4C3ZA

Nucleotide-free crystal structure of nucleotide-binding domain 1 from human mrp1 supports a general-base catalysis mechanism for atp hydrolysis.
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
231
structure length
231
Chain Sequence
TNSITVRNATFTWARSDPPTLNGITFSIPEGALVAVVGQVGCGKSSLLSALLAEMDKVEGHVAIKGSVAYVPQQAWIQNDSLRENILFGCQLEEPYYRSVIQACALLPDLEILPSGDRTEIGEKGVNLSGGQKQRVSLARAVYSNADIYLFDDPLSAVDAHVGKHIFENVIGPKGMLKNKTRILVTHSMSYLPQVDVIIVMSGGKISEMGSYQELLARDGAFAEFLRTYAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Nucleotide-Free Crystal Structure of Nucleotide-Binding Domain 1 from Human Abcc1 Supports a 'General-Base Catalysis' Mechanism for ATP Hydrolysis.
doi rcsb
source organism Homo sapiens
molecule tags Transport protein
molecule keywords MULTIDRUG RESISTANCE-ASSOCIATED PROTEIN 1
total genus 70
structure length 231
sequence length 231
ec nomenclature
pdb deposition date 2013-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00005 ABC_tran ABC transporter
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4c3zA00
4C3ZA 4E09A 3LWNA 2ZROA 4PFSA 5DGXA 5CJ2A 2CK3D 3D3QA 5HE8A 4EPRA 4P4SB 4CT5A 1OW3B 3NIBA 2IUTA 1NG9A 2YVUA 1EX7A 4W7SA 3NEJA 4Q03A 2ODEA 2ONJA 1AZSC 3QJYA 2PX3A 5EP3A 3IQXA 1L7VC 3B85A 5AUQA 4RCZA 1NVWQ 1OV4A 4TMWA 1UEIA 3AF4A 4CEIA 3LBIA 2ZR0A 2IS2A 4NCJA 1T3LA 4D26A 4AKGA 3THXB 4BPBA 5GVSA 5J4YA 5KNCA 3PXGA 2JASA 4EJSB 1MRNA 1ZCBA 4ZDWA 3A8TA 3RS3A 5CB6A 5FUWA 4RZXA 1IXSB 2JGNA 3LV8A 3U3KA 1XJ0A 3FKQA 4LJAA 4PZYA 1E3MA 1X8LA 4IHQA 5FPHA 4F38A 1XPUA 4MQBA 4C9BA 2ZI3A 2V54A 4LYJA 3CNNA 4A6XA 1W4CA 1G3UA 4LHVA 1Z22A 1SZPA 1E9CA 1R0WA 4DIEA 2O8EB 4F91B 1G8HA 2QNRA 3IGFA 3K0CA 4KI0A 4NCHA 3W8RA 4XWKA 4IDHA 3L0PA 3GFTA 1D2MA 3IPXA 4C0BA 4IW3B 1RVDA 4BFYA 4JT2A 3WP0A 4DWJA 2Z83A 3K53A 4ZCLA 2Q6TA 1KY3A 3KJHA 1A82A 3FHOA 1OFUX 3UMRA 3QF4A 4W5JA 2Q9CA 3T1OA 5B57C 3N2EA 4V0LA 1KAGA 4QBFA 1SXJE 5FTJA 4DLSA 4NH0A 2OBMA 4TYWA 2RH5A 2CJWB 4OI1A 3B6EA 2CHQA 1ZNWA 3AVUA 5BYJA 2R6AA 2XTNA 3LRPA 3LA6A 4CVNA 1UDXA 1GKUB 1Z07A 2IXFA 3FHCB 4ZIRA 1MO3A 3OEHA 4BFZA 1ZCAA 1ZC4A 2A2ZA 3WNDA 3SQWA 3TKLA 2Z43A 4URUR 5SZHB 3SYNA 1T4GA 4DLZA 4EQ6B 3CRVA 4LYHA 5FH9A 3K70C 1R5NA 1G4AE 4JSYA 4QC2A 4JL6A 3K9LA 5DYGA 1G5PA 1YQTA 2ZUDA 4WAUA 1B0UA 1KI2A 3EAQA 1RYHA 3OEHD 4HDCA 5EP4A 5HCNA 1N6NA 2NQ2C 5JS8A 2G3YA 1MO5A 2XJ9A 1E0JA 4OJKA 3WXMA 3AUYA 4LCBA 1YR8A 2ZS8A 1ZRHA 4ERNA 1FNMA 4G1UC 3VHXA 4CRWB 4KCGA 4S2EA 2OEPA 3AF1A 3VTKA 1BKDR 3K0FA 3TBKA 2EFGA 5GJBA 3A1TA 1G18A 4ZIRB 3TNFA 2JJ1D 3H84A 2QAJA 4GP7A 3P32A 1W47A 4LBWA 4V0OA 4GBMA 2QMEA 3I62A 5G3ZA 1W48A 1QG2A 1KNQA 3EC1A 3OHMA 4LBVA 4JJZA 3AUXA 2OCYC 1DAFA 5DN6A 2FFHA 1SVSA 4AK9A 2B21A 1OH7A 3JVVA 1WP9A 2JJ2D 4A0FA 2GAAA 4C7OA 4Q4JB 4URVR 1X3SA 4TTRA 2F9MA 2CNWD 1O87A 1W4BA 2IA5A 2IEZA 4FI3C 4HB3A 4ZO4A 2W0MA 4WZ6A 3SN6A 1B23P 2DB3A 2ZRMA 3PIRA 1OT3A 4YDSA 2JIZA 5EQTA 1WMSA 2G1KA 3A1WA 1NMXA 4JT4A 2D2EA 4NCIA 3SC3A 4OL0A 1II9A 5DSZA 4ARZB 2ONKA 4WW0A 3RWMB 4QXAA 3BH6A 3NBYC 3K0FB 3EZ7A 3CZPA 3V9PA 4PHFA 1HT1E 1ZBDA 5CYOA 4GDFA 3CX8A 4L4UA 3ZD7A 2VHTA 1W5TA 1FTNA 2NO7A 2SHKA 2CCKA 4PHTA 1S1MA 1XD2A 3QF4B 5EJEA 1S1CA 4RZ3A 3X2SA 2WJHA 4FWIB 1Y63A 1GDDA 4M1KA 2C9YA 4JSTA 1BO6A 4C0LA 1E2QA 1WB9A 1MABA 2JCSA 1KKLA 3FPAA 1NN0A 1FNNA 4D2IA 2BV3A 4NKRA 2GCNA 1JPNA 1PVOA 2F1HA 3K0EA 2CMKA 1P9NA 3HU3A 1AS0A 5J40A 3ZGXA 2CDNA 5FOUA 2IYXA 1M1YE 3L8YA 3RDPA 1NKSA 1XXHA 1Z3IX 3LH5A 3EA0A 4DT1A 1MABB 2VLIA 4YXWA 2LWIA 4JL5A 2IHYA 3KTAA 1EFRA 3FVQA 2ODNA 2IYVA 4HB4A 1RZ3A 3CR8A 2V6IA 4Z1MA 3ICQB 1J2JA 1G17A 2VL7A 1GSIA 2F1IA 2ZJBA 3CUEF 3BH7A 3EIHA 2OAP1 2ORIA 1ZM7A 3FWYA 4I1SA 5B2ZA 1DARA 4M2LA 2JLXA 5F9HA 4ILEA 2QMHA 3IBGA 3JZMA 4K8OA 4MRPA 1YZTA 4GP6A 5EUMA 4BZPA 3K09A 1W0KA 1M2OB 3BFXA 1JR6A 1CRQA 1KSGA 2QP3A 1UBGA 3QVUA 4FMCF 2OSBA 2C9CA 3Q8XB 4M53A 2VBCA 3FTQA 1VYVA 3BJIC 1F5NA 5JSZB 3IBYA 1E96A 1E4VA 2ZAOA 5FOWA 5JFGA 1MOZA 4Z54A 3R8FA 4LRWA 3D7MA 3PJRA 5FOTA 3KJEA 3NC1C 2WWWA 1KYIA 4UKDA 1QZXA 4FCWA 2F3RA 1SHKA 3PUYA 1E2MA 1GITA 1TPZA 4EJSA 4QHSA 5JECA 2WHXA 3WBKA 3C5CA 3KDSE 8OHMA 3P27A 1S2MA 5BWMA 2I1VB 2EWVA 4JVNA 4TZ0A 2W83A 2BBTA 1GZSA 1NRJB 1IY2A 4PSAA 3QXJA 3K70B 2YINC 4PPGA 2FPMA 4UJ3A 2NPFA 4XVRA 4JLOA 2FA9A 1YVDA 1Q1BA 5CLLA 1W0JA 5EUQB 2HYDA 4WA7A 3RS0A 3WMEA 3KJIA 5K8UA 2ZANA 1QVAA 4ZDJA 1KDOA 3C4JA 2J3EA 2ZQ5A 2XNDA 3UWOA 4QGFA 3WNBA 4B43A 2OT3B 2WTUA 1R6BX 1YZNA 2O5VA 2FSGA 2OXRA 3DDCA 3HDTA 1XEXB 4QFMA 4M9ZA 1SGWA 3TH5A 1XCPA 2V1XA 1U2RA 1DS6A 1KK1A 3QSYA 5FR1A 1JB1A 1NIPA 4LK2A 4JVLA 1P9WA 3OAAA 4TL7A 3IHLA 2WSSA 3Q85A 5IHPA 4P0TA 4WIAA 2DFTA 5C46F 5JCZA 1N0WA 1US8B 4QM6A 1DTSA 4JVMA 1NKTA 2WWGA 4I99A 4BEBA 4UXJA 3KFXA 4KFTA 3SJBA 2HCBA 3HR7A 3UG6A 2EQBA 2ZTSA 3H1TA 4Q7JB 4OQFA 3T12A 1F48A 3EZ9A 3AM1A 2H16A 4ZCMA 2H18A 3C14C 5JBQA 3DM9B 4TT3D 5BQ5A 1AK2A 1JEDA 5CJPA 3SE0A 2ZVQX 1RIFA 2RGNA 3IILA 4X8LA 1UKVY 4FXPA 2W0SA 3B1VA 3G82C 3UKDA 4DDVA 1DOAA 4JLKA 5DISB 2ZIAA 2AXPA 1SXJB 4IKEA 2UVQA 4D0LB 4TLDA 3SU8A 2CHVA 4IRUB 4E03A 4YLGA 2REOA 2REXB 4YMSA 4OQLA 3WNCA 3EA5A 4BZXA 4D81A 1XCGB 2L0XA 4ESHA 4HI0E 1G4UR 1ZJ6A 3W6PA 2WICA 1FUUA 3H86A 4EQ6A 