4C4VA

Structure of the outer membrane protein insertase bama with one potra domain.
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
462
structure length
445
Chain Sequence
FYVRKIRFEGNDTSKDAVLRREMRQMEGAWLGSDLVDQGKERLNRLGFFETVDTDTQRVPGSPDQVDVVYKVKERNTGSFNFGIGYGTESGVSFQAGVQQDNWLGTGYAVGINGTKNDYQTYAELSVTNPYFTVDGVSLGGRLFYNDFQADDADSSDYTNKSYGTDVTLGFPINEENSLRAGLGYVHNSLSNMQPQVAMWRYLYSMGEHPSTSDQDNSFKTDDFTFNYGWTYNKLDRGYFPTDGSRVNLTGKVTIPGSDNEYYKVTLDTATYVPIDDDHKWVVLGRTRWGYGDGLGGKEMPFYENFYAGGSSTVRGFQSNTIGPKAIYFPHQASAKDLCKSDDAVGGNAMAVASLEFITPTPFISDKYANSVRTSFFWDMGTVWDTNWDSSSGYPDYSDPSNIRMSAGIALQWMSPLGPLVFSYAQPFKKYDGDKAEQFQFNIGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Bama, an Essential Factor in Outer Membrane Protein Biogenesis
pubmed doi rcsb
source organism Escherichia coli
molecule tags Protein transport
molecule keywords OUTER MEMBRANE PROTEIN ASSEMBLY FACTOR BAMA
total genus 90
structure length 445
sequence length 462
ec nomenclature
pdb deposition date 2013-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01103 Bac_surface_Ag Surface antigen
A PF07244 POTRA Surface antigen variable number repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.50 Mainly Beta Beta Barrel Porin membrane protein fhac: a member of the omp85/tpsb transporter family 4c4vA02
3.10.20.310 Alpha Beta Roll Ubiquitin-like (UB roll) membrane protein fhac 4c4vA01
2X8XX 4C4VB 4C4VA 2V9HA 4PK1A 3OG5A 2VH1A 2QDFA 4XGAB 3MC8A 3MC9A 4K3CA 3Q6BA 2QCZA 4N74A 4QAYA 4BZAA 4N75A 2MHJA 4C00A 3NJTA 3EFCA 2VH2A 4K3BA
chains in the Genus database with same CATH superfamily
3V61A 3E9SA 1PDXA 3VTVA 1YN5A 1L4DB 3A1QA 1HQRD 1QQRA 2MLBA 4KX6B 3PGUA 5IN7A 4RGMA 1GAQB 4PT5A 5EDSA 2ZFGA 1WXMA 5L83A 2RDGA 3TJPA 4FT6A 4MM3A 1BXTA 1GFPA 4BUMX 2EKIA 3TEWA 2JWUA 3VVWB 2R2OA 4FLHA 3HRDD 2YEPF 3H7SA 1V5OA 2O2VA 1MM4A 2NBVB 4FADA 5D5DA 2W54A 2C9WB 3U52E 5MPOA 2O2VB 4WQOB 4IG7B 1OFFA 5C23A 2LRWA 3HHMA 2Y3AA 1YX6B 3NY5A 2YVCA 2LMCA 3AEAB 4TSSA 2DZMA 3U30A 1NEKB 5E6OA 2O4VA 3SD5A 1VJKA 4MGKE 4BZAA 2W3RA 2BF8B 4JGHB 2J0MA 3NSGA 5BO4B 1FNVA 1JCKB 4KRAA 2GBRA 5PRNA 4FRXA 1K8RB 5J18A 2RR9A 3X23A 4D64A 1WJ6A 4G50A 1TZ1A 3ZUNA 4N58A 1WXQA 3SHQA 2N1VA 5E6JA 5LLIA 3NVYA 2G9HD 2ERVA 1WGRA 1WX7A 2A5UA 4M0WB 3Q8EA 2KX0A 2XN9C 2WJRA 3TSSA 3AULA 3VH4B 5GMVA 4C4VB 1OTRB 2C7NB 2KWVB 2JU6X 5E6PA 1K52A 4FXCA 3VUYA 2LHDA 3ONSA 3VR8B 3L4PA 5HHDG 3AE9B 3DBHI 2KTRB 2JZPA 4RJWA 1FFVA 1QZEA 1J0GA 4DWFA 1XCTL 4JQWC 1IUEA 1A5RA 3ZGZA 2VRRB 