4C3ZA

Nucleotide-free crystal structure of nucleotide-binding domain 1 from human mrp1 supports a general-base catalysis mechanism for atp hydrolysis.
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
231
structure length
231
Chain Sequence
TNSITVRNATFTWARSDPPTLNGITFSIPEGALVAVVGQVGCGKSSLLSALLAEMDKVEGHVAIKGSVAYVPQQAWIQNDSLRENILFGCQLEEPYYRSVIQACALLPDLEILPSGDRTEIGEKGVNLSGGQKQRVSLARAVYSNADIYLFDDPLSAVDAHVGKHIFENVIGPKGMLKNKTRILVTHSMSYLPQVDVIIVMSGGKISEMGSYQELLARDGAFAEFLRTYAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords MULTIDRUG RESISTANCE-ASSOCIATED PROTEIN 1
publication title Nucleotide-Free Crystal Structure of Nucleotide-Binding Domain 1 from Human Abcc1 Supports a 'General-Base Catalysis' Mechanism for ATP Hydrolysis.
doi rcsb
source organism Homo sapiens
molecule tags Transport protein
total genus 70
structure length 231
sequence length 231
ec nomenclature
pdb deposition date 2013-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00005 ABC_tran ABC transporter
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4c3zA00
1NSFA 2G77B 1MO3A 3W8NA 1HT1E 1ZM4A 2H5EA 2VHUA 4TLBA 3LW8A 1U90A 4Q9KA 2QAJA 1PJRA 5FFMA 5IF9A 1U9IA 2GZAA 1P61B 4HB2A 4A6PA 4P0TA 3QXCA 1E4YA 1ZIPA 3VNUA 4US0R 2IS2A 2PBRA 5CDFA 5JJIA 4EPXA 1Z6GA 1XRJA 4B35A 3QVVA 5EXXA 4MQBA 3X1XA 3NKVA 4OI0A 4G5QA 5JECA 3TUZC 2JLZA 3SR0A 4CEJA 3FMFA 4JLPA 2ZPTX 2YHSA 1QRAA 2OEPA 4ZKEA 5F2EA 2JGNA 4DDUA 4ZDJA 5FOSA 1NSTA 1XTQA 3THWB 2EWVA 2ZAOA 1YZTA 1UDWA 2XITA 4F4CA 1Z6YA 4ZCMA 1R5BA 3DEFA 1KHTA 2FSFA 3AVOA 4M1YA 2Q9BA 3AKDA 2BBSA 2WSSA 4TL9A 3UG6A 4MRPA 1VCOA 1G7TA 1OYWA 1XCPA 5C46F 1SXJE 1XXHB 3NDBB 2OCPA 1UFQA 1IY1A 2B6HA 1Z28A 4P4UA 2D74A 5AWFC 4IEIA 1VG8A 4BUJA 2RMKA 2H17A 1TL7C 3GPLA 1ZYUA 3DZDA 1VHTA 3KTAB 2V9PA 1KMQA 4B32A 4DRZA 1NN5A 1S4QA 2FX3A 5E7JA 4C2TA 2ZJ8A 2DBYA 1VKJA 1L8QA 4B6FA 4OKSA 2BCGY 4EFNA 1KI6A 3GJ8A 5JHGB 4PHHA 4U00A 3F5FA 4XTRA 5HZKA 1KGDA 1F2TA 1OLOA 3QJYA 4IOJA 5TXGA 2FPLA 4BLOA 3QG5A 2JJ1A 3ETLA 4V0OA 2ZXUA 5L3SB 1E1QD 3VHXA 4LDJA 1G64A 5TY0A 4PXAA 4BFSA 1QVAA 3VX4A 721PA 2H16A 1T8UA 1OSNA 3AVVA 3KDSE 4FWIB 4OI1A 1SVWA 3KB2A 4D4KA 3SS8A 4HAWA 2ANCA 5JWHA 3X1WA 5L8VA 1Q20A 3AQ4A 3BFKA 3CW2A 2TMKA 1R10A 2GJAA 3HPRA 4BFZA 1NVXQ 2QNRA 4AYWA 4R2HA 2OILA 1RYHA 4CT4B 4JLOA 3QIAA 1GILA 2CBZA 4LBYA 2CHVA 2WSMA 3U61B 1E2EA 2JAQA 3R7WB 2CCJA 4JJZA 8OHMA 5B2ZA 1SXJD 4LWZA 2VP5A 3NHBA 3NXSA 1RJ9A 2NG1A 2UVQA 1FMLA 1KK1A 1HY3A 2R6FA 3P4YA 1EGAA 4NBSA 3LVQE 2W2XA 3UMFA 1DG1G 3BH0A 4UNRA 1TU4A 2A3RA 5CM8B 3RVBA 5EE9A 1G8YA 4DZZA 2CE2X 2C77A 4B43A 4HAUA 4DCNA 2EVWX 2Q3HA 3NH6A 3K9NA 1OYYA 2H57A 1X8JA 1XD2A 2P6NA 1G7RA 3B82A 4GBMA 2QBYB 4CT5A 3REGA 4N0EA 4JL8A 4NH0A 4Q1EA 1W48A 4MYHA 4OI2A 4G0NA 2D3WA 1JR3E 3QPUA 1FX0A 4V0KA 5JI2E 1FNNA 1S8FA 3C41J 3HYRA 4TZ0A 4RCZA 2IHYA 4Q1DA 2Q3FA 4FMCB 4TSFD 5BN5A 3QPVA 2IF0A 3C15C 1R0YA 1H65A 4MGKR 4LBVA 5CK5A 5CLQA 4ZI3A 2WAYA 3FDIA 4RD4A 3K9LA 4JLMA 2O0KA 4ACBA 2QP3A 2W6JD 1HH4A 2YOFA 4RD2A 3THOA 4IFEA 4NCNA 3CPEA 1LS6A 5CJPA 2NPIA 2ZRFA 5JBQA 3H86A 4MRSA 4LBWA 3AP1A 2R8RA 4RZ2A 2C2HA 1Z0JA 1YJ5A 3A4LA 2OSBA 4PPFA 1L4UA 2QTHA 4QOSA 2C96A 5BYJA 1XTIA 3EZFA 1G16A 4CVNA 4NZYA 4MUAA 1ZP6A 2IXEA 3AF3A 1T6NA 3MG9A 3T61A 2R2AA 1GAJA 1UKVY 4FXPA 3GLGB 1YZGA 3VR1A 3THXB 3DKVA 2AX4A 1XTRA 3LBIA 3VU9B 3B5JA 4JVMA 1K5DA 2PX3A 1ZCBA 3CRQA 1MT0A 1QHHA 2NO1A 3CM0A 4M1KA 1Z0KA 2AKAB 4HZUA 4LYJA 2ZYTX 1IN8A 1A82A 3LX5A 4PC2A 4YXWD 1JBKA 4R2IA 3A36A 2YYZA 4ARZA 1IHUA 1JR3D 1Z6AA 4GNKA 3EPHA 5AUQA 2F1JA 5JS7A 1UBGA 3OIYA 1IBRA 2DWPA 2FFHA 2FE4A 4B33A 5DN6D 2HUPA 3QY0A 4OK6A 4D82A 2B8TA 1ZU5A 2N1BA 5FR1A 2OE2A 2FWRA 3FKQA 1D8TA 1E94E 4A6XA 4WW0A 3QUSA 3O47A 2NO6A 3BBPA 1WMSA 4DHEA 1ZC4A 3R8CA 2DCUA 4RD1A 5KSOA 1O87A 1ZD1A 4LY6A 2QROA 4XOIA 4JYCA 3U4QA 1W36C 1EG7A 2H8KA 4ZIRA 4FCTA 5J4HA 1W36D 1AS0A 1Z47A 4KLZA 1YVDA 2QAGB 2B7BA 2F6RA 1G20E 2FSGA 4EQ6B 3KQUA 3HR7A 4YDHB 3C5HA 1E0KA 2A5FA 3TQCA 2QL6A 3FE2A 1OH5A 3TH5A 4U7DA 3TE6A 3B1WA 3EA5A 1VCIA 4WBSA 1GITA 1WCV1 2PH1A 1Y63A 3ASYA 2VP6A 3FGNA 1L2TA 2CLDX 2YVUA 4Q4JB 4DLWA 4C2UA 2ZRDA 5HKKD 2VHTA 2BMJA 2BKUA 2PX0A 1AK2A 1FQKA 2ZTSA 3WXMA 2HF9A 5DNYB 3KXIA 3ASZA 1SVKA 4NYMR 1OXSC 3H1TA 1JI0A 1XJCA 4GPTA 1VG9B 3ZLJA 2JLWA 5FPSA 2FEOA 4NYIQ 4D2IA 3AB3A 4PZYA 4QHSA 3W5JA 1RRGA 2BMDA 2EFDB 5FBVB 3ZS9A 2ZJ2A 5H68A 3TW8B 3ZVLA 1QHSA 3KUDA 3T1VA 1RRPA 4DLZA 1IOZA 2ZE6A 2IYUA 2GILA 2GCOB 5UKDA 1ZAKA 1LB1B 1Z0AA 3VX3A 1WBBA 1XPOA 5FBLB 4PQFA 1M6NA 2OAQ1 2CVHA 3X2SA 1YKSA 2IYZA 2RGNC 3P26A 5EUQB 3RAPR 4LHYA 3GEEA 3GLFB 2Z5FA 1CULC 2J87A 1AS2A 3LX8A 2ODEA 4OHXA 3CB4A 2PMDA 1SQ5A 2O8DB 1G17A 2ORVA 4JKIA 4B34A 1XD9A 5LBIA 2A78A 2ZREA 4L16A 2IWHA 1ZC3A 1Q3TA 2WICA 2DWOA 3D7MA 3TLXA 1U0JA 4V0MA 1W46A 1WA5A 2VBCA 4POAA 1MR3F 2XNSA 1K5GA 2QM7A 4BFVA 2J0SA 4PX9A 1COWA 4KYUA 4U5XA 4AKGA 1YR6A 1NJFA 1W1WA 4LJ9A 4PC3A 1YU9A 3B9QA 2G6BA 4II7A 4PQYA 4C0HA 3K8YA 1GIAA 3NC1C 2QTVB 4M1OA 5DHAA 3RRZA 3T1QA 4KODA 2ZI6A 1XEWX 1KIMA 3AUYA 3MCAA 5G41A 2CEAA 5JRJA 1TU3A 2YV5A 3C16C 2ODNA 4WXPA 2VP2A 2IYYA 4X8HA 4MDFA 4QRHA 3V00A 3VKHA 3OHMA 2GF9A 5DE3A 2IYLD 2NOAA 1ZUIA 2J7PA 1XBTA 