPA 3Q24A 4DR2J 1X5TA 3CDUA 9ATCB 2UP1A 1EKSA 2CNKB 4A8XA 2G2ZA 2YVSA 2MKHA 3V6DB 3HX9A 2BBEA 1ROFA 2EK6A 2DR8A 4HKQA 3TX0A 3NL0A 1MMNA 3MEGA 5KG0A 5D8HB 4DV5J 5J2MA 4DFPA 1VQPS 3LWLA 1AW0A 4MYTA 3HZEA 4ZVSB 2AF6A 4F7VA 2QZ8A 2C28A 1YJWS 3NWGA 5KT5A 5L1LA 2B8QA 3MD1A 3V6HA 3OVBA 1C0TB 4FBTA 3OFHA 3BBBA 3GJSB 2B6AA 2W9CB 3V4MA 4DR6F 2VBZA 1WKLA 1M1GA 2EBGA 5IXUA 4PEOA 3BREA 2BJ7A 5F8NA 1FF2A 5D0HA 4ZPBA 2E1RA 4IO9Q 1LK5A 2YNGB 4N56A 1DQ9A 4ZJQA 4I7FA 3BGRB 2BACA 2YNFA 4JYAJ 5DRKA 4LBIA 3QAUA 4C8NA 5EWEA 3JSMB 4LT6A 1F9FA 2ALYB 2WRMA 3M6XA 5IWAJ 1X7VA 5G4DA 2DO0A 3DOLB 2IM2A 1I94J 5LJ5Y 1YHQS 3OV7A 4ELTA 3UCZP 1MWQA 2KKHA 5EWGA 1D09B 5JUMA 3J7YI 4KGVB 4EBCA 1T9WA 3GR1A 3ZC4A 4UOFA 2DYAA 2W2PP 1N33F 3AH6A 5KG5A 3A8EA 3TUIC 2GNKA 1JX4A 1FDBA 1SXLA 2CQ1A 1N5TA 4K0KJ 2ZM6J 4TY8B 2IIHA 3HSGA 1R6YA 1NM2A 1GX6A 3UPFA 1S1WA 5KFNA 4ECWA 4WFBQ 2ZH3A 3JTOA 3HDSA 4F0KA 4X62F 3UDVA 2YQ3A 1JLEB 1JLAA 2OP5A 4M5MA 3L3CA 2W2OP 3A8JA 1IQTA 1SKWA 1PKUA 3BGLA 3QSIA 2QX0A 2MKYA 1JXLA 2AKWB 2EK1A 4DF4A 1QD1A 3TZZA 5HBMB 3GJTB 4RBVA 3H5XA 2GW8A 3BQ0A 1RCOB 2PN6A 1B0VA 2WVFA 3BSCA 2HKEA 3W5ZA 3RB3A 2AV5A 3G6YA 1OJ4A 2QA4G 5I42B 2IAJB 4Z7YA 2ZVSA 3K5NA 1NJZA 1AFJA 3OXGA 4KPCA 4F4XA 2NYHA 2VG7B 3H2UB 4UF4A 1CC7A 4MJKA 2LEAA 3CT9A 2CAJA 3WIUA 1XQIA 1SCJB 2CXEA 1R8BA 1HNXF 3WX8A 2UUWA 1RACB 3TJ8A 3IN5A 1SJ4P 2DB1A 1WI6A 1FKAF 3HHNB 2R42A 2N3OA 2MQMA 1TVRB 4ZN3A 2FHMA 3B4MA 1U1QA 2UUAJ 1ELOA 1Q4RA 4KGZB 4CH1A 5HLFB 3MMAB 2DEJA 2BOAA 2ZHAA 1NK8A 2YX4A 3Q0AA 1WTBA 2RHSB 1HPZA 2V34A 1ZM3A 1W25A 4ED6A 1VISA 1E6VA 4NMLA 3ZTRA 1LV5A 3QWUA 1S6QA 2ASLA 2P6SA 4JI2J 1RBAA 4B9UA 2IRXA 4LBPA 3W65A 2EI5A 3MFIA 1VIXA 2D69A 2R3VA 1YRXA 2CZ9A 3KLGA 4USVA 2N3LA 2DGXA 5HVFA 