3TRFA 3MD0A 4OI4A 3NDPA 4IXMA 3W9YA 1R5BA 4BZQA 4LHWA 3NHBA 4ZDIA 3T1QA 2V7QA 2LCFA 3CWZA 5E7IA 2EU8A 1J8MF 2VH5R 5TV2A 4L16A 1JBKA 4B32A 5BXQC 2IS6A 3ZVLA 2ZRGA 2ZJZA 3ZQ6A 2C98A 1DEKA 2BM1A 3BE4A 3H2YA 2P6NA 3ZS8A 3W5IA 2JLQA 2BBOA 1SVLA 3A1UA 2ZE5A 1E79A 1TQ2A 2OV2A 3B7GA 4FMDB 5CIWA 4DDTA 3OAAD 3U44A 2XAUA 2QTFA 2ZSFA 1UKZA 4B71A 4NTZA 2IHBA 5CK5A 1GP2A 4MGZR 1AQUA 4NHOA 1EG7A 4XSHA 2BKEA 2JDID 1OHHA 1G8FA 1SKQA 3DO6A 3EIQA 4D0NA 4DSNA 4KYIB 2J9RA 4FINA 5DHAA 4TQAA 5DH9A 3DOFA 4S35A 1W5SA 1KMHB 1N6OA 2QTVB 1CJTC 4F4CA 4JYCA 3B82A 2PT7A 3SFVA 4ZI2A 1W46A 2J7PD 2BMJA 3A36A 3IIKA 1R0ZA 1EFCA 2A78A 1NVVR 2XOKA 3AV0B 1NIJA 3MLEA 5B30A 4Q7LA 2R2AA 3NBZC 1OH5A 3SQXA 3MJHA 3CONA 3E70C 2BCJQ 2ZU6A 3FGNA 3LX5A 2ZEJA 4AC9A 2QAGA 4Q7KA 1AJEA 4H9GA 4EDHA 2FMXA 5FBLB 5FTMA 2IBMA 1CS4C 5E4FA 3CIOA 3KB1A 3RSOA 2Z4SA 4B44A 1E6CA 4KITB 3WBJA 2QA5A 4PQRA 3VR5A 2RGDA 1G7CA 1JXMA 3RAPR 1T5LA 4IVRA 1EFHA 1US8A 3THOA 4M21A 1EFUA 3AVTA 1PJRA 1TF7A 4O3MA 1OE0A 2ERYA 4QBIA 3FKSD 1E2JA 3OE7A 4QG7A 5DI9A 4PC1A 2VYFA 2FOLA 2RGXA 4KXFB 5BN3A 2GVDC 3IHWA 4M1MA 3LD9A 1KI8A 4AURA 2IK8A 3QKSA 3VR2A 4DDUA 3NXSA 2VF7A 2JA1A 3EXAA 1RRPA 3DPUA 3TQCA 2IWRA 3EZ2A 1FFHA 3KX2A 3W6OA 2GJ9A 4DBLC 2A7QA 4NPHA 1OLOA 4JLVA 3TR5A 1DADA 2QTHA 4IDOA 1H8HA 4V0ME 3MGCA 4A8JB 3BFVA 3PUXA 1P60A 2YOHA 4L9SA 4LHZA 3LAWA 4TYPA 4DC9A 4DLVA 1OYWA 3B8HA 2ZJ2A 4YMVA 3DOEA 2J59A 2O0HA 1Z8FA 3CH5A 2RGNC 2X1VA 1E2LA 5DNYB 1XZPA 2DHRA 5KDLA 1Z6TA 1KMQA 2DFLA 1VYUA 2GESA 4QGHA 4Y0AA 3FMFA 1QHIA 3NKVA 3AH8A 4JVSB 5IF9A 3TUIC 3THWB 2VHQA 2WKRA 1NVVQ 1Z6XA 5JS7A 1G8YA 1KO8A 1QVRA 4R2IA 5SZIA 4Q1AA 1J8YF 2V55B 4RD4A 1I4TD 2QT0A 1W36C 3AVXA 5A5GA 5CYPA 4CF7A 3GLGE 4QJ5A 2X2EA 2VSXA 5TARA 2VP9A 3KQHA 1KO1A 5EP1A 1VCMA 2QAGC 4E07A 3M0EA 3AEZA 2HXYA 1T91A 2C78A 2F7SA 4Q9KA 4LOAA 4GZMA 2Q9AA 2WOOA 1MH1A 1NF3A 5JHHB 2ODWA 2GVZC 1NBMA 3WY9A 1UAAA 2WSMA 1G5RA 1U8ZA 4FIDA 2V9PA 4HAYA 2GBLC 5D3MB 1FQKA 3P4YA 1NBMD 3DKPA 2QENA 1WE2A 1XRJA 5B64A 3UXMA 1IJFA 2V3CC 1HYQA 4WOPA 1DELA 1Q3TA 4P33A 3QBTA 2J41A 4LV6A 4YC7A 1LVGA 2H57A 1PZNA 2ZJOA 3BRWD 4TYNA 2XB2A 1SVOA 1ETUA 1UKEA 2P0EA 3WHLA 4HB2A 4OQXA 2ZYVX 4I81A 5JEDA 2RGCA 4KJZA 4TQUS 3R9XA 3ZZUA 3Q9LA 1OXTA 2TMKA 5AUNB 3ADBA 3SR0A 3F5FA 2ZI5A 1U94A 1NI3A 1CIPA 2C99A 1QRAA 2QU8A 1ZW6A 2ZSBA 4MGYR 5CM9C 3O8BA 5SZJA 2R62A 1IXRC 3ASZA 2AD1A 4F4JA 1XXHB 2BHRA 2IUUA 1KJZA 4XWAA 3THXA 4KODA 5TXGA 3RS5A 4M22A 2V8OA 1XD2B 3GP8A 3LDAA 4JBYA 3MRSA 3QXXA 3OE7D 4L5BA 1JEEA 1GKIA 2D4HA 2QPTA 4OHVA 1CJUC 2O8FB 3GPLA 3A1SA 3LLUA 1CEEA 421PA 2GJSA 3IEVA 4CIDA 2GEDA 1W2GA 2ZUBA 4KBFA 3AKEA 4DEXA 3NBFA 3BB3A 5KPDA 3X1YA 3GJ7A 1G3QA 4R98A 1H8HD 3QG1A 4U7DA 4A8JC 2Q3MA 1KHTA 1NY5A 3BS4A 4DLWA 2VHCA 4TLCA 1F2TA 2J46A 1F2UB 1VCNA 4NU0A 2W6ID 2VSFA 4UNPA 3SBDA 4TLAA 4B3BA 1OH8A 2J7PA 4DVGA 4M4SA 4DCUA 3AB3A 1GOTA 4Q9IA 2DFNA 2ZJ5A 2JLVA 5FOSA 1P73A 1QHNA 4OK3A 3BXZA 1LS1A 2ZS7A 4ACAA 3R9WA 2JDIA 1U0JA 3GLGA 1AA9A 1ZM9A 1RC8A 3EARA 3L8ZA 1M7GA 1QHHA 2GRJA 3ADCA 3BORA 3OEED 1BYIA 4K81B 1N5LA 4M0LA 3T1VA 3CX6A 1KY2A 1QHYA 2B7BA 3PCRB 2WIBA 4DUGD 2GDJA 2XTZA 3BB4A 3I4LA 4MYUA 4ON9A 3VNUA 2DFKB 1RRGA 3RHFA 2HF8A 2XX3A 1SKYE 1W49A 3DEFA 1KI1A 3LVRE 1IBRA 1VYTA 4HLCA 3WRYC 1F60A 1OPXA 4ABYA 3ZVRA 4TN1A 1NSFA 5EE3A 1GRQA 2O0KA 3QENA 3PITA 3U61B 1DAGA 3B5JA 4ZCIA 5K8IA 4Q7MB 3X1XA 5IT5A 5KNBA 2VHJA 4JLDA 5CLQA 3EPHA 4II7A 1CR2A 4XTCS 1CP2A 4Q4AA 4DRZA 4DSUA 2D7DA 2QBYA 1X1SA 5J4HA 3JVUA 1UBCA 4LDJA 1XNJA 1DPFA 2ZRHA 4QJ4A 3VFDA 4URWR 1KDTA 4Q66C 5G40A 3VU9A 2VP2A 2A3RA 4A9AA 5L3QA 2WWHA 5H8WA 4GPTA 1L4YA 1KIMA 1G16A 4X8OA 3GLHA 1AN0A 1BMFD 2EFCB 5FL3A 5HZHA 4UNQA 1J70A 2XSZA 821PA 3B13B 1G41A 3OIYA 4FMCB 4IFBA 1WA5A 1ONBA 4A6PA 4TYQA 4MRSA 4Q9HA 3GMTA 5FOXA 2HJVA 3ZLJA 2AXNA 4OBEA 4R7ZA 1ZYUA 4C4PA 4BQSA 3A4NA 4GNKA 4LPSA 2UZ3A 2BM0A 3GJ3A 3MWJA 4I1VA 1M74A 2RHMA 1KK0A 3W5JA 5HTKA 3CLVA 3RVBA 3DHWC 1OYYA 1MKYA 3B1XA 3I32A 1QHSA 4A0HA 3KQKA 4IVQA 5L3SB 2BJWA 2QMUA 2ORVA 1HA3A 4PO9A 1RE0A 1H8ED 1OB2A 1FZQA 2QG6A 1Z0AA 3EPLA 1OXVA 4MGIR 2IEYA 3R7WA 1DE0A 1HE1C 3NWJA 1E2EA 3O47A 4MYHA 1RRCA 1ZIOA 3CRQA 3A6PC 1CU1A 3U3JA 1QG4A 1OKKA 2X2FA 5JI3E 4JLBA 1SXJC 3SZRA 3TW4A 2VP4A 1NLYA 2NO9A 4HAXA 4OQMA 3TVDA 2XZLA 4EFNA 2ZSEA 4M1TA 5DHFA 4BLPA 4DXAA 2FFAA 1F2UA 4GOJA 4KU4A 3ZS9A 3MWYW 2ZRJA 3CNLA 2ZE8A 2ZI7A 3ECCA 2BCGY 3AF2A 3K0AA 2ZRNA 2BOVA 2BVNA 1XD8A 2GCPA 1CR0A 2PMDA 4B3FX 2ASEA 4HLDA 1DBSA 3E1SA 4JJKA 2D74A 3V4RA 4WXPA 1SVWA 1KGDA 2EWWA 1XP8A 2YWHA 4M1SA 2C03A 1CULC 1RJ9B 5FR2A 4O2RA 4F93B 2B8WA 3SOPA 2ZVPX 3GD7A 4EPXA 1PLJA 2J45A 4KVGA 2NO0A 1CF4A 1NP6A 3QVVA 4UXIA 2KE5A 4N0DA 5AJXA 4Z8YA 2NTYC 3IKJA 1OB5A 1VG1A 2MSDB 3D31A 5TY0A 1IN5A 1ODFA 4L9WA 2AHOA 1JALA 3OFND 4QJ3A 2OCBA 3SJAA 4QHYA 4DCTA 1P3JA 2OAQ1 4KFUA 2FNAA 5FFMA 2OBNA 3LBHA 2BKUA 2WIAA 1TADA 2HJGA 4NBSA 1W1WA 3HYTA 3UATA 1G7SA 1XEWY 2ZU0C 4MKIA 4JKYA 4C0JA 4Q48A 1ZM4A 1VPLA 2PEYA 4QL3A 2GCOA 5C2JB 3NEYA 1SXJD 2J0UB 2A5FA 4X8HA 1UADA 2QY9A 2CCGA 3K09C 1TF5A 2JEOA 3MWLA 2R6DA 4BFWA 2P5SA 4BFVA 4G5SA 1U9IA 4LBYA 1MR3F 1KI9A 5E7JA 4EFLA 4HAWA 2O8CA 4BLTA 1A2KC 4LZZA 4B75A 1A7JA 1D5CA 1GVNB 1LV7A 2ZYTX 