4GP7A 1CU1A 1E79A 3LAWA 3LO5A 4LOAA 1XFAA 2V4ZA 3K09C 2MMCA 3OE7D 3P4XA 1T3SA 2WWWA 4RZXA 4C0JA 3E5HA 2WKRA 4YQFA 1TAGA 1NL3A 1AN0A 4B2PA 4AKIA 2YWFA 2JLVA 2RGXA 1E2FA 3CIOA 4MGZR 4UXJA 3UK6A 2QP4A 1AM4D 3ZZTA 1TQ6A 1NBME 4LPKA 3VAAA 4M9XA 4DSNA 4JSTA 4TYWA 4C0SA 3GLIE 2R6DA 3EZ2A 4ITRC 4K46A 2A5JA 2QPOA 4FD2A 1N2CE 4IFBA 2FF7A 3T35A 3KQKA 2HCJB 2C03A 5J4YA 3A6PC 4F93B 2QMHA 4LBZA 4LYAA 1R0ZA 2O8EB 1XZQA 1Z6XA 3BD9A 4A2PA 1XD8A 5HCIA 2WWYA 3U7FB 1ZINA 1LNZA 3EWAA 2ZYWX 1KNXA 1E2HA 4NPHA 2VH5R 4XSGA 1G7CA 1L4YA 3A1TA 3NBFA 2P5TB 4Z1MA 1AIPA 4NDZA 3G5UA 4HAZA 4KITB 3C7KA 4BPBA 1F60A 3GLHE 5IK2A 3TSOA 1KMHA 4FCVA 4A0RA 2H7VA 1GFIA 3SHWA 1TNDA 1D2EA 3PEYA 5TARA 3PENA 3WNDA 3THXA 1NN0A 2G3YA 4A0GA 2BBWA 5EQTA 1UEJA 1A2KC 1QDEA 2J46A 3VU9A 3LBNA 3SDZA 1G4AE 1RYFA 2IXGA 2VEDA 1NN3A 1Y3AA 3T1OA 2O8FB 3LD9A 2J0UB 4W5HA 4MRRA 3ZYCA 4NL4H 1S2MA 3C4JA 3EZ7A 5H1YA 4DUGA 4ESHA 4GDFA 1ZM9A 2BBTA 4KV9A 4LRWA 3W34A 4ZDKA 2JJ2D 2QM8A 5CDFE 1G6HA 2RGNA 5F9HA 1UKEA 2GJ9A 1B0UA 2WJJA 4FN5A 4RFSA 4ZKDA 1RW4A 5CB6A 2W2VA 1R5OA 1KK2A 2YC2C 5EZ6B 2RGGA 1FP7A 1NBMD 1P62B 4F7WA 4I1VA 4D26A 4TMKA 5FBWB 4Q1FA 2BMFA 2F7SA 5KSZA 5J5CA 4NTZA 1II9A 2QY9A 2EYUA 1NKTA 3KXKA 4QKQA 5LD2C 5L3QB 4Q9HA 5EUMA 4JT4A 1KKLA 1SHZA 1K8RA 4XWOA 1KSFX 1UBEA 4DDVA 2C78A 1KDPA 3KX2A 2XZLA 3UMRA 4ACAA 5FOXA 3VFDA 1N0WA 3GJ5A 2VRWA 1I4LD 4PSKA 1G8GA 1ZM7A 2CL6X 2ZSDA 1U8YA 3SC3A 3FPAA 4NKRA 3WRYC 4ON9A 521PA 1KJZA 2JLRA 2J41A 3TSZA 4I1UA 1T3HA 1EFHA 1G3RA 4OHVA 1JEEA 5JZVA 4URWR 1SKYE 1U2RA 3U3MA 1VIYA 2GJKA 2ZJZA 2QP9X 1CXZA 4I81A 5KSYA 1KJWA 2O8CB 4V0NA 1JPJA 2GJSA 1UM8A 3SJZA 2EFHB 2FDCA 1NNEA 1XPRA 1SVSA 2LWIA 5EP2A 3L43A 1Z2AA 1RKBA 1X8KA 5GVRA 5E7IA 4B3BA 2O8CA 3GJ0A 2W0MA 2VL7A 3CWZA 4TYPA 2FOLA 2CL0X 1Z29A 3U7GA 4A15A 3BERA 3PUVA 2MMGA 4IVQA 3KKNA 4TL7A 4QGFA 2GCOA 4JJKA 3IIMA 3BK7A 3GFTA 1NRJB 3KQLA 2W00A 5JJLA 1G6OA 3QF4B 4ZCIA 4UXIA 4MA4A 4D4JA 4DIEA 2D7CA 1QHIA 3CPHA 1N6IA 1KSGA 1NVVR 5H70A 1D9ZA 2WSSD 3GLFA 1GL9B 4QM6A 1AJEA 4OK3A 3VR3A 2UZ3A 1TX4B 4C3ZA 1E0AA 4DDTA 2RGDA 3KZ1E 4OHWA 2VP4A 4PAOA 3RYTC 3BWDD 4E09A 1OXVA 4Y0VA 1GTVA 4NHOA 3QBVA 5CK4A 4NP6A 4HB0A 1G5RA 1BIFA 3KFVA 3SBEA 1VDZA 2FU5C 2B92A 1SVIA 2FPMA 2ZRKA 1RFLA 1E9CA 1GUAA 3NH9A 4KVAA 4DXAA 3CBQA 4HLUA 2ECKA 4OI4A 2ZI4A 5DI9A 1DVRA 2YZ2A 4O2RA 2GEUA 3B6EA 5FL3A 2BWJA 1GDDA 1CS4C 1RVDA 1UF9A 2JJ1D 2XAUA 3WBKA 3OEHA 1VG0B 1OHHA 2QG6A 3RNLA 1XJ0A 5IDVA 1R2QA 5SZIA 2J7KA 1ZU4A 3FYHA 3QI2A 1GSIA 2WJGA 1UKZA 2CXXA 1NVWQ 4Q00A 1DOAA 3MWLA 4M1WA 1V43A 3W90A 621PA 1HQCA 2KE5A 2ZRLA 1Q1BA 3N5CA 4KBGA 1QBKC 3GCGA 4XSHA 4BQSA 1W4RA 3Q8XB 3L0IB 2REXB 5HTKA 4N3NA 4DBLC 2K5UA 1LW7A 4DLXA 1RPZA 3CX6A 1KO8A 4QJ3A 1XTJA 1P3JA 4B3CA 2ATXA 5FBRB 3TUIC 3AF4A 2ZYUX 3ZVRA 1FFHA 4EPYA 6Q21A 3ADCA 1GL6A 2Z0MA 1F48A 4Q4HA 4IDPA 5FUXA 4E5UA 4OK5A 5JEDA 4DCSA 1GNPA 4C4PA 2ZROA 4NCIA 2CCGA 2OESA 3MWYW 4JLDA 5FPHA 2HF8A 3FB4A 2IS4A 3MRSA 1E9SA 4QG7A 2QGNA 5JSZA 3ZGXA 2GK6A 5DI3A 3KL4A 2G88A 2QE7A 3F3YA 2O8EA 1NG9A 4UQOA 1E69A 2F43B 2G0NA 1E2QA 2RGBA 2X2FA 4TWZA 3PQCA 3VKGA 3QKSB 2CVFA 2PEYA 2ZS7A 2XJ9A 1H8HA 3K70C 1GRNA 4LJ6A 2HEIA 3IQWA 1G21E 4AY2A 2Z6VA 4BLRA 5KHOC 3AVXA 2CE7A 2WMOB 1T5LA 3UG7A 2QUZA 2I4IA 1KAOA 2KSQA 1UAAA 2CDNA 3RWOA 3SJAA 5GJBA 3K0AB 2X19A 3PUXA 2NTYC 1E32A 3FHOA 2ZRPA 3K9GA 2PEZA 3WMGA 2GJ8A 4H9GA 2AKYA 1G3UA 3UWKA 2HT1A 1II8A 1P7CA 3HYTA 3AEZA 1NY6A 3IIKA 4A2QA 1ETUA 4DDWA 5J47A 1E3MA 2O8FA 1RRFA 4BFYA 1HE8B 4NYMQ 5ELXA 4H1UA 1M74A 1P9RA 2E87A 2J0UA 5JRZA 3RC8A 3OIVA 4ZI2A 1EWRA 2OBMA 2EU8A 4M1SA 4C0BA 2ZU0C 2ZSBA 1GP2A 3N2IA 2D7DA 4C0AC 2VQSA 1E2MA 2LKCA 2D06A 2JLYA 3WYAA 5B64A 3WP0A 4EPWA 1TUEA 5DIFA 2ORIA 5DHFA 1NG1A 4Q4AB 2ZRMA 2YWEA 1P60A 4Q9LA 1EX7A 1IM2A 5AJZA 3K9HA 1Z22A 4L8GA 3A1SA 5CYPA 3O8BA 3UWOA 5EP4A 4AKEA 3UKDA 5L3QA 4AYXA 1UJ2A 1LF0A 2RKOA 3A4NA 4C0LA 1GKIA 4BRUA 2QEQA 2GETA 4V03A 5EP1A 4ZCLA 3P20A 5KPJA 1TADA 4M1TA 2OXRA 4TN1A 3L0OA 4PHTA 4PC6A 2KBEA 1KI2A 3I5XA 1A4RA 2C5LA 5DO9A 3PCRB 5F3WB 4AG5A 3ZS8A 1GG2A 4TZ6A 1WXQA 2BOVA 1P4SA 5GVSA 5EE1A 4NONA 1OB5A 1KY3A 1R4AA 4EJSC 1A2BA 3KB1A 1FUKA 1M1YE 1XP8A 4IKEA 4QHYA 5CB8A 3K0FB 4ERNA 2ZVPX 2J0QA 4RFVA 4MKFA 2JIZA 2QSZA 3SEAA 1N6HA 4A8JB 3O8RA 3K53A 1VHLA 5FUVA 4PSAA 4HEJA 1CJUC 4M8NE 2NZ8A 2RGCA 3U3JA 2JLXA 4GRAA 4D0LB 2VHCA 3R8FA 1GNRA 1TMKA 4C0KA 2VIIA 1KI4A 2GXSA 2F55A 1UBFA 2DY1A 2G83A 3QEOA 3WHKA 3WNBA 4TL8A 4XVQA 3CR8A 3B9PA 5G53C 4OJQA 2ZSEA 4LHXA 4IOKA 1N6LA 1NY5A 2WJVA 2GCPA 3SJBA 4GSYA 5DYGA 3DOFA 2Q9AA 1KOFA 4V0ME 3CRVA 2QT1A 2WHXA 1ZNYA 2W0SA 1KJYA 1VCNA 2B8WA 4DJTA 4M1MA 2QSYA 4OQFA 3REFA 1E4VA 4QGAA 2FV8A 5JLJA 1C1YA 1NMYA 3FMOB 4PHFA 1OXUA 4LJ4A 1PUIA 3I72A 4YLGA 2J0VA 1JECA 5EXPA 3N70A 1P2TA 4KO8A 1XTKA 3LBHA 4HUQB 1DELA 2A7QA 2ZE7A 4F4JA 2ODWA 3U3OA 3CWQA 2BM0A 2ZE5A 3G82C 4W5JA 4B44A 1G291 1B23P 5DLQC 2GVZC 1AZSC 5DGXA 5KDLA 2NO0A 2GXUA 1W2HA 3T06B 3MJRA 2CHGA 5CM9C 1OH7A 1UADA 3AF1A 3BB1A 3KKQA 1W49A 4OL0A 4DLYA 5D3MA 1W5TA 3WNCA 1T9HA 4Q1AA 3EZ9A 4C7OB 1P2SA 1J7KA 4LPSA 1Q1EA 3EIQA 1PV4A 2EQBA 1OH8A 2YWHA 4DIDA 4JVSB 2AK2A 1TUIA 2P6RA 1ZRHA 2O8BA 2PMKA 1YR9A 5G3YA 2QORA 1UPTA 3SYNA 2ZIAA 1XF9A 4O2LA 