1HQEA 2FJWA 1YDLA 1F5AA 1UVKA 2ZEJA 2J9DA 4FKXA 3A3PB 4EBEA 2W1BA 4JV5F 4JI3J 4W98A 1Q53A 1EP4B 3WDOA 2ZUAA 4RW6B 2FHKA 2CZVC 3V4IA 1FRMA 3PRDA 2DR7A 4O3SA 4KYZA 1HNVB 4KPYA 2V4JA 2VFRA 2CFXA 2X1AA 2FLOA 2CJKA 5F8GA 4RLEA 2HNDB 1X4BA 2LFVA 2YX7A 4LF6F 2OPRA 4K8RA 2Z57B 1HI0P 2RDJA 2C2ZB 4I6WA 3AAWB 2QIFA 3DRSA 1K9MT 3DLLQ 3KK3B 2Q6BA 4EO8A 4IDKA 3BGFA 1DHMA 1PYOB 2HQGA 3UVJB 1HHTP 3IFEA 4M5JA 4B17A 4K5SA 3EVWA 2VQFJ 1YG0A 2HNYA 4ZOSA 2HFZA 2C2OB 4U9RA 1GXTA 1MMLA 2XNQA 4ED4A 4XPCA 1Y5LB 3J7YU 2FY8A 2R7VA 3DI6A 3MM5A 4M5DB 3VQTA 3H5YA 5L9XA 4LSNA 3CW2C 5A0YB 3ENWA 3J7Z5 1VQNS 4IQMA 1AUDA 5KFHA 4K50A 2VA3A 3OXLA 2C22A 2DNMA 4DR4J 3CJ5A 1RSCA 3J7AN 2EG2A 2F65A 3R5BA 4I2QA 1TMMA 1N5SA 5CZVA 4ETXA 2ZKTA 3NCRA 1QTMA 1X4FA 4OL8A 4Q8FA 5CYQA 3DRPA 1NPKA 3P6YC 2R4FA 2M0GB 1X5OA 4MT1A 2YX1A 4G6VB 5J2QA 3CDAA 3CCUS 3T5KA 3NGDA 3UI3A 3G87A 4K4UA 1JJHA 2C3OA 2LP4A 4C8YA 1N0UA 4TQSA 1IJEB 3NMRA 3CJSA 1IN0A 5E3AA 2NR0A 3MGJA 2QMUB 2HRYA 1LWEB 1NK7A 3QLHA 3EDQB 1TELA 4WIQA 3PYGA 5A8RB 1UVMA 1KTQA 1U1NA 2NSBA 1HNXJ 3IA0A 3UD3P 4DCOB 4NE9C 4GKJF 3MR6A 1VYAA 1U6FA 4IH7A 2KJWA 4OI4A 1Q1KA 1TL3A 3QGGA 4DL4A 3LW5C 2ZC4A 5DETA 3NEKA 1FI4A 2JVOA 3MAQA 1UWBA 2R8HA 1Z4UA 5D6GA 1FO1A 2D1CA 2IC3A 4Y2KA 1QVFR 4CRJA 4ANCA 4XK8C 5HQ8A 4ED3A 2HMIA 5DQGA 1N5QA 2YPYA 3Q8RB 3EPGA 1VBYA 2DH7A 5HP1B 4UY8T 3CJQA 4KHRA 3H4DA 2CJBA 1NAQA 3TANA 4DXLA 3QIPB 1L3SA 1N48A 3NWRA 1N6QB 1YITS 2DNQA 2O5DA 4NA2A 4NLDA 1HBNB 5KT7A 2NSCA 3RB0A 1FJEB 4KB7A 1JLBB 4BS2A 2JOQA 4CP5A 4Y00A 3MM9B 1HBUA 3QNWB 4F26A 4WJBA 2RS8A 4IRDA 3D5MA 2V4RA 3F41A 2XWXA 3AQPA 2VOOA 2J0XA 1FFSB 2R8GA 4JV5J 3SSRA 5LSOA 4NYOA 1RGVA 3IG1A 2ZJPQ 2IDEA 3SDEA 3V2UC 1KQFB 4LF1A 4NEYA 3T1HF 4QIWD 3MPUB 2IM1A 