1WWTA 3PRPB 4MDKE 3FKYA 3SZDA 4NQKE 1OQRA 5DL6A 1EM7A 2L7RA 1TJEA 5HG2A 3HIZA 1JMLA 1TY2A 2BB6A 2QDFA 4NY0A 3M62B 3GB1A 4IKGA 1GC7A 4K3CA 5GV0A 4KIKA 3BVGA 1QJ9A 3HVDA 2INCC 2KNBA 1FNUA 2Y0KA 4M0WA 4EZLA 1WGDA 4FULA 3BVMA 4A9AA 3WU2O 5JXVA 2M1MA 3R2TA 1K50A 1PQSA 5AUKA 4Z3TA 2KQSA 3R8BA 3KW5B 1UWMA 4C7ZA 1HTOA 4S0RA 1WGHA 1EU3A 3ALBA 2AQ3B 3EECA 1ZHYA 4N74A 2KWDA 3A9JB 3P4SB 1ZHZA 3QRCA 1I4QA 2K0PA 4LNIA 3VY9X 2WDRB 2KDIA 3AEFB 4IM0A 2KZ7B 2N2MA 2X38A 3ZO5B 1TGZB 1ESFA 1BXWA 4I6PA 5GTIO 3HM3A 1WR6E 2JQRB 1P7EA 2J52A 3AA7B 5AFUK 3B1LX 2N2LA 2N9LA 2XE3A 2FCNA 1I4XA 3DVNU 2W9NA 3DVGX 2WU2B 4RGOS 3IHPC 2M4NA 2KTRA 2ZVNA 3ZNGC 4A3OA 1GFNA 2IPKD 1WFYA 4XE0A 2C60A 1WGKA 2G3QB 4KGTA 2KDFB 3ZJTA 2MHLA 2DAJA 2BYTA 2B3AA 3EC8A 2AX5A 5EE3A 1ZDXA 3BYYB 1E7VA 1SE2A 1WYWB 3K9OB 2LFIA 2RDBC 3MFGA 1Q10A 4LNNA 2MP2A 1R4NB 4MELA 3DBLI 4JWUC 1WRIA 4GN1A 3P4QB 4IWOA 3U7DA 3NZ3A 1QOAA 1K51A 2RGFA 1RFAA 2QTKA 4BKSA 1KFYB 1SIJA 2BS4B 4TQ0A 3MC8A 4XNLA 1QLBB 2KMCA 1FEHA 4BKTA 2R4OA 4MEMA 3V05A 4O3WA 5EE0A 2R2QA 1HE8A 1OQQA 3VUXA 4H2AA 1SE3A 2ZNVC 2KMAA 4ZRIA 1ZDVA 1QOBA 1FXIA 3GS2A 2F1TA 2E3TA 3MJWA 5G2NA 2WXRA 4PYZA 2YLMA 4CO7A 5JDPA 4GDKA 1NENB 2K8BA 1WJ4A 3AEGB 1MPEA 2K6QA 2KLGA 1AYFA 4DHZB 1KOTA 4N9F4 3FYXA 1UF0A 2KVRA 2FE8A 3EA6A 3P42A 3SFEB 3UI3A 3ZNHB 2NMQA 2KDBA 1KLVA 3AB5A 4YXDB 1V49A 1UZXB 4JCHA 2Z0EB 4DQOC 3MHSD 5D94A 3MC9A 3AA0A 3DHIC 4IM2A 4XNKA 2JZZA 1T3QA 1MI0A 2IWVA 2BS2B 3ZJVA 4RCOA 4RLCA 3DPDA 4JL9A 3SYSA 3J9CA 2FIDA 2LXCA 3AA6B 1F2RI 2EELA 1S5LO 1H4RA 3VUWA 3N3KB 2J42A 2C5LC 2LVPA 2ZPNA 4TMAB 2RD0A 3ML8A 3TZGA 1THQA 3HVZA 2K4TA 4B6WA 3AA1B 2WXPA 4AZLA 1MHHE 2CJOA 1L7YA 2KK8A 1VD2A 5AUIA 4O1NA 2JPHA 3DWMA 3IAM1 1ENFA 3PPAA 4GCSA 1D6EC 4QAYA 1V1PB 4HKZE 3L17A 2MW5A 2V3PA 3RI7C 3PHXB 2N0SB 4FJYA 3AE1B 1F9JA 2KANA 1RYJA 4YWGG 3AE4B 3SR6A 2C7MB 3NVVA 4GLSC 2IY0B 3RZWC 5ADXL 3TEYA 4L23A 1YOVB 5D3DA 1KM7A 5JHBA 4ARIA 5DPSA 4W9DA 4ZHOA 5IOIA 1FRRA 1PGXA 1TS4A 4HVBA 4W9LA 2HTME 2LXAA 3W1YA 3IBEA 3Q3JA 3L13A 5CX3A 4WWPA 1GPXA 1D5ZC 4OVZA 3VE2A 2DNFA 3OWEB 4UB6O 2N1WA 1JWBD 3ZW3A 2FGRA 3LK2B 2KD0A 3SDLC 1SE9A 4FA6A 5KHQA 4NZLB 2OEDA 2RSUA 3AE3B 2D3BA 2LJ5A 1FFUA 4RH6A 1IPGA 4YTMB 4YSYB 2YEPB 3RBHA 1KF6B 3SEBA 1RWSA 2MWSB 3UINB 3FC4A 3AU5A 2CHXA 4MSMB 2Z8LA 2KXPB 4EKUA 1TKEA 1XF5L 2IY1B 3ABVB 4KVGB 2PVOD 3H7PA 2Y5CA 4KSKC 5FVNA 2KOXA 1ZGUB 2HDEA 1RRBA 4KKJA 1JWSD 3B9JA 1JW9D 1YS5A 4FZNA 1N5WA 1GNUA 2QIEB 2J53A 2LASA 4ZYSA 1E8XA 4ITKA 3UGBB 2O6VB 3I57A 1ZHWA 2QC8A 3UU2A 4M8MA 3DWGC 