4B6EA 5K8TA 1COWD 1E2PA 2ZSFA 1I2DA 3THYA 1W4AA 3HP1A 4UNNA 4RZUA 1EWQA 2ANBA 2ZR0A 1A7JA 2A5DA 3R9IA 5HE8A 4X8LA 1TEVA 2CHQA 4PQRA 5G40A 3KFXA 4M4SA 1HYQA 3PEUA 2GF0A 3PV0A 1Z0DA 1EFTA 1PZNA 2IEYA 3ZIAA 2FMXA 2RHDA 2F1IA 2IYRA 3FFBA 3RS7A 3AM1A 1ELOA 2C04A 5E3HA 3U5ZB 2XNDA 2V6JA 4BLQA 4BRWA 3M4YA 1GOTA 3GJ3A 2J7PD 1G4UR 3WYFA 1P72A 2OXCA 1PLLA 2Z43A 4WZAE 1E79D 2KB0A 2ZEJA 3HJNA 3RDPA 3DM5A 3RRNA 2IHBA 4GZMA 5TMPA 3CX7A 2IWRA 2RCNA 3CRRA 2AD1A 4EJSA 4TQ9A 4L5BA 4RKEA 1JPNA 1G5TA 4BLSA 2WWGA 4TQUS 3ADBA 1SVOA 2F1RA 1OF1A 3CH5A 4AG6A 1P2UA 3VTKA 3KJGA 3PFIA 3RABA 3U60B 1YRBA 2MSDB 2X2EA 3C8UA 4AI6A 2JEOA 3BGWA 1S1MA 1Z08A 2GA8A 4QBFA 2OT3B 4B74A 2VF8A 1FOEB 2IUUA 4DLTA 3K0AA 2O5VA 3T34A 1KNQA 3A37A 4A0HA 5KO2A 3P32A 4KJZA 2EFEB 1WDTA 3EC1A 1E9DA 4TQAA 1KYIA 2ZSAA 4TLDA 1JJVA 3FVQA 4LZZA 1X86B 3WRXC 3EAQA 4A4DA 4HAXA 1DS6A 3L8YA 3LLUA 4JVLA 4N1AA 4AD8A 3CRMA 2GAOA 3THWA 1Q44A 4EIWA 4CEIB 4LV5B 2IK8A 4U02A 3CZPA 1E0JA 1DE0A 2REBA 4XVRA 3SJCA 4Z1MD 3GFOA 4AC9A 2GZDA 2CJWB 2R65A 3A1WA 3V4RA 4P33A 4QGHA 2VP9A 4LV6A 5IK2D 4ZPXA 4FIDA 2HT6A 4YMUA 2D62A 1D2NA 2BJWA 1CR1A 1KKMA 1XXHA 1D2MA 1TF5A 4I4LA 2H18A 4HB4A 3VR5A 3ZZUA 2CK3A 3QENA 4Q18A 1RC8A 1N3BA 3GQBA 2WV9A 1N6RA 3KTAA 1T5IA 1MV5A 4IRUB 4LYHA 1NVVQ 1T91A 4Q7MB 1OIVA 4DUGD 5FTLA 4V0LA 2FNAA 4DEYA 5KU1A 1Q22A 5JCPA 1S96A 1E2KA 3KUCA 2NPFA 1U8AA 5JI3E 3T1TA 2Z4RA 3GMTA 4LUCA 4BFUA 1EX6A 3BB3A 2R44A 1F6BA 4L9SA 1EFUA 5KDDA 3ZD7A 4HLQB 5FH9A 5EE0A 1J70A 3EARA 4JLKA 2SHKA 5L3SA 1ODFA 2DHRA 2JJ8A 2QQ0A 4HB3A 3ND8A 1G41A 2ZJ5A 1Z5ZA 3K0FA 3B1ZA 4R9UC 2FGKA 4KYIB 2VSOA 4QBHA 4JIMA 3AF0A 3GLFE 4RD0A 4A8JA 2QAGC 4HLDA 1HEIA 1N5IA 3SN6A 5B30A 3I62A 3AVYA 1KI1A 1ZD8A 3Q85A 4B48A 3U44B 2HXYA 5CIWA 3QQ5A 1HV8A 1G5PA 2IYXA 3BXZA 4NCHA 1DAEA 4PO9A 1DARA 4PANA 3WHLA 2F9MA 4BLTA 4WZ6A 2OFXA 1MABB 1NIJA 2VF7A 4X8MA 4D0NA 121PA 2FGJA 1CJMA 1LY1A 3CO5A 2ZM5A 2EYQA 3ZH9B 3R9WA 2BM1A 2W83A 4M9SA 3R7WA 2Q0HA 5A0FA 2V54A 3BH6A 3DMNA 4TMXA 4Q9IA 3SFVA 3UANA 4GMXA 3VR4A 2JDID 3SNHA 4DSUA 1BYIA 3F8TA 1KZ7B 5JWOA 2PLRA 4JLJA 3QXHA 3FKSA 3TGPA 3LQQA 1W47A 3LY5A 1XWIA 1HTWA 3IPYA 3L2OB 3U3KA 1G18A 4JBXA 4G3XA 2F3RA 2C8VA 3WMEA 1NVUQ 2E9SA 2GDJA 4P32A 2QBYA 1TQDA 3O8CA 1G3QA 1GZSA 3LFUA 4US1R 3BOSA 1FNMA 5GJCA 2ZR9A 1NKSA 1CKEA 4FMDF 1GRQA 3B7GA 4JSYA 2GBLC 2ZRNA 3IO3A 3EPJA 4AWXA 3OFNA 2PJRA 2XOKD 3KKOA 2I1QA 4W9MC 1G8PA 3QNUA 3K0CC 2AXPA 2V8OA 3NEJA 4DKXA 5BN4A 3MWJA 1BMFA 1QHYA 3PG5A 3QVUA 1NLZA 3GLIB 2VP0A 2W58A 2ZUBA 4PC7A 2DFNA 2IT1A 4MGYR 2QGZA 4DSTA 2IUSA 3BJIC 4C7OA 1R8QA 4PZZA 5KUTA 3WY9A 4GZLA 2QT0A 1N5JA 2ZR7A 5KTYA 2BC9A 4A82A 1XDBA 5FTJA 3GJ4A 3TUJC 4LC0A 3L8ZA 5JFGA 4IDNA 2AR7A 2WAXA 4OHZA 1US8B 3RANA 2OG2A 2AN9A 1E2GA 3IHWA 4HLUC 4LSGA 1YE8A 2UKDA 3NDPA 3QEJA 3WP1B 2IX3A 2V7QA 4DWJA 4XIGS 1VG1A 2OV2A 2CLSA 3CNOA 5KYKA 3CKLA 3AV0B 3GLHB 1PUJA 3PVSA 4WAUA 4XD7A 3GLGA 3I61A 1JEDA 1EK0A 2BHRA 3OEHD 3NTUA 1OHHD 4A0FA 1FTSA 2IYSA 3LXRA 5JWRA 3DOEA 1K6MA 3ZJYA 821PA 4TL6A 1S9DA 4RVCA 1E9RA 1HURA 4JBYA 2DFKB 3L0SA 3GP8A 2OM2A 2IF2A 1QHNA 2CNWD 1G8HA 1JNYA 4G5OA 3NWJA 2V1XA 1XEXB 3IILA 1P5ZB 1SVLA 4BFWA 1T0JB 4BGDA 2ZI7A 4MYTA 2OLJA 1VTKA 1KY2A 2P3SA 2JA1A 2YOHA 4O0MA 3W6NA 4MRVA 5IHPA 2DWQA 3UATA 1N5LA 1ZJ6A 2NGRA 1IXRC 1NIPA 1W44A 2WIAA 4Q9JA 4CEJB 3TAHA 1XEWY 3OIUA 4LJYA 4MH0R 1A1VA 4LGMA 4KSBA 3U2QA 3CNNA 3IHLA 4LHWA 5J4KA 3SBDA 3ZQ6A 1KDOA 3D31A 4YDSA 4R71A 1P9NA 2QAGA 1DO2A 4XTCS 3B78A 4B2IA 1HT2E 2HDNB 4BEBA 4EQ6A 4AURA 1E98A 3IGFA 3H84A 5SZJA 3T15A 4HI0E 1ZM3A 3JVVA 3I92A 2NO9A 3OEEA 3T12A 3SQXA 3TAUA 1IY2A 1FPMA 1Q57A 2BKEA 2HYIC 3LNCA 3EX7C 2IC5A 2RAPA 3RRMA 3DKPA 2EW1A 2QE7D 3T5GA 3M1IA 4L9WA 2YKGA 3U7EB 1KSJA 4IDHA 4EUNA 4BECA 4Q4JA 2H1LA 3UPUA 3TVDA 3DDCA 3E70C 4ZDWA 2JDIA 2BEJA 5EP3A 4L4UA 1VMAA 1FP6A 4ABYA 1NN1A 1SKYB 1XTSA 3EW9A 1DAFA 1BKDR 1H8HD 4C9BA 3M0EA 1KI6B 3IIJA 2J45A 2OLKA 4B2LA 5JJKA 1YZNA 2CJWA 2HJVA 1F2TB 3X1ZA 3SE0A 1CIPA 4F4IA 3AP3A 1LV7A 3H4MA 4CGZA 1XPUA 4CW7A 5K8UA 4HYYA 4N0DA 1RIFA 1XEFA 4DB2A 3CF2A 2HLDA 4FINA 3CPJB 1KDRA 3ECCA 3D8BA 3IKJA 3BE4A 2X77A 1EFCA 4ASUA 1JAIA 2ZITA 5AUPB 2XZOA 1O3YA 4D0GA 2P0EA 1ESNA 4GOJA 4W5WA 1Z0IA 1FL9A 2GBLA 4DLUA 2XOKA 3MFYA 4TTRA 3I73A 1GNQA 5GJWC 2JLUA 1W0JD 2C9CA 2OUKA 2NZJA 4I1OA 5JCZA 5L3VA 2ZI5A 1P75A 4PSVA 1WQ1R 3K0CA 3WMFA 3X1YA 4TYQA 3DM9B 4JT2A 5EE5B 4RCYA 4QM7A 2O8DA 3AP2A 4EKDA 1L7VC 1RZ3A 4TMVA 1RJ9B 2A9KA 2O0HA 4PPGA 3GD7A 4FI3C 1M7GA 4M2LA 3CZQA 4O3MA 2JCSA 1J99A 3QKUA 5TDHA 2V6IA 3A4MA 4H1VA 4UKDA 2OHFA 1E2NA 4HATA 2ZAMA 3V4FA 5B58C 4BZQA 4QNMA 2BCJQ 2XSZD 3TR5A 1RE0A 1HE1C 4QC2A 3SI7A 1OFIA 2WWFA 1XD2B 3RS3A 3CUEF 3LW7A 4LJAA 1MABA 4JZKA 3D3QA 1DAMA 3EASA 4HLCA 2LCFA 3LLMA 3KJEA 4HDQB 3TBKA 4HUTA 3I8XA 3W3ZB 3SQWA 4TTPA 4ZV4A 4HAYA 4R7ZA 2ZE8A 4QFMA 1HQYE 2JIZD 1V5WA 2WBLC 1IN7A 2Q3MA 1DAIA 1PLJA 2WPDA 2CNWA 3TMKA 4LJ5A 1Q21A 4EDHA 2XZPA 4Z54A 1JB1A 3K1JA 1OE0A 4UNPA 2X1VA 2ODBA 1WB9A 2QU8A 4BFTA 4DCVA 5D3QA 1R0XA 2V1UA 2O52A 2OBLA 4A9AA 5IT5A 3B60A 4NU0A 1R7RA 3EWSA 3RSLA 5HR5A 2NQ2C 2FJUA 1CJTC 1W0KD 1E9AA 1OT3A 3QXSA 1AKYA 5CYOA 5BQ5A 5AJVB 4E03A 1S1CA 3OAAA 2VYFA 5CJ2A 4DLSA 5JS8A 3HDTA 2XTMA 