3KLFA 2V94A 5L38A 1VBZA 1RT5B 4OMFG 3I87A 4KV8A 3NXZA 2X51A 1RAHB 1TL7B 4CO1A 4WKYA 4C8ZA 3MEDA 2E5LF 3TX8A 3IR6B 3MAHA 3BN4A 2VU5A 2IBKA 1NNDA 1OPIA 3LP1B 4OZ0A 1FFWB 1GK8A 2GVDB 3G4SS 1M5KC 4LFAJ 2HEKA 2Y1IA 3P96A 2AGQA 4ZN1A 5LMUJ 4QPTA 1UVNA 2MSSA 5LM7E 1RTHA 4OLOA 3CCZA 2MXYA 4B02A 5F9LA 4EUVA 4H4MA 2ZWOA 3HVTA 2VBWA 3DGPB 3JYTB 2NYIA 4L6V3 2XS5A 4Q0BB 3C8YA 4ZLJA 2ZZTA 3TAQA 2KXNB 2HZVA 2XY7A 3M32A 2QA2A 2MQ8A 4CWBA 4EGLA 4NLWA 1UJ5A 4H4OB 1YLXA 1T9TA 3M30A 5KFGA 4V1Ak 2RJZA 4DV6F 3UWTA 2W7AA 4B9NA 4ANEA 1MMDA 1ZTTA 2QSWA 3P8BB 5CCLA 3R3TA 1UZHA 3EMTA 4DU7A 4C4WA 5IC4B 2BVZA 1K8AT 1TMJA 3DNCA 1VR6A 3PRVA 4C11B 3FGVA 3IXQA 4ERDA 4CO5A 3CIMA 1DJ0A 4TU7A 3PJ9A 1YBAA 4WKRA 3H90A 4OYPA 3CDWA 2UXBF 1FWKA 3G8QA 4BLGA 2V2KA 3OUYB 2KFYA 4LRFA 3CB4A 4C0OC 1KOHA 1GH8A 3ETOA 1QAIA 2WOMA 2HVHA 5B0AA 2OMLA 2MMYA 1FE0A 2A3JA 2DH8A 2Z30B 3HFKA 2BQRA 3DLJA 4F25A 4WE1A 3MXHP 5H1SV 5E3PA 3PX4A 3Q23A 2W2QP 5ETQA 2RSQA 1Y4ZB 1FVSA 1LOUA 3ITHA 3DM2A 2XEXA 3TAMA 3M8QB 5DM7Q 4JBCA 2R2RA 4C97A 4IYQA 1TKTB 2JEGA 1JJ4A 4YQWA 4RUHA 3M2VB 4PG7A 1BLUA 5CA5A 3E01A 5IOLA 2R7UA 2RB7A 2OIHA 4K4VA 4X4PA 2WZ1A 3BGUA 4DPOA 5IT4A 2LDYA 2WK4A 2B9YA 3OHAA 1SC3B 3LA0A 5J2NB 3TZWA 2L48A 3TWZA 4DR7J 1CS4B 2OPSA 2RDIA 1W7WA 3HPOA 4J9KA 4LF9F 5KFDA 2KL8A 2AU0A 1O6XA 2X7IA 4FN5A 1KLMB 3KMSA 1TFWA 2GJ2A 3IM9A 1S99A 3D66A 3T9ZA 5D0EA 3KYLA 4K2JA 2GX8A 3IAM9 2GC8A 1PO6A 2XHCA 3PNIA 3DRYA 1WELA 1SPBP 4NI2B 3SFUA 1IBKF 5F0WA 4I2PA 1HR0F 1DTQA 3THVA 2GJFA 3I6PA 1M1KT 3X1LB 4IFYB 4CLFA 3Q83A 2DKOB 2GVZB 3VCDA 1OS5A 1Q5VA 2NZCA 1IKXA 2MKCA 4M1KA 2JC0A 3G8SA 3SV4A 3FFIB 3IGVA 3MPYA 3KLVA 2PFFB 4F3MA 4L3NA 4W92B 1K47A 3FZBA 3CMES 4LRDA 3PFEA 3LH2S 3R6GB 1N5YB 5F8HA 3D1HA 