3V00A 2W2XA 4US2R 1OFHA 2GF0A 4TWZA 4KHZA 3BBPA 5L3SA 5KHOC 2DWPA 2ZITA 3QF7A 4GMXA 2QT1A 1CRPA 2OLKA 2R65A 2FSHA 4MRVA 2CL7X 1NVXQ 1N25A 4XH9B 1KTVA 5A4JA 1QHXA 1G291 2GZHA 2W2TA 2QORA 3S1AA 3X1WA 4D4JA 2NIPA 1N0VC 1YZKA 2GXSA 4OJQA 2QZ4A 1FX0A 4OK5A 4B6EA 5EZ5A 5L3RA 5GADl 4EPVA 2XOKD 2ZR9A 1KI7A 2ZI4A 4CEJB 2OUKA 4JBWA 2FGJA 4JYBA 2LKDA 4LV8B 4LHYA 3UIEA 1GILA 3K9NA 1Z5ZA 3HR8A 5AJZA 1P5ZB 1ZMXA 2PMKA 2OILA 3TUJC 3THWA 1VHTA 3PV0A 2G77B 2VQSA 3A1VA 2XZOA 1RFLA 4NZYA 5E7MA 1OHHD 2YV5A 4TSFA 3LVQE 1W36D 4TTPA 4C0KA 1GL6A 1GKYA 4OQNA 4HUQA 4EPWA 1Q21A 4TLEA 5AR1A 2RMKA 2DY1A 1V5WA 2H1LA 3CBQA 1II8B 2MSCB 1E2PA 1UBFA 4E5UA 3T15A 2ZAMA 3SHFA 2D7CA 3HYRA 1IOZA 2DWOA 5DI3A 5LB2A 2BBSA 4B76A 3UG7A 3JZAA 4CGZA 1P4SA 3CM0A 5F3WB 2AX4A 1CXZA 4CEHB 4LYFA 4KSCA 5FBRB 3P1JA 4G5RA 4HZIA 1XEXA 2IYRA 1OSNA 2YC4C 4NMMA 1KZ7B 3QE0A 2FSFA 1OXXK 4LSGA 2NG1A 1SVIA 5AJYA 1U8AA 5FUVA 1H65A 3IEUA 3MSXA 1IN7A 1XMSA 3ZZ0A 2I1QA 2P65A 1ESNA 2O8DB 5FOVA 1U0HC 1FMJA 1C1YA 1QF9A 1J99A 2ATVA 3PG5A 2GETA 1S3GA 1UDWA 1KI4A 3T1TA 2JLRA 1T6NA 2BMDA 3ONWA 1JR3E 1E2HA 3UANA 1JJVA 1AKEA 1LY1A 3IIMA 2ANCA 3FB4A 4TMTA 2Z4RA 3O8RA 2UZIR 4TLBA 1G3MA 1E0AA 3J81k 4JL8A 2KJQA 1HE8B 1NJFA 2IWHA 2GZAA 2UKDA 3HWSA 3PVSA 1WBDA 1Q0UA 5K8TA 1P61B 2IYQA 4GZLA 4AD8A 3GJ8A 4JLJA 3RWOA 2DCUA 4AI6A 5EZ6B 3DMDA 3CWQA 5BW8A 2BC9A 2GCOB 2HUPA 1CR1A 3NBXX 1VDZA 1OH6A 4BGDA 4M1OA 2XXAA 3LLMA 5JMTA 4E22A 2IYZA 2F55A 3EPKA 3W8NA 3CPJB 4KLZA 4IJMA 5DLQC 3ZD6A 2OHFA 1JI0A 5HR5A 1YRBA 2ZETA 3AVQA 521PA 1G6OA 1HY3A 2CVHA 4FWTA 1PLLA 1LW7A 4UQOA 3AQ4A 1WCV1 3QPWA 4PQFA 1U8YA 2ZRPA 4AKEA 1G9XA 3SEAA 4CEJA 1AS3A 1W7AA 2BWJA 1TL7C 1W36B 1E2IA 1FMLA 2JJ1A 2A9KA 3GEHA 4DLYA 1N0UA 5G41A 1Q1QA 1KOFA 1TU3A 1ZIPA 2DR3A 4V0KA 1W2HA 5E3HA 1JQLB 2OM2A 4BEJA 1E98A 2ATXA 2DBYA 2QI9C 5B58C 3ZVMA 2O8EA 5SZKB 4MA4A 2WJIA 2NO6A 3V4FA 1BH2A 1XMVA 2XNDD 1HH4A 4PC7A 4ASUD 4RCYA 2OXCA 3GLFE 3KJGA 1A5TA 2RB4A 2XSZD 4GMDA 3KXIA 4QNRA 2I3BA 4QGGA 2E1RA 1XEFA 1M8PA 3QPVA 4FCTA 1A1VA 2EW1A 1X6VA 3MG9A 2GXQA 1X8KA 2WPDA 1R2QA 2KI5A 4P3YA 4TSFD 1AGPA 1IN8A 2F1JA 2WWYA 2YOGA 4CEIB 2OZEA 1DVRA 2FFQA 4KO8A 5L3VA 3AGQA 3VHLB 4B35A 5CDFE 1TNDA 5KSOA 1KKMA 3KKMA 3OIVA 1E94E 3IO5A 3U3OA 4YMUA 3G5UA 1ANKA 5DE3A 3VNVA 3QKRB 4RJLA 4U02A 3K8YA 5FUXA 2H5EA 3SFZA 4AKHA 4A2WA 1G7RA 2QRZA 5JI2E 3B2EA 4Q4HB 4HZUA 4OK6A 2PLRA 2AFHE 5LD2B 3QXSA 2WAXA 2AD5A 3B1WA 2W58A 1OFTA 2F6RA 4QRHA 3L43A 3KL4A 4PAMA 1E9AA 5D3QA 1VG9B 3ADKA 3UMSA 2LKCA 4HLUC 4DUGA 2A5JA 1E32A 3NHAA 4LJ7A 4NCNA 3ZDQA 4QM7A 1G19A 1K5DA 4TL8A 1Z83A 2QROA 1XJQA 5K8LA 4EFMA 1AIPA 1E1QD 1Q3HA 4PPQA 3GFPA 2J87A 3QIAA 4KVAA 1IQPA 2FN4A 3SS8A 4B73A 3THYB 3N70A 2G0TA 5L8VA 2ZJ8A 1YRAA 4C0SA 3RC8A 6Q21A 4DZZA 5JJLA 3IDQA 2BDTA 4A0RA 4DCNA 1XX6A 1M7HA 3MFYA 2N46A 1Z47A 3EPJA 1WBBA 2XGJA 4LYAA 4UNRA 4WZBE 1XEWX 3RS2A 2IC5A 3U4QB 1S9DA 3NC0C 3BB1A 4BE7B 1VKJA 1CTQA 3U6KA 5FPSA 4ZDKA 1OFIA 2E87A 3KKPA 3LBNA 5TVKA 3E2IA 4EJSC 3TMKA 3PFIA 2EYUA 4ZKDA 3O8DA 2GK7A 2ZI9A 2IL1A 2X77A 3QBVA 4HLUA 1UBEA 4YONB 4B3CA 3RABA 2ZI6A 2WMNB 2CCJA 1L8QA 3B78A 2FEMA 3MUFA 1VMAA 3GLIB 1XDBA 4D6PA 4PX9A 3L0IB 2VRWA 1YZUA 4WXRA 3FKSA 4C30A 2HXSA 3U7EB 4XD7D 2OFXA 3F3YA 1K8RA 1ZNYA 1AM4D 2IW3A 1XPRA 1KJWA 1YR6A 4L15A 3RS7A 1QHHB 1EFRD 5JJKA 1BS1A 1NJGA 4F92B 1TQ6A 2RGBA 3CH4B 3QPUA 4JLAA 2ZXUA 3RLFA 2OLJA 1ZAKA 1ZUIA 4YQFA 3SYLA 2YKGA 1N3BA 2WKQA 4DLUA 2XJ4A 2G1JA 1PUIA 3R20A 1E99A 3RSLA 3AKDA 3AGPA 2VTKA 3VR4A 4B3XA 5KYKA 1W4AA 4DEYA 5JWHA 4HATA 4B3GA 2ZE7A 1HURA 1HTWA 3TJZA 3I3SR 3PENA 3RRYA 4OI0A 4LC1A 1MT0A 3U7GA 4XIGS 2PZEA 1R5OA 4P31A 2YJTD 2WWIA 3OIUA 1OIVA 1CLUA 2V1UA 5CDFA 1XTJA 2QPOA 3C16C 3N5CA 4G5OA 3QKTA 3VU9B 4GRAA 1UF9A 3RANA 3NVAA 2HT1A 2D62A 5FPTA 1JPJA 2GKSA 4XD7A 5BN5A 5JSZA 4U00A 5IK2D 5KSZA 1KSJA 2ZSDA 2Q3FA 3RYTC 1JNYA 1XXHE 4URYR 4XSGA 1Z06A 4J0QA 2WV9A 3KKNA 2CBZA 5JRZA 2VP5A 2NMVA 3D6TB 3KKOA 2Q3HA 4BFSA 1S3SA 2WVJA 2PZGA 2OFOA 1FOEB 2QE7D 2ZRAA 3L0OA 3ND9A 2ERXA 2I4IA 3TSOA 3ZQJA 3KXKA 5FTKA 1NBME 2HYIC 5TDHA 4HZUB 1F3OA 5EXSA 2ZPTX 1Q57A 1E0SA 2CE7A 4Z8XA 2RKOA 2JLZA 2C77A 3IUYA 3Q72A 3CO5A 4PHHA 4HLQB 4DT1B 3SJCA 1IAQA 4PANA 3I1FA 3TW8B 2YWEA 4JLPA 1D8TA 1GRNA 4C2TA 4HAVA 2F9LA 2WJYA 2R44A 4FD2A 4W9MC 2PJRA 3EWAA 1D9XA 1G7TA 1KO7A 3ZIAA 2OO7A 2GK6A 1NL3A 4GSYA 5H68A 4CDGA 3FFAA 4O25A 2R6GA 2VF8A 3B9PA 3UPUA 4KLNA 1TEVA 5FL7D 4MDFA 4LGMA 2R6FA 3FMOB 1Z0DA 4OI2A 3AVPA 5GVRA 4CZ2A 2J0UA 2XITA 3RRZA 4OHYA 2AKYA 4QBGB 2DPXA 1S0UA 4UNNA 2IF2A 1IN4A 5LD2C 2OG2A 2AWNA 1L4UA 2ZJAA 4IEIA 4V0MA 4RD6A 1DAMA 1IONA 2QQ0A 3MMPA 1C9KA 1G6HA 2BEJA 1E0KA 3TQFA 1WXQA 4MRRA 1T8UA 5J5CA 4QKQA 1E9BA 3VKHA 4FW9A 5G3YA 2XXAB 4KAXA 4BLSA 3I8SA 5AUOB 1II0A 1MO4A 1YE8A 1YZQA 1Q1ZA 2WPDD 4HB0A 3QXCA 2EFEB 1UEJA 2AFIE 1Z08A 1MRSA 4HAZA 2REBA 2ZREA 4A2QA 2QP4A 5KSPA 5JWRA 5LDDC 5DYIA 3IPYA 4FCVA 3C41J 2WSSD 3C5HA 2KB0A 2J0QA 3WYGA 4I4LA 5HPYB 3IQWA 3Q7QA 3AP1A 3CZQA 3U2QA 1S96A 2Q9BA 1GUAA 3KXLA 1Z0FA 3EZ6A 5M04A 4B2LA 1ZC3A 4LC0A 4TL9A 1XFAA 1Q22A 4KV9A 4AG6A 1CJKC 2A5DA 4IDQA 4LPKA 4PPFA 1BIFA 2O0JA 2ZRDA 1RW4A 1DO2A 4Y0VA 4A15A 1N6IA 2W6IA 3PEUA 4LJ5A 2FF7A 4RD2A 4KFRA 4KBGA 3TAUA 