3TJZA 1Q0UA 1FTNA 4JLBA 2ZRBA 1ZNXA 1QHXA 2ZS9A 4M9ZA 4Q19A 5BYKA 4PPNA 2F1HA 3I1FA 4Q66C 3RS5A 4DEXA 1VECA 2GZHA 4YONB 4GOKA 1QF9A 3QBTA 4B3GA 2PLFA 1IJFA 2NMVA 1ZD9A 4HZUB 3TVTA 2D4HA 1MO6A 2C9YA 5EE3A 2ERYA 3E2IA 4ARZB 4BE7B 2XB4A 4RZ3A 1XU4A 3GJXC 4J0QA 4YMWA 3EG5A 1D5CA 3NEYA 1US8A 2HV8A 3MAAC 3W9YA 3K70D 2X8AA 1VPLA 4LCBA 2YC4C 1C4OA 1I4DD 2GCNA 3CX8A 2AWOA 1ZNZA 2VLIA 5FBQB 2N42A 1MOZA 4FMCF 2XXAB 5KSPA 3VNVA 2FPKA 5BWMA 1DTSA 2IS1A 2IEZA 3NBZC 5AJXA 4HDCA 4BZXA 1P9WA 2GVDC 4K81B 3U4QB 4KFRA 4ZIRB 1JALA 3DL0A 1SKQA 1I2MA 3PXGA 4TMWA 3BAFA 5DSZA 1HUQA 4E22A 3ZVMA 2BMEA 3Q7PA 1W0JA 4P4SB 1KZGB 1G19A 4PPQA 1LF5A 1ZMXA 4B71A 1XEXA 5M04A 4YMVA 3IEUA 1XX6A 1N6NA 3P27A 4IHQA 4LJ7A 1GWNA 2GXQA 1M7BA 1SXJB 2FSIA 3B1YA 3NG1A 4MKHA 2F3TA 4XVUA 1VYVA 4GT1A 2C95A 5K8LA 1S0UA 1XZPA 4OQLA 3KQNA 2FG5A 3ZIAD 4URXR 4IW3B 3PUZA 3EPKA 2P65A 3FTQA 1XJQA 1JR6A 1XXHE 2O0JA 4PR0A 4X8OA 2XSZA 2VHQA 2XNDD 4P4TA 4AK9A 1CRPA 3PUWA 1OIWA 4S35A 1N5KA 3IQXA 2RGEA 4KFTA 5EZ5A 2RGAA 3EZ6A 2YJTD 3MWKA 4TMZA 1SGWA 2GRJA 1XB2A 3EC2A 4MGIR 3FHTA 1W5SA 1CP2A 2J3EA 2ONKA 1OFHA 4DB4A 2VTKA 2ZI3A 4DSOA 2ZS8A 1GM5A 3HU2A 4NCJA 1A5TA 3VR6A 1GKYA 4A1FA 1II0A 2WZQA 4HSEA 3LWNA 3KJIA 4G5RA 1GVNB 2ZJAA 2GK7A 1X1SA 4OJKA 3NIBA 3QOFA 1J90A 4PO1A 3L82B 4Q02A 4UXHA 5E7MA 4IXNA 3UMSA 5HCNA 1CR4A 2JASA 1CBUA 3S1AB 4BASA 1J8YF 4B3FX 4RSGA 3BFVA 1F5NA 4A92A 3K0SA 1CF4A 1WP9A 3QXJA 4AYTA 5AK0A 1U0LA 3QKRB 1Z07A 5DISB 3BB4A 1W0KA 2AK3A 2I1VB 5C4GB 4LYFA 4D80A 1OV4A 3PR1A 1GL7A 4QJ4A 1DADA 1XMJA 3BRWD 1Q1ZA 3D6TB 3H2YA 4F91B 1CR2A 1F2UB 5FR2A 5TB5A 3QF4A 1E2IA 1QHGA 3UXMA 2QI9C 3CR7A 3ZZ0A 4Q03A 4I99A 4PTLA 3RRYA 4DT1B 2AXNA 3AKEA 3AKCA 4KHZA 1N6PA 4M21A 4S2EA 1WBDA 3A58B 4RD3A 4FWTA 2AD5A 2PL3A 3VHLB 1SXJC 2G0TA 2V55B 4US2R 3O8DA 4EPVA 5FTNA 2CK3D 2CL7X 2WJIA 2YNMA 4B76A 1TF2A 4JMPA 4LHZA 5FPKA 2QENA 2FEMA 2R9VA 1MKYA 3QF7A 1T4GA 3TQFA 3UIEA 3WYGA 5TVKA 4KVGA 4PZLA 1EESA 4FCWA 4QJ5A 1XCMA 2ZRGA 1JAHA 1XMSA 3V9PA 1UBCA 3BORA 2YINC 3FMPB 4PAMA 1QVRA 1OKKA 1BOFA 3HU3A 2OFWA 2VHJA 2QPAA 1W2GA 3KKPA 3RWMB 3FFAA 5A4JA 2BVNA 3FHCB 5FPYA 1W36B 1Z6TA 2ZJBA 4KCGA 5EJEA 4JBWA 1IN5A 4A8JC 1Q3HA 3X1DA 2VSFA 2WWHA 1I4TD 2QRNA 5JHHB 1KDTA 3BH7A 3PUYA 4URUR 4D6PA 5BXQC 3RSOA 2KJQA 1S3GA 3BS4A 2QRZA 2IA5A 1UEIA 2QMEA 2LKDA 3A1VA 3AGQA 2J5XA 2R6CA 1S3SA 2KWIA 3AF2A 4G1UC 5H8WA 5F98A 1E9BA 3I5YA 4NYJR 4Y0AA 4A36A 4GMDA 2QA5A 4HZIA 1ZW6A 2GAAA 2J9RA 4JL6A 1AKEA 3IBGA 1CLUA 2IW3A 2PZEA 1MO5A 2VPPA 1NJGA 1KK0A 1TPZA 2ATVA 3A8TA 2RB4A 3FKSD 3JZMA 4XH9B 3ZQJA 4D4MA 5A5GA 3GLGE 1KMHB 2ZRAA 4QBIA 4MDEA 1X6VA 2H92A 5EXTA 2XTNA 1FQJA 5EXSA 1M34E 2XX3A 2ZETA 2B7CA 2KI5A 4HAVA 1W7AA 1DPFA 1R8SA 1AQYA 4WZBE 4DVGA 1SVMA 4LK2A 2CMKA 4JKYA 1R0WA 4IDOA 1FUUA 4GP6A 2VO1A 2F43A 3NBXX 4JS0A 1AA9A 5FI1B 1MRNA 5AR1A 3QKSA 1TF7A 4LHVA 221PA 3OFND 4KBFA 4RFSB 4WXRA 3DVLA 2Z4SA 1TEXA 4UJ5A 1VCMA 5IRCD 1N0UA 3NHAA 2GXAA 1OJLA 1IAQA 3CH4B 1CEEA 1BS1A 1TQ2A 1X1RA 3KXLA 1BMFD 3Q3JB 3QPWA 3CF6R 421PA 1E1QA 2XXAA 4PAQA 2N46A 3ONWA 3HWSA 1Z0FA 1KSHA 2FFBA 2W2TA 4XWAA 1G3IA 3ND9A 4LI0A 4CEHB 4P31A 1F3OA 2DFLA 3F0TA 4MITA 1AGRA 1G8FA 3TK1A 2XEXA 2G1JA 1MRSA 2ASEA 4GFDA 1OPXA 4P4SA 1IJEA 4QNRA 4JLAA 2IYQA 2JATA 2V7QD 3W3AA 5AUNB 2OBNA 4TYNA 3TKLA 3FOZA 2QMUA 4CZ2A 1CRQA 2REOA 2GHIA 4Q47A 4Q4AA 4XD7D 4WVFA 4RJLA 5J40A 3EPLA 2DB3A 2BV3A 1E2DA 1SXJA 2PT7A 2V3CC 3L0PA 1PVOA 1KK3A 4EFMA 1G9XA 3GEHA 2C9OA 3DPUA 1YHNA 4KU4A 2FFQA 3AGPA 3AKYA 1E0SA 1SZPA 2HXSA 3FMIA 1J2JA 5FOTA 1G1MA 3H0KA 3BIFA 2OCAA 3IEVA 1T0HB 3VKWA 3Q9LA 4O25A 1KI3A 3QKTA 2A2ZA 4D81A 1UDXA 5SZHB 1Z8FA 1R5NA 2IYTA 4BLPA 3DHWC 4ILEA 1XNJA 4AIIA 1J8MF 1ZUHA 3RS2A 4B3XA 4YC7A 1S9HA 2FN4A 3DMDA 4OHYA 4D25A 1VIAA 3TR0A 1E9FA 1WF3A 1T3LA 2VSXA 3TSWA 1SHKA 4C30A 4TSFA 4ESVA 1QG4A 1YZLA 5BN3A 2QN6A 4G01B 1NMZA 3S1AA 5E95A 4UNQA 2FZLA 2FA9A 3P1JA 5JEEA 2J1LA 2W6JA 4V02A 3OEED 3KKMA 4TLAA 3LDAA 1ZIOA 5TV2A 4KXFB 4GI7A 3QSYA 5C1BA 4Q01A 1ZUNB 4Q7KA 1AGPA 1ZVQA 1H8ED 3QKRA 1ZBDA 4OQMA 4QL3A 2J59A 2B21A 3RS0A 2XGJA 1IXZA 3DZ8A 3AUXA 2ZI9A 4IEEA 5HPYB 2XTZA 4DCTA 4KI0A 5SZKB 2ZJYA 4Q48A 3TNFA 1F2UA 2DFTA 4NCKA 2ZUDA 2UZIR 2ZANA 2ZRCA 3MJHA 1E1RD 3IUYA 4IDQA 4DT1A 3U7HB 4B47A 3KQHA 3ADKA 4URZR 1JJ7A 1LVGA 2Q9CA 4FMBB 4EFLA 2FSHA 4BZPA 3WBJA 4E07A 4TT3D 5C18A 4HUQA 2BIFA 3VMFA 1ZM2A 1SULA 2A5YB 1HA3A 1NMXA 2DPXA 2HLDD 4YXWA 1WE2A 2A30A 2FZ4A 4TLCA 3PEVA 4ASUD 3ZD6A 1JR3A 1DAKA 1Z3IX 4YMTA 4L15A 2PT5A 3PEWA 3EXAA 1AZTA 3BC1A 5DN6A 4KAXA 3QXXA 5K8IA 1P2VA 3B1VA 1BYUA 5KNBA 1BO6A 1DO0A 1TTTA 4IVRA 2XJ4A 2AFHE 2R6GA 3MLEA 1GKUB 2GEVA 4Z51A 5CITA 2WIBA 4F92B 2ZRJA 4WOPA 3GEIA 1IN6A 2WM9B 2P5SA 4UNSA 3RHFA 5LD2B 5FL7D 5P21A 3QE0A 3W8RA 2IYVA 2GWHA 3ZVNA 4QHTA 2CCKA 1OW3B 2Y8EA 4LX0A 4Q4HB 1Z2CA 1EFRD 3R9XA 4OQXA 4W7SA 5LPNA 1U0HC 1U98A 1KO5A 3B85A 5LB2A 4M0LA 5G3ZA 1ZCAA 3Q5EA 2RH5A 1YZQA 4IXMA 5JSZB 2QTFA 2IS6A 1YRAA 1MH1A 4GOXA 2DYKA 5DI3B 2YOGA 4QGGA 3T5DA 4EAQA 3LQRA 4TLEA 4DLRA 1WRBA 2ZJOA 2PJZA 4WA7A 3GJ6A 5B57C 2GKSA 1P73A 3VR2A 5HKKA 2HCBA 1KTVA 2W6ID 4IVPA 3I8SA 5FOUA 5HE9A 3RS4A 1IXSB 1NLFA 3NVAA 2WJYA 2P67A 4CF7A 3CONA 4B75A 3E1SA 2A5GA 4IJMA 5C2JB 