4C3ZA

Nucleotide-free crystal structure of nucleotide-binding domain 1 from human mrp1 supports a general-base catalysis mechanism for atp hydrolysis.
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
231
structure length
231
Chain Sequence
TNSITVRNATFTWARSDPPTLNGITFSIPEGALVAVVGQVGCGKSSLLSALLAEMDKVEGHVAIKGSVAYVPQQAWIQNDSLRENILFGCQLEEPYYRSVIQACALLPDLEILPSGDRTEIGEKGVNLSGGQKQRVSLARAVYSNADIYLFDDPLSAVDAHVGKHIFENVIGPKGMLKNKTRILVTHSMSYLPQVDVIIVMSGGKISEMGSYQELLARDGAFAEFLRTYAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords MULTIDRUG RESISTANCE-ASSOCIATED PROTEIN 1
publication title Nucleotide-Free Crystal Structure of Nucleotide-Binding Domain 1 from Human Abcc1 Supports a 'General-Base Catalysis' Mechanism for ATP Hydrolysis.
doi rcsb
source organism Homo sapiens
molecule tags Transport protein
total genus 70
structure length 231
sequence length 231
ec nomenclature
pdb deposition date 2013-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00005 ABC_tran ABC transporter
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4c3zA00
1N5JA 3A1TA 2QE7A 1SHKA 3MAAC 3ZZUA 5E7IA 2R62A 4CEHB 4LWZA 1YZKA 1NN3A 4HB0A 1GITA 1XD8A 5A4JA 5IRCD 2YINC 4PZZA 4LV6A 1A4RA 2HF8A 3LX8A 1W49A 1XFAA 4BFYA 1IHUA 3U2QA 2PT5A 3EX7C 4MGIR 3WNBA 2Z83A 1DO0A 1R0WA 1PLKA 3GJ0A 1RJ9A 4D4JA 1YU9A 4LJ9A 4PQFA 3ZZ0A 3PG5A 2ASEA 2VA8A 3W3ZB 5FR1A 3WMFA 2YHSA 1F5NA 1KY3A 1QHNA 4PC2A 5FTKA 2EFEB 2WTUA 4LHWA 1ESNA 5JS8A 4QL3A 2RMKA 4AC9A 4Q4LA 2WJYA 1CJUC 1X1SA 4HZUA 2IHYA 1KOFA 2QPAA 2FN4A 4TL9A 1S0UA 5CB6A 5KTYA 1IOZA 3QUSA 2AKAB 1Z29A 4DT1A 1HE1C 2JLXA 5C4GB 5F9HA 4JLJA 3HJNA 3RDPA 3W9YA 5AJXA 2C9CA 3DHWC 1Q12A 1QHXA 2IL1A 3DL0A 4V02A 1P60A 3AB3A 1V43A 4DB4A 3ICQB 1SXJA 4AG5A 3EASA 3GCGA 4U7DA 5IF9A 1Z22A 2FSFA 2GILA 3B8HA 1XNJA 3T35A 1LNZA 1DARA 3DM9B 1KSFX 3KXIA 5CM8B 2CCJA 3RS5A 1R6BX 4IOLA 4A36A 4CT5A 5FTNA 3RWMB 1AS2A 1DAKA 2B6HA 3OIYA 3S1AB 1ZM9A 3QI2A 1F48A 1XPUA 3CIOA 2C96A 2WKPA 2ZJZA 3QXHA 4IW3B 3I1FA 2FA9A 2GNOA 2C99A 4V0OA 5EZ6B 4D26A 1WCV1 4IDOA 3X1DA 1RKBA 3BK7A 2J87A 2VP6A 2ZI7A 1TADA 1US8A 2B21A 4BUJA 3GMTA 3EPHA 2C2HA 1GKYA 4L5BA 2CLCX 3U3KA 2ZJAA 4CYMA 1GL7A 1QG4A 1VCMA 2VF7A 3LVRE 4H1VA 3B9PA 3PEWA 2G1KA 1KO4A 1W4RA 2HXYA 3B78A 1R5OA 3TLXA 1CJVC 1D9XA 5J4LA 2H57A 5KSYA 1J2JA 1FX0A 1YZUA 1ZM3A 4QKQA 4ZCMA 3BB4A 3UMSA 1C1YA 2XZLA 3PFIA 1XCMA 2F3TA 4N0EA 4EPXA 1DTSA 4MA4A 2Q9BA 3A4MA 4WOPA 5L3QA 4PZYA 2ATXA 1NP6A 1E6CA 2GXQA 1OT3A 4H9GA 1L4UA 2IWHA 3O8CA 2GK6A 5IT5A 3F8TA 2VHTA 5DN6D 4AY2A 3HP1A 3LV8A 1FFHA 4PHHA 1RC8A 4JL5A 1OXTA 3LQRA 4ZCLA 5FOVA 2WMOB 3AUXA 1A2KC 3QXSA 4P4SB 3CO5A 3NXSA 1M1YE 3DOEA 3OF5A 2CNWA 3IIMA 4D4KA 1KGDA 1FQKA 5DNYB 3OFNA 2ZI9A 3LDAA 3OEED 2OILA 3L0PA 1CR4A 3IKJA 3K0CC 1M7HA 1G5RA 1DOAA 4OQXA 3W90A 5EXPA 2ZUDA 1H8EA 2IYQA 4R2HA 4TTQA 3CRRA 1IN5A 4CF7A 4BASA 1P5ZB 2DYKA 3KKMA 2EU8A 3GJ3A 1M7BA 1AIPA 4NL4H 3U60B 2WKRA 5D3MB 2W2XA 2ORVA 3K0FB 2Q0HA 4EJSB 2C95A 3AVOA 1TUIA 2WKQA 4XIGS 1D9ZA 4EDHA 3THWA 4IXNA 4M9QA 5EE9A 1SVWA 4K8OA 1T8UA 1XEXB 5DYIA 3CWQA 2G0TA 4XVQA 5AJYA 2ONKA 1G5TA 4RD4A 2J41A 4TQ9A 1CJMA 2FJUA 2VF8A 4O25A 1R2QA 2P67A 1E0JA 3LXXA 2QMOA 1FTNA 1MABB 3KTAB 1GSIA 5AJZA 4M1TA 1DG3A 1LS6A 1NMZA 2VHQA 5JWRA 4AG6A 1YJ5A 1UM8A 4URUR 1NN1A 1YZLA 3UG7A 3QENA 3QSYA 3CR7A 1OH8A 1IN8A 1QF9A 2J0VA 2GDJA 2GA8A 3I92A 1XTRA 1N6LA 2GEVA 4ON9A 1XXHA 4EIWA 4XTCS 1LW7A 3DEFA 4IOJA 4N0DA 1IQPA 2GXSA 5KUTA 3GLIB 4GOKA 4US2R 4LYJA 3V4RA 2ZS9A 1KI8A 1Z63A 1YE8A 2PEZA 2B8WA 4LZZA 3FWYA 2I4IA 3REGA 1II8A 3VU9A 4WBSA 3F5FA 2IS4A 2ZE7A 2XX3A 1E2NA 4RD0A 2R6AA 4WIAA 3UWOA 3O8RA 2F1IA 2G88A 1G291 3VMFA 3AGPA 2F43A 3NIBA 3WP1B 1UBEA 2RGGA 1GKUB 1A1VA 1W46A 4Q1BA 2AXPA 4DLTA 1F6BA 2ZYUX 3A1UA 2Q3HA 2V4ZA 3KKNA 1XDBA 2V54A 3K0SA 5GVRA 2ERXA 5AUQA 4JL6A 1QHHA 4PHGA 4BE7B 2HT1A 1W36D 3NH9A 4BPBA 4UXIA 1EFHA 4JSTA 1UEJA 1TEVA 2HJVA 1G7SA 2ORIA 4OK3A 3A1WA 4EJSC 1M74A 2NZJA 4FMBB 1VMAA 2RGDA 1HQYE 1JPNA 2IW3A 3ND9A 2RAPA 2WWHA 2AFIE 4AWXA 3A1VA 2QZ4A 2VHUA 4AIIA 3MFYA 1E2IA 2KBFA 1NJGA 2ZYVX 3K53A 4B71A 2A9KA 3QF4A 4KSBA 1RIFA 1G8FA 1UBFA 4KHZA 3LWNA 1ELOA 4OL0A 1HT1E 3EWSA 3ZVNA 1HUQA 3CPEA 2WJJA 3K9HA 4F7WA 4NONA 1J70A 1Q22A 1GILA 4Q7LA 3THOA 1NLZA 1PV4A 4TZ0A 1E79D 2EFHB 2GBLA 3QPUA 1BYUA 3AUYA 4Y0VA 2GCNA 4A0RA 2O8FB 4OQLA 2ZR0A 1NRJB 1LS1A 1KI1A 5J4YA 3TNFA 4M9XA 1KMHA 1P2VA 2OBLA 2ZSBA 2ZR9A 3TR0A 4IFBA 1CJKC 1HQCA 1Z5ZA 3CLVA 1AGPA 4F4CA 2ZJBA 3BC1A 4GP6A 3GEHA 3Q9LA 4IVRA 5H68A 2FZ4A 4L8GA 4UXHA 1IN7A 1ESMA 2MMCA 3I3SR 1Z08A 3IPXA 3AF0A 5CJ2A 2CJWB 3B13B 3CPJB 3HR7A 2VO1A 3QEJA 1Z83A 3LLUA 4C9BA 1ZJ6A 5JHGB 1EFTA 3QVUA 3PR1A 5EE3A 3H86A 2NTYC 4POAA 2FMXA 3TGPA 2JA1A 2J3EA 4KVGA 2VYFA 4DDVA 1XD9A 4A0GA 4B73A 4EFMA 5EP3A 4QGAA 3OE7A 1S2MA 3WHLA 5AK0A 3RVBA 4S35A 1E1QD 1U2RA 2CL0X 3T1VA 1CULC 2IYXA 4QM6A 4DHEA 2WAYA 3FB4A 4PFSA 3Q7PA 3MLEA 4HLDA 5GJCA 2GTPA 2HXSA 3H4MA 2XXAB 2IC5A 1X8LA 1IJEA 3FTQA 4WXRA 4HAXA 2ZRAA 4HB2A 3VQTA 3FMPB 4DCVA 2GZDA 4RZXA 5GJWC 2ZRPA 1W0KD 3KKQA 3LD9A 4M8NE 1E99A 1MO6A 3KJGA 4LX0A 1HURA 1UBGA 2AWNA 5TARA 3U44A 1JQJC 2O8EB 2F1HA 3U7FB 3GLGB 4BLOA 4BLTA 1DEKA 3OEEA 2QRZA 3AP2A 