2HVIA 3DLEB 3VZIA 1KP6A 2NS1B 2HHHF 3O1LA 1JJ2R 1P6TA 4KT0C 2R2SA 2M52A 5J2PA 1A0OB 1S1UB 4RUBA 2B7CB 1T9UA 2RH3A 3K59A 2J0SD 4DFMA 5E5NA 3KMQA 1SC1B 3GB0A 4PYDA 4X65J 5KFFA 5HQMA 2FUG9 2ATLA 2HURA 3TW0A 4PQUB 1TV6A 5B0GA 1IWAA 1DAXA 5B0EA 4QYZK 2N4CA 3NGUA 1NZ8A 1KHWA 2DGQA 4LQ9A 1D8YA 3V6JA 4CLTA 3SSQA 4DWIA 4GMKA 5C2GA 4ZVEA 5HROB 1HMVA 1RWUA 3R5CA 4AE5A 1M1HA 4DMZA 3CULA 1NHUA 2QMXA 2VJVA 1LK7A 2UXBJ 4PXDA 5KG2A 1S6OA 3V6KA 4AD6A 5C5JA 3UO0A 1GT8A 2AJ4A 3SQOP 2KT2A 3LUYA 3PJWA 4DQQA 3K5PA 2DY1A 1AA1B 2ZBIA 4QWEA 3UR0A 3FRYA 4LF8J 2DNHA 2XWYA 2G2YA 1NKCA 1DLOA 2Q66A 4GC6A 1O0PA 3GWCA 3PM9A 1LW0B 3UN2A 1QDUB 3OLBA 1HL6A 4B9MA 3DLKA 4IG0A 2RHQB 3WX4A 5IV3A 1F3FA 5CXTA 4YB6A 1VMBA 1VQOS 1SI9A 3CC2S 4Y2AA 4QU6A 2KXHA 2F8EX
chains in the Genus database with same CATH topology
1S48A 4OX6A 1IKYA 2UUBF 1HQUA 3MF5A 3JTPA 2WTFA 3LALA 1S0NA 1L3VA 4CQ1A 2HNZB 1VIOA 2A2DA 4GKKF 4NLOA 4MK7A 2WSEC 1NEEA 3O8WA 4BWJA 3CMAS 1SJ3P 2IYGA 3G9CA 2GCFA 2YWHA 2IYIA 1N5VA 1JLGB 2HPUA 3MMCA 4RW7A 3TOQA 1CC8A 4PQUA 2WONB 2J7KA 3EGWB 4N47A 4AXJA 2Z2MA 1XR5A 2LEPA 2R7RA 1T95A 3B82A 4B9SA 3Q8QB 3LP2B 3QMQA 1S1VA 2VV5A 2QLXA 1O8BA 1J2VA 1H2UX 4RBTA 5SZTA 2FD2A 2YKMB 1XTZA 2MGZB 5L1JA 2HHSA 4NYZA 1QY7A 3QIPA 3TA2A 2OKQA 2QFJA 4O44A 1XNQF 5KFRA 2MQLA 3HVAA 2HG4A 4DR2F 4R5PA 1VLYA 2ZH6A 4OZ5A 4RNHA 3C3LA 1FK9B 1SIWB 1ZTWA 2OTJS 3NP5A 4MFBB 4PWUA 2XSJA 5HMZA 1UETA 1KEKA 1B0PA 2WBRA 2W4DA 3GG1A 2VFVA 5HROA 1C1BB 4DLGA 3QJJA 2DNYA 2B0GA 4QWCA 3GFXA 5EWFA 4ID5A 3ZZ0A 3R1LA 1JLBA 3PDNA 2UVWA 2CPEA 2UVRA 4O3OA 1HFEL 1K0TA 2KRBA 3GILA 1MNEA 1R3NA 1REVB 4PWDA 3DLGA 3ISZA 5K14B 2ZJQQ 1J5OB 4ED0A 1N88A 2RRNA 4DV3F 1HARA 2BJDA 3D0HE 1QVGR 4KO0A 4A8YA 4UQGA 4TN2A 3TVKA 