1KAGA 4ZDIA 5DH9A 2IXFA 3J81k 5AUOB 2WPDD 1KO4A 1EXMA 4P3YA 3IDQA 3SOPA 4PFSA 2ORWA 1OIXA 1MO4A 2EFCB 2P2LA 2ZYVX 1CJVC 1CJKC 1W4BA 4HDOB 5E4FA 1Q1QA 3PJRA 4JLVA 1M7HA 1AS3A 1X3SA 3GFPA 3Q7QA 1RRCA 1II8B 4OBEA 3TW4A 3SZRA 4M9QA 2ZVQX 4DCUA 2PZGA 1OXXK 3HR8A 4MKGA 1IONA 2NIPA 2VA8A 3HPQA 3OAAD 4PC1A 3IBYA 2ZQ5A 3IO5A 2G1KA 3ADDA 1N6KA 1ONBA 3B13B 4M53A 2IBMA 2R6AA 3TRFA 3A1UA 2EFGA 2Q6TA 5FOVA 4FW9A 4KLNA 1ESMA 1YZKA 4Z8XA 4CYMA 1XMIA 3AVUA 3AVWA 2QPTA 3AH8A 2E1RA 3I3SR 1DAHA 5FI0B 3SU8A 1E2JA 5F9FA 2GESA 2HYDA 1H8EA 4ZO4A 1U8ZA 4D4LA 4XWKA 3LA6A 3MD0A 3SHFA 3HU1A 4URYR 1NF3A 5FTMA 4PHGA 2YWGA 3BFXA 4CEHA 2L0XA 1E9EA 4G5SA 2BEKA 4TMTA 1C9KA 2Q21A 3JZAA 4LC1A 1VYUA 1D9XA 2C98A 4CEIA 1D6JA 5GJVC 3PITA 1DBSA 1FMJA 1IY0A 2QQEA 4JVNA 2JLQA 3B1XA 1N25A 1E1RA 3DO6A 1Z83A 1JQLB 4MRNA 1TQ4A 2Z83A 4CRWB 1OFTA 2BBOA 1XMVA 2WKQA 1N0VC 1XCGB 1YZUA 4PO8A 1YR7A 3G0HA 2D2EA 2PCJA 4JL5A 4TT3A 2OCBA 1OH6A 5CIQA 1BH2A 1CR0A 2OCYC 4BWYA 4B73A 1ANKA 2GTPA 1M8PA 5KPDA 3CLVA 3B2EA 3NC0C 2NO7A 3CNLA 3QG1A 3OZXA 5KOYA 5FUYA 2WWIA 2AL7A 2BJVA 3CRW1 5FTKA 3W5IA 1U9IC 4TTQA 2QZ4A 4A2WA 5GADl 1E99A 2G9NA 1GRRA 4BFXA 3K0EA 2XB2A 4NMMA 2WKPA 1NLYA 3C5CA 4FMDB 4IOMA 5L3RA 2ZUCA 4BEJA 4R98A 3OE7A 5BW8A 1DAGA 1U99A 3K09A 1DEKA 3OIWA 3VQTA 5LB4A 3W6PA 2F9LA 4NYIR 4EPTA 4Q5IA 3RC3A 1YQTA 5FL7A 4DLVA 2EWWA 5FUWA 1R6BX 2FH5B 3AVTA 1EFRA 1NI3A 3C14C 1CTQA 1LTQA 2JLSA 3Q72A 4B3DA 3NBYC 2ONJA 3U44A 2MSCB 3OF5A 3U6BA 2CLCX 4MUBA 5CLLA 1X8LA 4YMSA 1LFDB 4JLNA 5J4LA 1Z06A 4OQNA 2I3BA 3MMPA 1UKYA 5DYIA 4Q7LA 3TIFA 3ICEA 3MGCA 3LH5A 2FFAA 1M2OB 5FPTA 1FX0B 2ZU6A 2W6IA 1KO7A 2WMNB 3IPXA 1JXMA 4KFUA 2AWNA 1VYTA 2WOJA 2MSEB 2AFIE 4F38A 3K70B 1OFUX 4K8OA 4Q21A 4Z8YA 2AHOA 4MYUA 4TYYA 3EIHA 4I1SA 3B8HA 4JYBA 5KNCA 2IL1A 4G5GA 2WTUA 1PLKA 2ERXA 2WOOA 2OAP1 5D3MB 2PZFA 4LV8B 4WIAA 3LVRE 4NYJQ 5KDOA 2RHMA 3GJ7A 1AQUA 3RLFA 5FOWA 3U6KA 1KI7A 2HJGA 4QBGB 5HZHA 2OZEA 5JMTA 3I4LA 4Q7JB 2ZRHA 4DC9A 2GNOA 3LV8A 4CDGA 2DR3A 2P6UA 2C99A 2PCLA 2O8BB 3I32A 2IYWA 1QZXA 2ZRIA 3LXXA 1Z63A 4Q1BA 5J4VA 2JJ2A 1OXTA 4XJXA 2D2FA 1FZQA 1DG3A 5C4MA 5AJYA 2IUTA 3THYB 3Q5DA 4RD6A 1JXOA 3SYKA 4KFSA 2OO7A 4CIDA 1NBMA 1U94A 3SYLA 3CF0A 1KI8A 4RY2A 3SFZA 3R20A 1IQPA 2GEDA 5LDDC 3MUFA 3GLIA 1QHHB 2WJHA 1FW6A 1KI9A 4RKFA 4MYCA 4UJ3A 3MSXA 5KNDA 1YR8A 4MKIA 1Q12A 3M6AA 3PIRA 1N6OA 2BDTA 3OESA 1QG2A 4IOLA 4EPRA 1LS1A 1JQJC 4NE2A 1W4CA 3LRPA 3U3RA 1T8TA 3N2EA 2QMOA 4Q4LA 1NP6A 1E2LA 4GL2A 4Q1CA 4M22A 3W6OA 3AVPA 4OYHA 2OFOA 3ZDQA 4URVR 5ANRB 2WWXA 3ICQB 1G7SA 1E6CA 5AJWA 1P6XA 4AKHA 1G3MA 3GLHA 1OKKD 4C0QC 1IN4A 3EA0A 1OB2A 2KBFA 4KSCA 4QXAA 2R62A 4LJ8A 4EJSB 2WVJA 3EIEA 3AVQA 3KJHA 1E96A 3FWYA 3JVUA 1KO1A 1ZNWA 1U81A
chains in the Genus database with same CATH superfamily
1NSFA 4KQKA 3C8HA 2FPIB 3KEOA 3JZDA 3VDXA 2WAOA 2ZR8A 1VJTA 4FZVA 3W8NA 2IW1A 3LW8A 2OGWA 2REQB 3Q0IA 2IHJA 4GWKA 5FFMA 1O0BA 4YEDA 2YVLA 5IF9A 1YFZA 2RGYA 3JQBC 4KX3A 3S2IA 4KPGA 4CU2A 3QWFA 2A67A 1BVYF 1Z4LA 2YVQA 4LMPA 2XVAA 3I6ZA 3L06A 2P9BA 2NV0A 1N33B 2R5WA 2W2MA 1ORIA 1Z6GA 4ZT3A 3USES 3QVVA 4WK6A 3JD3A 3QZUA 3OJ0A 1OWLA 5AVOA 1BVUA 1UK6A 2JLZA 4OI0A 2CLEB 2H1RA 5HWSA 1ZSVA 3Q3EA 5A3RA 4CEJA 1AGXA 2PR2A 1FP4A 1EUZA 3QHAA 4DDUA 3D5EA 1NSTA 4J9VA 2ZAOA 2Z2JA 3DDUA 3BKWA 3DR3A 4K9DA 4F4CA 1Z6YA 4BB0A 4M1YA 1E89A 2UXDB 4KTVE 3AKDA 3UG6A 2WSSA 5KKCA 4TL9A 1W5AA 5T41A 1VCOA 5E7QA 1G7TA 1WPGA 1Z7YA 1ENPA 1EXWA 1LSUA 1SXJE 1TQHA 1XXHB 1XCPA 3CEAA 4O59O 2HHHB 4YCLA 5CVEA 1UT5A 2C4WA 1PW7A 2I1WA 3PNBA 4G41A 5AWFC 3HLKA 4JY7A 4AUNA 1NLMA 2O06A 3WWZA 3URMA 2RMKA 3B70A 4LIPD 4Y2JA 3MJ4A 1HEUA 2GD2A 1P18A 3PFNA 4R3WA 3HS3A 1ZYUA 2L42A 3CN7A 1VHTA 3DZDA 3FNGA 3KTAB 3L40A 4KWIA 4OXQA 1E1DA 5FTWA 1SXHA 1U2DC 2B36A 4UPVA 2JHFA 2J3HA 3SQDA 4M1EA 4DDHA 4E12A 4EY7A 3OIGA 3V3TA 1L8QA 2H8GA 4NJOA 4OKSA 1GPKA 1EHIA 4PHHA 4RULA 1P1RA 4U00A 3F5FA 5GAJA 5JR3A 3O2NA 4XTRA 1KGDA 2WR8A 1C9DB 1OLOA 1Y4AE 1YXMA 2QSJA 3QJYA 3QG5A 4ZVNA 1TIKA 1W4ZA 4D3FA 1SXPA 1YNOA 3H5NA 2R5NA 3BSSA 3CE9A 4AF7A 2ZXUA 2E4VA 3EZXA 4HVAA 3RKRA 3ROFA 3W9UA 3RV3A 2G5CA 5DCLA 1EFDN 4ALNA 4Y18A 2WQ7A 2H16A 1T8UA 3OQ6A 3E5NA 1MB3A 3TEJA 3UO8B 4O4IB 2P91A 1L4BA 1SVWA 4O08A 5DTMA 3SS8A 3LKDA 4HAWA 1U0BB 1SUIA 1PEYA 4TS4A 3X1WA 2CKDA 3TI7A 5BUQA 3IUEA 1I5EA 1M3SA 4KZPA 1NATA 4YCCA 1P3DA 4WSOA 3NAZA 5AKZA 1R10A 4X61A 3UM9A 3GGJA 9MHTA 2RSLA 3UYKA 4UQPA 4DLPA 4WH0A 1R6XA 1QC5A 1CC1S 2IE8A 5BNTA 1F5SA 3KZKA 4LE0A 4LW8A 1GILA 2V96A 4YQEA 3COVA 4LBYA 3G2QA 4RWEA 2ZDHA 3LQ2A 4MWDA 1VGRA 2CXNA 2GPWA 5ALWA 1TUBB 1FLNA 5IZCA 5B2ZA 1KQPA 2P4UA 2VP5A 4RZIA 1IM5A 1WABA 3HCPA 3SM3A 1LXCA 4X1KB 2ZIXA 3LQKA 3SPXA 2I9PA 1HY3A 1JILA 3RFCA 3TR6A 1EVZA 1DG1G 3BH0A 2BGGA 1TU4A 4JT9A 2A3RA 3RADC 2RHOA 4KWTA 4G37A 4CM1A 5EE9A 1JG3A 2HO5A 2CE2X 3BF8A 2WT9A 2AKEA 5BSEA 2O20A 1J8FA 2C8KA 3ZDFA 2ZTLA 4P3OA 4K6CA 4XUDA 2IP4A 4JEUA 4K86A 1U0OC 2P6NA 3ISTA 1G7RA 3B82A 3ORFA 5BQOA 3REGA 4JL8A 4HYTA 1GGFA 1FDOA 2P9FA 4L08A 4D4IA 4V0KA 3OLVA 3C41J 3CUWA 3FW1A 5GZ1A 2F3UA 3AEXA 2W6QA 1ZVVA 5C8YA 1GUFA 1Q92A 2XCOA 1HBJA 3P0RA 1V95A 4S0XA 3H0EA 3PF8A 3BGSA 3QPVA 4OSEA 4EFDA 1E8MA 3ZVKA 2X1HA 1IULA 2IDJA 3TRJA 