2ZRFA 3DKVA 2GNOA 4CT4B 1N6KA 3O8CA 2H7VA 2O8BA 2O52A 2NZ8A 3DZ8A 1S8FA 2FPKA 2FWRA 1IXZA 3X1DA 4O2LA 1VCIA 3WHKA 2HT6A 4I1OA 2OCPA 1WRBA 3LW7A 3EWSA 3UK6A 5C18A 3BD9A 4G3XA 2O8BB 5AWFC 1G21E 4H1UA 5TMPA 2CK3A 4DLXA 3QNUA 4F4IA 4XWOA 2ZUCA 4HEJA 1RPZA 3FFBA 3C7KA 2CLSA 4Q4HA 2IS1A 3GQBA 3SBEA 2HF9A 1E69A 1NG1A 1XB2A 1EXMA 1JR3D 1ZD9A 4HUQB 4Q1BA 3M1IA 4US1R 2DWQA 3AF3A 3EZFA 1M6NA 4NYIQ 1A4RA 1U9IC 4B2PA 621PA 1DAKA 3EASA 3KB2A 4NP6A 3WMGA 1COWA 4BFTA 4DHEA 4FN5A 2JAQA 4R2HA 2O8CB 3K70D 1Y3AA 3I5YA 4L8GA 2C9OA 1FP6A 3AP3A 1MV5A 4LJ6A 1KDPA 2NOAA 1KDRA 3DZDA 1GL9B 3K0CC 2FU5C 1JQJC 1K6MA 1P6XA 1D9ZA 5CM8B 3UWKA 1EK0A 1FL9A 2GJAA 1EFTA 3I92A 4JLNA 4Q5IA 4TL6A 3VR3A 2H92A 1GNRA 4DLRA 4H1VA 2J0SA 4MYTA 1EGAA 1NY6A 2GAOA 2JLUA 2IS4A 5KTYA 3GJ0A 2BMFA 1SVKA 3Q3JB 3C15C 2CLCX 4N3NA 4M9SA 4AYWA 2MSEB 2RCNA 3RNLA 3MCAA 3QUSA 1R0XA 4JBXA 3QKSB 2P5TB 2C96A 2CVFA 2FG5A 4JZKA 3Q5EA 1QDEA 2NPIA 1CR4A 1ZUHA 3A58B 4RKFA 1XU4A 4XJXA 4D4MA 4JMPA 1FPMA 2QUZA 5EP2A 4EPYA 3U44B 2FSIA 2WAYA 4C2UA 4QBHA 3EX7C 5TB5A 4F7WA 3OIWA 1KI3A 1T3SA 1NMZA 2WWFA 4RY2A 4P32A 1KI6B 1P2TA 5ANRB 1E2FA 1G5TA 2R6CA 1EX6A 1NN3A 2IXGA 3B1YA 4NYMR 3FHTA 4AG5A 3L82B 2GJ8A 2QM8A 3RS4A 4N0EA 4AIIA 1V43A 1E1QA 2QQEA 4XTRA 3GLGB 5EXTA 2GTPA 1ZVQA 3R8CA 4OKSA 1U81A 4G5QA 2V4ZA 3U3RA 1W44A 5JRJA 1HQYE 1TUEA 2QM7A 4MKHA 4N1AA 4B34A 1Z0KA 2C5LA 2QEQA 4DB4A 1T8TA 4ACBA 3U6BA 2Z0MA 1KMHA 2PL3A 5F98A 1VG0B 4GOKA 1R0YA 1TUIA 1WDTA 1QBKC 3GCGA 3LQRA 3LNCA 4KSBA 4RFSB 5EXPA 3A37A 3DMNA 3MAAC 5C4MA 4NE2A 4EUNA 1T0JB 3PR1A 3TLXA 2GA8A 3S1AB 221PA 2XTMA 2VEDA 4NL4H 4WVFA 3CKLA 5D3MA 1X86B 2F43B 2GILA 4C0AC 3F0TA 4U5XA 3FMPB 2JJ2A 1MO6A 3OESA 2X19A 3U7FB 2FFBA 2D2FA 2AR7A 3CRW1 4C0HA 1RYFA 1E9DA 1C4OA 4I1UA 1PV4A 1JAHA 2CEAA 4ESVA 5FBWB 1OJLA 3BC1A 4M9XA 4HUTA 1XF9A 1H8EA 2EFHB 3BH0A 3ZZTA 1ZM3A 2EFDB 4PC3A 2VP0A 3GLHE 2A30A 3WRXC 1DG1G 4ASUA 1Z6AA 4Q4JA 4RVCA 2WMOB 4RFSA 2C95A 1KAOA 2AKAB 2QPAA 2JLSA 2F3TA 4RD0A 4POAA 4PC6A 3T34A 2FZ4A 2B7CA 1LNZA 1YZLA 3SNHA 3VMFA 1D6JA 2ZE6A 1XWIA 2QL6A 721PA 4B2IA 1ZU5A 4QGAA 3AVYA 5IDVA 2AK3A 5UKDA 1N5KA 4MGKR 1Z0JA 4BUJA 4PTLA 1BMFA 4LV5B 4IOLA 2O8DA 1N6PA 3IO3A 1P2SA 1YR7A 3QI2A 5P21A 4US0R 3MWKA 4Q1FA 3R7WB 4G0NA 4Q47A 3AKYA 5JZVA 4M1YA 2GF9A 1EESA 1UJ2A 2QMOA 3PUVA 3NDBB 1I2MA 2FJUA 4B47A 2FGKA 4RD3A 4LJYA 1XBTA 4Q1EA 1IY0A 1TX4B 4TMXA 2RGEA 1NMYA 1W0KD 2FE4A 3PEWA 2VHUA 1OXUA 3SI7A 3CF2A 1DG3A 2QN6A 3DM5A 4FMBB 4MH0R 1ZM2A 1A2BA 4B48A 1PLKA 4Q00A 1P2VA 1Z29A 4LHXA 3GJ6A 3M6AA 4WZAE 5FI0B 4AKIA 2H8KA 2PEZA 4MUAA 4Z1MD 2IYLD 1FUKA 4D4KA 4MKFA 1T0HB 2VPPA 1ZU4A 4YXWD 1HV8A 2CJWA 3LQQA 3P4XA 1E9FA 2PLFA 4EAQA 1P9RA 4BFXA 2ZRKA 3A4LA 4IEEA 3T5GA 3H4MA 1FQJA 4IDNA 3W6NA 4A8JA 4C7OB 1M7BA 3KFVA 1R7RA 2OCAA 4BRUA 1GAJA 2WJGA 1T9HA 5HZKA 121PA 1XTRA 3BK7A 3NH9A 1FX0B 5JLJA 1FW6A 2G6BA 2Y8EA 2JLYA 3D8BA 2N42A 2CE2X 4XOIA 4O0MA 3AP2A 1P2UA 1FTSA 3GJ4A 1JECA 1P72A 2CHGA 3T35A 2G83A 3TR0A 1FP7A 3KQNA 3FDIA 4EIWA 1TQ4A 4BFUA 4Q1DA 3ZYCA 1E1RA 4Q4AB 3OFNA 2EVWX 2KBEA 2FV8A 3CRMA 1LF0A 3UMFA 3HPRA 2C04A 1HUQA 2BIFA 1M34E 5DIFA 2CXXA 4DJTA 4A4DA 2XEXA 1ZINA 1JR3A 1EWRA 4D4LA 1R8QA 1VECA 2B8TA 4BWYA 1ZP6A 2GEVA 4TMVA 3VQTA 4NYMQ 3K1JA 4Q9LA 4URXR 4GOXA 1XCMA 3LXXA 5HE9A 3KTAB 3BGWA 3K0AB 2VO1A 4M1WA 2QRNA 1YR9A 2CNWA 4RZ2A 3GEEA 3ZVNA 3NG1A 1COWD 5JWOA 1X1RA 4NCKA 3VAAA 2AL7A 4PQYA 2IYTA 1E2DA 1GNQA 4A0GA 3M4YA 1D2NA 3CPHA 4Q21A 2FH5B 3KQLA 3TVTA 3U7HB 4W5WA 3VR6A 4Q4LA 2N1BA 2HLDD 1RRFA 1WQ1R 2XNSA 5CIQA 2IUSA 3CB4A 1GL7A 4DSTA 2RGGA 3I8XA 3BWDD 3TSWA 2PCJA 2P67A 4HYYA 3SYKA 2VSOA 1LB1B 3ZH9B 3ASYA 3IIJA 3OEEA 2ORWA 2DYKA 2KWIA 4RKEA 1VG8A 1JXOA 3AKCA 3CR7A 3FE2A 5JCPA 4A36A 3QQ5A 4YMTA 2ZYWX 3PEYA 1VTKA 4BLQA 2ZRLA 2B92A 2QGZA 5GJVC 3VX4A 3K0SA 1EWQA 3TGPA 4X8MA 4FMDF 1BOFA 3TE6A 2KBFA 3R9IA 1J90A 1IN6A 1ZD1A 1G1MA 4Q9JA 4DDWA 2J5XA 3QEOA 5HCIA 1TMKA 3FOZA 1HQCA 4LJ9A 4IDPA 1UKYA 3OZXA 2YNMA 3A4MA 2WWXA 4NYIR 5IRCD 3U60B 2PZFA 5FI1B 3CW2A 5H1YA 1VHLA 2P6UA 5H70A 2ZYUX 1O3YA 4IVPA 5DO9A 3T5DA 4A2PA 1SQ5A 5FPKA 1WF3A 1OIXA 4UNSA 4DKXA 1XTQA 2PH1A 5JHGB 1KO5A 5KDOA 1E9RA 4NDZA 4OHZA 1G64A 2WBLC 4BLOA 3GLFA 4PZZA 4LY6A 2ZRIA 1YHNA 3KUDA 3KQUA 3REFA 1T5IA 2BJVA 3VKGA 2MMCA 3BOSA 1KI6A 2YHSA 2WJJA 2ODBA 2VIIA 1U0LA 3GJ5A 4HDOB 4PXAA 1Z6GA 4A92A 5KSYA 2K5UA 1TAGA 1RJ9A 3GLIA 1NLFA 1VCOA 4IXNA 4PSVA 4C0QC 2FZLA 4NYJR 2P3SA 3VX3A 1I2DA 4DLTA 4TQ9A 3K9GA 5L3QB 1CJMA 2AWOA 1AKYA 5EE9A 4K46A 2CLDX 2OE2A 5FBQB 4JS0A 4TYYA 5C4GB 2YC2C 4QOSA 2JJ8A 2AN9A 1N5JA 2GBLA 3GEIA 1OKKD 1N6LA 1KK3A 2WOJA 3P26A 4JKIA 1U99A 2HV8A 4G5GA 5FL7A 5HKKD 1S4QA 4YDHB 3RRNA 3T06B 1VIYA 1YJ5A 3CRRA 3AVOA 3EC2A 2HLDA 5GJWC 1XMIA 3QY0A 3Q5DA 4B74A 1XPOA 3RC3A 1CBUA 1JAIA 4PSKA 2QBYB 2Z6VA 3HP1A 4GI7A 5LPNA 1KZGB 1P75A 1I4DD 2R8RA 2Q21A 5J47A 1LS6A 3KKQA 1UPTA 1CJVC 2HCJB 1XTKA 2C8VA 4HSEA 1S9HA 2RHDA 4MUBA 2WZQA 4UJ5A 4DCSA 5CB8A 5KU1A 1CKEA 4NYJQ 1NN1A 5EXXA 2QAGB 4ZPXA 4DIDA 2OESA 1G20E 1SKYB 2OFWA 4PR0A 4BECA 2IXEA 4PHGA 3N2IA 3B1ZA 3REGA 4JIMA 1IJEA 1LF5A 3E5HA 3TAHA 1G3IA 2PBRA 4URZR 3GLFB 4YMWA 3F8TA 1DAIA 2RGAA 3L0SA 4M8NE 2QP9X 1TF2A 2RAPA 4A82A 3K9HA 3W34A 1G3RA 2XB4A 