1W2BR 1KOOA 1NH7A 3QYYA 1NJYA 3BSNA 1ZM9A 3SMZA 1S1XB 1WACA 2UZAA 2XBPA 4NLPA 2N82B 2RU9A 2KFZA 2HLTA 4RW4A 2IVYA 3M2RA 2G0CA 3JTNA 4BC9A 3S8SA 5IT0A 3M9NB 1VQ4S 4AYBD 4B9LA 3NBPB 2G4BA 1K0VA 2YWKA 1G3OA 3W2VB 3CWJA 1S1TB 2CZ4A 3RTVA 3MZIA 3K2YA 4KC5A 4YP3A 2J9CA 3CUNA 2V0NA 3SYZA 2W9BA 2BV3A 1BD6A 3BSOA 3OJUA 2Y1JA 1P9QC 2FVRA 3PR4A 1G2EA 2ACYA 2G9OA 2WW8A 1DBDA 4PPDA 2KYZA 2XULA 4Q44A 1A7GE 1TL4A 3W2WA 4ECZA 2DGOA 2KZZA 3ZZPA 3DDNA 1XNRF 5K8NA 2HHQA 2IVMA 2UUTA 4I1TA 5F8LA 3CJ3A 1LW0A 2J8AA 1JLCB 3QPIA 4A8MP 4Q45A 4Q8EA 4WK3A 4OZLA 4NL5A 1LFWA 4DJBA 4B08A 4LUBA 3HKWA 1S9GB 2X3GA 2CQDA 1D9AA 4X65F 4FXWA 1HI1A 4OHZA 1JK9B 4LFBF 2K3KA 2OLWA 4ZPTR 3H2LA 2VASA 3CCES 1U6ZA 5LXYA 4K4WA 4LVOP 4YY3F 2NPIA 2GIQA 1ZYQA 5F0UA 2J6UA 1U8SA 3BO3A 4KFBB 4DL5A 2MKSA 4DL0C 3CC4S 2QMWA 1D8ZA 3SCIE 1WI8A 2VBYA 3MOZA 2HNZA 2HHTA 2PA8D 3OFFA 3OLAA 2HFOA 2ILZA 3N5FA 1JLGA 2O3DA 2Y0SD 4I6YA 4RU2A 2WONA 4YB5A 1HBMB 2COLA 1WEYA 3TP2A 3K8WA 5I3PA 3R1HA 3GR0A 1WG5A 4C7QA 3LP2A 2GGPB 1N56A 1R27B 1M5OC 3IRXB 3LAKA 1Q86T 1DURA 2YKMA 1A6LA 2MGZA 2LECA 4DX8H 4NRUA 4A8FA 3Q2TC 3THTA 3BSAA 1QLNA 3GQCA 2R8KA 4RBUA 3C6TB 3TR5A 1TKZB 2E5JA 2LCWA 2YWGA 3IR7B 1U7LA 2PFFB 5KOWA 4DR1F 2AQ4A 4HHJA 1FK9A 1P1LA 4ZVHA 4MFBA 3AQOA 2C3UA 3CDEA 4IO1A 1C1BA 2ZOMA 2ZJRQ 3DRRB 2KB2A 2PD1A 3M6UA 1N8RT 2E1CA 4B3OB 3H20A 4HT5A 2ADCA 5T14A 1I94F 2MQQA 3NS5A 4I6AA 1JWWA 4DL3A 4DUYF 2KFNA 2W25A 2DNOA 3ONQA 4KJIA 4OHWA 1REVA 4KRWA 5K14A 1RT6B 2CQPA 2LLZA 1J5OA 5EUHA 3FNNA 2MKKA 3CC7S 4E0DA 2XY5A 4ECVA 1FERA 2J0WA 4G1QB 3U27A 4TLRA 3BO4A 3V81B 1ZPWX 4NCGB 1SJQA 4ZCLA 2VUGA 2D3OR 3VWSA 2MZQA 3OTOF 4DN9A 4F4ZA 4LF8F 2BDPA 1S1XA 3MTKA 2KH9A 1HWKA 4ZP8A 5D3GB 1YJUA 5CYJA 3HO1A 5F8MA 4X2BA 