5AXDA 4DR7B 4RNCA 3VU3A 2OB1A 3PQ2A 1OI4A 3FDIA 2IH2A 3IEVA 5FLEX 4AJHA 5MN5A 1QKIA 1V5EA 2GN4A 5AHXA 4ACBA 1JBQA 1HH4A 1JIKA 1Z5PA 2GHRA 1IPHA 2PMFA 3ABQB 3GOHA 1AKWA 1NUSA 3NORA 3PFBA 4KIFA 4KO2S 4J1NA 1LK7A 3NO4A 3RTAA 1T9GR 4DV0B 5CJPA 5AM0A 2FFRA 1V26A 4MRSA 5DNDA 1FZTA 1WKVA 4TLMB 4Q37A 3COZA 2C2HA 1K7XB 2QM3A 3QUAA 4RZ2A 5A3JA 3WK5A 5LQJA 1TGVA 2OSBA 5J9FA 1DDIA 1Z5WA 1UAYA 3K16A 4PPFA 4PZ9A 2QTHA 3SR4A 1OZGA 1P44A 3VUFA 3EC7A 3KR2A 3ZGZA 3VJMA 2MIIA 3O9ZA 2I4MA 2UYOA 3EZFA 4HY3A 1WW8A 4FGJA 3WXBA 4CE6A 4CVNA 1NM5A 4MUAA 2IXEA 3WADA 4ER0A 4RZSA 1YI0A 1GAJA 5JD3A 5EUBA 4DMHA 2G9UA 3GLGB 1TCBA 2XE4A 3DULA 3QSGA 4WOJA 2AX4A 1UKCA 5IJ0A 1IPEA 1YDGA 3CLUC 2NU9A 2Z5VA 2PX3A 5AKYA 3F1LA 1E8NA 2JGKA 2YHIB 4M7RA 1MT0A 1Y4DE 4M1KA 2FCRA 2RI6A 1Z0KA 4CUZA 4DR6B 1I80A 4LYJA 5DHSA 1IN8A 1I7NA 1C1HA 1JBKA 4P83A 2WC1A 1DUVG 3V6MA 4G9GA 1IHUA 3F47A 4P36A 1MTZA 3RSGA 2F1JA 3HY6A 3OJEA 3OIYA 4R51A 2A9RA 2IH5A 3D4OA 1QFMA 3RVDA 4GMGA 1XZCA 2SECE 4JODA 3FCAA 2HUPA 3QW4B 4LJSA 1SCDA 4OK6A 1ZU5A 2H51A 2PLAA 4FHZA 4BJHB 4D82A 5CG2A 1SWVA 4ZZIA 3NBQA 1E94E 2IUYA 5DASA 4A6XA 5DCYA 1C7QA 2MR5A 2NO6A 5AJTA 2QD2A 6REQA 3EY9A 3FJYA 4RTQA 2DCUA 3ZH2A 4RD1A 4JJ6A 2CC2A 3I6IA 2BR4A 1PSWA 3EQ8A 1ISFA 1O87A 2P77A 2QROA 4O6VA 4JYCA 4ENUA 3U4QA 1PQWA 1EG7A 4PQEA 4KWEA 4KQ6A 1WWKA 3W1VA 1W36D 3WGJA 1YVDA 2C2WA 4XCVA 4Y6QA 4UFPA 2B7BA 4CKEA 1W8DA 2DHQA 2Z2YA 3D6NB 2COEA 1YJBA 3HR7A 3I5AA 4R1MA 3EAGA 1E0KA 4YDHB 5G0VA 3SF0A 2X86A 1Q95A 2FN3A 1F0KA 1V5GA 4OBWA 1JIXA 4B45A 1GXSA 2CZQA 3FE2A 3QW2A 5U1PA 2WFAA 4ZWNA 1VCIA 5JDCA 1XT6A 4CMHA 2ZIGA 5H3HA 2CLDX 4DLWA 5IEBA 4GXQA 5HKKD 4HGZA 5LIPA 4YT8A 4UBMA 1RHJA 1J9ZA 1KWKA 2BKUA 2FLWA 1RYZA 1AK2A 2AEMA 2VYVA 2FPWA 3JQDA 5YASA 3WXMA 2HF9A 1VP3A 4UUQA 3D1JA 2ZT8A 1OXSC 1CUFA 3KG2A 2I99A 2FMIA 2ZKLA 4JQZA 3UMGA 5JNSA 4JYAB 1XJCA 2W4IA 1BA2A 2AOUA 5F5NA 2PWBA 2JLWA 1JYFA 5DBOA 2FEOA 5FPSA 1JDBC 3VUEA 4W8GA 4XRRA 2WY2D 3KALA 2H1VA 3W5JA 1A5AB 3CJQA 1Y80A 3MYYA 3TCNA 2EFDB 2BMDA 4G4GA 3V1TC 3ZS9A 2D7JA 2VNSA 5CVDA 1P1BA 3ZVLA 3QHQA 3KUDA 4WT7A 3GUHA 2ZE6A 1XN1A 2GCOB 5DM0A 3GDOA 5ITWA 3VX3A 1Z0AA 3WDLA 4HUJA 1TRHA 1NVFA 4FHEA 4DM7A 2G9RA 1Y9AA 1K6IA 1M6NA 1M1YA 4P4LA 1YKSA 1T3ZA 4B8YA 4LS3A 2BHNA 5EUQB 3JCZA 1UFRA 4Q3AA 3TQHA 4EI8A 1N2IA 3IEIA 2J87A 1AS2A 1AQIA 4MZXA 3IALA 4C6SA 1TVCA 3LXMA 2WTAA 5E1DA 1SD5A 4L2IB 2OGSA 2ORVA 4B34A 3PD7A 4K6OA 5C1DA 2IZ6A 2QOEA 1JIQA 3L3BA 4WTOA 3SP1A 5BR8B 1NC1A 1JAZA 1CNMA 2XD9A 3S5JA 3LTEA 3ZE8A 3PXUA 4IIJA 4L16A 4UU0A 1C1DA 1KFJB 1TEHA 3MJSA 2HSZA 1Q3TA 1JIUA 2PD3A 2P8JA 2WICA 3IYLW 3KJXA 1LBQA 3NTQA 2D1SA 3TLXA 1WS6A 4JMLA 3G85A 3I2GA 2QMQA 4WJLA 3KYCA 1TT7A 4POAA 1UZUA 4BQPA 1YJCA 4XPIA 1MR3F 2XQJA 4F4HA 4BMNA 5DWQA 1E60A 1Z82A 1X7XB 1MXFA 3ER6A 2H1CA 1NJFA 1A9XA 4OU5A 3VSDA 4PC3A 1YU9A 3LUPA 3B9QA 1HC7A 5C31A 4BBZA 1YQEA 5ELLA 3KU4A 4PQYA 2OORC 3AB7A 4YGXB 3WLRA 3DZIA 5BSHA 1VBFA 4ICIA 2ISSD 2ZI6A 1F0NA 1K86A 4ZYZA 2QRPA 3NANA 3LOQA 5HBGA 1KIMA 2Q1UA 3HJAA 3TE7A 4BWFB 1IUOA 4E94A 5K01A 3JASA 2CEAA 1TU3A 2YV5A 3C16C 1PL0A 1YVUA 2I0FA 1LEHA 3OZCA 2VP2A 4WXPA 3FCEA 2XODA 4JUIA 4M9CA 3OHMA 5LL6P 2GF9A 5CDYA 1W5FA 1Q17A 4YV0A 1JSXA 1HYEA 4UMDA 2PH3A 4WV3A 4XE5A 3MS4A 3WC4A 1HLFA 2Q2WA 2BR5A 3BA6A 1E79A 3HU5A 4ZZ1A 3EOZA 2AOVA 1QE3A 1N36B 4LOAA 1XFAA 4RHFA 1AA6A 4WVLA 2P5UA 1SCQA 1ZSNA 2WK1A 5IKXA 1YUMA 4B2YA 3MK31 2V9CA 3C6ZA 1R4NB 2PANA 1VL1A 4B2PA 1CDOA 3RYFA 4Y1RB 5F78A 4MARA 1E2FA 4AZVA 4EKIA 3PCXA 1AT1A 4P9NA 3IP6A 3ZZTA 1C3VA 2VG8A 4H31A 4EHNA 5LN1A 3W8FA 2YZ7A 3GNQA 4RIHA 5THKA 4M9XA 1PO7A 3AZQA 5IYZA 2A0KA 3T9CA 4E31A 5C9ZA 2O2GA 1LPAB 2FF7A 3KOZA 4DOMA 4UHKA 2G80A 5J4YA 1YMVA 3AEUA 3AX6A 2WD8A 2ZTUA 4F93B 1H93A 4AJKA 1YA8A 2JI4A 3HA3A 4LBZA 5JCOA 3SZOA 3TN7A 5CPFA 4UE3S 1KH2A 1G4HA 1HDXA 2PYDA 1WZIA 1QG6A 3L9WA 1SXQA 4FBGA 3E3OA 3IAXA 3H9UA 1WB5A 4OXNA 3IVAA 1ZINA 3EWAA 3AEQA 2AEEA 1KNXA 2ZYWX 4WHMA 1XQXA 4XB6B 3TPFA 4DYDA 4X1YB 1E2HA 3SICE 1Q84A 1BWQA 3ESRA 3K6KA 5AIBA 2ZIZA 4MW2A 4EY8A 2VT3A 3QMPA 2ZSKA 3FPBA 4F86A 2DULA 4NDZA 1A0OA 3SC6A 4PLGA 4BPBA 3P8ZA 1F60A 3GIDA 4GWGA 5C5CA 5KNCD 1U8XX 3FOBA 4C4XA 2A9VA 4QASA 1SKAA 3AFMA 4BAZA 5DT9A 1K1EA 4V39A 2N3ZA 1L3CA 1Q11A 4FDTA 4NBLA 2PKWA 5IMBA 3B3JA 3THXA 4A0GA 2I3ZA 5JSQA 1HTBA 4R16A 2R84A 2ZYIA 3CY6A 1ADBA 3LBNA 4KWCA 5BSTA 4WZAA 3UWSA 1I14A 2PV7A 5KX5B 1CVRA 2W6ZA 4YMHA 4M60A 2XZTA 3LD9A 3REQA 3PQEA 2XUQA 1V7QA 1PR0A 3T5CA 1S2MA 4TTIA 3EZ7A 4UTZA 2DWUA 4GDFA 3GAFA 3OZSA 4KV9A 5CDFE 2JJ2D 4C01A 1FMFA 1DJNA 1TD9A 2RGNA 3OTWA 1SH7A 2GJ9A 1CF2O 4RFSA 4Z0PA 3WI7A 3EIWA 4UBOA 3WJAA 4X94A 3CCBA 4UUNA 4DNOA 2YC2C 1EGMB 3PI6A 1UBNA 3HCRA 4O2BA 4CIXA 4F7WA 1Z9BA 1MW9X 2AG0A 3BWYA 1CQZA 2ZCVA 3NUQA 1Y6FA 4Q1FA 1QOPB 4MVJI 4TV8B 3ABSB 4TM8A 1J1ZA 4OP2A 1UIRA 5J5CA 1AUOA 4QKQA 2HM7A 5BVGB 4CR7A 1EZ4A 4KIJA 1L7PA 2OHHA 4UDNA 3G7UA 5KNDD 4DDVA 1BQ3A 1KSFX 3PFCA 3VZCA 4F9EA 2VSQA 2XTAA 1YTLA 2O4UX 2GQ0A 1AZLA 1NW3A 4MEBA 4ACAA 3KS9A 3JR7A 1XRQA 3GJ5A 1I4LD 5EIXA 5ALOA 4ARBA 3FPLA 3AUAA 1DHTA 1T6ZA 2VYND 4C22A 2C2XA 1FSGA 3KQMA 1NRIA 1DKRA 1U8YA 4DR2B 5AXCA 3HMKA 3FPAA 3F71A 3DE5X 4XYBA 3WGHA 3WRYC 2B0JA 4QYMA 1YE3A 