4XVUA 3IGFA 2K5UA 3OIUA 2NIPA 3TW4A 2J0SA 3PUZA 2NO0A 1FMLA 3QKUA 2XEXA 4KU4A 5JJKA 4QGHA 2FPKA 3PUVA 1N6KA 2WWXA 1OH5A 2ZS8A 2P5TB 3WNDA 4E03A 2YYZA 2AXNA 2D06A 2KE5A 1P7CA 3PITA 3WXMA 2QT0A 1E69A 1JAIA 2P2LA 4KXFB 2EFGA 3RS4A 1CEEA 4TT3A 3V00A 3K0AA 2GCPA 2IUTA 2IS2A 1G1MA 4A1FA 4TSFD 2FDCA 5E7JA 3TVDA 2F9MA 2BCGY 1QBKC 1AQYA 3QOFA 3R7WB 3ADDA 2XSZA 3M1IA 3DOFA 3F3YA 1GL6A 1EFRD 2QPTA 4TMVA 2R44A 1KZGB 1N2CE 1XEWX 2AK3A 2H7VA 2FGKA 1Q21A 1TQ4A 3LXRA 3CBQA 5JSZB 1FPMA 3HDTA 4G5SA 3SN6A 1YR6A 2FX3A 6Q21A 2NO1A 2ORWA 4OHWA 5J4KA 3I61A 5H70A 2EYQA 1ZU5A 2IX3A 2XB4A 4JSYA 4L9SA 1Z2AA 2YJTD 3MGCA 4L4UA 4TMZA 4PAOA 4TQAA 1PUIA 3GFTA 5CITA 1QVAA 4I4LA 1KK3A 1IM2A 1EX7A 1WA5A 4FMDB 3TAUA 4PPFA 4PC7A 2P6UA 1SVIA 1I4LD 3L8YA 4RSGA 4Q01A 3BB1A 1GRNA 2A5JA 2F9LA 2R65A 1W36C 2RB4A 3BE4A 3SS8A 3QIAA 3THXB 1EGAA 3JZMA 2JCSA 2RGCA 4JJKA 4LJYA 4WA7A 2FFHA 5JMTA 1IY0A 1JXOA 3WMEA 1FMJA 3WHKA 4DCTA 2OHFA 5FOSA 1D2NA 1KO5A 4HSEA 2QP4A 5SZHB 1MO4A 1N6PA 1O3YA 2R6DA 2A5GA 2V7QA 3BD9A 2LKDA 2CBZA 2ZAOA 2QE7D 4ZDIA 4PANA 3SR0A 2PZFA 5L8VA 2OCBA 2OAP1 2FGJA 3TSWA 3QBVA 3SBDA 2HCBA 3IDQA 4WVFA 4DB2A 5J4HA 3KL4A 1NY6A 5G3YA 4EPRA 2ANBA 2WSMA 2ZSEA 4D81A 4DEXA 5EP4A 5FH9A 4GPTA 2WWYA 2QEQA 4WZAE 1TQ6A 1FOEB 5JCPA 3B82A 1WE2A 2KSQA 2CEAA 4QGGA 1G18A 1CKEA 1D2MA 5HE8A 3ONWA 3DKVA 4W5WA 1E79A 3LX5A 4GT1A 2QM7A 3L0IB 5JS7A 5EP2A 3I62A 4GOJA 5F98A 2VPPA 2NO6A 3CRVA 2VTKA 2W6JD 1E4VA 2WAXA 1ODFA 2OXCA 4JLAA 4JKYA 1KK1A 4Q19A 4IDHA 4QBIA 3ZH9B 1G9XA 2OFOA 4LYAA 4QHTA 3C4JA 4A2QA 4EQ6A 5KPJA 1UAAA 1RYHA 2AL7A 4MRPA 1S3SA 3EIHA 1RPZA 4L15A 1JXMA 3KX2A 3LW8A 5FOXA 4HAYA 2R9VA 4AK9A 3P20A 5DISB 3K8YA 1XD2B 3IQWA 2Q3FA 1SXJD 5KSOA 3D8BA 4V0ME 5CLLA 1PJRA 2CE2X 4IJMA 3B5JA 4B3BA 3U7GA 3IIJA 5EQTA 4MH0R 1E2MA 1BO6A 1NBME 1E1QA 3TVTA 1NSFA 3T61A 3LNCA 3GJXC 1G3IA 4KBFA 3U3OA 2BKEA 2O5VA 4DXAA 4IOKA 4M9SA 3RRZA 4DBLC 4RJLA 2AK2A 1NLYA 4GNKA 2OT3B 3ZLJA 3RS0A 1P9RA 1F60A 1U9IA 2BHRA 4M1SA 5HKKD 2W0MA 3HU3A 4GDFA 5CIWA 5KSPA 2V1UA 3FMFA 4P4TA 4DLVA 3N2EA 3SJZA 2WBLC 4RZUA 1E2KA 4TZ6A 1BMFD 3P4YA 4B3DA 4JBWA 2CHGA 2FF7A 2BOVA 1GDDA 4B35A 2G83A 4NCNA 1KI6A 3E1SA 3QF7A 3GJ8A 4KFTA 5FL3A 2BDTA 5FPTA 3C41J 5JEDA 3MMPA 3TKLA 1RJ9B 1E2GA 4X8HA 4GP7A 2GKSA 1EG7A 1W0JD 1KI2A 2GJ9A 4MUAA 3T5DA 2OBNA 2GK7A 4MGZR 2PZEA 1VPLA 5K8TA 1E9SA 4KCGA 4X8OA 3K09A 1E2QA 2PT7A 3UANA 1FL9A 2QM8A 3DO6A 4W9MC 1Q1ZA 1JEEA 1JR3E 4ZIRB 1XPOA 4DLYA 1XZQA 2AX4A 1EFRA 1XEWY 4HZUB 1TL7C 1FP6A 2XJ4A 4B76A 4P31A 1L8QA 1UJ2A 3VKHA 3B1ZA 4PSAA 5CIQA 3A58B 3HR8A 1E32A 2CNWD 3IHWA 4DT1B 3UK6A 4XWOA 2PLRA 3EAQA 1OIVA 1GFIA 1RRFA 4PO9A 4ABYA 2GZHA 4KVAA 5L3RA 4Z54A 3AKDA 1H8ED 3O8DA 5FL7D 5ANRB 1G7TA 4TTRA 1K6MA 4A6PA 3T5GA 4PC3A 2RGEA 3IBYA 3TQCA 2QSZA 1GUAA 3RLFA 3SZRA 3W5JA 1SKYB 4CVNA 4NP6A 1GNRA 3QJYA 5GJBA 1AS3A 4RD2A 1YZGA 2YOHA 1XWIA 5KOYA 2ZRIA 1XTKA 2ONJA 1U8AA 4FCWA 3BERA 2QROA 2BMDA 2ZRGA 2LCFA 4PO8A 3ZJYA 3PCRB 3CNLA 2ZSFA 3RRYA 2QTVB 4B74A 4C0QC 1Z6GA 2J1LA 4NH0A 3B7GA 3EPKA 2G0NA 3TK1A 1OHHD 4B2LA 5KNBA 2CL6X 1OW3B 1E94E 4GFDA 3SJCA 4IHQA 1RRPA 4UNNA 3RSOA 3KQKA 1US8B 4JLPA 1ZBDA 2ZYTX 3GLFE 3NKVA 4CRWB 4JBYA 1OXXK 5DHAA 2FEOA 1W5SA 4QC2A 1Y3AA 2REBA 3GPLA 4C3ZA 5GVSA 1NNEA 4OI0A 3C8UA 2BM1A 2HJGA 3LVQE 4ESVA 1OH6A 3QPWA 4ARZB 4Q4HB 2ZAMA 3CH5A 8OHMA 3I5YA 1G3QA 1NVUQ 5FPKA 4HLUC 3NG1A 1JI0A 1O87A 1G5PA 2ZJOA 2GJSA 5DI3A 4EPWA 4KSCA 4HDCA 5L3QB 3QXJA 4PAQA 1NVWQ 2X19A 1Z06A 2JJ2A 3EG5A 1MV5A 2Z43A 4DDWA 1OB2A 4TL7A 1OXVA 5DSZA 2H1LA 5JWHA 2XOKA 3LBHA 4JLOA 2ZJ5A 4TL6A 1KDPA 2OFXA 2WIAA 1T5LA 1T0HB 3OAAD 2WMNB 621PA 4RD6A 2A2ZA 2W6JA 5BW8A 4Q7KA 4FCVA 3RNLA 2J0UB 1M34E 4Q4AA 2WZQA 3R8FA 4KFSA 2QG6A 2FSIA 3TUIC 2OSBA 1NSTA 1P2UA 4HI0E 3SHFA 1N3BA 2HV8A 4AKEA 3CW2A 3K0EA 4LOAA 4PPGA 4MYTA 721PA 2ZQ5A 3EZ2A 2FE4A 1KKLA 3B1YA 1J99A 2OG2A 4NCHA 4Q1EA 5EXSA 4C0JA 4BLRA 1ETUA 3RS3A 3IHLA 1VCIA 5AJVB 4TMXA 3BOSA 2BEKA 4GRAA 3P4XA 4A92A 2GHIA 4XH9B 5DH9A 3THWB 4Q66C 1GRQA 1OSNA 1CR2A 5GADl 3CX6A 2DFLA 2JLQA 4JVLA 4NBSA 2VP0A 4C7OA 5DIFA 1LF5A 3DVLA 2PZGA 3DPUA 3BXZA 3GFOA 4URXR 1Q44A 2V9PA 3EZ9A 1J7KA 5FFMA 2DPXA 2HEIA 1BS1A 2EVWX 5HKKA 1E9RA 3KJHA 2FPMA 4LY6A 3HYRA 5L3SA 1XMJA 4R71A 3D6TB 5FUVA 5B64A 1IAQA 2REXB 1BMFA 4XWAA 3CRQA 2O8CA 2BMJA 3Q85A 2QMUA 3QVVA 1KSHA 4AYTA 3K70D 2CHQA 1S1MA 4TMTA 1JBKA 1D2EA 2DR3A 3L0OA 2JASA 1WXQA 2CL7X 1RRGA 5CDFE 3BBPA 1II8B 3MWKA 2FH5B 1W0JA 2JLUA 4XSHA 4LV8B 1CRPA 3OE7D 4Q48A 5FTMA 3DDCA 4BQSA 1G7CA 4M1MA 2DB3A 2F43B 4P4UA 4DZZA 1KIMA 4KBGA 4LJ8A 3KUDA 2EW1A 1XTQA 5SZJA 3Q7QA 1P2SA 3WP0A 2BJVA 2D4HA 5CB8A 1AN0A 1DS6A 4M22A 1DAEA 4C0SA 4YDSA 1Z0FA 5C18A 2YVUA 1GIAA 1ZD1A 2ZI4A 1NVXQ 4OHYA 5HZHA 4LK2A 2RGAA 2R6CA 2ZRDA 1QHHB 2FFQA 3SE0A 4ZV4A 4YQFA 3U4QA 4UNPA 4RZ2A 1L2TA 1LF0A 3AVVA 3CNOA 1KY2A 3AVWA 5KHOC 1XB2A 4DLWA 4FWIB 3R9IA 4D4MA 2VHJA 3ND8A 4JKIA 4G5GA 4US1R 4BFXA 2BV3A 5FL7A 4GI7A 1DBSA 4LDJA 2CDNA 2ZROA 5TVKA 1T9HA 5BYJA 1R0XA 2N46A 4B3GA 5J40A 4HUTA 1KI9A 3MUFA 1KAGA 1S8FA 2WICA 4RFSA 4AKGA 5HCIA 2VP4A 2KWIA 1KDOA 2IS1A 2XNDA 2GF9A 1SULA 4TT3D 1GTVA 4D80A 3KFXA 4F93B 4DDUA 3KQNA 2H16A 1KMQA 2CHVA 1ZVQA 4YONB 1CTQA 1R10A 2R2AA 3AVUA 3AVTA 