3RYTA 4C4VA 3NVWA 4BFRA 2M17A 3K9PB 3LK41 2KN5A 1V81A 4MJSB 2M8SA 3U2SC 4GCPA 1R7SA 3AV8A 4WAFA 4EE2A 1XLNA 2O6VD 2XK5A 4RF1A 2BTEA 3GE8C 2WX0A 2R4PA 1BT0A 3RNEC 4W9HA 3ZRFA 3IT4B 1SJED 1I7HA 2KN4A 2CKHB 2JQYA 5KAFO 4GB9A 1YD8U 2WHIA 4ANUA 1SGHA 4P6VF 4NAWB 3N1YC 3AM9A 2D5GA 4AFKA 4IWPA 3M95A 2WXJA 4WH4A 1TYGB 3L10B 3RNCC 3VRAB 1WH3A 2OHFA 3BIID 2N7JA 2KFKA 4KDLB 2YPVA 2ZNVB 4TUUA 1XLPA 2BKRB 4IUMB 2VH1A 4K7UA 3NHEB 1TS2A 4GDLA 1LQBA 4M01A 2K8CA 1FD6A 4KKIA 3PSEB 2PE6B 3KYCD 3K19A 1ISNA 3LYYA 1WXVA 4PS7A 2N7DA 3DBLB 3DHGC 3HK0A 2PJHA 1AARA 2KO3A 2WNMA 1IGCA 2ONQA 2BYEA 4WJNA 2CR5A 2J0JA 5T5FA 3TL5A 1V9JA 1ZW7A 5JHAA 3P1MA 3IG3A 5D3IB 5BMGA 4FBJB 1D5MC 3CF6E 1BT9A 2NCNA 1ZHTA 1GFQA 3VZUX 3Q69A 2IYDB 4EEWA 1HZ5A 2NVUI 4OHJA 4C00A 1WX8A 3HUIA 1N62A 4K7WA 4W9FA 2AQ1B 4O4XA 3EHVA 4FUVA 3NRZA 3ZRCA 4GMVA 1TS3A 1EU4A 5TR5A 2D07B 4IM3A 3G7GA 1YJJA 4TKNA 4FSOA 3APCA 2KJHB 2R4NA 2XK5B 4HPMB 2G4DB 1DGJA 1YJIA 2JT4B 4DHJD 1T0YA 1F1HA 2ZEQA 1FMAD 4F8CB 2MX2A 1K53A 1Q9GA 4RLBA 2JF5A 4YSZB 5TISO 5L95C 1Q0WB 2AL3A 2RDHA 1WZ3A 2QCZA 3PGEA 4AJYB 2L32A 2O6VA 1H8CA 4NJ6A 4RM9A 2LI5A 1L0VB 3BINA 1JWUD 2R89A 4A8XC 2B76B 3PGRA 4PUXA 2FNJB 4MSQB 2XTQA 1B1ZA 4DXAB 1XLQA 4CHKA 4RJXA 1OEYA 1CJEA 5IP4D 2OMFA 1ET9A 1SIFA 2KVZA 4PS8A 4LSIA 1R4MI 2L0FA 4X57B 2VZKD 3QX1A 1WSPA 4ZRQA 5DCNA 2LRUA 1N6ZA 2W55A 1STEA 2KZRA 3SU8X 2JMMA 2DYOA 4W9GA 1ZKHA 4REZA 1YMHE 4LNOA 1E8ZA 2ASQA 1ORMA 4W9CA 3M63B 5C1ZA 2XMXA 3ZXRA 4FHJA 1GFOA 3EMNX 5GTHO 2J1NA 1J19A 2WXGA 3AE6B 1CQVA 2JVCA 4ACFA 3SYBA 3MP9A 3BVZA 3PO0A 3VZWX 1V80A 4RF0A 2K5PA 4KGRA 2AXTO 4Q2JA 3AA1A 1JRPA 5D7GA 1SBBB 4US8A 4G75A 4FN2A 2REXA 3BS0A 1E7PB 1E9MA 1LXDA 2EMTA 3IVFA 3LK3B 3URYA 2KACA 3PRMB 1LM8B 1QOFA 2Y5PA 5E6NA 1ZOYB 2L05A 1C3TA 1V6EA 3A4RA 1UGMA 1NVID 2JUOA 3ZTDA 4GCQA 2MSED 3GZNB 4ZHPA 3TBLD 2IBIB 5EE9A 3RT3B 4KSLC 2NTSA 3AA7A 1GUAB 1T0RC 4XZ4A 2KC0A 1OPFA 5BYQA 3DBRI 4AYID 4ANVA 2FCQA 4BOZB 4ANXA 5C2TB 3VXWA 1MPFA 2MHJA 3O65B 2QILA 4FJZA 4BAXA 2D2QA 3NZUA 3QK0A 1OGWA 2N4FA 1ZXHA 2PKOA 3N1ZC 3RZFA 2NPTB 1E90A 1HEZE 2Q5WD 2M07A 1FCLA 2KTFA 2YNKA 3DA4A 3W5VB 2XTRA 3UIPB 2UU7A 2KC1A 3PLVA 4GXBA 4N75A 3T20A 4FOZA 3VTUA 2IDYA 4EZKA 1JALA 1KH0A 1QT9A 1LO5D 1PFDA 3N1XC 3AXCA 3TIXA 4BKSD 1C4PA 3QWZB 3NG0A 2CHZA 4AS1A 1D5XC 3ENEA 3OLMD 3B08A 3A33B 2DYBA 1VZ8A 1CMXB 4E1TA 4L1BA 1ACCA 1XQQA 3LXFA 3N20C 3A9KA 1YNTE 1PGAA 1FNWA 1EWCA 3Q3NC 3OG5A 3AN1A 4FSPA 3RCZA 8PRNA 5LXHA 3AA0B 5DL7A 4A90A 3JSVA 4URKA 2WXIA 1GC6A 3L0WB 1E7UA 3CWIA 5G3AA 1Q5WB 