4AJEA 2LRHA 1I7DA 3NJRA 2BEUB 2J41A 2H1WA 1NUQA 3BCHA 3LZ6A 3RF6A 3TSZA 4ENWA 2ES4A 1G3RA 2C5BA 2GCGA 4QT0A 2FB9A 1JEEA 1F9AA 4JU8A 4CI0B 3A3OA 1PFUA 1SKYE 3R5KA 3BUSA 1IZ7A 4B7CA 2ZB2A 2X4DA 4H77A 3ITEA 4I9HA 1P7ZA 1V7CA 1Z2EA 2GJKA 4V38A 2INGX 3D7LA 5AICA 5TQ2B 3F90A 1A95A 5TSDA 1YAJA 1MP0A 4BFYA 4I7EA 5KYGA 5DNEA 1JPJA 2H00A 5L3ZA 3SJZA 1LZKA 3DF9A 1IUNA 1W1IA 1NNEA 1QG0A 2AMVA 1SVSA 4HWOA 5JJCA 2LWIA 1G8AA 1WMEA 2BR3A 3IOCA 3D0OA 1Z2AA 4H6WA 1PR4A 1RKBA 1LDMA 5EP2A 1ONPA 2A1UA 2QTAA 5IW8A 3U48A 4NJEA 3O7MA 2R11A 3GJ0A 3CWZA 2AJTA 4F0JA 2EBHX 3G59A 3HO6A 1HNZB 4Y9DA 3TW8A 4CL8A 5LMCA 4G84A 3BXXA 5DYWA 5IN4A 4B31A 4JJKA 2DR2A 2FK7A 3DL4A 3GFTA 1NRJB 4U7HA 5EJ6A 1E3EA 1L7QA 1PYGA 1ZGHA 2Y1GA 3T9EA 4ZCIA 4UXIA 4YCSA 4NMHA 3HB0A 1VOTA 1R9NA 2XBUA 1TAHA 2W90A 1NV8A 2ZAIA 1QHIA 1N6IA 1KSGA 1NVVR 2VCHA 5H70A 1D9ZA 3OTOB 3GLFA 1NUHA 1SUPA 4AZWA 1AJEA 1ZL2A 2UZ3A 1E0AA 5FLKA 5KVCA 2VZEA 4DDTA 4FGUA 3K92A 2YCBA 5AKLA 4D5EA 5KWSA 1QQ6A 2VUIB 3GFRA 1GTVA 1EBUA 1RBMA 2HB6A 2AW5A 2NO5A 4LVCA 4CV0A 1P1KA 3ER8A 2P0AA 1PDVA 2FZKA 3OKAA 5CK4A 2ZB3A 1ENYA 3NHJA 1YZYA 3SDSA 1ES9A 1G5RA 2D5IA 2FOXA 2VPTA 1NQVA 2X0KA 3D3JA 3SBEA 2FXIA 2VS1A 4TMYA 2H9AA 2FPMA 2ZRKA 2NT3A 4AZ3A 1RFLA 4CLRB 3GEBA 4GOOD 1YL5A 2XUZA 3KOYA 3NH9A 4RVUA 1FQOA 4LJLA 2VBFA 4OI4A 2IOFK 3P45A 4BWVA 1HORA 2GFHA 3SM9A 4ADSG 3B6EA 2ZAGA 1WPRA 3S28A 1GDDA 2JJ1D 2GCEA 3BMOA 5CTAA 3QVMA 3KQSA 5CUQA 3Q3IA 4GR9A 1VG0B 1M9NA 3A9SA 4UUBA 1OHHA 1SR8A 3E22A 3FGPA 4J4TA 5ALEA 1FLDA 1MB0A 5AW1A 3TFOA 3BULA 5ENDA 1ZU4A 3K6JA 1HR0B 4C88A 2E4AA 4E5KA 1GSIA 4KAFA 2WJGA 1UKZA 3EGXB 1UPBA 4DR3B 1T4BA 2HGSA 3JQ8B 1KOJA 1XTTA 4N9WA 4BE4A 2R5FA 3W90A 2NXCA 1U1CA 3NNSA 1DKNA 2ZRLA 3CZ4A 1BKYA 5KTKA 4Y0NA 1NMQA 1WULS 4BQSA 4AJPA 2A9QA 1Z17A 1G8KA 1M0TA 1KP3A 2I6GA 4XIJA 2YMQA 1Z37A 1JLRA 3GEMA 5HTKA 4O4HA 4DBLC 4OFWA 2K5UA 2ARKA 4BOYA 1NQAO 1QAMA 2QW1A 1IZYA 1J22A 2QRMA 1L5HA 4MI1A 1OBFO 3Q9NA 4FIZA 2PJDA 5IWAB 1VLQA 2ATXA 2P68A 5FBRB 1RDFA 5AVWA 3HDGA 1BWPA 3ZX5A 5DSTA 3ZVRA 1EQAA 3LCRA 4PVCA 3HJFA 4EPYA 4I6GA 1D5WA 5T8KC 2IYOA 8ABPA 2Z0MA 4RVSA 3ADCA 4IDPA 1MB2A 4NR0A 2EOAA 4GBGA 4PZDA 1JI3A 5IVIA 3TNLA 2Q50A 1MNQA 4AJOA 1WCXA 2YUTA 3MWYW 2OESA 2WF8A 4GYJA 4UEOA 3WTBA 4GEKA 1YJXA 1KEVA 1WW3A 3FB4A 4IF6A 4DCMA 3GU3A 2BFEB 4KRXA 1OVGA 4LX8A 3WRVA 1KHHA 3D0RA 2PFSA 4TROA 4Y7DA 3RIMA 4FP9A 2O8EA 4KMOA 1E3TA 2EG9A 3RSFA 1NG9A 1KDYA 1BE0A 1ZD4A 2PZBA 3CURA 5CYFA 4DQUA 1ORHA 4FMPA 4D9IA 1E2QA 2RGBA 4X6XA 2PO5A 5FLYA 2CVFA 2ZS7A 3A2NA 5AHRA 1M1UA 4B7XA 5TGDA 1AX9A 1LQ2A 2JFQA 3I30X 1GRNA 4GPD1 4A6DA 1T0BA 2GM9A 1LW6E 2QNBA 3QLUA 4JBIA 5F2NA 4X65B 1YU6A 1EJ6A 3O0DA 4MB2A 4BLRA 3AVXA 1I33A 1MAHA 1Q50A 5EMKA 3UG7A 3MWDA 3MJCA 4XX0A 2I4IA 4TRMA 1KAOA 2KSQA 3WLFA 2CDNA 1AQNA 1JHYA 2YY6A 3MHPA 3HVRA 2ZBQA 2NTYC 4CFZA 1E32A 4N82A 4YCMA 4L5CA 4JGGA 1EGQA 3UMBA 1C3OB 1EQUA 1BWRA 2AKYA 4H9GA 5IYZF 5TEVA 4C76A 5JU6A 1P7CA 3ND5A 4NZZA 3SSMA 1EUDA 3IIKA 2GLTA 1NQTA 1JFVA 1WXIA 2HJ9A 1NT4A 1LC0A 5ELXA 4RDIA 2J0UA 3F5QA 3RC8A 1SG9A 3GZ4A 3O75A 5BSUA 3UCXA 1ZEJA 2FMHA 2QRUA 1IL0A 4M1SA 2XUPA 5ICCA 5IP5A 4W1RA 4KP7A 4CG2A 3WYDA 2XTJA 3N2IA 4L07A 3FVTA 1NM5C 2VQSA 1E2MA 4ER3A 1LTKA 3GVPA 4ZYVA 2JLYA 5LZ4A 4F4FA 1R6UA 2J9FA 4FT2A 5DHFA 4IIDA 2ZRMA 5C34B 1P60A 3DEYX 5I7FA 3OA2A 4Q9LA 1Q16A 1PJ4A 1EX7A 1XG5A 1XVIA 3GP5A 4N3GA 5IAGA 3FPGA 5AJZA 3A3NA 3RUCA 1CEYA 1Z22A 2ALJA 2X4IA 2P7IA 2QJTA 2WW8A 4D96A 3O8BA 2XXJA 4FYJA 2HRQA 3RC1A 2ODQA 2RKOA 3OUZA 2X23A 4JJGA 4LXHA 4MB0A 3VU0A 4BRUA 4ZT5A 5AD1A 2G04A 1WUYA 3EGIA 1NBAA 3DLCA 1OTHA 1O57A 3GH3A 3PQ7A 1NUUA 2VDKB 2OXRA 4M1TA 1E92A 1FFYA 4D1YA 1FYDA 1H0SA 4PC6A 3I76A 1FFXB 3N1UA 1D7AA 1A4RA 4FCCA 1DIAA 2B5WA 2C5LA 5DO9A 4AG5A 4MVXA 1HE3A 4IMPA 5L6LB 4RVFA 2UAGA 1TLLA 1GYRA 2HL6A 1F3LA 3UOGA 2Y92A 1R4AA 2WTBA 4EJSC 2Y9PB 3CGGA 3KB1A 1CJBA 3WWDA 2AHRA 1SBHA 2XCUA 4O2BF 4I9UA 4ID3A 4RVOA 3G2JA 2YQ5A 4PEVA 1I51A 2Y1FA 2AMLA 4J1QA 3EH1A 1N6HA 4A8JB 1O6GA 3JYHA 4IIXA 4FFOA 5FWAA 5KYYB 2OC4A 2AF4C 4RVHA 1ISPA 2CXTA 2PZAA 4R1LA 2FWIA 4M8NE 1DPGA 2NZ8A 2RGCA 2H1HA 1NW7A 2WG1A 3EAFA 3QA9A 3YASA 1DC4A 3G5TA 1VSVA 2VIIA 4DFDA 2DY1A 1DFIA 3HCAA 3WHKA 4XVQA 4OJQA 5KQSA 5I7WA 3KT3A 1C0EA 1RLJA 4KGZA 1NY5A 2X9VA 2OV6A 3GVHA 1RYEA 4GSYA 4WXHA 2VWHA 3DOFA 5EJMA 1QAQA 4V0ME 2QT1A 1MD9A 1QPGA 3HN7A 2W0SA 3MYRA 1EXDA 1VCNA 4MTLA 3AFIA 3OMXA 3IBFA 5KYXB 4OQFA 2PS0A 3HKEA 4II2A 3DEKA 1KQNA 3GA7A 3LVBA 2ID7A 2WIGA 3O73A 1QWOA 4ZVRA 2B9VA 5AKHA 1VPVA 3FMOB 1W29A 3SHTA 1MLDA 1N0IA 5A5FA 5LQMA 1GU1A 4X24A 2VEOA 3QRWA 3I72A 1NW4A 3PQ8A 4YLGA 2OM6A 3QV1A 4OHFA 3NQ41 2BFNA 2L69A 3HB1A 3NPMA 3L4JA 4CG0A 5C3MA 4EO7A 4CJXA 1XTKA 2Y3IA 4O3FA 4AECA 1SD2A 1DL5A 3C3AA 1I3OA 4MW7A 4WDRA 1M2OA 2IODA 5DSXA 5FP0A 3DLHA 2AUNA 3P0JA 7YASA 3UBTA 1O77A 2GVZC 1X1AA 3PYXA 3K20A 2R6JA 2GGSA 1NI4A 3AIOA 4IIYA 2GXUA 2AEJA 3OC6A 4I9GA 2QUKA 3VKFA 1H66A 3T06B 1ZESA 2YV2A 1YJ8A 3BB1A 3D6VA 5BSVA 4BJ3A 4HWRA 3IBCA 4J16A 4OL0A 3WNCA 4FT4A 5FD8A 1QCYA 3JQGA 3ZE9A 2Z30A 2QD3A 4LPSA 2NTJA 4U39A 3EIQA 2NUTB 3UAVA 1L7NA 4LK3A 2YYSA 3DDNA 3T7CA 4L5JA 3V4VB 3ISJA 2AK2A 1GAQA 1ATIA 4ZRDA 1EA5A 1ZRHA 2PMKA 3IKTA 