3ICEA 4LWZA 4Q02A 1N5IA 4PO8A 2ZRCA 1R10A 2W6JD 4LBZA 3QG5A 3P20A 4IOKA 1AGRA 3WYAA 3BAFA 1VIAA 5A0FA 4D25A 4BLRA 3GLHB 2JIZD 4ZKEA 3TSZA 4OHWA 4MDEA 2R9VA 4CYMA 5KOYA 2W6JA 1J7KA 1NLZA 1P7CA 2YYZA 3C8UA 2CL0X 3G0HA 2A5GA 5LB4A 5F9FA 3MJRA 3B60A 2FX3A 4IFEA 5DN6D 1IM2A 3I72A 1U90A 4JLMA 4P4UA 2QGNA 4IOMA 2GEUA 1ZD8A 5LBIA 4D82A 2C2HA 3TIFA 1E2GA 1KK2A 2JLWA 1SULA 1N6RA 2A5YB 2GZDA 2PJZA 4ITRC 5J4LA 1GNPA 5EE0A 1XTIA 3RRMA 4AYXA 2V6JA 1D2EA 4EPTA 3L2OB 5JJIA 1ZUNB 4W5HA 4B33A 1GRRA 1E2NA 2ZJYA 5ELXA 4CW7A 3AF0A 2WJVA 4KYUA 1AS2A 3PUZA 1KSHA 5C1BA 4TMKA 3CF0A 1KJYA 3GJXC 3DL0A 4UXHA 1L2TA 2WKPA 3LY5A 1ESMA 3PEVA 1SHZA 3NTUA 2BEKA 5G53C 1IHUA 2F43A 2YWGA 4Q18A 4V0NA 1LTQA 5KUTA 3BERA 2J0VA 1R4AA 3FMIA 4A1FA 2W00A 3TUZC 4XVQA 2AK2A 1TU4A 1G8GA 3VKWA 5HKKA 2IYUA 2O8FA 4V02A 1YKSA 2W2VA 2ZSAA 4PO1A 4PPNA 2GWHA 1E9EA 3T61A 2ZM5A 2NGRA 1ZNXA 3SHWA 2IYWA 1LFDB 3GLIE 5KPJA 4KFSA 4PZLA 4BRWA 3WMFA 2IYYA 3VR1A 1W4RA 2YZ2A 1OIWA 2ZR7A 1OF1A 5GJCA 2G9NA 2ANBA 4D0GA 4R9UC 3ETLA 2PCLA 3PUWA 3CX7A 3AVWA 4TZ6A 3EW9A 5J4KA 1HEIA 4TT3A 1RKBA 3LXRA 1GIAA 4GL2A 1XMJA 4DB2A 3SDZA 2B6HA 3W90A 4IOJA 4D80A 1DAEA 1ELOA 4ZV4A 2D06A 5F2EA 3DVLA 2BMEA 4ARZA 3GFOA 3I61A 5EE5B 2VA8A 1NN5A 2X8AA 1UFQA 3OF5A 1YU9A 4P4SA 3HPQA 4TMZA 1IY1A 1AZTA 1E79D 5FTNA 4B3DA 4WBSA 5AK0A 3ZIAD 1GG2A 1NSTA 1Q20A 4DCVA 2HEIA 2P2LA 2J1LA 1TTTA 4CEHA 1XTSA 3QOFA 1E2KA 1E9SA 1Z28A 1Z2AA 2F1RA 1Z63A 4LI0A 4Q19A 2IYSA 4QNMA 2EYQA 4Q01A 3U5ZB 5AJVB 1II8A 2IT1A 2P6RA 1JJ7A 1NVUQ 2Q0HA 3BFKA 4MKGA 3U4QA 4B6FA 3SJZA 4LUCA 5KO2A 1XJCA 2D3WA 1P62B 2E9SA 2G0NA 2QE7A 2XZPA 3KZ1E 4EKDA 3I5XA 1SXJA 5KDDA 1XD9A 4LX0A 3TK1A 3KUCA 1DAHA 5BN4A 4OYHA 4P4TA 1OXSC 1UM8A 5AUPB 3THYA 2FDCA 3W3ZB 1AQYA 3LX8A 4TTQA 2OBLA 2H17A 4AY2A 2G88A 3QEJA 4QHTA 3FYHA 4MRNA 1QHGA 3QKUA 4GT1A 4NONA 2GXAA 3BIFA 2YOFA 2Z5FA 4Q1CA 2BBWA 1KNXA 3B9QA 4RZUA 1Q1EA 2NO1A 3HJNA 3WP1B 1U98A 3EIEA 1GM5A 3ADDA 4R71A 5FBVB 3CF6R 1G8PA 3PQCA 1KO4A 4BASA 3CPEA 4HDQB 1KSFX 1XZQA 4LJ4A 3QKRA 1DO0A 1R8SA 2J7KA 1K5GA 4M9QA 1T3HA 4AWXA 4Z51A 1BYUA 2YWFA 2VP6A 4G01B 4AYTA 1Q44A 1N2CE 1I4LD 2GXUA 1ZNZA 5CK4A 1PUJA 2FPLA 2ZS9A 3Q7PA 3H0KA 4RSGA 3LW8A 2MMGA 5AJWA 2FEOA 5FPYA 4PAQA 1GTVA 1Z2CA 2PX0A 4MITA 4PAOA 1GWNA 5IK2A 2ECKA 2HDNB 5E95A 4XVUA 4MYCA 4RD1A 3W3AA 3LFUA 5DI3B 3LO5A 5JEEA 1E4YA 1TEXA 3AVVA 5EE1A 2GJKA 2PT5A 1F2TB 2NZJA 2QSZA 4LJ8A 3U3MA 5J4VA 2JATA 3NH6A 3QXHA 1N6HA 1Z0IA 2KSQA 3WYFA 2CL6X 5BYKA 1E1RD 1X8JA 3I73A 4V03A 1NNEA 4PC2A 4RFVA 2IX3A 1YZGA 3HU2A 4OHXA 1Q12A 1HT2E 3ZJYA 1F6BA 3ND8A 2V7QD 1W0JD 3X1ZA 1GFIA 2WM9B 4HAUA 1Z6YA 3CNOA 4DSOA 5KNDA 2IF0A 4GFDA 1SVMA 1TQDA 2QSYA 3HU1A 4ZI3A 2ZRBA 5CITA 3EG5A 2GHIA 5FUYA 5FTLA
chains in the Genus database with same CATH superfamily
4E09A 2E2WA 2GF2A 3MK31 5CJ2A 3DNPA 4KVFA 4AMBA 3SJUA 1OW3B 1W0CA 5JR3A 4WNAB 1MX5A 4JC0A 1C8KA 5J43A 2B1GA 2ODEA 3ONVA 2Q3EA 1QYCA 4PZ9A 1RQRA 5JDCC 4DBZA 3B6KA 1F12A 3QJYA 3E0XA 3SD7A 3U7JA 1Q0SA 3IQXA 4NOKA 3ZCUA 4DCGA 5C1PA 1Z6ZA 4Y6RA 5JE8A 3W3AH 3WRVA 4E5YA 3QLUA 5KOIA 4Y2YA 3QE2A 1NVTA 4TMWA 3L0DA 5CFOA 4WNAA 4CEIA 4RDIA 2KX7A 3DE2X 2JARA 3O3MB 1O8CA 3I6YA 1WMEA 3OZ7A 1NF2A 4RPGA 3JAKA 4KQKA 1XROA 5CDYA 3Q87B 5J4YA 5KNCA 1JFFA 1BEEA 2JASA 2SBTA 1TRKA 3P2KA 4WLOA 4J76A 1MHPA 2GYVA 1T9GR 2MDTA 3A8TA 4QSHA 2CMHA 5E2BA 3WTCA 4HV4A 3FROA 3K9WA 3DMHA 5JSKA 1UR5A 3ORRA 4FC7A 3U3KA 4IJQA 3WB0A 5KKNB 3CC8A 5CFMA 2AQHA 2C4VA 1X8LA 4IHQA 5EKTA 3VGPA 1E3MA 2BI8A 3NHPA 4C7MA 3MM4A 2SICE 1L7OA 2HMVA 2OCKA 3RVPA 1Z5WA 3D9QX 4LQDA 4ND8A 4YI3A 4DIEA 4W5OA 1G8HA 3L7MA 2PL1A 3K0CA 4KI0A 1GPMA 5HA5A 4X64B 1V1RB 3VC2A 1SUBA 5IDWA 3IPXA 1Y8CA 4QDZA 2D1YA 4C0BA 4D9JA 3GCZA 1RVDA 4BFYA 3ONNA 2VBFA 3WP0A 4DWJA 2Z83A 1PK7A 3UFXA 1AO3A 1Q91A 2Q6TA 2FSPA 5EFZA 2FPGB 2Z1NA 3KJHA 3ROTA 1Q0TA 2NT4A 1NQWA 1OFUX 1P1CA 3FHOA 4TTIA 4ZVPA 5HFAA 3FFTA 3UMRA 3H6GA 4W5JA 2HJWA 2RAFA 1E4EB 1K5PA 1LSOA 1V6SA 1W2WB 2AF4C 3AOGA 1KAGA 3LBAA 3N2EA 4Q3NA 4V0LA 3H7AA 2C00A 1JHYA 5E4JA 2CNKA 2GYUA 2CJWB 2QSUA 3NW9A 1Z36A 2ASVA 1IQ0A 2CHQA 3AR9A 1ZNWA 1DCMA 1PZXA 2FZ5A 3K20A 1ZD5A 2R6AA 1T29A 3OG9A 3Q3VA 4QOHA 2B7LA 2XH8A 4EFKA 4OG2A 3WGIA 1MORA 1Z07A 2H2FA 1LSSA 3D6HA 4GOOD 3OEHA 3OC6A 1XU9A 4I08A 3O7MA 5D00A 1Z5GA 4NAHA 5FWAA 3U5TA 2Z43A 4URUR 4AICA 2I54A 1T4GA 1WW8A 2O2SA 2P41A 3AESB 1P0FA 4K26A 2XD4A 5DHSA 4C76A 4CM8B 1R5NA 4QC2A 4JSYA 5DYGA 5FH9A 5I7EA 2FR1A 2HNKA 2HNBA 4ZMRA 3GO4A 1B0UA 4QYIB 2G63A 3L41A 4HDCA 5D01A 4D3DA 4NXMB 4IXWA 5C8YF 4DA0A 1MO5A 1E0JA 4JK3A 3W6ZA 2YTZA 4LCBA 2O2YA 3M3DA 4HWOA 4KXYA 1HM5A 1YR8A 2ZS8A 5KCZA 3F97A 3ETCA 1EVIA 1FNMA 2HU8A 3VHXA 1PJQA 3B5IA 3SHQA 2OEPA 4WOBA 2P9YA 3K0FA 3UUEA 3VTKA 2EFGA 3PR3A 4KR6A 3PGLA 2CLHB 3PCXA 3A1TA 3WAGA 3OPNA 1OLUA 3WLKX 1E4OA 1KZ4A 4ESOA 4ZIRB 2M98A 3LQ4A 4QDJA 1QVVA 2JJ1D 5AVJA 1KU6A 2H0AA 4OU4A 4F2WA 3CUTA 3DL2A 4IJKA 3QLVC 4LBWA 2Y1CA 4Y9SA 3WRXA 1K6EA 3ZOKA 4GBMA 2GO1A 4HL6A 1VBNA 1YJBA 1UM9A 2M32A 1QG2A 3EC1A 5JPDA 5IAJA 2V7VA 3MQFA 6NULA 4RPLA 1FXUA 2PUJA 2FFHA 3BJEA 5DN6A 5ALEA 1SEVA 1UZMA 4S1TA 2JJ2D 4W5RA 2VXYA 2IOYA 2VF2A 5JZBA 1LI7A 4C7OA 5EIOA 3U4HA 1X3SA 3CR3C 4AUMA 1ECBA 1XXLA 5CA1B 