4USAA 5BMIA 5CHWA 3TEXA 2NS5A 1VLBA 1EO6A 1L6UA 4FRTA 2IO3B 1GB4A 2DX5B 3AE8B 1T5XD 3WAMA 1V5TA 3D32A 3KUZA 3Q3OC 2M56B 3Q8CA 2FUHB 4EFOA 2D10A 3ZVVA 1Y8RC 4HJGE 3MC0B 1WRDB 4O3XB 1MFWA 2PPHA 3PF1A 1P7FA 2GOWA 3JVZX 4KR8A 4P1CC 4XYCA 3AAEB 4GF4A 4OVVA 1WIAA 2D3CA 2V0GA 2FBWB 4JLCA 3DDCB 2KYWA 3VY8X 2BQQA 3PGSA 3LK42 1VCBA 2L3ZA 3KQ4A 1C79A 4TQ1A 1WM3A 4MGZE 2WP9B 3KYDD 2Y0HA 1JQ4A 4FZLA 4WURA 3WIMA 3APDA 1YQ4B 2HE7A 2LGIA 1SE4A 2I1KA 4RL9A 3N32A 3ZTCA 1N63A 1VDVA 4PR7A 3SY9A 4YTNB 1C77A 2XNAC 5DPWA 2IWWA 3DCGA 1ZPSA 1C4AA 2SEBD 3KLSX 3PRNA 4DXGA 3R66C 1V97A 3H7PB 3UQBA 1WJNA 4HKQA 3A9JA 1HTQA 4EOYA 4E1SA 2LFUA 3CIRB 2CJNA 2PORA 1XO3A 1WY8A 3RNAC 4XGAB 4JX1C 2SAKA 1LGRA 2WWZA 2LGYA 4NAMA 3TEZA 4PS3A 2FIFA 2LGDA 2WYQA 3PQUA 2N9EB 1ROEA 1L6VA 2QJLA 2W81C 3OJ3A 3QJZA 1VZ7A 1P4TA 2PTLA 4KZCA 3UQAA 3DBRB 3JW0X 2K0LA 3V60A 3GP6A 4QQ1A 1HXUA 3POQA 3TCAA 1NYQA 3T24A 3B2FA 4XC2A 1BMLC 1XEEA 1UH6A 1YQ3B 3FAHA 2V4IB 2WDTB 3V6EB 1FM0D 2WGSA 3U8ZA 2QHOA 1B9RA 1KRHA 2GB1A 2ZLDA 4O4UA 3KVFB 2FCMA 2PEAA 2IGGA 4GSWA 2MRPA 1IYFA 1D4BA 4WJOA 1UBIA 2JX5A 4P7IA 2WQYB 1Z5SB 1TZOA 1N5XA 4FJVB 2LGSA 3DWOX 2WJQA 4MGIE 3AH7A 5AZFA 3H8HA 2UYZB 2BKFA 4KIKB 2R4LA 4A3PA 1UWXA 4DXFA 2WXNA 2DZKA 2L0TA 4B95A 1JROA 4P1BC 2X27X 2LUMA 1T0QC 2V9HA 4JFBA 2WXLA 1JWMD 1UNSA 1ZP0B 3TMPB 1MVKA 2MQJA 3VE1A 1YIWA 2WXQA 4I6LB 2M19A 1RFKA 2BS3B 3N9YC 3BK1A 4XX5A 1SF0A 2KDEB 2K22A 1SXTA 4ICVA 1HXTA 1XD3B 3MTNB 4AYEC 2GBMA 1WX9A 4LNFA 1XXGA 3PHWB 1XCQL 4LJOB 1IP9A 2N9PC 4A6QA 3C5OA 1WYGA 2NR2A 2KDMA 1SJHD 3L08A 3ZKJC 1R4MB 4BVUC 4MM3B 2LHFA 1YX5B 2FGQX 3I63C 1J8CA 4OZCA 2AYOB 1Y56A 2K8HA 5G55A 5HFYA 1TKYA 1E0ZA 5T8IA 5I4DA 3EGRA 3KH0A 4IW0A 2H89B 1H6S1 2L83A 2W80C 3POXA 3VDZA 2PRNA 2XE1A 4HLEA 2K25A 3KWVA 1ZUD2 5IAAC 4EUTA 1KLGD 3GE3C 5G5HA 3R7RA 3UF8A 4KR4A 2DHZA 5GXGB 3ZQ4A 3VZTX 4ZDVA 2ACZB 2XE5A 4B61A 2V3SA 3KZIO 1WE7A 3NUHB 3LB8C 1V86A 4LJPB 5CHVC 2MNHA 4HK2A 2DZJA 4AP4C 2Y0LA 2HJ1A 2MBBB 2DENB 2F1VA 2ZCCA 3VRBB 3QQ8B 5G26A 2LVQA 3P4RB 3RNFC 1E6EB 3APFA 3UIOB 1C76A 2JYEA 2LHEA 1NI2A 3QARA 1YQBA 2WVPA 1M4VA 3RMKC 2LWPA 2LJIA 4M00A 2MEKA 1FXAA 2KAJA 3A9KB 4M8NA 4HJKA 4K81A 5D6JB 3AECB 5IKCM 4K3BA 4NJCA 3S2AA 1V2YA 3KUDB 4N6EB 4PYUA 1N61A 3DBHB 4HPPA 4LTUA 4B9KA 2Y7SA 1GB1A 1MJDA 4AYDC 2C7HA 4W9IA 3ZDMC 4AKRB 1AWDA 4NQLB 5CHFA 2BYFA 3Q8AA 2LZ6A 4DHJB 4F4BA 3CSFA 2WDVB 4NJ7A 4DK5A 2FCSA 2JWZA 3DVGY 4WWMA 4FMSA 1BH3A 4HXDA 1QF6A 4HROA 2KFJA 3BRZA 1C4CA 3OAWA 2XEWA 1EF5A 4ANWA 4S17A 2KDYA 2G1EA 4JWSC 3R2IA 1NYRA 