1OHHA 4UJ3A 2ZRLA 5KNCA 2ZRBA 1E0KA 1OE0A 2XSZD 3HPRA 2J0QA 3JZAA 2NOAA 1KMHB 3FKQA 2WWFA 3WRYC 4FIDA 2HCJB 1YZQA 1ZM2A 1ZMXA 3ZZTA 2QAGA 1F2TA 5K8UA 2D7CA 5LBIA 4NU0A 3RYTC 2HYDA 4IOMA 3S1AA 1Q1QA 1YR8A 3BH7A 4JLMA 4XD7A 1VG1A 2VSOA 1XPRA 4W7SA 2C03A 3KB2A 2QBYA 2ZE5A 3EWAA 3Q5DA 1CF4A 1HE8B 2JLYA 4QFMA 4V0MA 4BZXA 2P6RA 2AHOA 1TQ2A 5JWOA 4G01B 1HEIA 4V0NA 1NBMA 4CIDA 2G3YA 1IN4A 2XNSA 3TE6A 3CF0A 5CK4A 1ZM7A 1U81A 2G77B 4LRWA 4Y0AA 3SI7A 3UPUA 1JQLB 3CX7A 2QTFA 2PX3A 1ZUNB 2ECKA 5KDOA 2BKUA 3OIWA 2WHXA 4B3FX 4BEBA 3BRWD 5ELXA 3RSLA 2OXRA 1VECA 3AF3A 1N0UA 2RGNA 3OAAA 3SC3A 3LFUA 4A0HA 1T3LA 4DSTA 4K81B 2DWQA 3PEVA 1XMIA 1G17A 3QY0A 3MG9A 1U98A 1Z6YA 4LSGA 2Q6TA 3BH6A 4Q9IA 2RHDA 2J7PD 3NEJA 2P6NA 4NCJA 4JYCA 2CVFA 3REFA 3NBFA 1E9CA 3R9WA 2PCJA 2W2TA 2V7QD 3QG5A 2GVZC 2YOFA 4G5RA 3U44B 3AVYA 1DO2A 2PJZA 4FINA 3ADBA 2NZ8A 1YVDA 3MJHA 421PA 2AD5A 2OCAA 4F38A 1XMSA 2A5FA 2PMDA 3AV0B 4NYIR 2B7BA 4FI3C 3B2EA 4QJ4A 1ZD8A 4CEIA 1OF1A 5DYGA 4BECA 4JIMA 1N6OA 3CWZA 2GBLC 3QXXA 1G8PA 4M4SA 3RC3A 4YMVA 5K8IA 4RVCA 2DWPA 3A36A 4LYFA 2QP3A 5C2JB 4EUNA 5KYKA 4Q1FA 3U6BA 2O8DB 5FI0B 2NGRA 1XRJA 4Q47A 1NMXA 4AKHA 1OYYA 1JR3A 1ZNXA 2Q21A 3LAWA 2LWIA 3L8ZA 4JJZA 1ZD9A 1GNPA 5AJWA 4NYJQ 2E1RA 2D3WA 5JEEA 4O2LA 2DCUA 4C4PA 1OYWA 3FHTA 2FOLA 2ODNA 3CB4A 4G1UC 4U02A 1NJFA 1T5IA 4XWKA 4M1KA 3H0KA 1KI7A 3LY5A 5C1BA 2ZE6A 3D3QA 4MKHA 2GZAA 3HU2A 3ZS8A 4O3MA 1I4TD 4DCUA 3K0FA 4EJSA 4LBZA 4P32A 3QQ5A 4FW9A 3E5HA 3F0TA 2BVNA 3DZDA 2ZRKA 3NDPA 1TF7A 2OO7A 3NBXX 5FOUA 1EK0A 3KJEA 2ZM5A 2VBCA 1G4UR 2JLSA 5FBWB 1P72A 4YMSA 3KTAA 1YZTA 1GZSA 4II7A 4XSGA 2GETA 1QHIA 1KKMA 4JLKA 3H84A 3SU8A 2P3SA 1VYTA 4M0LA 1OXUA 2WJVA 3T15A 1SVMA 3KKPA 1M7GA 2WOOA 1G21E 3FFAA 4JZKA 4ZKDA 2AWOA 5HZKA 1QG2A 4M1WA 5JI2E 2F55A 1RRCA 4BFSA 4K46A 3TBKA 4TLDA 2VQSA 5BYKA 2V6JA 1NKTA 2ZU6A 1SKQA 1NVVQ 4Q1AA 3TAHA 4KYIB 1KO7A 4WXPA 2IBMA 3NVAA 1G4AE 1Z0IA 4LJ6A 3GJ4A 2G1JA 1XX6A 3GEIA 2IF2A 2J5XA 2X77A 1G41A 1YKSA 1SVKA 1ZNZA 1EESA 4DIDA 1GG2A 3PQCA 1XP8A 1JJVA 4PSVA 3BAFA 2WV9A 1T6NA 3GLFA 4KAXA 1VYUA 4ILEA 1BOFA 1W36B 1UFQA 4MDEA 1I2DA 3KQHA 2ATVA 4RKFA 5G40A 5AUPB 2QAJA 5GJVC 1FP7A 3FDIA 2BMEA 3EXAA 4I99A 1IY2A 2XZPA 4EKDA 1ZP6A 3R20A 4CZ2A 5JRZA 3I32A 4O2RA 4ZO4A 1UDWA 2QL6A 3GJ5A 4DEYA 5C46F 1OLOA 3EARA 3U7EB 1CP2A 5CK5A 4D0NA 3DM5A 1SVOA 4HUQB 4QGFA 4HAUA 3GJ7A 3NBYC 2FNAA 4WW0A 5BWMA 4N1AA 3X1YA 1FQJA 3EZ6A 5F9FA 1CR0A 3GJ6A 4Z8XA 1NLFA 4BLSA 2JJ8A 4XOIA 5AUNB 3FPAA 4BEJA 4E07A 1G64A 4TLEA 2B8TA 2IF0A 3L82B 4TLAA 4GBMA 4TYQA 5CLQA 1N6RA 1GWNA 1CIPA 4MYCA 4OQFA 2NO7A 3FGNA 1U0JA 2JIZA 4IVPA 2VIIA 2QU8A 1R0YA 1FTSA 2ZXUA 1EX6A 3C7KA 3EZFA 4ASUD 4LHXA 2BBTA 1VIYA 2P65A 3CRMA 3TSZA 3ASYA 1UBCA 4EQ6B 3RWOA 1NN5A 2HDNB 3CR8A 1TX4B 3GD7A 2KJQA 3IILA 3JVVA 4TMWA 4RKEA 3MSXA 1CJTC 4IFEA 2J45A 121PA 4UNSA 3ASZA 1AZTA 2IYRA 4NYJR 2NPFA 4P0TA 2ZJ2A 1QZXA 4DLZA 3QBTA 4QRHA 4AKIA 4Q21A 4M1YA 3N70A 1CLUA 3AH8A 3BGWA 1AZSC 2IYLD 1HYQA 1Z28A 2N1BA 3NHBA 4NYMQ 4URZR 3TH5A 4G5QA 3VX4A 3P27A 3Q72A 4KLNA 4QBFA 1W2GA 1HT2E 4HDOB 4EPVA 4B2PA 2W58A 4RZ3A 3FHOA 2FSGA 4OK5A 2EWWA 4J0QA 3J81k 2BBSA 3PXGA 4ZDWA 3A4NA 1VYVA 1TMKA 2H18A 4FMCB 2BBOA 2D7DA 2YZ2A 1XTIA 3A4LA 4PSKA 1KJYA 2J7PA 3DMDA 3EA0A 1YZNA 2BC9A 3FHCB 3GLHB 3QKTA 1PZNA 2JATA 4L16A 3RRMA 1X8JA 3N5CA 4OQNA 3TRFA 1S1CA 4MDFA 1K8RA 5JJLA 1N0WA 1F2UA 2WM9B 3WBKA 2EYUA 3WBJA 4B47A 4BFVA 4DVGA 4LHYA 3DMNA 5H1YA 2NO9A 4B33A 2IXGA 4IDQA 1X3SA 3LA6A 1RZ3A 3CRW1 2XXAA 4L9WA 3B60A 1NVVR 1N0VC 4PC6A 3ZDQA 4LHVA 1ZM4A 1MRSA 5JBQA 4BRUA 5CDFA 1G3RA 1VHTA 1KI6B 1E1RA 2Z4SA 2XB2A 2VRWA 1FUUA 2OBMA 5D3QA 4DLRA 3G0HA 4ITRC 1KI3A 1MH1A 2F7SA 2O8EA 3ZGXA 3GLGA 1WB9A 1KNQA 2C98A 2JJ2D 2H17A 3KXLA 5JZVA 1BYIA 1C9KA 4H1UA 1CXZA 5TMPA 2XOKD 4TL8A 3IO5A 3LH5A 4LUCA 1E4YA 4FMDF 4ACBA 1TTTA 2C9OA 2DFNA 4QXAA 1K5GA 5TV2A 2IT1A 3T1OA 2MSCB 1ZC3A 2OV2A 2GCOA 3LQQA 3WNCA 2VH5R 1HTWA 4HAWA 4G0NA 3KZ1E 1OFIA 3PEYA 1VCOA 1U0LA 1G8GA 4D6PA 1TNDA 2GXAA 3W6NA 2A78A 1OJLA 2Z0MA 2ODEA 4DDTA 2ZPTX 1LTQA 2RHMA 3VR5A 4DLXA 2Z6VA 4AURA 2BCJQ 2RGBA 5SZIA 5KNDA 2R6FA 5KDDA 4DLUA 1NL3A 4LGMA 2ZRMA 3FOZA 1S9DA 4B34A 1EWQA 3SYLA 4FXPA 1E9BA 4Q1DA 4BFUA 5EE1A 3R7WA 4M2LA 3SJBA 1DAGA 3KFVA 2QMEA 3PIRA 1MOZA 3VNUA 1S4QA 4JLBA 4LI0A 1U99A 3BORA 1GOTA 4PQYA 2YV5A 3IUYA 4C0KA 2HUPA 4C30A 3SEAA 3CZQA 3BFXA 4F4JA 1U9IC 2GEUA 3Q5EA 1U8YA 2YNMA 3QXCA 1E9AA 3FE2A 1KO1A 3N2IA 3I4LA 5FPHA 4CDGA 1KYIA 1KTVA 1OKKA 1X86B 4KODA 4FD2A 1CR1A 3FMIA 1VKJA 3DZ8A 5LD2B 2FPLA 4KJZA 4NYMR 5DO9A 1NF3A 1N5KA 4Q00A 2G6BA 1N6HA 2ZJ8A 2ZRNA 1HA3A 3ZIAA 5AUOB 3THXA 2P5SA 2WVJA 4LYHA 5F2EA 2GWHA 2ZRHA 4QNMA 3K09C 2JDIA 4B44A 2ZI3A 2CVHA 4W5JA 4ZDKA 5FPYA 1TU4A 1WRBA 1Z0JA 4A6XA 1R7RA 1E9DA 5DI3B 4UNQA 2ZTSA 4V0KA 5LPNA 3VR3A 4GOXA 1SQ5A 1QHSA 4GZLA 1XBTA 4MKGA 1II0A 1VG8A 4PHFA 3GEEA 3I73A 2ZIAA 3BS4A 1L4YA 3G82C 2SHKA 3AQ4A 3VX3A 1ZRHA 2JLRA 4RCZA 4EAQA 1GAJA 2V55B 1AA9A 4HB4A 5FUXA 1ZIPA 1VDZA 3SYNA 2JLVA 3TUJC 5JFGA 5EE5B 3VTKA 4UQOA 4ASUA 2O8BA 4F92B 1EWRA 2UVQA 3X2SA 1KSGA 3QKRA 3OHMA 4JYBA 3PVSA 4Z1MA 3U61B 3QPVA 4DWJA 3T12A 2IXEA 3THYA 4TYNA 3QG1A 5CJPA 2RGXA 3ZQJA 2V1XA 2ODBA 3D31A 5B2ZA 