1U11A 2C8JA 3USZA 2OV8A 4R1QA 4UAUA 1NNI1 1O87A 1W4BA 2IA5A 2IEZA 3M82A 1UEXC 4FEGA 2W0MA 4ZO4A 2PWZA 1X1BA 1XWWA 3BWXA 4H4DA 3SN6A 3PIRA 4UBKA 1P80A 4J1TA 5JDCA 2JIZA 3QOXA 3DKRA 4NFHA 1ADFA 1NMXA 2ZSHA 3A1WA 1L5WA 1OA0A 2OBYA 4JT4A 3VVLA 3ZXXA 3FF1A 3OQIB 1X13A 3LWZA 2LPMA 2WF7A 1B16A 1R3UA 1EBBA 1T1EA 1TUBA 4NJEB 3RKSA 1NDQA 1PP4A 1JQ3A 4J7XA 5A3VA 2A9OA 5EGNA 4EMBA 5CDTA 3STXA 2XAAA 3MOSA 4TN5A 3NVKI 1CZHA 3V9PA 5DBHX 2WKSA 3FCXA 4K9OA 1MRZA 4ISBA 3U3XA 3CX8A 1FTNA 2NO7A 1K8YB 1WSAA 2X0IA 1AVTA 3KOOA 4P2GA 1VLZA 2H1VA 1V35A 1CUCA 1Z37A 2WJHA 3ORYA 5BUCA 3E2PA 1H2RS 4WZBB 1ADGA 3OQNA 4FWIB 4WOJA 1Y63A 2RH9B 4AJ2A 4YCSA 4M1KA 4B31A 2C9YA 2WF5A 4PCVA 1O96B 4JSTA 1CT9A 4FOOA 1E2QA 3SDSA 2IE8A 1KKLA 3PRJA 1NN0A 1P1FA 1LPOA 1UPCA 3R7SA 1FLVA 1CDOA 1SUCA 4Q82A 1PDWA 3DFZA 3A26A 3TL6A 4D2IA 1JPNA 4DSAA 1G2OA 2CZQA 7ADHA 2F1HA 3EEBA 4LKRA 2P90A 1QFMA 1P9NA 4KMOA 5HF5A 2QR2A 1T8WA 1U28A 1D6MA 2WNIA 3O8NA 1AS0A 2QN3A 2QYHA 4YA6A 4U0KA 5J40A 5B3LA 1QO0D 1KFJB 1RXEA 4M0EA 3SF8A 2DUNA 1IQUA 2ACKA 2IYXA 3L8YA 4M89A 4NATA 1XXHA 1Z3IX 3RDPA 3VU8A 2O9JA 3DWFA 3GFQA 1BAPA 4U3JA 3O90A 4DT1A 5JC8A 2PPLA 4JL5A 1HF3A 5ALTA 2QZZA 2R1VB 3CKKA 3BFJA 3HVHA 4J4BA 4MJ3A 3RTEA 4BP8A 4CLOB 3L6RA 1R3DA 3BA6A 1B8UA 4FN4A 4DIKA 1RZ3A 1YQ9A 4JZYA 2ZJBA 1JQBA 1MAAA 2JHAA 3EIHA 3R9XB 2D13A 3FWYA 3R3VA 1ZONA 4M2LA 2C94A 2JLXA 1Z56C 2HHLA 2ZIFA 1SUPA 3IJPA 3JZMA 4ILEA 2I2FA 2VJQA 1YZTA 4JUIA 4PS0A 4GP6A 3O26A 4Q34A 3RJZA 4H7KA 4PGFA 2W6QA 2P11A 3LCVB 1PEKE 4YJFB 4OXYA 1BXRB 3HVUA 1CY4A 2BHSA 5T67A 1KSGA 2QP3A 2OSBA 1C3XA 4HKTA 1S01A 3VDRA 1EAMA 1F5NA 2ISSD 5IJZA 3MERA 2ZAOA 1P6QA 1T1RA 3DV0A 3C45A 3KJZA 2ISCA 4QREA 5IUJC 4GLOA 5JFGA 1A7UA 2WHYA 4D79A 3R3WA 1XV5A 1Y34E 4G4JA 1F4PA 3WGVA 3ETHA 2QRMA 3WDMA 4UKDA 2FMHA 2F3RA 3SYRA 3PUYA 1GITA 2P2GA 1H94A 1BWRA 4S1OA 2WHXA 2BR5A 3WBKA 2XD9A 5BT8A 1F51E 2DWCA 2XT9A 5K8JB 1O6BA 1GU1A 4XWYA 1T2EA 3P27A 1N8NA 4RM3A 2I1VB 4GZ3A 2EWVA 3VZQA 3JQAA 3PVCA 3EQ2A 1QPZA 3GRAA 4L2IA 1ULTA 2QRVB 3C7DB 3WIVA 2V7PA 1IY2A 1U3GA 3IMKA 3S2FA 3PD0A 2VA9A 5D84A 4PPGA 4A0SA 2FPMA 4ZU1X 1VL0A 4UJ3A 4YUAA 7MDHA 1QCZA 5IFKA 1U8CB 4V1CB 5J4VA 1W9HA 5TRTA 5MN4A 4MARA 1QXSA 3GAMA 1WB5A 3FFXA 1K92A 4FFNA 3I42A 3O1IC 4PG5A 2P9EA 3RM3A 1XO1A 2AC2A 1LI5A 1MW8X 3HJBA 5CLLA 2HV9A 3DYIA 2WHEA 4OB8A 5K8UA 5T3YA 4AS2A 2G80A 5CRIA 1K06A 3INYA 3PGJA 4HFNA 4M60A 4BP1A 1PG0A 2ZQ5A 3C4JA 3AI7A 4EUKA 5A2QA 1CY6A 4QGFA 5FAXA 4AM8A 4B43A 2OT3B 1CF2O 5ULLA 2ADOA 4FFLA 4MV7A 2XGSA 4M9ZA 2A33A 1QWSA 1YB1A 1U2RA 5JAQA 1DS6A 3FCUB 1KERA 1RHJA 5AKXA 2AZDA 4M0FA 3BRWA 4JR2A 1NUSA 3LK7A 1JB1A 4CHTA 2NW6A 4ZZIA 2WZDA 2VQEB 4KK4A 4NQZA 2R8EA 3IHLA 2WMDA 1UK7A 1NMSA 1QQAA 3OOJA 4LNHA 4RK7A 3IQZA 2Y0DA 4MVJD 4MIOA 1US8B 4QM6A 3MPUA 3P2OA 1QNFA 4YJ3B 3FHJA 3CLRC 5HMMA 3Q9SA 1A95A 1P1KA 2FWNA 4JX9A 2C82A 3MINB 2B6NA 4KFTA 1K86A 3E3MA 4PFQA 3NT4A 4JJGA 1YDWA 3HR7A 2ZYAA 4KKXB 1V37A 3H1TA 2VNKA 3LTEA 2DLCX 3IAHA 2H16A 3A28A 1V4NA 4TT3D 2WWYA 1AK2A 1QOQB 3PGVA 5CJPA 1NWHA 3F6EX 4EB6A 1XQWA 5HM8A 1HOXA 2ZVQX 1WHSA 3IILA 3TCNA 3D0RA 1UKVY 2YY7A 4RUKA 4DRXB 4HQKA 1GGKA 2ET6A 4FXPA 1UXJA 3QV1A 3D4OA 4CTKA 3UOAB 1KF0A 1DOAA 2PUVA 3PGKA 2ZIAA 3G8CA 2XNJA 2VI5A 4DG5A 2W8BA 3K30A 2O7QA 3CSSA 2CN1A 1TIPA 5AW4A 4LXQA 3BRSA 4WUTA 1O97D 3SU8A 1GTL1 4K03A 4IRUB 2OPHA 3CMMA 2OCGA 4YMSA 2L18A 3BL5A 4Y30A 1IYZA 3RC1A 5AVUA 3NZEA 1P17A 1A76A 1GARA 1XC7A 4FQ5A 3KU1A 2RC5A 2O20A 2X5JO 1JX6A 2BYTA 1YONA 4M49A 2H11A 3Q3IA 2ZBRA 1TT5A 1G4UR 4NESA 1CERA 1E7SA 2FWPA 2W2KB 2NSJA 1FUUA 1O95A 2WICA 4EQ6A 5ENDA 3J80A 3W9YA 1R5BA 1S2LA 4HQLA 4BZQA 3N1UA 4LHWA 4JP2A 3NHBA 3ZWPA 4ZDIA 1DXQA 5LDHA 3LUJA 1UMBA 1XCOA 3ZDDA 3GRFA 4IDCA 4UW9A 1ZLXA 4V24A 1EWTA 4F3RA 1H3NA 3OQHA 2C31A 4NZNA 1TE2A 3ZVLA 1HYEA 2A9PA 4JJFA 1QQTA 1X15A 2WINI 3BE4A 3W5IA 3PNOA 2Y92A 3SEQA 2DAPA 2FSSA 3FDJA 4BDSA 1H4SA 2NQ8A 1TQ2A 2OV2A 3DP7A 1VJ1A 4FMDB 2J30A 3MRTA 1RXCA 3OAAD 3UKOA 4MS3A 3BGIA 3ORFA 2ZSFA 3JAKB 4NTZA 4AD8A 2R60A 5IJXA 5CK5A 1J9ZA 1GP2A 2C97A 2CF5A 4K6HA 4NHOA 4NS4A 3KHKA 1YQQA 4O33A 5FADA 1OHHA 4UTRA 1WPRA 2ZB3A 3E58A 1SKQA 5AM3A 2P4UA 1ZAYA 1UJ4A 2J9RA 2OHHA 1GXSA 2XT0A 4FINA 4S35A 4OUDA 1LJ8A 4DS3A 1SIBE 3EOAI 3RVSA 4JYCA 3QU9A 2PQ0A 2PT7A 1GL3A 3OQPA 2J7PD 4HRXA 2AN3A 2BFMA 4BU1A 4ZAFA 1KC3A 2MINB 4IIGA 4YLYA 1GTJ1 1DEXA 1E58A 3CONA 3E18A 4N82A 3VDMA 2ZU6A 3P0EA 4CMGA 1U1EA 4HNAA 6REQB 4H9GA 3HUDA 4Y1FA 5FBLB 1QMGA 1N1DA 1CS4C 3CIOA 3FSGA 3V2HA 4C4ZA 1K75A 3F9RA 3BCSA 3RSOA 1SKUA 2Z4SA 5CD1A 1C4KA 3JS5A 3M9LA 2X14A 4AY5A 4QYWA 4MCIA 4R4JA 2B1IA 4OLBA 2RI1A 3WBJA 4PQRA 3DB2A 2RGDA 4KPGA 5EOVA 1G7CA 1QSGA 1TPYA 1JXMA 4F2DA 1T5LA 2AEFA 3MWGA 4M21A 1EFUA 2GZSA 3AVTA 2CSXA 4MVJI 3WO1A 1NVBA 3LCCA 4ZEOA 1E2JA 2FUEA 1A3CA 1F6WA 2ZIVB 4C3VA 1JZTA 2RGXA 1MA3A 3D1VA 3KJXA 2GD0A 1H2EA 3LD9A 2BFEB 1KI8A 2Z3WA 4FZRA 1WMAA 4L9RA 1QFYA 2OZVA 1EIWA 5A6SB 1RRPA 4J03A 3TQCA 2P4EA 1NV9A 3EZ2A 2IWRA 1FFHA 4PHCA 3W6OA 4IPTA 2C7QA 4NV0A 3MGBA 4IV0A 4EG1A 4JCCA 1R8XA 3KBBA 4MQEB 5LP1A 4JLVA 4RNCA 1DADA 1TAHA 4MAMA 1FSZA 4IKOA 2SKDA 4CTNA 9ATCA 3PX7A 2G7ZA 3MGCA 1XZJA 1E61A 3VU1A 4XGRA 1P60A 2CDRA 5JXGA 3O75A 5DXAA 