2PLPA 3EUB2 1UUPA 2EKEC 2MJ3A 4BBNC 2ZW1A 3DA3A 4IDIA 2J4UP 5KHOA 4MACA 1V1OA 3R3MA 1ZXIA 3A2SX 3V3XA 3RUIB 1F52A 1KJTA 1SB3C 3Q3MC 3LDZE 4MT5A 4TV3A 2MCNB 3AAEA 2JY6A 1T0SC 2MBEA 1S1QB 4LDTB 4AJWA 3DHHC 4E3CA 4LSFA 3EFCA 3VH3B 2I1JA 2INPE 1S3SG 2ZZPB 4C80A 1WJUA 4XWWA 1VZ6A 1DOXA 3MHZA 4AKMA 2JRIB 2ODJA 1G6JA 3V6CB 1GG3A 2KMMA 4LSEA 3AMZA 3Q6BA 4WIPA 3QHTA 3T9LA 3HOLA 4JE3B 2H88B 2MBQA 1I4RA 1PHOA 3AE5B 2X8XX 1LFDA 1NI3A 3PT2B 2Y5BB 3FILA 1YN3A 2A4ZA 2JZ3B 4KDIC 3PLUA 3KVDD 1CK1A 4RGTA 2VZKB 3WI4A 1E8WA 2KJRA 1AW7A 4HRSA 1QKZA 2RPVA 1FCCC 3NJTA 2V1YA 7PRNA 4ZRKA 2KJ6A 3B2GA 2BT6A 3WA0A 2LVOA 4WWNA 2NBWB 1XLOA 4KGSA 6PRNA 3VTWA 2BB5A 4W9JA 5TSSA 1SSNA 2KC2A 2TSSA 1I4GA 2LUEA 3ZYYX 4M02A 2MH7A 3A0BO 2R88A 3IAS1 3V62A 3O13A 1F77A 3VAWA 2ICIA 3PZ7A 3DBSA 2HJ8A 4EZJA 2K39A 4O3ZA 5B66O 2EMSA 3GZNI 3L54A 3POUA 3RNGC 3QC8B 3PRZA 3QRAA 3BWUD 1P3QU 3LK2A 5DPTA 4UDUC 3WAPA 4A20A 2VH2A 4W9EA 4AWJA 2L8JA 3AAAA 4BKGA 3A4SC 3HM6X 4HDQA 4YTPB 1WF9A 2DAFA 4CYEA 3SZVA 2K9XA 3ZDTA 2XE2A 1IBXA 3M3JA 2CU1A 4LK0M 5D2MB 2KT7A 4WAAA 2PMVA 1UBQA 2QSDA 3P4PB 5KAIO 4CQNA 4AYNA 1DOIA 2PVGC 5B5EO 1JWAD 4ASWC 3PREA 3P2BA 5BYRA 3NZSA 2WX1A 1D3ZA 2WXHA 3IXSA 1T6BX 1WMHA 4OW0A 4N59A 3CMMB 3ZXVA 4HCPB 4RGNA 4NNJB 1MM5A 1F2RC 2CHWA 1BUIC 3PQSA 5AFUL 3BY4B 2AWTA 4MGYE 3PORA 4FQEA 3ZNZB 3JCUO 3GP7A 2LD9A 4BOSC 3UPGA 3T0SA 5G39A 4GDLB 4XWTA 3SFDB 2E6XA 4IWQA 3N30A 1TTNA 2KZ7A 3Q14C 2MBHA 4I6NB 1OSMA 3H6NA 4BBNF 2WLBA 1DOYA 3E56A 1A70A 3WANA 1ZHXA 2WXFA 1U4AA 1WXAA 2IJ0A 4IL6O 2QMTA 3AA6A 5BYSA 2I2YA 3WI5A 2XBBC 4DDID 4G11A 4NAWA 3TUOA 2KQ4X 1V1PA 1N60A 5EE2A 1J7BA 1RLFA 3HWBA 2HD5B 1SEBD 5HKHA 3I5JC 2BGFA 5FR3A 2J7QB 4HPLB 3W5UB 1RAXA 3AI5A 2AQ2B 3Q2AC 1PYWD 1VR9A 1FXTB 3RNBC 1L0XB 2PE9A 1WM2A 5H92C 3U4EG 1NDDA 3QCAA 1M94A 1WR1A 1L2NA 4C56C 1C9FA 2KLCA 3BK2A 4XDDA 2IO0B 1FRDA 4L2YA 2GMIC 4WWOA 3RPFC 4ZRJA 5HI1A 4HCNB 4IC7B 1IZNA 4NPNA 1T16A 1R4NI 1VRAB 1WGYA 4LLGM 4FZMA 2BWES 4E74A 2IZVB 2XG6A 2FUG1 4O3YA 2LEKA 1WI0A 5G5GA 2AL6A 1FPYA 2QEJC 2IO2B 1I4HA 2BYVE 4OZBA 2ZW0A 5AZHA 1T1LA 3ZNID 2PIAA 2JXTA 3H1UA 4D5UA 4FHKA 4HWIB 4LCDE 3T8MA 2BBCA 2G4SA 3T3NA 4JIOU 1JRUA 1OEYJ 3BRYA 3Q3FA 4AUQC 1WXSA 4W9KA 4C7YA 2FAZA 5EE1A 1I4PA 2N9KA 2Z0DB 3DZMA 2NPTA 3WALA 5IYUA 1I35A 1UGJA 2D3AA 1QILA 2Y2XA 3PV1A 4US9A 5FKAC 1C1YB 1X1MA 2JRHA 1E54A 4GDKB 3U7ZA 4XDCA 3ECIA 1HZ6A 2R61A 3KUCB 1IGDA 3GOEA 4MH8A 2OJRA 1E8YA 5IA7A 1OQYA 5JZEB 1ZE3D 2DYMA 4G0NB 2AEHA 1WE6A 3AE2B 4RM8A 4HDOA 4F1SA 1DYQA 1TKGA 4PJ0O 1GFMA 4ICUA 