2W2QA 4WUVA 1P39A 3DBRB 1P0QA 2CVPA 1SCUB 2JVKA 1Z8HA 4L4XA 2ZIAA 2JHCA 3UC5A 4U7JA 2DE0X 1XF9A 4DSAA 4DPLA 4F9TA 2JIDA 2Y66A 2C5GA 4OUDA 3WQHA 1FFGA 1YCDA 2A9FA 2Y1KA 4JC4A 4AWAA 4QPDA 1I2DA 1J0DA 1W4AA 1H2EA 1UMDA 2O3TA 3UXEA 2ZJ7A 5K99A 4CV1A 4RZUA 4ZEMA 2ACKA 1JXQA 3KJZA 4GQBA 2OD9A 4IO1A 3ZBPA 1EVYA 1TEVA 3S1SA 4JR0A 1VLMA 3CLUD 1XVUA 3VDRA 4TKVA 1V8ZA 2GF0A 3VR4D 3OZUA 4P2GA 5IX8A 5JYEA 1M1XB 2IEYA 4NS1A 2Y1WA 1KPIA 1N5RA 3OJXA 1FDTA 3FFBA 5SYAA 2A5LA 3RS7A 3A28A 3F67A 3AC0A 1WKCA 2XNDA 4IGAA 4HNAB 5AOCA 2M6RA 3M4YA 2VYCA 5FJJA 3WYFA 2J7PD 3PI7A 4KGXA 4XGQA 1UBRS 3SE7A 3ZHZA 3OX3A 4ZQBA 1I7PA 2ZEJA 3GLKA 3BGVA 4R0MA 3E7XA 4HO1X 1ORWA 2O2YA 4AUKA 1HZZC 1J24A 2RCNA 5KQPA 2MCFA 1KJNA 5JH7F 2EWMA 2I03A 3EVNA 5HF9A 4O4HF 5F76A 5T6BA 2YFYA 4RQUA 1T35A 2A9JA 4OM8A 4PPYA 3ADBA 1YQWA 5LDGA 1OF1A 3PGJA 5K3AA 1A8QA 1YRBA 2O9JA 2REQA 1LDNA 3C8UA 3HCEA 5HS4A 1DIHA 4KRYA 1AN9A 3SXUB 4BMOB 2GA8A 4KQGA 4N18A 2PKQP 2CXHA 1CUVA 4MVJG 3LUFA 4ME6A 2VF8A 2VDJA 3N59A 1FJHA 3IAM1 2IUUA 3J7TA 3V8QA 3A37A 4DWVA 1YBVA 3MINA 4EEXA 5CA1A 5JYDA 1WDTA 3IRVA 4MIKA 4MIYA 4Y2HA 1L5LA 3EC1A 1E9DA 2VF2A 5I8WA 2G1PA 3RAJA 5B1EA 1TIPA 1NONA 4TLDA 3ZDBA 1JJVA 3WRXC 3DF7A 4KQHA 3WQSB 3G02A 1DS6A 3LUGA 1GZDA 1PCXA 1SOVA 4URFA 5JMOA 4LRYA 5KU7A 5IULC 4L4SA 4KDCA 4EIWA 3G1UA 5BWCA 5JAUA 4XVRA 1NE2A 3M6WA 1FUIA 3PGMA 2GZDA 2CJWB 3A1WA 4AC9A 4GOND 4P33A 3V4RA 5FWDA 3H4IA 2VP9A 2HNAA 5IK2D 1CEQA 4ZPXA 5BXYA 1DQSA 3AMVA 3KDAA 1JDSA 4YMUA 1FSSA 2B37A 4L22A 1XXHA 2JIPA 3DTVA 3K5IA 1UMBB 4I4LA 4OQ4A 2H18A 5J63A 3C43A 1AGYA 4P5PA 1SCJA 5M7EA 2B5OA 1T4CA 1JDZA 3F4KA 1YBFA 1J8DA 2V5VA 3GFFA 3I9FA 4Q18A 4WWHA 2VRNA 3V48A 1AF7A 1PR6A 1EXNA 2HMSA 4NSNA 3U16A 3KTAA 1U3WA 4MVJE 2NVUB 1H2FA 1LNQA 3T52A 3ER9A 2O7SA 4ZQFA 2FUG1 2OLEA 5TS2A 2J48A 4V0LA 1IYZA 4DEYA 4Z1OA 4RTOA 2WSYB 5KU1A 5A62A 1C4WA 3L6RA 1S96A 3FA2A 1E2KA 2H5IA 3LE8A 2W22A 2BGNA 4MI6A 1JPVA 3HO8A 1M6VA 2NPFA 3T7IA 3U3XA 5JI3E 2C97A 4BFUA 1EX6A 1YK0A 4XDHA 5TPZD 3M5WA 2ZUUA 5KDDA 1K7SN 1HE4A 4R1SA 5FH9A 5D1HA 1RPNA 3HKDB 3FLBA 4I2VA 5EE0A 4DY6A 4X3PA 5ER9A 2C8JA 3KBBA 5EEHA 4OQZA 2DHRA 3DDWA 4HB3A 4HNQA 5J2UB 1OCEA 2QUJA 3ND8A 2ZJ5A 3Q7RA 2AG5A 1SG0A 1TK3A 3B1ZA 3M89A 3AJDA 3K35A 1R9GA 4UULA 3GT7A 3MPUA 4O4IA 2V7WA 4OJTA 3I62A 3GHHA 1B3RA 3ICCA 3P9QA 3SQNA 3QQ5A 4YAEA 1HV8A 4WD3A 1DAEA 5AKEA 1DARA 4PANA 2P3QA 1EFPB 1HNNA 4O2AA 2IOFA 1CZHA 4JB2A 1HSZA 1ZBQA 3K8ZA 4X8MA 3WIVA 4D0NA 4EG1A 2IKQA 2FGJA 3DO8A 2EYQA 2JGJA 1WXHA 2ERCA 2JZNA 3R9WA 1RPTA 5T4HA 1TUBA 3RRJA 4PBRA 2V54A 4JBGA 3RKUA 2PGDA 3ZD9A 5LOVB 3UANA 1SEVA 2XCQA 4GMXA 3VR4A 5GTDA 4RF2A 4EJFA 3QUQA 3FYCA 3QI7A 4X1KA 3F8TA 4R0VA 1KZ7B 3SNHA 1B8VA 1MO2A 3GIWA 4JLJA 2IPMA 5B1SA 5FEUA 3FKSA 3TGPA 1B73A 2WSIA 4JKOA 2QTRA 1XWIA 1UDAA 3INNA 5EMJA 4ROTA 5GIPE 1D4AA 4KYVA 1ZZEA 1QZTA 4PXSA 2IV7A 5G1OA 1AOXA 4OA5A 1NVUQ 2EW8A 3F6SA 1NXXA 1VGQA 1J2TA 3GPLA 2XMQA 1N2HA 2NO4A 3V7WA 5ICMA 1T9BA 3QK7A 2LTAA 3RJZA 4KAAA 5EMNA 5GONB 3WIEA 3O8CA 3NP9A 2X0FA 3LFUA 4W5RA 4US1R 3MJDA 2ISCA 1W5BA 4PBSA 4IHJB 1LBHA 3N28A 4FMDF 3WMWA 4I4CA 3B7GA 4JSYA 5CP8A 4ZQHA 3IO3A 3EPJA 4L3OA 2O0LA 3BMQB 3EEFA 4F56A 2PJRA 1G2OA 3OE4A 4WOKA 1RS0A 1VE5A 4N7RA 3ZV3A 3FCXA 4BX0A 1RWVA 3KUKA 3COSA 1KTIA 3QNUA 3RYCB 2FVXA 4YT5A 1T2FA 5COQA 2Q4OA 3V32A 4QYSA 1LBTA 1ZI6A 4FYXA 4TMFA 4UHBA 2A86A 4NZOA 4ZVUA 2P2GA 3C6MA 4IX9A 2GFIA 1X77A 3L92A 3JQ9C 4J4BA 3QE9Y 5E1MA 3L9XA 2PUAA 2UZ4A 1S2GA 2IUSA 4LZOA 5GOZA 5KUTA 2GS9A 1YUBA 2QT0A 1VLHA 4JI3B 2H4HA 4X93A 4K7JA 5D6NA 4BJ6A 5KTYA 4A82A 1PL6A 1MEJA 3RC9A 3MF4A 1ZXXA 1Z25A 3Q11A 4M54A 1US8B 4YO8A 2YIVX 3H5OA 3A9WA 3G2NA 3IHWA 2J4DA 3HBFA 4LSGA 4YP0A 3RYHB 3ENWA 3NHMA 3FB1A 1YE8A 2JW5A 5GGXA 1KYQA 2QHXA 1VG1A 1IOWA 3ONVA 4QUHA 1U4SA 4QUDA 1ZKDA 4Q12A 4AO6A 3GLGA 3N0TA 2EL7A 2AFRA 4DY4A 2O7NA 3IJEB 4XQGA 3S3TA 3OZEA 4LE1A 3E81A 3ECSA 2CL5A 1KARA 3AHJA 3Q4GA 2IYSA 3WK7A 5JWRA 2R6HA 1GTRA 2J08A 2PUEA 1K6MA 4HEA1 3HLYA 1V9SA 1Z38A 1M34A 4DN6A 1BE6A 1E9RA 5HGXA 3AM4A 1HURA 2YJ3A 3L0SA 1DC5A 3PLRA 5EWJB 4G5HA 1Y8AA 2E1PA 4ER7A 1MBZA 4LWPA 1G8HA 4G5OA 3R8XA 2P3OA 1U0NA 3NWJA 1YZFA 2V1XA 1THGA 1XEXB 3QFRA 3QX9A 1BQEA 4HBGA 2PXAA 3W8DA 4ENVA 3L18A 1T0JB 1A8PA 1LD3A 3K2IA 2ZI7A 3UV3A 4BGDA 1SO8A 1XCOA 3A32A 4Q9JA 2DVMA 2WIAA 1IWPB 5EZYB 3TAHA 4RK5A 1Z73A 3OIUA 4II3A 3L41A 4Z86A 2WEKA 4WKPA 2O2DA 5ALPA 5CB0A 2P5YA 1T1IA 3HQ4O 1RAIA 1QFSA 4KNWA 1RCFA 3U9LA 3X1JA 4Z4GA 1AV7A 4YFVA 1EWTA 1OLSA 1PJZA 5EJ4A 2HDNB 1A97A 5C7YA 1RR6A 3A11A 4Q4CA 3H84A 5A1JA 2HA5A 3OTGA 5SZJA 4CCSA 3TMAA 4Z2YA 1DZ3A 3OEEA 3RU2A 5G1NA 3P2MA 3G9TA 5A7HA 2ZUTA 3T12A 2R7NA 4K9KA 3SQXA 3JAWA 5I8PA 2ZZKA 2BKEA 3SHOA 3GMIA 2RAPA 1YRWA 1Z7BA 3DKPA 4OM7A 4UVGA 5LP1A 3T5GA 4DSZA 3P0HA 1MMFB 4L9WA 3STWA 3LUHA 3PPXA 1A9PA 1KSJA 2AS0A 3TTXA 1RI5A 5DW3A 2XA9A 3OU7A 4TXMA 3TVDA 3ZW9A 4F4UA 1O5IA 1Y3IA 4J29A 3VR6H 1P7VA 2NTVA 1S2NA 1K5PA 3IH5A 5EP3A 1VMAA 4FUQA 1QFYA 1SKYB 1XTSA 5IN5A 3D8RA 5CX1B 3QVJA 1KI6B 1SBTA 3OT5A 1R18A 2I3GA 4QLAA 1P2GA 2P1RA 4U8GA 4BC1A 5D85A 4UHEA 3T1YB 3IEMA 1YOBA 2HJVA 3QYFA 1FVOA 1ISRA 1CNEA 3JARB 4WCFA 5ES3A 3TTWA 1LV7A 4G2TA 3KKZA 1CVIA 3D81A 4JJ7A 4F1KA</