2IJFA 3MM6B 5DLGA 2B9XA 3RYLA 2E44A 2EFPA 2JJ4D 3NBPA 3GFZA 3LANA 4DQSA 3PY8A 2DNRA 1R7IA 2V8DA 4IFVB 3W2VA 4W90B 1S1TA 1XERA 4ETZA 1ZOTA 2YNIA 4K0KF 1FRLA 3QO9A 3NAHA 2B5JB 5KG6A 5DDQC 3V5RA 4OZ1A 1XMOF 2ZH2A 2E5IA 1VQSA 1YWXA 3H5SA 2W7OA 2PMZD 4Q2LA 4FF2A 1NK5A 3NKYA 3MMBB 4WCEQ 3WBZA 3I55S 3PO5A 2JLGA 3U1NA 2HHWA 3UFCX 1YJNS 3T5LA 3ISND 4F2SA 1JKHB 4NLYA 4LF4F 3GIKA 1R89A 1JLCA 2CYYA 5D4OA 4U7UK 1BC6A 3ULHA 5IS2A 4NCAA 2YKOA 1S9GA 2ZD1B 4U67Q 3MR5A 2LQJA 2A18A 3GG0A 3NG8A 4RNOA 1S6PB 3C6UB 4P7VA 1WF2A 4IOCQ 2KYXA 4IOAQ 1GTHA 3VZHA 1WHXA 4N8OA 1KQGB 1KR4A 2CJ9A 4A8KA 1NKBA 3FEXB 3T6BA 4FXDA 2CPHA 2NQPA 2MJUA 3DFEA 3DHWC 4LSLB 2QEXS 2KT5A 4KFBA 3SCJE 4TQRA 5AJ3F 2R2TA 4YR0A 4QWAA 4J9QA 2Y1RI 5EN1A 4QU7A 4XPEA 3VAJA 1NB7A 2CQ3A 3VAFA 3MR2A 1HBMA 5LMNF 1TKXB 1HNIB 4OI3A 2EBEA 2GGPA 2V9KA 2Z4PA 2GO9A 3IRXA 4E98A 2DNZA 3RAXA 4UW2A 3PW5A 5HMYA 1QJHA 3HHLD 3MM7B 4JI0F 2OFGX 1T94A 1VQ9S 4I64A 3CEDA 3MTJA 3C6TA 3MR3A 1TKZA 4Y6IA 2FVQA 4J9MA 3AY0A 2VA2A 5DLFA 1NHVA 4EYHB 4JV0A 3S1TA 1D9FA 1UL3A 1JNRB 4DG1B 4NLQA 2DNGA 3MEGB 5THWA 2PI4A 3K57A 4IRDA 5LXRA 4A4JA 3DRRA 4UY85 2MSTA 1DARA 2M88A 5J2MB 5KT3A 4O3PA 3BM7A 4G3IA 3I96A 2B51A 3MHYA 1X9MA 3KOAA 3PV8A 4K4TA 2B9WA 1RT6A 4QIGA 3UDCA 3T1YF 3D0GE 4NLUA 1H98A 2KHCA 4RWWA 3S6EA 5BYSA 2GQQA 4G1QA 2OD6A 3V81A 4NLGA 1GQEA 4NCGA 2M2BA 5E7OB 4PG4A 2LU1A 5CH7B 3K58A 4FF3A 1RA6A 3G6VA 5JVHQ 1Q78A 2AGOA 2NUUG 2P5VA 4WU3A 4RUAA 1RTJB 4ZPDA 2M8HA 5E3CA 1QE1B 1V3RA 4RW9B 4WU2A 1WHWA 5D3GA 2DGSA 2WAQD 4IRCA 2RUGA 1VQ7S 4ECYA 3MM6A 2OPQB 3VALA 2FGOA 4P2SA 4BWMA 3AB4B 2N7CA 1XR6A 2B6AB 3CJ0A 5KFVA 3M8PB 5KFTA 3OR2B 5F9NA 1L5UA 4QIEA 1NK9A 1IUJA 3OFEA 3CDBA 4K4XA 5CYMB 2B5JA 3NMAA 3ISNC 1RYSA 2W8KA 1M90T 