3C19A 3VHTC 3OJ4B 2M06A 3I3TB 4ZOHC 1FIQA 3QAQA 1RM6C 4JPSA 3W1SA 2WXOA 2X9KA 2KWUB 1P9DU 2KHWB 3C8YA 3DQVA 2WS3B 1G90A 5C3JB 5LNK1 4LDTD 5AZGA 3IFWB 5H8YE 1WGGA 2MA9B 2G45B 3FILB 3L16A 4ZYNA 3W9CB 2K1FA 2J0KA 2BVCA 3B0AA 1HXYD 4IOIE 1AN8A 4J6IA 1L5PA 4OVUA 2GLSA 1EF1A 1CZPA 4P16A 4F7ZA 1J7CA 2ZVOA 4LSHA 4UB8O 1QOGA 3PZDA 4GU2A 3ML9A 1GOZA 2V3NA 2KFKB 3VFKA 3R7QA 4YT0B 5DPRA 5DL5A 1PGBA 4AKRA 1L0YB 4DHZE 1TY0A 3ZIMA 3DOWA 2JXXA 3UAQA 3HW9A 2KX3A 4YSXB 5FK9C 2GRIA 2F1CX 2IGHA 2W3SA 3A1QB 3EFUA 2L76A 4D2KA 2GE4A 2ON8A 5H2FO 1C78A 1IBXB 4U9CA 3AE7B 4KV2A 3RULA 2M0XA 2JSVX 1PUTA 3ZLZA 2KQ7A 2J4XA 2L52A 2MBOA 2MJEA 4YL8A 2BW2A 1TIFA 3RFZB 3A0HO 2GBKA 4FESA 1E10A 4B0EA 4DDGD 5BMHA 2D3GA 1EUVB 2OOBB 3NS1A 2BWFA 5J17A 4K7SA 2KXPA 4K1RB 1HA5A 2MP2B 2DBYA 3DVNV 2OJWA 3WCQA 4WJPA 5AEKB 4GHBA 3V8UA 4E71A 1KLUD 2NBUA 2CS4A 3RN9C 5FR6A 3IT6B 2M0AA 3CSTA 4G3XB 1HXXA 2RPQA 2NTTA 2DZIA 4AQ7A 3QA8A 4C69X 1Q1OA 3JYUA 1P0RA 4RMAA 1ET6A 5JH5C 5E79O 2IO1B 4B0MA 1EWYC 2K6DB 4MH0E 4A55A 3C0RB 1J7AA 3W2DA 1UELA 3PVLA 2V4LA 3Q8FA 2DLBA 1UD7A 4RNAA 3VR9B 3AEDB 2LGXA 3NS8A 1P98A 4GIVA 1PRNA 3I9V1 2KWCA 1WZ0A 3NOBA 4II2B 5DL8A 4R3DA 3H9DA 1TBEA 4AUIA 1YJ1A 4GGQA 2R8AA 4ARCA 2DWQA 4CTDA 3Q8BA 3T3OA 3AEEB 3ZJUA 3AAAB 2W82A 4PK1A 3MJ5A 1QJ8A 4HEA1 3PZ8A 4D65A 1MG4A 3O0EA 2ZCBA 2BPSA 1E5WA 2N9XA 2KXJA 3KWLA 2N7EA 3BYTB 2MJDA 3NVZA 3LK3A 2JYTA 3LJ3A 1TT5B 4RFBA 1FO4A 2D11A 2INDC 4LNKA 3RD2A 2UWQA 2GBNA 2PW9A 5J2RA 1QJPA 4ZRPA 2L1AA 3X0WA 5LXIB 3WAOA 1XT9B 3HOEA 1GJZA 2WXKA 3SY7A 3AEBB 2GBJA 4OZAA 1IZNB 2GI9A 3PS6A 1L4ZB 2HTHA 4WQMA 1MG8A 3W1SC 4KZ0A 1WMHB 4G76A 5ADXK 1Z2MA 2KKCA 3AU4A 4J3OD 5IO9A 2CU3A 2IGDA 5G38A 2L00B 4O49A 2INNE 4GOCA 1MHXA 1I42A 2I38A 4DBGA 1F0ZA 1TS5A 5CTRC 1NBFC 2RMMA 4II3B 1YN4A 3JSVB 1V8CA 4AYMC 3DWNA 3ETRA 3QIJA 4MJSA 4WJQA 1P1AA 2Z59B 2WDQB 2ZJDA 3BZDB 1Q9FA 3PTFC 2ZPYA 2WXMA 1KTKA 2WU5B 3JTYA 3VQIA 3P63A 2K3UA 4AOFA
chains in the Genus database with same CATH topology
2X8XX 4C4VB 4C4VA 2V9HA 4PK1A 3OG5A 2VH1A 2QDFA 4XGAB 3MC8A 3MC9A 4K3CA 3Q6BA 2QCZA 4N74A 4QAYA 4BZAA 4N75A 2MHJA 4C00A 3NJTA 3EFCA 2VH2A 4K3BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2X8X X;  4C4V B;  4C4V A;  2V9H A;  4PK1 A;  3OG5 A;  2VH1 A;  2QDF A;  4XGA B;  3MC8 A;  3MC9 A;  4K3C A;  3Q6B A;  2QCZ A;  4N74 A;  4QAY A;  4BZA A;  4N75 A;  2MHJ A;  4C00 A;  3NJT A;  3EFC A;  2VH2 A;  4K3B A; 
#chains in the Genus database with same CATH topology