3JVUA 5E4FA 4LV5B 1SXJB 4LJ7A 1NY5A 1DADA 3CUEF 1U94A 3AVPA 1JPJA 3QKSA 3NC1C 4DC9A 1OV4A 1DPFA 2YWEA 3PUXA 4GSYA 2A5YB 4NCIA 5HTKA 5LD2C 2Q9AA 1TAGA 2AFHE 2XTNA 2C04A 3EIQA 2IUUA 2DWOA 4MUBA 4YMWA 4UJ5A 2XNDD 1W5TA 2D2FA 2WIBA 4A8JA 3VAAA 4ZI2A 1Z8FA 4BZPA 1V5WA 1XCGB 1XD2A 1S9HA 4C7OB 2GESA 1AQUA 1D8TA 3SYKA 3GLIE 2R6GA 3I72A 2DFKB 2KB0A 3UMRA 1DE0A 1KAOA 2MSDB 2YWHA 4HDQB 4JVNA 2ZUBA 4C0AC 1ZCAA 2ZRCA 3KUCA 1OXSC 2IYUA 4OBEA 1Y63A 1MKYA 3WMGA 1DVRA 3T06B 5TDHA 3BJIC 4OI1A 3TUZC 5L3SB 3B1XA 2QQ0A 3NC0C 1KJWA 2ZSAA 4JLDA 4XD7D 3MWLA 4C2UA 1N5IA 4Q9KA 2QSYA 1A5TA 5BQ5A 4BFZA 2ZJYA 4Z8YA 2O8CB 1UKVY 1MO3A 2ZREA 1PUJA 3VR2A 4KV9A 3A6PC 2Z5FA 3FFBA 1S3GA 4OJKA 1KHTA 2OAQ1 3WRXC 1FX0B 4U5XA 1QRAA 3AVQA 5J4VA 5BN3A 5M04A 2L0XA 3U7HB 4Z51A 2W83A 1LV7A 1NBMD 1I4DD 1TQDA 1OB5A 2RH5A 2QENA 2QUZA 1U0HC 5EJEA 2BEJA 1UKYA 1J90A 1XZPA 2VSXA 1R5BA 3PENA 4EFLA 2QGZA 2ANCA 4EPTA 1FNNA 4S2EA 1E9EA 4KFRA 4DCNA 4B6FA 5EP1A 1GKIA 1SXJC 4DJTA 5F3WB 4BLPA 2IHBA 3MWYW 3SQWA 2WPDD 1NN0A 1Q0UA 4NTZA 3B6EA 4Q03A 3W8RA 3U4QB 3LW7A 221PA 4MGYR 1KO8A 3IBGA 4LBVA 5JECA 3UKDA 3GFPA 1XU4A 2BWJA 1WDTA 4RD1A 1AKYA 2IUSA 3SOPA 4HLUA 1RFLA 1GM5A 4ZIRA 1P9WA 1OH7A 4E09A 4QOSA 4B75A 1UF9A 1CS4C 1XTJA 1BKDR 2QNRA 1ZCBA 4E22A 2J46A 4NMMA 4RFSB 4Q4JA 2CLDX 5A5GA 4CEJA 4I1OA 4HAVA 3OZXA 4O0MA 5HE9A 3CZPA 4AD8A 1QHYA 4P3YA 1E2LA 2ZETA 1P3JA 1TF5A 4Q1CA 1JR3D 4B3CA 4DUGD 4NKRA 2WJIA 2GEDA 1GP2A 4IRUB 4PTLA 2FU5C 3VKGA 2X8AA 3I8SA 4V03A 4A82A 2HLDA 3U6KA 4RFVA 1J8MF 2IK8A 5EXTA 2QAGB 1F2TB 4Q9JA 3W5IA 3V4FA 2CCKA 1W7AA 1P62B 5FOWA 4B2IA 3CNNA 4IDPA 4QM7A 3VR6A 3CONA 2OLJA 1XXHB 4IVQA 3BH0A 2QBYB 2PBRA 4AI6A 3SNHA 5CM9C 2D62A 4OHZA 4URVR 2OCYC 1GVNB 3NH6A 3K1JA 4URYR 1DAHA 4URWR 2PX0A 5LB2A 3H1TA 5TB5A 3CF6R 3ZD7A 1E0AA 1FW6A 4Q7MB 3B1WA 4CW7A 1MRNA 3VU9B 5SZKB 4JS0A 3ADKA 2F1RA 5P21A 3K9NA 3CX8A 4HLQB 1XTSA 2ZUCA 3E2IA 4LPSA 5FBQB 4CEHA 5IHPA 4OHXA 3CH4B 5DI9A 3L2OB 2PMKA 3GLGE 2ZSDA 2QN6A 4NYIQ 4ARZA 3AM1A 4Q4HA 4MKIA 2CK3D 4F4IA 4X8LA 1VCNA 2O0HA 1RVDA 3AP1A 1PLLA 3O47A 4MRNA 4TMKA 3IIKA 1E0SA 1NIJA 4MKFA 3ADCA 4G3XA 3KXKA 2GAAA 2FFAA 1EXMA 1DAIA 3FMOB 1P61B 5FPSA 3SFZA 4E5UA 1OFUX 1ZU4A 3X1XA 2FG5A 2LKCA 5FBVB 1NG1A 1Z6XA 5TXGA 2JJ1A 3EA5A 1P2TA 1Q3HA 2QORA 5KDLA 4QBGB 1KZ7B 1Q1BA 4CEIB 1OIXA 3PEUA 2PCLA 3C5HA 2EQBA 3EW9A 5EZ5A 3KQUA 3LBIA 4ESHA 1NMYA 3MWJA 3U3JA 2EFDB 2J0UA 3QF4B 1T3HA 3FYHA 2HF9A 4D2IA 4JVMA 2O0JA 2XTZA 2IS6A 2QAGC 1TU3A 2VL7A 3HU1A 2YOGA 2BM0A 4M1OA 1N6IA 1T4GA 3A8TA 2A3RA 1R0ZA 4OI2A 2H8KA 5DE3A 2B92A 1JB1A 2RCNA 3TJZA 1G16A 4HB3A 1H8HD 2JIZD 3ETLA 2ZITA 3LLMA 5DGXA 1M2OB 4KO8A 4HEJA 1SGWA 1T8TA 1E2DA 1P75A 2IXFA 3WYFA 4DCSA 1R5NA 4D0LB 5JCZA 2IA5A 1E2EA 5CYOA 4EFNA 2MMGA 3K0CA 3PV0A 3G5UA 2JEOA 1A7JA 5IK2A 3EPJA 2IEZA 3NEYA 4V0LA 2QPOA 3HPQA 3SHWA 1ZINA 4NHOA 3IEVA 1GL9B 1COWD 1MR3F 3BIFA 3KB1A 4PQRA 1AJEA 5K8LA 3X1ZA 1C4OA 5AR1A 2P0EA 2OUKA 3K70B 2AN9A 1XMVA 3CM0A 2ZI5A 3PUWA 2RGNC 3Q3JB 2VLIA 5BXQC 4BFWA 1ZNYA 1YHNA 3SQXA 3AP3A 4AYWA 2CE7A 1TPZA 3GLHE 4KFUA 1LFDB 4HLCA 3BB3A 5UKDA 2WJGA 1JEDA 4TLCA 2NMVA 1Q3TA 5HPYB 2KI5A 5B30A 1IXRC 1KNXA 2GJ8A 1KI4A 3EC2A 4YMUA 4QHYA 2WWGA 3X1WA 4GL2A 4Q9HA 4OKSA 1W4CA 4D4LA 4YLGA 1RW4A 2WPDA 3GLFB 4D25A 1UKZA 2OLKA 3AEZA 1KK0A 1L7VC 2AR7A 2X1VA 3RC8A 4MYHA 2GJKA 1T3SA 2AD1A 1AGRA 2YWGA 5G41A 5FR2A 1PLJA 4Q7JB 3FVQA 2F3RA 4MITA 3W8NA 1XJQA 4PZLA 1W47A 4OQMA 2NQ2C 3OIVA 1VG9B 4ZKEA 2I1VB 4P4SA 2XTMA 1P4SA 4ZPXA 2GRJA 1E1RD 2UZ3A 2QMHA 1KJZA 3VR1A 4BZQA 5FTLA 1CBUA 2H92A 1P6XA 1R8QA 4NCKA 4RD3A 3T1TA 2IYWA 2FSHA 3VKWA 2Z4RA 4XTRA 3U3MA 4G5OA 4ZDJA 3K0AB 3AF2A 1DAMA 4D82A 4DUGA 2DFTA 3RANA 1YRAA 2N42A 2YC4C 4OJQA 4YC7A 3TW8B 1JECA 1JALA 4M21A 4R9UC 2XGJA 2OCPA 4D0GA 3CF2A 1UEIA 4QBHA 1QDEA 3AKEA 3B85A 3K70C 4JVSB 1IXZA 2ZU0C 5D3MA 1G7RA 3IPYA 2JLZA 2YC2C 2QQEA 3L0SA 3H2YA 4QJ5A 1RYFA 3SDZA 1G3MA 4W5HA 2IYYA 1XEXA 2QGNA 4TLBA 1FUKA 1U90A 3AGQA 1VG0B 3KDSE 1GRRA 2MSEB 3T1QA 4PO1A 4C0HA 2BIFA 1NIPA 1MABA 3K9GA 3NBZC 1FNMA 4I1SA 4WZBE 5AWFC 3U3RA 4R98A 2W2VA 4LBYA 3W6PA 1YR9A 2V3CC 3UWKA 2ZRJA 4RY2A 2ZEJA 4FWTA 3NTUA 1FZQA 2IYVA 4JBXA 1E2JA 1E2HA 1TEXA 2QRNA 3P32A 3M6AA 1MO5A 4M9ZA 3SJAA 2NPIA 3MCAA 1W4AA 2CK3A 3GLIA 4GMXA 3UIEA 1OKKD 3ECCA 3IEUA 2FEMA 1LB1B 3V9PA 1Z0DA 4JT4A 1E3MA 2W6ID 2C9YA 1XCPA 2TMKA 4PC1A 2CMKA 2IWRA 1E2FA 1CRQA 4JLNA 1K5DA 1VIAA 4KLZA 4Q02A 4UXJA 2JGNA 1QVRA 1S96A 1F2UB 1JR6A 5DN6A 4US0R 3M0EA 4PX9A 3MRSA 5JHHB 3ZIAD 4C0LA 1HV8A 2ODWA 4QNRA 4DKXA 4DSOA 3B1VA 3LBNA 3FKSD 1G20E 2JDID 5CYPA 4A2PA 3RAPR 5HCNA 3TSOA 3SFVA 3QEOA 5EE0A 5IDVA 4NPHA 2B7CA 3C5CA 5C4MA 3WY9A 5JLJA 4YDHB 1OIWA 3UG6A 4Q5IA 1P73A 3UATA 1W2HA 4A15A 5JI3E 4NZYA 2ZRFA 4BLQA 3ZVMA 3QE0A 4HAZA 1WBDA 4BGDA 2WSSD 4BRWA 4ERNA 2CCGA 4RCYA 3ZVRA 4MGKR 521PA 3IO3A 4OK6A 1G8YA 3IQXA 2DY1A 1N5LA 1H8HA 2GCOB 1SXJE 1Z6TA 4PHTA 2BBWA 4IDNA 2A30A 2I1QA 1VTKA 1ZYUA 4PPQA 2XJ9A 1H65A 1DAFA 4MRSA 1A82A 1SKYE 4Z1MD 2GJAA 2X2FA 2O8DA 4FCTA 3OEHD 1M8PA 4IEIA 1Q57A 1U8ZA 4PR0A 2REOA 1LY1A 2G9NA 3D7MA 1COWA 4I1VA 5B57C 2FFBA 2E9SA 2AKYA 2O8FA 2WWIA 2OEPA 1WBBA 3TIFA 1P9NA 1E98A 1W1WA 4IXMA 4TYWA 2J9RA 1UPTA 5TY0A 1JNYA 