3KEFA 1ADBA 4MKZA 1X77A 3NDRA 1D03A 2Z3VA 1X0VA 2QYOA 4G0OA 4TYPA 1M9NA 4DC9A 1QO9A 1F8UA 3VI4B 4DNFA 5AW7A 5GTDA 3B8HA 3EWIA 3CSDA 4NWIA 3RK1A 3T1NA 4YMVA 3RT9A 3DOEA 3CNEA 4AZVA 1Q0PA 2RGNC 3WWDA 1JU3A 2AOVA 8ADHA 5BSFA 1R8YA 3GLVA 2YHIA 5ILGA 4CCWA 3AYZB 5ARCA 4E70A 1I6MA 2G17A 3TTTA 4LJRA 2HOQA 1COZA 1KMQA 5WRFA 4QU5A 1NA5A 1X92A 1E5DA 1JMYA 4Y1RB 5C9ZA 4Y0AA 2QWXA 3FMFA 4MUMA 3RU2A 2IEDA 4Y9TA 2MJLA 3QPAA 1ZHFA 2WUDA 4EEXA 4FEYA 4L8VA 1NT2A 3T3PB 1SUSA 2WMYA 2WKRA 2P2CA 1NVVQ 1PJTA 5JS7A 1C9MA 2I76A 4MQFA 1N5DA 4JEMA 5LQRA 3HY4A 4NU6A 3A70A 3PL1A 4Q1AA 5AKGA 1J8YF 3GHYA 1JUDA 3IPCA 4O08A 1BJTA 4RD4A 4TLMB 2Y3IA 2IY9A 2VPQA 3FYTA 4I7EA 4MJLA 3AZQA 3R5SA 4G81A 4BO1A 2AC7A 4EYKA 3AVXA 1U7ZA 4KXWA 3AY0A 4Q3CA 4CMHA 5BO5A 1L8OA 2ZAYA 2VP9A 1FS4A 3H5IA 4RJIA 2QAGC 4V0QA 2I4NA 3AEZA 1JWBB 3WK7A 3WWCA 1FLNA 4UPEA 1L8XA 1K97A 3E9QA 5EJ8A 2IODA 2C78A 3IP7A 4WOKA 4Q9KA 3HCBA 4HGPA 2G9QA 3ESRA 1HTTA 4P4LA 2ODWA 4X1IB 1JTVA 1VJCA 2NZXA 2R6R1 2FUG1 4PZEA 3E8MA 1U8ZA 1J42A 3VR6H 4FIDA 1VYHA 2GBLC 2Q5FA 3JWEA 1NBMD 2EWMA 1UDCA 1X70A 1SJ9A 4A1OA 5AQ1A 1U9YA 2QENA 1XRJA 3DMFA 3KSMA 2YYSA 4HXFB 4EENA 1IJFA 3EQ9A 5LYJF 5KYYA 1H5UA 4TVBA 3KQVA 4LV6A 5L6LB 1LVGA 3TBFA 1PZNA 3BRWD 3PE3A 4D9CA 5AI8A 3VR3D 3T0GA 3G1WA 3PFHA 3CVYA 4BN0A 2CXRA 5SICE 3D4IA 2NUAA 5EJMA 5JAPA 1SVOA 1D0IA 5C37A 3HEAA 1XZEA 4BGEA 3HDQA 4M99A 1VMDA 2V0CA 2X13A 2ZYVX 3QVOA 2AYZA 3PI7A 4QUEA 4M88A 5JEDA 2RGCA 3RFCA 5DLDA 2OZLB 5LNK6 4WADA 4PWYA 1FW8A 3VGJA 1MV8A 4P92A 2QLMA 1SU8A 2C99A 1RYNA 4MGYR 3ZY4A 3O8BA 4K9SA 4FHGA 3SG0A 1ES9A 4H7JA 1OD6A 5F64A 4BFLA 1EFAA 3IKLA 4F4JA 4BC0A 3S7ZA 3PF9A 5JISA 1DWPA 1KJZA 1PWEA 4ZYTA 5FEUA 4D99A 1ZVJA 3OZSA 2VDVE 4IZIA 1N1GA 2ZIEA 1F20A 3FUXA 3IDZA 4H0CA 5BWOA 1RRVA 3OPXA 4GL4A 2B37A 2HMSA 2VTBB 1DG9A 1SC4A 3GPLA 3A1SA 2FETA 1IFXA 3LLUA 3KYBA 3D7SA 2XCOA 4Z99A 1RQPA 4CIDA 5I7HA 3IEVA 3T7IA 5E1DA 1VJGA 3AKEA 3KYDB 1SHUX 4KIUA 5HX7A 4YJDA 3SZGA 1PWZA 3NM4A 1DQRA 4EI7A 2H07A 2EX1A 2YUIA 3BHNA 1EX9A 3QG1A 1X80A 4A8JC 2Q3MA 1QV9A 3JATB 4FNMA 4OAPA 3WNZA 4DUYB 1CWUA 1AV7A 3GF4A 2WB2A 1NMQA 3C74A 4TPKA 3OCYA 4BIMA 1F2UB 2VJYA 1P0QA 1T9KA 1RR6A 3KUUA 4JFRA 4B6SA 1Q16A 1X7ZA 1QX3A 1N78A 1MIOA 5T8KC 5LQMA 2J7PA 4DVGA 1B8VA 4H7IA 2NXNA 4PO3X 1PDOA 1HETA 2HLPA 1ICIA 2F59A 5D8DA 2O06A 1QHNA 2FE1A 4OK3A 3WKCA 4D57A 1IULA 2KHZA 1K3TA 4F4FA 5KX5B 4RQBA 2VG8A 2ABWA 2D5CA 4OX9B 3G17A 1M8FA 1U0JA 3GLGA 3QBEA 4BKRA 1M34B 2M1ZA 3L8ZA 1SWVA 4RY9A 2EGHA 4KQEA 2EZTA 5CFLA 5FB3A 1T24A 2X22A 1BYIA 1N5LA 2H00A 1KY2A 4CFYA 4ER6A 2JKYA 3PCRB 1PUXA 1YL5A 3N6VA 5FULA 2WIBA 3BB4A 3EPRA 3H1PA 3I4LA 4ON9A 2IUYA 2DFKB 3P2YA 5ALMA 5JVDB 4EHLA 3RHFA 1C2YA 4ZI7B 3IKMB 4OYLA 3L1JA 5ICEA 2I8LA 3WRYC 1KI1A 1B6TA 3HHEA 3LVRE 5ALIA 5KC9A 3ZVRA 4ZQIA 9MHTA 1NSFA 1J2RA 5EE3A 3ND7A 1R1DA 1PQUA 2O0KA 3ZOZA 4NR0A 4RPHA 5LU8A 3U61B 1Q6YA 3DDHA 1PNTA 4JDPA 4K9RA 4AECA 3X1XA 4UAVA 4ZHSA 1PS8A 4REQA 1XMPA 4AP9A 4M0DA 2R1TB 4EJ6A 4EYQA 3ZK8A 3L1IA 3VJLA 4XGQA 5KZMB 3QELB 2SECE 3ILYA 3TAXA 3GNTA 1L5NA 1Y1LA 1DAPA 3OMWA 1Z2PX 3EBLA 1JWLA 2QBYA 3EEOA 3COYA 1UBCA 3GEGA 2DUMA 1GPH1 2XA9A 2PGIA 3OT5A 2PBFA 2QMYA 1F0PA 1PFWA 5G40A 4AWBA 3MS2A 3AOEC 2DM6A 3O03A 4B6GA 3I9MA 3N2KA 4PZAA 1GAWA 5AJHA 3NM6B 3GXBA 1L4YA 5JYDA 3GLHA 4D3XA 1BMFD 2EFCB 2PSEA 1PFGA 5HJ2A 4WFKA 5FL3A 5HZHA 2YNMC 2XSZA 2IUFA 3MVEA 1L9KA 1T1GA 3MWDA 1XKXA 2QLJA 3OUUA 3LC1O 2O4UX 2ZWAA 3GMDA 1V3TA 4K9KA 3VUFA 3GMTA 2XV1A 4WN3A 1F0NA 2J3KA 3LQ2A 4J0JA 4OBEA 2B4RO 4KDFA 3A4NA 4BQSA 4DWOA 4LPSA 2UZ3A 5F21A 2PKYX 2A9VA 1KOLA 4LZPA 5KQGA 2WT9A 2AQ8A 2CXHA 3NTVA 1P7VA 5DBGA 2JK1A 2RHMA 1KK0A 1VJDA 3L46A 4FONA 1N92A 5E2IA 4L7VA 3QFFA 4Z7QB 1NBEA 1EVQA 2Y0BA 1AT1A 3PP8A 2DTXA 1QHSA 1JVNA 3HM9A 2BJWA 1RVV1 1RE0A 5F7XA 2UUAB 2QTZA 5EJGA 2PZJA 3B53X 3O2SB 1NVDA 3EPLA 4QGSA 2XQJA 4C4YA 4KWIA 2AZMA 3NWJA 5BNIA 4J91A 4YMLA 1E2EA 2W42A 3ZJVA 4EA8A 2JGRA 3ZWAA 4DXHA 3PZBA 2F67A 3LOQA 1L5LA 4A6EA 4EL0A 4HWSA 1QG4A 2VJBA 3H04A 5MGBA 1G5HA 3ANLA 2BISA 3G3EA 4JLBA 4NJMA 1H05A 5HTOA 1RTKA 3TVDA 1CUWA 1PJSA 1TVEA 1J0EA 2YWXA 3HYCA 4PY2A 4JLSA 4BLPA 4IMRA 2FFAA 4GOJA 1J8QA 1Z4JA 4IIJB 5CW2A 4AU1A 5K6RA 4GQBA 4ALJA 4CKWB 2W93A 3MWYW 3Q10A 3ECCA 4H15A 4TM8A 4F5EA 3OMLA 2P7IA 3C43A 2ZRNA 2BVNA 3LKZA 1DFHA 1E4EA 1XD8A 5TS2A 1ZKMA 3SQNA 1NONA 5KQLA 3LUDA 1DC5A 4NV1A 1CR0A 3IOEA 4B3FX 1ZGCA 3E1SA 4QUHA 1I1HA 1A69A 3F3MA 2C9MA 3RV4A 1KGDA 1ATIA 2B36A 4M1SA 1CULC 4IQ4A 3GGPA 4YJHA 3VSBA 4ZFNA 4O2RA 3DZBA 4MV1A 2Y05A 3UWSA 3QTLA 1NE2A 2VAVA 1YVUA 2P2SA 3NR2A 5HM6A 3Q12A 4KVGA 1QV6A 3BKXA 3QVVA 2KE5A 1CZRA 3IKJA 5DHRA 1D04A 1UC5B 2WFMA 4MI6A 1R6DA 2ZJ1A 2N9UA 1LDNA 3HB0A 3P9XA 4L95C 3W4JA 3KPUA 1RACA 1T1JA 2BGIA 1BX1A 1K5HA 2HBQA 1JALA 4BO0A 5EINA 4QJ3A 3M1AA 1ZR2A 4FR5A 3C1TA 4ZPJA 4M86A 4QHYA 4UEWA 3ROEA 3MF4A 4DCTA 5IJ0A 4ARBA 2W2OA 1CUHA 1DIAA 5IKOA 1U7PA 2BKUA 3TSYA 2IKQA 4OP3A 3GX1A 5EMMA 3UATA 3P0RA 3S7TA 2ZU0C 4LF8B 1IM8A 3VYVA 3K05A 1JHQA 2BF4A 2UZ4A 3SAJA 3A6EA 3A3YA 3SR3A 3RUEA 1VPLA 1YAHA 2HSDA 3G0DA 4QL3A 1SXJD 2J0UB 4Y9UA 4ENTA 3G2IA 4C78A 3E9MA 1TF5A 1T3GA 4MI1A 2H7CA 5EUBA 1PIWA 5TSDA 3RC9A 3WK6A 1NGSA 1IB6A 5G0WA 