 3V61 A;  3E9S A;  1PDX A;  3VTV A;  1YN5 A;  1L4D B;  3A1Q A;  1HQR D;  1QQR A;  2MLB A;  4KX6 B;  3PGU A;  5IN7 A;  4RGM A;  1GAQ B;  4PT5 A;  5EDS A;  2ZFG A;  1WXM A;  5L83 A;  2RDG A;  3TJP A;  4FT6 A;  4MM3 A;  1BXT A;  1GFP A;  4BUM X;  2EKI A;  3TEW A;  2JWU A;  3VVW B;  2R2O A;  4FLH A;  3HRD D;  2YEP F;  3H7S A;  1V5O A;  2O2V A;  1MM4 A;  2NBV B;  4FAD A;  5D5D A;  2W54 A;  2C9W B;  3U52 E;  5MPO A;  2O2V B;  4WQO B;  4IG7 B;  1OFF A;  5C23 A;  2LRW A;  3HHM A;  2Y3A A;  1YX6 B;  3NY5 A;  2YVC A;  2LMC A;  3AEA B;  4TSS A;  2DZM A;  3U30 A;  1NEK B;  5E6O A;  2O4V A;  3SD5 A;  1VJK A;  4MGK E;  4BZA A;  2W3R A;  2BF8 B;  4JGH B;  2J0M A;  3NSG A;  5BO4 B;  1FNV A;  1JCK B;  4KRA A;  2GBR A;  5PRN A;  4FRX A;  1K8R B;  5J18 A;  2RR9 A;  3X23 A;  4D64 A;  1WJ6 A;  4G50 A;  1TZ1 A;  3ZUN A;  4N58 A;  1WXQ A;  3SHQ A;  2N1V A;  5E6J A;  5LLI A;  3NVY A;  2G9H D;  2ERV A;  1WGR A;  1WX7 A;  2A5U A;  4M0W B;  3Q8E A;  2KX0 A;  2XN9 C;  2WJR A;  3TSS A;  3AUL A;  3VH4 B;  5GMV A;  4C4V B;  1OTR B;  2C7N B;  2KWV B;  2JU6 X;  5E6P A;  1K52 A;  4FXC A;  3VUY A;  2LHD A;  3ONS A;  3VR8 B;  3L4P A;  5HHD G;  3AE9 B;  3DBH I;  2KTR B;  2JZP A;  4RJW A;  1FFV A;  1QZE A;  1J0G A;  4DWF A;  1XCT L;  4JQW C;  1IUE A;  1A5R A;  3ZGZ A;  2VRR B;  1WWT A;  3PRP B;  4MDK E;  3FKY A;  3SZD A;  4NQK E;  1OQR A;  5DL6 A;  1EM7 A;  2L7R A;  1TJE A;  5HG2 A;  3HIZ A;  1JML A;  1TY2 A;  2BB6 A;  2QDF A;  4NY0 A;  3M62 B;  3GB1 A;  4IKG A;  1GC7 A;  4K3C A;  5GV0 A;  4KIK A;  3BVG A;  1QJ9 A;  3HVD A;  2INC C;  2KNB A;  1FNU A;  2Y0K A;  4M0W A;  4EZL A;  1WGD A;  4FUL A;  3BVM A;  4A9A A;  3WU2 O;  5JXV A;  2M1M A;  3R2T A;  1K50 A;  1PQS A;  5AUK A;  4Z3T A;  2KQS A;  3R8B A;  3KW5 B;  1UWM A;  4C7Z A;  1HTO A;  4S0R A;  1WGH A;  1EU3 A;  3ALB A;  2AQ3 B;  3EEC A;  1ZHY A;  4N74 A;  2KWD A;  3A9J B;  3P4S B;  1ZHZ A;  3QRC A;  1I4Q A;  2K0P A;  4LNI A;  3VY9 X;  2WDR B;  2KDI A;  3AEF B;  4IM0 A;  2KZ7 B;  2N2M A;  2X38 A;  3ZO5 B;  1TGZ B;  1ESF A;  1BXW A;  4I6P A;  5GTI O;  3HM3 A;  1WR6 E;  2JQR B;  1P7E A;  2J52 A;  3AA7 B;  5AFU K;  3B1L X;  2N2L A;  2N9L A;  2XE3 A;  2FCN A;  1I4X A;  3DVN U;  2W9N A;  3DVG X;  2WU2 B;  4RGO S;  3IHP C;  2M4N A;  2KTR A;  2ZVN A;  3ZNG C;  4A3O A;  1GFN A;  2IPK D;  1WFY A;  4XE0 A;  2C60 A;  1WGK A;  2G3Q B;  4KGT A;  2KDF B;  3ZJT A;  2MHL A;  2DAJ A;  2BYT A;  2B3A A;  3EC8 A;  2AX5 A;  5EE3 A;  1ZDX A;  3BYY B;  1E7V A;  1SE2 A;  1WYW B;  3K9O B;  2LFI A;  2RDB C;  3MFG A;  