2ZE8A 1KK2A 4ZI3A 4WAUA 1I2MA 3DKPA 3NWJA 2PL3A 3ZQ6A 1JAHA 4B32A 1TF2A 1AM4D 2F1JA 3VFDA 1M6NA 2CJWA 1WMSA 5JRJA 2NG1A 1Z6AA 4U00A 1RE0A 5DLQC 2D2EA 4LC1A 4TTPA 4UNRA 3E70C 1UDXA 1YR7A 1W4BA 1Q20A 1J8YF 3RABA 4LJAA 1SVLA 3A37A 1ZC4A 2VP2A 1NG9A 1HH4A 3A1SA 3CPHA 1F3OA 3ZS9A 4ZCIA 4CGZA 3PUYA 1X1RA 2FZLA 4YXWD 4Q9LA 5EUQB 2R8RA 4B3XA 3ZD6A 1PVOA 5KPDA 5H8WA 4A2WA 1NKSA 2EFCB 1IY1A 1DELA 2V8OA 1IN6A 1G3UA 5B58C 4LCBA 5KO2A 3RS2A 1E96A 4LJ4A 5FUYA 3W3AA 5FTJA 1G19A 1XJCA 1OPXA 1X6VA 4KI0A 3TMKA 2JLWA 2QP9X 1JJ7A 4NE2A 1UKEA 3UMFA 1GNQA 2O52A 4PXAA 3TR5A 2IYSA 1KDTA 2BMFA 4R2IA 2DBYA 4TWZA 1AS0A 4DIEA 5LDDC 1KDRA 3ICEA 3CKLA 4IEEA 3MD0A 3LO5A 2OM2A 2X2EA 2IYTA 3AF4A 4GZMA 4R7ZA 2ZANA 3EIEA 2OE2A 5FI1B 1Z47A 1SZPA 2C5LA 2OESA 3C15C 4TYYA 3T34A 3LRPA 2BJWA 2O0KA 4HUQA 1ZIOA 4DSNA 4LC0A 2WJHA 2O8BB 3VHXA 3KQLA 3GP8A 4P33A 2QT1A 5KSZA 2JAQA 1T0JB 3QKRB 4DLSA 2GVDC 2KBEA 1II9A 4MQBA 2GAOA 2PJRA 4FMCF 4Q18A 4M53A 2VP9A 3W6OA 4BWYA 3THYB 1D6JA 2V6IA 3K9LA 1ZUHA 1B23P 3QNUA 1ZAKA 2QA5A 3GQBA 1W44A 2J59A 3C14C 5G53C 1BIFA 4JLVA 1VHLA 1ZNWA 5E95A 4TQUS 4B43A 2W0SA 3PJRA 3U5ZB 3QKSB 3KKOA 3UXMA 4JMPA 5L3VA 2I3BA 1SVSA 1BH2A 1OFTA 2ZR7A 1KSJA 4FN5A 2CLSA 821PA 2WWWA 1IXSB 5JSZA 1G8HA 4LJ5A 4UKDA 1W48A 2XITA 1Z07A 4CT4B 1E2PA 4WZ6A 3I8XA 2OZEA 1XXHE 4A8JB 1IONA 1X8KA 4OHVA 3WYAA 4JL8A 5BN5A 1LVGA 1CU1A 2W6IA 3W34A 2H5EA 5DHFA 1OFHA 3R8CA 1EFUA 3OESA 2HLDD 3AKYA 4I1UA 1AKEA 4DRZA 5KU1A 3AKCA 1ZW6A 5G3ZA 4HYYA 3EC1A 1N25A 2Y8EA 3SBEA 1ZUIA 3VHLB 2FV8A 2PH1A 4HZIA 5FBLB 4TN1A 3P1JA 2ZI6A 2QTHA 3FKSA 3AF1A 3O8BA 2C77A 2YKGA 2VP5A 3R9XA 4TYPA 3VR4A 3RHFA 3GLHA 4AYXA 5E7MA 1SHZA 1W0KA 3C16C 1HY3A 1WQ1R 1XEFA 2OFWA 2D74A 4XJXA 3I5XA 2XZOA 4HATA 2UKDA 2PEYA 4B48A 4QJ3A 5JJIA 2WSSA 5FOTA 1MT0A 1ANKA 4LBWA 2J7KA 4KITB 3P26A 3M4YA 3MJRA 2CXXA 4NDZA 1XJ0A 4LHZA 5FBRB 2ZYWX 2HYIC 1WP9A 4C2TA 2VHCA 1G6HA 4MYUA 2A7QA 1E9FA 1EFCA 1Z0AA 4OI4A 2PLFA 4QHSA 4Q4AB 3EPLA 4I81A 3OEHA 3VNVA 1T91A 1N6NA 2W00A 3BFVA 4MRRA 2Q9CA 4A4DA 1R4AA 4LPKA 3HYTA 4TSFA 1Z0KA 2JJ1D 1UADA 1B0UA 2GF0A 4ACAA 3AVXA 3NDBB 2E87A 2Q3MA 2WOJA 2ERYA 4A0FA 4A8JC 1Z2CA 5A0FA 1WF3A 2FWRA 2UZIR 2A5DA 2IEYA 4GMDA 5LB4A 4PPNA 4Q4JB 2XAUA 1QHGA 4N3NA 4CEJB 2HT6A 4X8MA 3RRNA 1IJFA 5E3HA 4F91B 4C0BA 4DSUA 3OFND 4MRVA 5HR5A 1IBRA 2RKOA 4IKEA 5FUWA 3WYGA 5J47A 2F6RA 2ZVQX 4PAMA 1ONBA 1A2BA 5EXXA 3HWSA 2ZS7A 4YMTA 2QI9C 1AK2A 3L43A 4KYUA 4A9AA 4QG7A 1R8SA 3BFKA 3TQFA 3KJIA 4YXWA 1YQTA 3B9QA 1Z3IX 4JT2A 1TUEA 1G6OA 5EUMA 4EPYA 1Q1EA 1DG1G 5IK2D 2VEDA 2ZVPX 2EWVA 1D5CA 2IYZA 2C8VA 1NI3A 2VSFA 3NHAA 3RS7A 5J5CA 4XVRA 3BWDD 3Q8XB 2GXUA 3EZ7A 4OYHA 3ZVLA 1XF9A 1YRBA 2YWFA 3ZYCA 4BFTA 4B6EA 2QY9A 2DHRA 5BN4A 2C78A
chains in the Genus database with same CATH superfamily
3CH6A 3M6WA 4RKWA 1FPQA 4DHWA 2CLIB 1Y7LA 4CMBA 1Y4UA 3MAAC 4HVAA 1XDZA 2QLTA 1IHYA 1UFKA 4LWZA 1NVKA 5TJHA 1YZKA 5I4BA 2P4EA 4E5PA 1N8SA 5IRCD 4D57A 2DJIA 1MCZA 1SNYA 1M0TA 2FN3A 3LX8A 4R6XA 5D84A 5AW9A 2FZWA 2HR1A 2YCBA 2QYSA 4BFYA 1IHUA 2VK4A 4QDJA 3U2QA 1X80A 3E48A 4OXQA 1E92A 1CPYA 1ESDA 4CDMA 4C6RA 2ZUEA 3RH0A 3HDHA 1QIFA 3KU4A 4LJ9A 2OHJA 1NUTA 3ZZ0A 3PG5A 3COWA 5FP0A 3W3ZB 2PR2A 2HA3A 2OYSA 3FR7A 3S2IA 5FR1A 3TVYA 5ERYA 1Y82A 4UTXA 3WMFA 2EFEB 2HRRA 1NI4B 2HWYA 1GTMA 1LLUA 3RFUA 1ESNA 3ORRA 3ZBTA 4CR8A 5HX7A 2RMKA 5AK4A 4Q3CA 3PC2A 1U7XA 4R9NA 1P18A 2WJYA 3LGXA 5K5EA 1ZQ9A 1CJUC 1K97A 1X1SA 1YACA 3LPDA 4B6QA 1U1FA 5B4VA 1T9ZA 3TQIA 2AE1A 3AR9A 3EQ7A 4RHXA 3D3NA 3WO1A 3DR3A 3TKYA 2H4HA 2Y1GA 3QUSA 1QG6A 3ESRA 1Y89A 1TZ2A 3RDPA 3W9YA 1UKCA 2YYSA 3A9UA 3DQQA 1D2HA 5H82A 3DL0A 4FM9A 2B30A 4HRXA 3KQSA 4DB4A 1V43A 3G9QA 3ICQB 2P2YA 4OB6A 3EASA 3HDYA 4ERXA 4G9BA 5IF9A 5TIIA 2FSFA 3CSUA 1EWKA 2OV4A 4FLFA 5E6RA 3T35A 4CKBA 1D7AA 4NOMA 3C97A 1ECPA 2WJZB 3KXIA 1UINA 4HXYA 5CM8B 4RHTA 4IOLA 4AZ0B 5JW6A 1N8TA 4XR9A 4OL9A 3E5MA 5JH7F 1AS2A 1I6WA 4U0KA 3F6PA 3S1AB 3DGFC 4YO8A 4QULA 1DBPA 3HFRA 4ZAZA 3X0DA 2C96A 3IR6A 1XPUA 1R3DA 1KJNA 2ZJZA 5LFAA 3QXHA 3WWPA 1YIDA 6AT1A 2GNOA 1YJCA 2PAFA 4FTWA 5LU9A 3QEBZ 1XELA 2C99A 4IH4A 2R4UA 4V0OA 3JXEA 4M83A 1WCV1 3AJEA 1ULUA 3TRDA 3AL0C 1V8DA 3H8WA 5AI0A 1XL1A 2PSSA 5CIYA 3BK7A 4JEMA 2F90A 3BSYA 2Q50A 3MPOA 3VPXA 2PX2A 4RPJA 1KAMA 2C2HA 4KC0A 4KPYA 2CLCX 3C87A 3U3KA 1C3JA 1MAVA 4CYMA 5DBOA 3LVRE 3S6JA 4EAAA 1E3WB 1QE0A 2H4WA 1KO4A 2HXYA 3KR0A 3H2GA 3L0BA 3TLXA 4PVDA 2WABA 4WGGA 5J4LA 4EA6A 5FLXA 5KSYA 2EFJA 1FX0A 1ZM3A 4L5JA 2JI9A 4ZCMA 3BB4A 4PG7A 4H6XA 4C87A 1B8PA 2CFCA 3EULA 4DMUB 5CEJA 2F3TA 4OP1A 4EGQA 2IP4A 3AUKA 4WKPA 3HKDA 3ZXUB 4TVKA 1UJ4A 2O1XA 5L3QA 1TAUA 4XGQA 2VJDA 1IB0A 4CLRB 2ATXA 1NP6A 4ZK2A 1V6SA 4ZK6A 2OGZA 1NYRA 3O8CA 1XZAA 2GK6A 5IT5A 2RARA 2VHTA 3F8TA 3FPCA 3OJLA 3R77A 4LDNA 2C2XA 3P9YA 1PD0A 3DMGA 4PHHA 1H0SA 2OVFA 2Y2UA 3JQFA 3N59A 1YL7A 3OOSA 4FDAA 1EINA 4JL5A 5U4XA 1EXVA 1OXTA 2WU4A 3AHFA 1CF2O 2RC6A 4KTTE 4UNIA 5AHKA 5GGYA 4BNWA 3NHFA 1EM8A 3TTXA 1A2KC 4KLRA 4P4SB 1MQSA 3SF8A 5CG1A 3IB6A 4RK1A 2C2ZA 3RU3A 3NXSA 5JTUA 2X5JO 3AONB 3HXLA 1VE9A 2XDWA 4MW9A 4W9RA 1M8JA 2MINA 2WU3A 3F47A 3Q10A 2JKVA 2CNWA 3F98A 3TNJA 3VZBA 4ZCTA 1QZUA 1U65A 5T3UA 3ZCSA 1D6SA 4D4KA 1R50A 