4BFWA 3UHPA 4D9KA 3IESA 4JJ4A 5DEIA 4DLPA 1U9IA 5E0KB 1MR3F 2BSXA 1KI9A 5IKMA 3T5CA 1THTA 4KDCA 4EFLA 2EHDA 4IIFA 1A2KC 4GP9A 1CQXA 1NQTA 3IHKA 4E33A 1A7JA 1FFWA 3MTAA 3OO0A 3V00A 5E1BA 2P7HA 4US2R 2I5PO 2GF0A 2ZB4A 3BJZA 1Y37A 4RULA 1EXVA 3BBPA 5ECWA 5L3SA 2DWPA 4YI5A 4GMXA 1ZRSA 4RM2A 1SXQA 5GIOE 2TS1A 1VPEA 5I4BA 3S28A 3PWTA 1OZAA 1U2SA 5EZSA 2VPWA 3WNQA 3SSAA 5A4JA 5I6DA 4HS9A 3DEIA 1GZ6A 4Y6PA 3W1VA 1EFDN 2W2TA 3T95A 3X1WA 4MW2A 2E4ZA 1O2DA 2HW8A 1N0VC 3FIUA 4HN2A 2WVHA 4OK5A 3PXXA 1GVHA 1JQ5A 4V38A 1QIHA 3I9FA 5C5EA 4EPVA 3UZUA 1WUHS 1NDHA 2ZI4A 1PW7A 2HU7A 3K16A 5B57C 1J21A 4CEJB 2VJMA 4JJ7A 4U5QA 2JFVA 1J06A 2ZWPA 4DY4A 2Y76A 1UZNA 2XCUA 3I23A 4F3CA 3B7WA 4LHYA 2DP4E 2PR7A 2HHAA 1YT5A 2RGYA 1P5ZB 3HR8A 1QYXA 4KQXA 5AJZA 2VDOB 3TUJC 1BZYA 2G77B 3A1VA 2XZOA 4NZYA 1OHHD 4GVPA 1E59A 4ZTUB 4TSFA 3N6XA 5LP6C 2PRZA 3AUAA 1GL6A 5JH7B 4EPWA 4A23A 3FOBA 3HCNA 4G1BA 1TM1E 2DY1A 1V5WA 1O6GA 2DG2A 3CINA 4ZOAA 2G8LA 2JW5A 2XF8A 1UMCA 3HL4A 3T15A 1SBIA 1IOZA 2DWOA 5LB2A 3SEZA 2HRDA 3I76A 1ZJWA 3O4RA 1ZA1A 3UG7A 3C2QA 4XQ9A 5BXYA 2QK4A 1E6UA 3QYPA 4CEHB 2DPGA 5FBRB 3PX3A 4HRAA 5COBA 3VC3A 4B87A 5JSQA 4DV7B 2ECPA 1DC8A 3KKZA 4BYMA 1C1XB 1CHDA 2HPZA 2WIDA 3WMRA 2YV4A 1FMFA 3RROA 2IYRA 3AM3A 5ELLA 1L4NA 2DUWA 1KBOA 3VNQA 1MU0A 1Y81A 3ZDXB 1K0FA 3PF8A 1ZD2P 3QE0A 1OXXK 4HO1X 3I8OA 4LSGA 1SMKA 3AILA 5AJYA 3ZWBA 1ARZA 1H65A 5BNTA 2IGBA 2EFYA 3QLJA 3GVIA 5EJ2A 3MSXA 1D0VA 3WJ2A 5I8WA 5K4GA 3U4MA 3ZTTA 3ROQA 1NJ8A 1DHTA 5CAEB 3CRZA 4X85A 1DJOA 3N0RA 4LDNA 3SHTA 1C1YA 1QF9A 3ML1A 1J99A 2ATVA 3PG5A 3G8BA 2GETA 2I03A 4HD8A 4ZXFA 2JLRA 3LPMA 1T6NA 2BMDA 3ONWA 2C8LA 3STWA 1JJVA 1N4DA 1AKEA 2ST1A 3DDSA 3LCUA 3PPXA 2XGGA 3FB4A 3IE0A 3RVJA 2V7WA 5KYNA 1N1EA 2UZIR 3O8RA 3OQJA 1ORRA 4EKIA 1Y1TA 1AGYA 2HWXA 5K0EA 4CFZA 1QH1B 3OX4A 4JL8A 4D4GA 2I2BA 4EG7A 3K71B 2C5AA 5BN3B 1ACJA 1XA3A 4WOCA 5DN9A 1Q0UA 1ZRMA 1P61B 2IYQA 5K8TA 1P5RA 1D1PA 3GJ8A 3QE4A 2DCUA 2OKGA 3HXPA 5B7PA 1N77A 4UREA 3SF0A 3CWQA 5BW8A 1I7DA 1KP9A 2PH5A 3LYLA 2R8XA 3NBXX 1N33B 5LDGA 4X62B 1ORWA 3LLMA 5EJ6A 1A5AB 1MC1A 4H60A 1EBFA 4NDAA 1SU7A 1GNVA 2F55A 1TQ8A 1X7WB 4UTZA 3EPKA 3ZD6A 2FY8A 5DLQC 5ALLA 3TM5A 2IJGX 3B52X 3QV2A 4TXJA 4FKBA 1RMQA 521PA 3SSNA 1YS7A 3WGMA 2G70A 1PLLA 2FP4A 1LW7A 3AQ4A 2AR0A 2ZRPA 1X94A 5F12A 1CVIA 3SEAA 1AS3A 1YIAA 5K3AA 2VTEA 2CVQA 5CVJA 1W36B 3TI9A 1FJ2A 1E2IA 3MXTA 4JYAB 4ME6A 3UJBA 5BUSA 1MAHA 3H5OA 2XUIA 4DW8A 3NHWA 1N0UA 1BX3A 1Q1QA 2YZKA 1TU3A 3F8WA 3Q0TA 4JUBA 2VJPA 4AJOA 4YR9A 4JOCA 3ZU6A 2OM2A 4ZD6A 4ESEA 5IJAA 2DBYA 2QI9C 5AJTA 2GYWA 2H4HA 4YRSA 1FNSA 4E14A 1XMVA 3PWZA 2XNDD 2TMDA 1WMBA 2VTDA 1FRFS 1LXCA 2IPAB 2HIGA 3GLFE 2HGZA 4AROA 3UGQA 1N9GB 1M2VB 3IQFA 3BMOA 5DWDA 2XQKA 4WHMA 2I2WA 2NSHA 4EHAA 2FZGA 2I3BA 3NP9A 5KJ6A 1JEQA 1WCXA 3PX2A 3CN9A 4IWNA 3QPVA 1JHMA 2IGTA 3WKEA 4WBXC 1GTMA 1IUPA 4WK4B 1V5GA 3DFKA 1O1YA 3RADC 2I1LA 5C5CA 4NNPA 4P3YA 4DNPA 1RCUA 3GC6A 3B36A 1SUEA 1GKKA 2DY0A 2OZEA 3CUYA 3H42B 2PFGA 1DVRA 4JEHA 4KO8A 4OXXA 4PCLA 2GBGA 3GFBA 4Q24A 3JQAD 4R8SA 4W1PA 4HNUA 2DLDA 3WA7A 3ER9A 1FBTA 1ANKA 5DE3A 3VNVA 3H13A 3QKRB 4RJLA 4U02A 2FZWA 1H85A 2ZRQA 3CF4G 3NBUA 3OP1A 4QT0A 1I5EA 2RHJA 3QSGA 3ROFA 1AKVA 1NE7A 4PBTA 1JAYA 1UAGA 4HCJA 3T4UA 4Q93A 4EAAA 2AD5A 2W2NA 2W58A 2PH7A 3IMEA 4RK1A 7REQA 2W11A 3WK5A 3Q11A 1E9AA 4PAMA 3QXGA 4TUYA 4B81A 4CODB 4AT1A 3B1KA 3M6MD 1MNQA 2YICA 4GECA 4L7QA 2W48A 1OLSB 4CMIB 1E32A 4QM7A 1LDEA 3IT1A 4YJKA 4PAWA 1K5DA 3ZJUA 2C92A 1KJJA 5KCMA 3TIIA 1QH1A 1XR3A 2C3UA 4N0QA 2H63A 4EX6A 4NJMB 1Q3HA 5AOAA 3DBLA 1AHHA 1Q7RA 2Z9BA 4B73A 4O29A 5E0OA 2G0TA 3B3GA 1XG5A 3WVNA 5CD9A 3Q9UA 3HB1A 4EFDA 6Q21A 3RC8A 3IDQA 2ID8A 1TMOA 4OGGA 2N46A 4X7MA 4EW2A 2BHNA 4LN1A 3EPJA 2XGJA 4H6WA 3S3TA 4RQUA 4WZBE 5K0NA 3RS2A 1CC1S 3EXEA 1LPMA 3F2IA 3NC0C 1DL5A 4RORA 4YREA 3KSBC 2YNMD 3WFJA 3AU8A 3MMNA 3O8LA 1EUCB 1IXYA 3VISA 2QNBA 4IICA 4NF2A 4C89A 2NUAB 1VGQA 1FDWA 3TMKA 2W70A 3PFIA 5LWQA 3C5VA 3EXFB 4ZKDA 2GR9A 2IL1A 2NSDA 4YONB 4D74A 1MGPA 3B6ZA 1HOTA 2C1XA 3JAMA 2WMNB 4WJLA 3HCRA 1L8QA 4LGVA 5HCUA 2UZ1B 3ZC3A 2VZ9A 3R0VA 3U3DA 2GFQA 1K6IA 2DHDA 2MU1A 3GAAA 3HA3A 4DA9A 2EATA 3F3YA 1K8RA 1YS6A 3UW3A 4HMQA 4BNJA 4KR3A 1AM4D 4ZHQF 1ZK4A 2IW3A 3NWPA 1XPRA 3B6JA 2PWAA 1T25A 4G8DA 5ALPA 3RS7A 3AINA 4XX1A 5BV7A 1OCEA 2FRVA 1VKRA 1EFRD 5BN5B 3ZQUA 3C3CA 2EV9A 1I9CA 2B4KA 2XB9A 4F92B 1NJGA 5FQNA 1T6ZA 5JQGA 5KJ1A 2ZXUA 4MV3A 1RXIA 4N5LA 2PSSA 4BV3A 2GMWA 1N3BA 1YNSA 3N5KA 4DLUA 4BTEA 2WQ6A 3B3JA 1PUIA 3R20A 1JTEA 3KVVA 4W99A 1QR6A 3EXHC 1IMJA 2WUVA 2VTKA 4QYIA 3A2MA 2BFBB 1HZZA 3VR4A 2Q7XA 4B3XA 1YJCA 3H4IA 4L22A 2XOEA 5BOSA 5KYKA 3U56A 1O0CA 4B3GA 1XDDA 4N5IX 1HTWA 2CYBA 4EHNA 1QTIA 3I3SR 3ZW8A 2COKA 2UZ1A 3SQOA 5DWVA 2IU0A 4AIRA 1LU9A 1H4QA 2RJOA 1O5OA 4BVKA 1R5OA 2NVOA 3ZWVA 4A8TA 1BE8A 3OIUA 4O59O 4CQLB 3VR0A 1RDFA 4Z4EA 2HJHA 1UPBA 4UE2A 3SHOA 4OHBA 3UCEA 3UGTA 4CI9A 4EGQA 1PJAA 2DCMA 1RBQA 2YJNA 1UF9A 4O0LA 3VU9B 3ZWKA 4DILA 3K94A 4DL9A 5FFFA 5FPTA 4F9TA 2GKSA 2J3QA 4XD7A 1EA7A 1YCHA 2FWJA 1J8VA 5IK2D 1TLLA 1ZEJA 3CKYA 3DA8A 3SBOA 1B8NA 2HQRA 2Q3FA 2YMQA 3JQ7A 1JNYA 2OLEA 5EKXA 2QJFA 1CK4A 1Z0SA 5IVIA 3L1HA 4LCEA