1RT4B 2CPXA 1LKZA 3MMBA 5E3QA 2EWHA 4QPXA 2DTJA 3PW7A 3MPWA 3C2PA 5K8MA 2I8EA 2FDNA 4NA3A 4NZ7A 4ECQA 3KFWX 1XK8A 4OFZA 4YR3A 4DL2A 1JB0C 4MKAA 2IA6A 4ECUA 1VFJA 3HVWA 2KM8C 4PG5A 2ZD1A 5IQQA 5U47A 5H9FJ 2EG1A 1V6HA 3CJ4A 5DG8A 4MK8A 2P9GA 3WZ0A 4PG8A 4BCAA 4EYIB 1S6PA 3C6UA 2WCXA 3N6LA 2HRUA 3LQVA 3ZZOA 4C0BA 5B0DA 3ZZUA 1H7WA 3LP0B 3RAMA 4CH7A 2XNRA 3DDKA 4EU0A 2ZZNA 2KTQA 1NJXA 5L39A 3RBEA 4LSLA 5F8JA 4NRTA 4I56A 1X9WA 2CIMA 2FHJD 3M2UB 4I7FB 2YNFB 2M5YA 4CT8A 2DPJA 3CIZA 4ZP6A 4AXIA 3IRWP 3H40A 2VONA 6FD1A 4ZLPA 1R8HA 3Q24A 4EEYA 4F02A 1X5TA 2MJNA 1O51A 3D1OA 2KG1A 3CDUA 3RR7A 3G96A 2UP1A 2ZBCA 2HHVA 2HGNA 2VFUA 5F3TA 1TKXA 1WF0A 2DGVA 2ZH1A 5F8IA 4A8XA 2DBBA 2RQ4A 2YVSA 5JVGQ 4UQTA 2MKHA 3V6DB 1Q7YT 4ELVA 2QA1A 3HX9A 4DF8A 2BBEA 1ROFA 3H4BA 2LQ5A 4Q43A 2EK6A 1V9OA 3C66A 2EFGA 3MM7A 4MIWA 5E33A 4DR5F 2DR8A 5T7LB 4HKQA 4DSKA 5DDOC 3H59A 4PCQA 3BF4A 1OWXA 3AB2B 3RB6A 2ZDPA 4M63A 3NL0A 3WC2A 2QSFA 4DG1A 2OPPB 2HYIB 1MMNA 3I5BA 3MEGA 3PJXA 1GX5A 4I0WA 4DDFA 4KHPF 4RNNA 5KG0A 3MEEB 3OTBA 4QR2A 5FD1A 3VAIA 5D8HB 5J2MA 4YDDB 4DFPA 2EFOA 1U25A 3M8SA 2ZC3A 4DQPA 1F2GA 1VQPS 4KE5A 3LWLA 3I56S 2VKRA 4EZ6A 4EBDA 1AW0A 4MYTA 4KR0B 2ZH9A 3HZEA 2AF6A 4NXMF 2A1BA 1N34F 2QZ8A 2C28A 2PA3A 1RP5A 1YJWS 1B7FA 1FHTA 3NWGA 3T6JA 3N9UC 5KT5A 2ZE2B 1FRKA 2FC8A 5L1LA 2EKYA 1XN9A 1RTJA 3HHDA 3MD1A 3V6HA 4WK1A 1QSLA 3OVBA 1QE1A 4RW9A 1C0TB 2OTLS 2EFQA 1TUVA 5KFXA 1KLMA 2VPWB 1U49A 4FBTA 2XLKA 2YY3A 2OPQA 3OFHA 1S1WB 2J9EA 2B6AA 1XC9A 1FNXH 2M7SA 2B4OA 3M8PA 4FVMA 3V4MA 2W9CB 4DR6F 3OR2A 1UVJA 3B8HA 3KHLA 1R0AA 2MQNA 4OIXA 2VBZA 5CYMA 4LJMA 3RZAA 4OZJA 3HHLB 1FNMA 1VHFA 1JLAB 2GMHA 1RT4A 2CVIA 2EBGA 2K1RB 1HNWF 3HKZD 5IXUA 3I5CA 3US5A 4QQBA 3BREA 