4JI8B 4JITA 2ZI9A 5D1HA 1UC5B 3OJ0A 3P45A 3G0BA 3AF6A 5THKA 1M7HA 1G5RA 2HZ7A 4OQXA 1JGTA 2IYQA 4S0XA 1IN5A 4BASA 2HLNA 3H5NA 1DQPA 4P53A 3OTQA 2UUOA 3RVJA 1JSXA 3PGVA 2EU8A 5AKEA 3PYLA 3ITKA 1O0BA 1QGZA 3D4LA 3A2KA 3GD5A 3IPLA 2WKRA 5LZ2A 2IHTA 2DLDA 3K0FB 5LA6B 1YUMA 3K0KA 3OCWA 2C95A 3VZCA 3DE1X 4XIGS 2ID8A 3DLCA 1VPVA 4S1PA 4ZA2A 4Y0NA 4M9QA 2ZYRA 3PDJA 3GPBA 3JD0A 4ZTZB 1LRLA 4BVFA 3KLNA 1WTAA 4MCIA 4MW5A 4IDGA 2FP4B 3ISJA 4WE3A 2ONKA 1DNPA 3F2VA 5AJYA 5IUKC 5CCDA 5KI6A 4RD4A 4EMBA 4GR5A 1BKSB 2H0QA 3DYVA 3OX4A 2D1QA 2P67A 3PRKE 1E0JA 2G36A 2ZWOA 2QMOA 2VPQA 4O25A 1CE8B 5COBA 4D9IA 5BMOA 1Q14A 1L5VA 2EZ8A 3GY0A 4U6NA 2DQ4A 5DBIA 1ZWKA 3B1FA 1QQ7A 4YGYA 5H4GA 1Z5UA 1NN1A 4CU2A 1YZLA 3A26A 3LUCA 2YMPA 2ZSUA 2VBIA 2IXBA 2GDJA 2NVWA 4B3IA 4ATNA 1JL3A 3EEYA 4ND8B 1IRIA 1MB4A 1AKUA 1LW7A 3DEFA 4IOJA 1IQPA 4OO3A 4PSDA 1W8DA 2C3OA 2I29A 3U62A 4AL4A 2FWNA 1ABBA 3SJUA 1DKUA 4LRXA 4US2R 3OT1A 1MPTA 3V7WA 4JGBA 3UMMA 3PNYA 1S7CA 3FUWA 1A71A 1EFDN 3UXHA 3WRYA 1WCIB 1TJ5A 1GQSA 4RNCA 1P44A 4BVBA 3KYDA 2B8WA 4UOEA 4LZZA 1YR1A 1Y5LA 4DA0A 5B1EA 3RR2A 3PD7A 4FOLA 4NU5A 1RRVA 1AQ6A 2WC1A 4FUTA 4QRDA 4WBSA 1Z2OX 2PWYA 3A6ZA 2EIHA 1XRSB 3GZNA 1NNLA 1Y4SA 1VL6A 4LY0A 2P6PA 3F2IA 1CZKA 3GRAA 4YRRA 1D2AA 4LGCA 1Y3IA 2RGYA 4HWGA 3QTLA 2HDHA 2AXPA 4UZSA 3C1TA 4FFVA 4CM4B 3DVRX 3G2JA 3IAUA 2Q3HA 2HHCA 3AETA 4YECA 2IUYA 5AFSA 1NJ6A 4MEAA 1SUAA 3QLVC 3PD0A 2VJAA 3GYGA 4R5MA 3DFKA 5ECYA 1QGAA 5G4KB 3SEQA 2BEVA 3CEMA 1J0DA 3NH9A 3SN6A 4BWVA 3K6SA 1EFHA 1VKOA 2RK4A 2B98A 3OWXA 4L95C 5DKFA 3SK0A 4Q3EA 1TEVA 2HA7A 2HJVA 1G7SA 1NLUA 3A1WA 1M74A 2HPHA 5DBHX 2OP0A 2RGDA 4Z9AA 1TKRA 4AIIA 3ZWAA 4WNCA 4F5DA 1NNI1 1RQRA 1ZOPA 3AF5A 2ADOA 3ZY2A 1JHAA 2ZYVX 3KLPX 4DZTA 1VPWA 3EH1A 3G49A 2WM3A 4FC6A 1E6WA 1U7WA 1HR0B 4MVJD 2QUIA 2DMRA 3NT2A 4NVRA 3FB1A 3VZPA 3F5MA 1EH5A 3NJ8A 1SBZA 3TXAA 4OUKX 3EW7A 3HRHA 1Q22A 3IPCA 2GD6A 2G63A 3E1KA 5DT9A 1JLSA 4TWRA 1E79D 2EFHB 4JI5B 1DC3A 3RBZA 4BNVA 4O4IA 3PQ5A 1JHDA 1NRJB 5M2QA 3R0VA 3ZZ1A 3TNFA 4G97A 1KMHA 3O38A 3IVXA 1A50B 2ZSBA 3DDUA 3EOAI 4ENVA 4IFBA 3WGZA 2ZWPA 1MHPA 4HTFB 4ZFNA 5L53A 4DANA 4JEHA 4G84A 4GP6A 3SS7X 3Q9LA 4MUMA 2G9UA 3C5WP 4LRUA 4L8GA 3GCWA 3SLRA 2FYTA 2WG0A 2MMCA 3I3SR 3AF0A 1I0LA 5CJ2A 3B13B 4FFDA 3PC4A 2AC2A 3OM9A 4XYLA 3IKMB 2VO1A 3MYYA 1OLUA 3HBFA 4XJTA 5D51S 2BFEA 2PNFA 4H08A 2NUAA 5AK5A 1IBLB 5FBHA 2YHBA 2H2WA 5JHGB 1EFTA 3DEAA 3QVUA 3PR1A 1USKA 3H2HA 4CKYA 3UJ9A 2UZ1A 2HMVA 2DBRA 4XM1A 3L93A 3EEFA 1DFIA 1OYVA 2I2BA 2GD2A 3WA6A 3MCZA 2V7EA 2VYFA 3V6MA 4DDVA 1V5FA 5AKJA 3CUVA 2M98A 4A0GA 1NVDA 4EFMA 1MO2A 4IZOA 2WSYB 4MMXB 2D5BA 3OE7A 1S2MA 3PGLA 4Q7QA 3T1VA 1NR5A 2CL0X 1U2RA 3JQGA 4S35A 2WPNA 5G02A 4DCGA 3GFGA 3RIYA 4YMGA 1E5VA 2WAYA 3JYHA 2B82A 1Q2XA 3N6XA 4MSUA 4HLDA 4PFSA 2ZTVA 2GTPA 5GJCA 1MIOB 1X7HA 4QUHA 4QQNA 2XMQA 1X8LA 1IJEA 3EZXA 2FPUA 1UQTA 3FTQA 3TMAA 4HAXA 3VQTA 3C3EA 4HB2A 5HIJA 5HP4A 1GEEA 3FMPB 1Y1SA 2XHZA 1UJCA 3C8HA 3P0JA 4RZXA 2ZRPA 3H9UA 1K66A 3LD9A 4CMGA 4QQRA 4QDOA 1MO6A 3K1ZA 3KJGA 3B9BA 4ZJZA 3CLUD 1N9ZA 1GCOA 1QH1A 3GL9A 1YZHA 1TJ4A 3DLAA 4D8VA 2O8EB 1U8XX 2O5RA 4HDSB 4Q82A 1ISMA 1E4OA 2X6TA 2XYGA 3EEIA 3OEEA 4OHMA 3NB0A 4IUDS 4E5VA 2QWXA 4N18A 1OTXA 3TW4A 3TBHA 3L49A 4ZZIA 5JIBA 2OD9A 1BDJA 2NUPA 4WCVA 4TN5A 5CR9A 4DJDC 4XQ0A 4HQNA 1TCUA 3I37X 4BB5A 3KDAA 4BNYA 3PUVA 3LPCA 2QY6A 2PX4A 3DWEX 4ZJYA 1TD1A 3O21A 5TS2A 4QDKA 1VP3A 4M0MA 1QQBA 3WNDA 1ZGAA 2YYZA 1AH2A 3WXMA 1DC7A 1RKUA 1E69A 3RS4A 4NZPA 4BE4A 4TT3A 4MHTA 3M5PA 1P4JA 5DCUA 4U63A 1V35A 1QPZA 4TSFD 3FDFA 2BFCB 2F9MA 4KDFA 3BHIA 3HKBB 5J1TB 4NCBA 1GL3A 3QOFA 1AQYA 5ALPA 4D4HA 3ADDA 2OWDA 3MJFA 1IMOA 2K87A 4HN2A 3DOFA 1GL6A 1EFRD 3WFIA 1X15A 5DSTA 2GEBA 4IX9A 5BNIA 4LVNA 1GZVA 1XEWX 7GPBA 3DXYA 4FZ3A 3S70A 1O1YA 4RL6A 1TEHA 4GUAA 4XKJA 1W96A 3HB7A 4GBJA 2YVKA 2GBCA 4BB0A 1YR6A 1O97C 4IMRA 2YJ3A 2ORWA 4B84A 6Q21A 3TJRA 5H70A 4ALJA 3I05A 5HEKA 3AMVA 3FM9A 3RTAA 2G1UA 2XB4A 3WWYA 4OLBA 2I7XA 1RPAA 3PD1A 2YJTD 3MGCA 3Q0TA 4TMZA 4PAOA 1B41A 2IHNA 3GFTA 1P0CA 4ZVMA 4ZOQI 3VPGA 1FYFA 3FUCA 1EX7A 4J0FA 1V4NA 2X0NA 5I45A 4QBKA 3ABSB 4PCVA 3VPCA 1SVIA 2IDKA 5MFZA 4UPEA 2ZVJA 4JA0A 2F9LA 4HQOA 1A7KA 3SWWA 4AG3A 1K4YA 1J1IA 2RB4A 3BE4A 3FSJX 3SS8A 3L0DA 1XNGA 3QIAA 1EGAA 3GMDA 3LPMA 3JZMA 1KXJA 3OF3A 2JCSA 1XG5A 4JJKA 4WA7A 4UHHA 4H1WA 5LMUB 3DAPA 3WAGA 4JQCA 1X39A 1Q91A 4ZT6A 2EKPA 4CMIA 4FOSA 1A95A 1PBNA 3CPSA 3CIFA 4RU1A 2Z1MA 3QEMB 4DCTA 1ISPA 3VSDA 4P36A 4RULA 5DOVA 4NFSA 3ML1A 1MO4A 1C3LA 4OGGA 3TCNA 2R6DA 3BD9A 3F74A 1X2EA 1U04A 2WINI 1FF9A 1JRLA 2CBZA 2XE7A 3L1VA 5K6AA 1MC4A 4CR7A 5ADVA 5DGCA 3INTA 4CI9A 2FGJA 3FGOA 4ZEVA 5EZSA 3E3LA 3ZN2A 4WVFA 1QB8A 1ZH8A 1XNRB 1ITZA 3ELDA 4DB2A 3STUA 3ZZMA 2WSMA 3GXOA 1V4BA 2X2OA 4HHEA 1LDMA 1QRDA 1WXHA 2FFRA 1SCUA 1G9TA 4S12A 4RYLA 1MNQA 1PEAA 5EP4A 1TLFA 4BTEA 1FC0A 4GPTA 5FH9A 5LWQA 1VJ0A 1E64A 1XDSA 3O5AA 1KFKB 1NMEA 5GP1A 3M6XA 1PJ2A 13PKA 2YXPX 3B82A 3S28A 1WE2A 2KSQA 4OHKA 1S4MA 4B8YA 3IXMA 4C4OA 3SP1A 2ATIA 2VT7A 5HDBB 4R1OA 3N05A 5TQ0A 1E18A 1VA5A 2C88A 4D45A 4RESA 3LX5A 3VJRA 4ARIA 3GEMA 4DCPA 4NOKA 2AZXA 3T5BA 5F98A 5DJ5A 1JWLA 4V0SA 1NW4A 2G70A 2WE8A 7REQA 1O9HA 1KARA 1OMOA 2NO6A 2OGWA 1M1YA 2ECFA 2V3VA 1GZ5A 5GIOE 2VTKA 1U5BB 4I4TB 4ED9A 1QU3A 1SUDA 4JLAA 4Q19A 2XUKA 3VOTA 1CX9B 1KK1A 3PHGA 4B6SA 1TK2A 4C4AA 2OFOA 3AFMA 3AZQA 3LPNA 4QTXA 3H2KA 5HQJA 1KOLA 3EIHA 4X7RA 2X5NA 1YXMA 2X9LA 3A1NA 5FOXA 1XZMA 1JMKC 2F59A 3CE9A 3MT7A 5ERGB 16PKA 3IQWA 5A3JA 1WD5A 3V9AA 1OX4B 1FDWA 5KSOA 3KV1A 2B1GA 4V0ME 4QE3A 5CLLA 1WS6A 2YIDA 2CE2X 4FC7A 1VC2A 3KT3A 4NBLA 1DHTA 2O3JA 2QN9A 4OV6B 3EAGA 1C9DB 3QU4A 2W9XA 2GA9A 4JI1B 1E2MA 2CBXA 5CT4A 1NBME 1UDBA 2VWPA 4PG5A 2X5KO 1C3XA 1A8SA 3TVTA 2D5IA 2FQQA 3ZX5A 1BHQ1 1SG0A 2OZVA 2QVLA 1WSWA 2LXNA 2GM5A 1J22A 1C1DB 1DTEA 1RBZA 4FHFA 4PR3A 1FRFS 4RJLA 5LBUA 1T9GS 4AU1A 2FEKA 1MJ5A 1F8UA 2HSDA 2CXUA 1P6UA 3P2EA 2Z6QA 3RS0A 4F3RA 1F60A 2HSJA 3ZLJA 2GPSA 1PJ8A 4XRRA 3UK1A 1U9IA 1Z4OA 2JARA 2XD4A 3C5VA 3E9QA 1G5IA 4X41A 1L4KA 3SE7A 1DRJA 1G21B 3EPPA 3N7TA 4HX9A 4JAVC 5REQA 2YHIA 3FMFA 4FB4A 4DLVA 3IQZA 4HWTA 3SJZA 2AG5A 1M6VB 3K72B 2WBLC 3LL4A 4RZUA 1OREA 1NF2A 4WL0A 1E2KA 4INAA 4BBZA 3KYJB 5B7GA 1RWNA 3A3YA 4ZGWA 5J2TF 1GPH1 1BVHA 2MSLA 3C3CA 3PC8A 1XN1A 5B3AA 3WQSB 2FF7A 2BOVA 5BYAA 3LCCA 1Q2UA 1B16A 5DXJA 3NMUF 2G83A 3UQYS 4GOOD 1G0NA 3A0RB 4EF6A 1AKNA 3D2LA 3QF7A 4KFTA 5JEDA 5DK4A 3C41J 3ESYA 3DE6X 3TKLA 6ADHA 2W6ZA 3KJZA 5ALRA 4N3AA 3LC1O 2QTRA 2RFLA 4RANA 4O4HB 3OPVA 3AXSA 3WZMA 2ADFA 5JNSA 4MGZR 1WHTA 3ZU6A 1JFSA 2GZMA 1LUAA 2ZOSA 3T54A 4TV8F 4PIPA 2VZEA 2O7SA 1SB8A 3DAFA 2R87A 3R7NA 2I4MA 3HSSA 4PBTA 1YV9A 3PLAE 1OI3A 1JR3E 1Q1ZA 1H42A 3IEIA 2GBFA 4R51A 4D3FA 1CQIB 3EXHC 1C4KA 2D1YA 5EL0A 2IYNA 1RJWA 3VU0A 4F8JA 5KTMA 3SKXA 5CIQA 3A58B 3E18A 3GNSA 5ALNA 2QKYA 1G8KA 4KPUA 4W5RA 3EG9B 3MTDA 4DT1B 2RIRA 2GS9A 1HLFA 3BULA 4PNHA 5ALMA 3K5HA 5EQFA 1J39A 1ML3A 1E1CB 2X4GA 4G1BA 3OQIB 4YRNA 1PNVA 2AFIA 5L3RA 3RS9A 1VSBA 2DLCX 4Z54A 3DUFB 4W8OA 4M3NA 5HF9A 1GYQA 2I8LA 1QE3A 4RA6B 1VKZA 1NJSA 3ZKWA 1JFTA 1CYEA 2R751 1JIJA 4PC3A 4MV1A 3A27A 1Y9ZA 3WWDA 3LGSA 2IKSA 3TQCA 1GUAA 3SZRA 3KOMA 3W5JA 2W6MA 1SKYB 2ZYAA 2JHCA 3OSZA 3T94A 4G4IA 5L7YA 1KEWA 4K1LA 3H1FA 4WUTA 2A86A 3RIHA 2QROA 3O8QB 5L6LB 3PHBE 4QFBA 4DMGA 1RI5A 1TIPA 1MB3A 1J00A 1JSRA 1ZIXA 3CNLA 2ZSFA 3MWEB 3NRJA 2YY5A 1J9GA 2QTVB 4INOA 5EPUA 3KEOA 2AC4A 3NANA 4FGSA 2J1LA 3WIVA 2B37A 1FX1A 1OW3B 1U31A 1E94E 1I1OA 4LMPA 4O59O 3MAJA 1KU0A 5DNCA 2ZUSA 2I78A 4LE0A 2LDBA 3KQKA 1US8B 4JYAB 3VM6A 1HTBA 3DEJA 3OQ1A 5AVQA 5BOSA 2XUIA 1Z82A 3MJTA 3NKVA 5CTAA 2ONYA 3KAKA 4MPPA 3ZW8A 1JLHA 1NNEA 2REBA 3VR4H 2B4YA 2CVZA 5CVTA 3GPLA 3C8UA 5JY1A 2DBQA 4JB2A 3ELUA 4WFIA 1CDDA 1I24A 1RLTA 1U0FA 2ASVA 2GPYA 4L4RA 2WLTA 1ML4A 2WZBA 3BKWA 3HCBA 4J29A 2ZAMA 1L4LA 3JD1A 4NLLA 1ZJZA 4PAWA 6YASA 3CUTA 1ECCA 4X6UA 4UW9A 4HLUC 3N2GB 4ALKA 3F3SA 4OQQA 3X1MA 1LSSA 2GJSA 4EPWA 2BKVA 2HSWA 1LX7A 1EZ1A 3D8RA 1Y33E 1QDUA 1ENZA 1IQUA 1Z06A 1U4NA 3EG5A 1MV5A 4DDWA 1XO1A 5HK9A 1J9EA 4UU7A 1OXVA 2Q5FA 3WBBA 2O3RA 4IDEA 4JLOA 2ZJ5A 3E9NA 5L3ZA 1P4GA 5H9VA 1EBUA 3GRPA 3ZEIA 1JQ5A 1XLVA 1APBA 2WIAA 4WESA 3CW9A 3OAAD 4W7HA 4ZYUA 1ZLXA 5M3BA 621PA 2QN1A 4IL5A 1G4HA 2PKXA 2C4NA 4DL9A 1LSUA 2OV3A 2A2ZA 2W6JA 3CA8A 3W5DA 4ZRNA 3OZRA 1FSGA 2BKAA 3DZFA 5IYZF 1NP3A 2J0UB 3R5KA 3DXFA 4YAGA 2F3UA 2UAGA 1NPTO 1OLSB 3ELWA 3ENQA 4LZNA 4WSOA 4AJHA 2NAPA 1C7FA 4BVLA 2BFFB 1D4AA 4AKEA 3WDKA 2Q3CA 4LOAA 5DM60 1JHVA 2W8BA 3UF0A 3O1IC 2AMVA 3EZ2A 3P97A 3A9SA 1VB3A 4W1PA 4XRGA 5TPWA 3B1YA 2BW0A 1PL8A 1V8BA 3RCBA 4Y8VA 5JNVA 3BMXA 5EZYB 1ETUA 3FLAA 1GU0A 1H93A 4NDNE 4Y2YA 5AM4A 3BOSA 3KR2A 2VHZA 2WP0A 3ETEA 3QYJA 2VDUE 2EKBA 3P4XA 3PQ7A 5ESRA 2R7LA 3W2HA 4GKJB 2JGDA 4ALIA 1V6AA 5T4HA 2PD4A 3A9TA 3UUGA 3EMKA 2I22A 2DFLA 1KXZA 4JVLA 4C7OA 2VP0A 4M0UA 1PQWA 5DIFA 2ZSJA 3DPUA 3O8LA 5HQTA 2ZIXB 3EXFB 2GPAA 4AUNA 1GCUA 1N2CA 2MDTA 2WJPA 3D1LA 5HKKA 4ZHQF 4MZDA 4JWTA 4GKKB 4JXKA 3E9RA 1P4RA 3I5UA 4G9GA 4K26A 1XMJA 3RG8A 4UATA 4NG4A 5T4BA 4BOYA 4HYEA 2D1FA 3UYLA 2O8CA 2QMUA 3T1YB 2AG1A 1GSHA 2R5WA 3R7AA 4FT2A 2TMYA 3OU7A 4L5YA 2FEAA 3C7CB 3KPYA 4EMSA 2ZQZA 3JQFC 1JBKA 4H60A 1LI7A 3ZHUA 4L0DA 1L6IA 4RGYA 1RRGA 3M49A 3PGJA 4DCJA 3MWKA 1W0JA 1Z7BA 3E35A 5GWXA 1ZITA 1J97A 1GAQA 3H2ZA 1CRPA 2V7WA 5AW1A 3SVTA 5FTMA 5B4TA 1CY6A 4BQSA 2K2WA 1G7CA 1RHUA 4ENTA 2DB3A 4P3NA 4WX2B 2F43B 4HN4B 4P4UA 1KIMA 3I0NA 4DZZA 4KBGA 2Q5CA 3O8NA 4JROA 3KUDA 3WLTA 1R16A 1DC6A 1XTQA 2GX6A 3GRKA 2BJVA 2D4HA 2I4RA 1NLMA 4LDAA 3DLBA 4L02A 1JJBA 1RJGA 3W1VA 4EG4A 4XARA 2IDZA 3I2HA 4PINA 5C18A 1FLDA 1N5MA 3ZHVA 1NVXQ 4IPTA 3NRCA 4MS1B 5JS2A 2RGAA 2R6CA 2ZRDA 1QHHB 3C2QA 3L18A 3D7KA 1N2HA 3FJYA 4QASA 4V0QA 1I1HA 3B6IA 3RWBA 1L2TA 4R0VA 3G8CA 4L8LA 1U2QA 3RKSA 3AVVA 1ZK1A 5KHOC 3R76A 1SD1A 2C3PA 3K4HA 1A8IA 4DLWA 4FD3A 5BPFA 3R9IA 3RTBA 4D92A 4G5GA 3ZLBA 4QD3A 1XVLA 3BAZA 1BA2A 4US1R 1TT5A 5FL7A 4CQLA 2FCRA 4FONA 2QW1A 4LDJA 2H4YA 5TVKA 1Y81A 4IQ4A 4TLMB 1J6UA 1T9HA 3Q6IA 3QNWA 2AV6A 4JUBA 4B3GA 2M6LA 1W581 2B5OA 3D64A 2V59A 4EATA 1I9CA 1KI9A 2XV1A 4HMOA 4YHHB 1KAGA 1S8FA 3ZDEA 4BRZA 3V7FA 1G42A 2PRYA 3HVHA 4Z0HO 3RAFC 2HA6A 5HCIA 1B74A 2R86A 3ACCA 1EWYA 3F3MA 4HK4A 2KWIA 4P54A 4ZZ3A 3VNRA 2IV7A 2GF9A 5F7OA 4KQIA 1YE3A 1QTIA 1ZK0A 2NU9A 1GTVA 3FA2A 4A23A 4KV7A 1LH0A 