1UFWA 4DUZF 4DSIA 5B08A 2C2EA 4J5OA 2JLFA 1FF2A 5F8NA 1N0VC 1SH2A 2JVRA 1SH0A 2RT3A 2RE1A 1N54B 4ZPBA 4Z37A 2EFVA 5KT2A 2W9AA 1KQSR 1OSCA 4URQU 4QCLA 1U48A 4AUKA 1J5EF 4UUWA 2E1RA 4IO9Q 4JI5F 1RT2B 2DCLA 1LK5A 2HS4A 1LWFB 4EWTA 3CCSS 1R8PA 5KFIA 2LYVA 4PQAA 2K2PA 4IRKA 2YNGB 4N56A 3LP0A 3VAHA 1DQ9A 3IR5B 2BXJA 2HHUA 4CZCA 2IRYA 4IH5A 4H4KA 2NLWA 1FCAA 5J1NA 3CCMS 2UU9F 3M2UA 3KLEB 2E7WA 4I7FA 3BGRB 2BACA 2YNFA 4UUXA 4DHVA 5KFLA 5DRKA 4Z2XA 2LXIA 4HT7A 3QAUA 4C8NA 5EWEA 1FNOA 1RT3B 3JSMB 4LT6A 2H9ZA 2OSQA 4M8LA 2I9SA 1F9FA 2E66A 2K8GA 1Q79A 3J7ZT 2WRMA 2MHEA 1RAJA 3M6XA 3K5MA 1X5SA 4K59A 2HS3A 5AE1A 1YJTA 4J9SA 2ABYA 1X7VA 3C46A 5G4DA 3V6DA 2GA7A 3DOKB 2DO0A 1X4DA 4OI0A 1NRKA 3DOLB 1NZAA 2IM2A 2DHSA 5T7LA 4O3QA 3O44A 1TK0A 1KN6A 4A46A 5LJ5Y 2WSCC 4F4YA 1YHQS 3OV7A 4ELTA 1RTDB 1ZM4A 4CI0B 2DIUA 3UCZP 1YI2S 3N6MA 1DZ5A 3PR5B 2OAUA 3DYAB 2KKHA 4ZPVR 3GIMA 2VG6B 5EWGA 2OPPA 2BRLA 3U7JA 3KKFA 2DPIA 1HI8A 3OTEA 4DV2F 3CE8A 1S79A 3MEEA 4K2XA 3BR9A 4OLPA 5JUMA 3J7YI 1T3NA 4EBCA 2J6SA 2KJVA 3GR1A 3U1MA 4OQJA 3ZC4A 2LEBA 3SCLE 5KAKA 3HVRA 3K0JA 2RQKA 2GHPA 1FEHA 4MH8A 4ECSA 1N33F 3AH6A 5KG5A 4C8KA 3A8EA 3QGIA 4YOEA 3G71S 5D78A 2EVZA 1IBMF 3TUIC 1AFIA 2GNKA 3KLIB 1JX4A 1FDBA 1SXLA 4ZPAA 3SFGA 2CQ1A 1LXNA 3TA0A 1N5TA 2MKIA 1JXEA 1NJWA 4B3SF 2ZE2A 1NU4A 1T02A 3FMBA 1NK0A 4TY8B 4A8QA 2HGLA 1QSSA 3JB9k 2R8IA 2XC9A 1C0TA 4DN0A 2PEHA 1R6YA 1CVJA 2VC1A 1GX6A 3UPFA 4CTAB 2RMLA 4XO0A 1S1WA 2C3YA 1AROP 3GV7B 3RRGA 5KFNA 1BQXA 4ECWA 1H3DA 4WFBQ 2W9CA 2ZH3A 3JTOA 4RUCA 3HDSA 2PC6A 2YNHB 1X0FA 2W4CA 5AXNA 4X62F 2G13A 3ZZZA 2LMIA 1N32F 2YQ3A 3HHLA 1JLEB 1JLAA 1S6UA 2OP5A 3L3CA 2LQ9A 4C8OA 2K1RA 4FPRA 1HPZB 2BE2B 1IQTA 1SKWA 4CH0S 2RQCA 2BJEA 3BGLA 4DQRA