1T15A 3PDWA 4YONB 1HOTA 3DMHA 5B1DA 1OHHA 1QC5B 2B83A 4MW7A 5ICMA 3HYCA 4MULA 5AIAA 1OE0A 1DBRA 2JIDA 1RAGA 3HPRA 1MQ9A 3KQQA 2WWFA 3IT2A 4FIDA 4P31A 4G0PA 3WRYC 5EVJA 2QAGA 2GT1A 1F2TA 5FNVB 2GGSA 3RYTC 3X2FA 1KAHA 2QD3A 3HB5X 4IOMA 3UWDA 1Y8ZA 1Q1QA 1YR8A 2FTKE 3UTDA 3BH7A 3VOAA 3CH7A 2GN0A 3EFEA 3VKFA 3ZV4A 2C03A 3W4JA 1H94A 4B8ZA 5E9AA 2IDJA 5LQMA 5EN4A 4YDQA 3BE5A 2P6RA 4XDGA 5D6NA 3WK6A 4DA9A 3PX7A 1Z5PA 1DJPA 2WG2A 5JWOA 1TM4E 1H3FA 1IHXA 2BZ1A 1X70A 2D2IA 4CMJA 4D79A 2F2TA 1NJ8A 1BOOA 3T99A 4RMIA 2ZVDA 4LRWA 2BFAA 3SI7A 1JG7A 2YICA 4CF4A 1YCDA 5JCXA 3S8EA 3PFKA 1ZUNB 3I5MA 4UUQA 1WKCA 5KDOA 2WHXA 1SA0A 3BRWD 4J03A 1BJTA 2RJOA 2QHXA 2X3UA 3AF3A 4QJBA 1KY5A 3ANYB 3PWKA 5MN6A 4UHJA 5IAGA 3U40A 3AEQA 2UYHA 1H2ZA 1F2VA 5GTDA 4YJDA 1T3LA 4YBRA 3LP6A 4A0HA 3FFTA 2BGKA 4E31A 2YFKA 3UOGA 1G17A 2PBFA 5F2NA 1N7HA 1K8ZB 1SC3A 3E05A 4TVBA 3FPGA 1SHUX 1YBAA 2J7PD 3DXXA 3NEJA 4QLBA 4RPCA 2JH3A 4OFXA 3KUUA 1E9CA 3NBFA 4G0OA 4XDZA 3AO0B 3QG5A 2V7QD 3REFA 1TYCA 3RRBA 4A4DA 1QNLA 4H7JA 4C07A 3U44B 1R4MA 4HEHA 3DBHB 3WK8A 4TRNA 1YVDA 3MJHA 4EHIA 4YWHA 3ADBA 4O4IF 3SZMA 5AQ1A 1ID8A 2HN9A 4X44A 2RI0A 3GXBA 1EHIA 3IE1A 4CQMB 2Q45A 2A5FA 2Q07A 3RVMA 3UT5A 3NM5A 4WN3A 3G9XA 1L3IA 4KR0A 4RY8A 4Z7QB 4CLOB 1N32B 2J67A 1NSYA 4WBXC 3FLEA 1Y4DE 3E03A 4JIMA 1N6OA 2DCMA 1QK4A 2FEWB 3A3OA 4ZWNA 1P77A 3ETGA 4LNHA 3LQ4A 4BX8A 4YMVA 2I62A 3A36A 2RH8A 1KJJA 5ALVA 5CRIA 3EEBA 4PLCA 3OCZA 3WGOA 2WJ4A 1SQFA 3D4OA 1F9AA 2E4ZA 4TROA 5H0IA 1QYDA 4AKHA 4BMVA 3BTOA 4GX0A 1BNCA 3LAWA 2HQBA 3L8ZA 4XX1A 2GSDA 1Q5PA 2BCEA 5DTEA 4B0OA 2EDCA 5MGBA 2D3WA 3IHTA 3CLSC 3JTEA 1CUEA 5NLLA 2DCUA 5MGNA 3EJ6A 3FHTA 1EXDA 1M2OA 1JEQA 1NZDA 2ODNA 2P77A 3IJ5A 3GR6A 1LK7A 4OLFA 1A2OA 1GKLA 4AP6A 5HMMA 1M5RA 1MVOA 2QS9A 2ZE6A 1RHJA 3E3NA 1RZUA 2WKSA 4X3OA 1I4TD 3GWGA 3S99A 4BN4A 4EJSA 1DC8A 2F00A 3T0IA 1JYEA 4FW9A 1T2CA 4P32A 4DZRA 5CB0A 2PUTA 1QLHA 3EVEA 3DZDA 1S8OA 4KUEA 4XUCA 4M1ZA 1JJFA 3I34X 1N9GA 1R0RE 5CAEB 5FOUA 4IG9A 4B7AA 2ZJ4A 4JR1A 2ZM5A 2O48X 2G8NA 4Y2QA 4ZAGA 5A7FA 4R1SA 3OQPA 1G4UR 1KKUA 2JLSA 2V97A 3IRVA 4UMDA 1J9ZA 3TQRA 3KTAA 1YZTA 3JQDA 5CFLA 1U02A 1KKMA 1SCJA 1HT3A 1DIAA 5FIUA 1H69A 2I3AA 1VYTA 1OXUA 3T15A 1SVMA 3RU2A 5C1IA 1L7XA 3KKPA 5A7HA 5B3KA 3A9VA 3FFAA 4ZKDA 2AWOA 1GQFA 5HZKA 1F12A 5JI2E 1UP6A 2NVUA 4YT4A 5FBZA 1WB4A 4KR3A 5BYKA 1NKTA 1YVPA 3ZHCA 4Q1AA 3TAHA 1LNQA 1DZ3A 4WXPA 2UYOA 2W2PA 3PDHA 4M8KA 3EUAA 2OAGA 1FNCA 3L5OA 2J5XA 2BF7A 4GDMA 3AR4A 3QKIA 1SVKA 3THRA 3VDMA 4DIDA 3WADA 1HLPA 3ROXA 9GPBA 3D3EA 2I6UA 4PSVA 2WV9A 4JEIA 2XMPA 1VYUA 1HQDA 1BOFA 4OXNA 4QUEA 3AEXA 4WN9A 3WYDA 4NS1A 2Q1YA 4DA7A 5G40A 4EKNB 2A0FA 3BWYA 3FDIA 5HVNA 5JZBA 4IBOA 3H11A 3D1JA 1JEAA 2XZPA 2XRYA 3R20A 1K8QA 4CZ2A 4WERA 4N76A 3MBKA 3GPDG 4GBED 4O2RA 3L7IA 1GYPA 1NUHA 2H63A 4GNRA 1TZCA 2E55A 3GJ5A 2NZUG 5HF8A 4DEYA 3EARA 4H59A 2QN8A 3QVMA 5FI5A 5CK5A 4KE9A 3DM5A 3SR3A 2PS3A 2B2CA 2B78A 1FTYA 2X9VA 2YY7A 3NBYC 3OETA 1IJKA 2FNAA 2AG0A 3JAKA 4GX2A 1BE8A 4HPWA 1ARZA 4OBXA 2X0DA 4N1AA 5JDCC 3SSNA 1FQJA 1XHFA 3H6HA 5GONB 4LRYA 3RGGA 2G6TA 5C52B 2Q4TA 3EZ6A 4FBGA 5F9FA 1CR0A 1EK2A 1I3LA 2BFDB 2BEUB 2VHXA 2AOUA 4IF4A 5AUNB 1U28A 3DG9A 4YRJA 4BZWA 3FPAA 4PSUA 1CUUA 3Q0EA 1Y7TA 1G64A 2IF0A 4TLAA 5CLQA 4UM5A 1X77A 1RPTA 4RJIA 4PGHA 4ZRDA 1N6RA 8ATCA 1WV0A 1CIPA 1H4TA 3JWIA 4C08A 1G5HA 3TFWA 3OM1A 3DZBA 4YAUA 1U0JA 2I4NA 1TVEA 3OZFA 2L42A 3V2HA 4E51A 3FPHA 3ZE0B 4R8MA 5ITVA 1FTSA 1LQUA 3BMQA 1F2DA 3U16A 4ASUD 5EMMA 2FUG1 3C4VA 2BBTA 2W2LA 4I6EA 1MJHA 1SCAA 4YJGB 5HUHA 2FPGA 3R6TA 4KGZA 4CTMA 1GRCA 3CR8A 1TX4B 3CQ9A 4UASA 3IILA 3CY6A 2VRCD 4S1VA 1SD5A 4TMWA 2ZBFA 3MSXA 3QFHA 2ILTA 4OHFA 2IZ7A 3ASZA 2IYRA 5B1YA 2NPFA 3HA2A 1QZXA 1TIKA 1SB9A 4QFCA 4V24A 2OO3A 3W7BA 3M6VA 2D2VA 2H06A 5IN5A 2GD1O 4Q21A 4BO9A 4M1YA 3N70A 4Q1VA 1MD9A 5BQOA 5A62A 2IYLD 2VQEB 1HYQA 1OA1A 3OBBA 3BL8A 1RWQA 3ZCUA 2CWDA 4B6GA 1SY7A 1V3VA 1Z2NX 4NF2A 2X6QA 3L7KA 3R3ZA 4GSKA 2AYZA 2W58A 2PRJA 3Q15C 4DNFA 3Q1KA 2EJCA 2FPSA 1QKIA 2PGJA 4BNMA 5LCXA 4J0QA 4BKUA 2BBSA 2REQB 5EC8A 4ZT4A 4H1HA 3BMOB 1VYVA 2NU6A 3ICPA 4LAFA 4LQ4A 4EHDA 2BBOA 2GOYA 3MT9A 2YZ2A 1KJYA 1CY0A 3DMDA 2PKEA 5E6UA 2XRMA 4QSMA 3RV4A 2I87A 4BKRA 5EJEA 1X8JA 3KJFA 4MEBA 1S1CA 3HWRA 4Y18A 3VH1A 3WBKA 4CF3A 1E7QA 3D8SA 5K8JB 4QUBA 3FZGA 3QFFA 5CA0A 2VK1A 1CWUA 5DLYA 2CXRA 2IXGA 2Y1KA 3HFSA 3LA6A 4XD2A 2XXAA 4L9WA 3B60A 1NUSA 1FXWF 1NVVR 1IC6A 1K27A 3PSHA 1LW6E 4WZZA 3N2KB 4IQFA 1ZM4A 2ZXEA 5JBQA 1NUAA 5CDFA 1KI6B 2ZXFA 1SEPA 5CX1A 2A88A 3HJHA 1N1GA 4O2AF 1U7PA 3WJ1A 3K92A 1I94B 3LT4A 3ZY6A 3T4XA 1JIVA 3AM3A 1GCAA 4YX9A 1YL5A 4UTNA 3ZWCA 4AO6A 3H1AA 3GLGA 5AM2A 1RM3A 2C98A 3FYTA 1J1UA 1LJ8A 3KXLA 3X2EA 3R40A 1C80A 1C9KA 2MT9A 1BAPA 2O05A 3KAJA 1JV2B 4TL8A 3IO5A 1IZ7A 3KFLA 2AUNA 3EQ6A 2J07A 3LH5A 2C9OA 4LXTA 1TECE 1N36B 3ASUA 5TV2A 3T1OA 2OV2A 2QTZA 2I34A 3CZ4A 2OPHA 4EA9A 3LQQA 4FZVA 1OFIA 4ZTUB 3PEYA 1U0LA 2WUEA 3H4VA 1TNDA 2VP3A 1OGJA 2C82A 2ZBDA 2GARA 3SXPA 3O1HB 2BSAA 5I7VA 1LTQA 1B76A 2Q0SA 3FFWA 3VR5A 1AO0A 3O9VA 3E2PA 4ZT5A 2QK4A 2C9MA 2RGBA 4RM3A 1OQAA 3EDRA 5EJFA 3PIIA 3OCUA 5JISA 1A76A 3PRJA 4E1BA 2R6FA 3WB2A 4DYVA 4DLUA 2ZDGA</