1Q10 A;  4LNN A;  2MP2 A;  1R4N B;  4MEL A;  3DBL I;  4JWU C;  1WRI A;  4GN1 A;  3P4Q B;  4IWO A;  3U7D A;  3NZ3 A;  1QOA A;  1K51 A;  2RGF A;  1RFA A;  2QTK A;  4BKS A;  1KFY B;  1SIJ A;  2BS4 B;  4TQ0 A;  3MC8 A;  4XNL A;  1QLB B;  2KMC A;  1FEH A;  4BKT A;  2R4O A;  4MEM A;  3V05 A;  4O3W A;  5EE0 A;  2R2Q A;  1HE8 A;  1OQQ A;  3VUX A;  4H2A A;  1SE3 A;  2ZNV C;  2KMA A;  4ZRI A;  1ZDV A;  1QOB A;  1FXI A;  3GS2 A;  2F1T A;  2E3T A;  3MJW A;  5G2N A;  2WXR A;  4PYZ A;  2YLM A;  4CO7 A;  5JDP A;  4GDK A;  1NEN B;  2K8B A;  1WJ4 A;  3AEG B;  1MPE A;  2K6Q A;  2KLG A;  1AYF A;  4DHZ B;  1KOT A;  4N9F 4;  3FYX A;  1UF0 A;  2KVR A;  2FE8 A;  3EA6 A;  3P42 A;  3SFE B;  3UI3 A;  3ZNH B;  2NMQ A;  2KDB A;  1KLV A;  3AB5 A;  4YXD B;  1V49 A;  1UZX B;  4JCH A;  2Z0E B;  4DQO C;  3MHS D;  5D94 A;  3MC9 A;  3AA0 A;  3DHI C;  4IM2 A;  4XNK A;  2JZZ A;  1T3Q A;  1MI0 A;  2IWV A;  2BS2 B;  3ZJV A;  4RCO A;  4RLC A;  3DPD A;  4JL9 A;  3SYS A;  3J9C A;  2FID A;  2LXC A;  3AA6 B;  1F2R I;  2EEL A;  1S5L O;  1H4R A;  3VUW A;  3N3K B;  2J42 A;  2C5L C;  2LVP A;  2ZPN A;  4TMA B;  2RD0 A;  3ML8 A;  3TZG A;  1THQ A;  3HVZ A;  2K4T A;  4B6W A;  3AA1 B;  2WXP A;  4AZL A;  1MHH E;  2CJO A;  1L7Y A;  2KK8 A;  1VD2 A;  5AUI A;  4O1N A;  2JPH A;  3DWM A;  3IAM 1;  1ENF A;  3PPA A;  4GCS A;  1D6E C;  4QAY A;  1V1P B;  4HKZ E;  3L17 A;  2MW5 A;  2V3P A;  3RI7 C;  3PHX B;  2N0S B;  4FJY A;  3AE1 B;  1F9J A;  2KAN A;  1RYJ A;  4YWG G;  3AE4 B;  3SR6 A;  2C7M B;  3NVV A;  4GLS C;  2IY0 B;  3RZW C;  5ADX L;  3TEY A;  4L23 A;  1YOV B;  5D3D A;  1KM7 A;  5JHB A;  4ARI A;  5DPS A;  4W9D A;  4ZHO A;  5IOI A;  1FRR A;  1PGX A;  1TS4 A;  4HVB A;  4W9L A;  2HTM E;  2LXA A;  3W1Y A;  3IBE A;  3Q3J A;  3L13 A;  5CX3 A;  4WWP A;  1GPX A;  1D5Z C;  4OVZ A;  3VE2 A;  2DNF A;  3OWE B;  4UB6 O;  2N1W A;  1JWB D;  3ZW3 A;  2FGR A;  3LK2 B;  2KD0 A;  3SDL C;  1SE9 A;  4FA6 A;  5KHQ A;  4NZL B;  2OED A;  2RSU A;  3AE3 B;  2D3B A;  2LJ5 A;  1FFU A;  4RH6 A;  1IPG A;  4YTM B;  4YSY B;  2YEP B;  3RBH A;  1KF6 B;  3SEB A;  1RWS A;  2MWS B;  3UIN B;  3FC4 A;  3AU5 A;  2CHX A;  4MSM B;  2Z8L A;  2KXP B;  4EKU A;  1TKE A;  1XF5 L;  2IY1 B;  3ABV B;  4KVG B;  2PVO D;  3H7P A;  2Y5C A;  4KSK C;  5FVN A;  2KOX A;  1ZGU B;  2HDE A;  1RRB A;  4KKJ A;  1JWS D;  3B9J A;  1JW9 D;  1YS5 A;  4FZN A;  1N5W A;  1GNU A;  2QIE B;  2J53 A;  2LAS A;  4ZYS A;  1E8X A;  4ITK A;  3UGB B;  2O6V B;  3I57 A;  1ZHW A;  2QC8 A;  3UU2 A;  4M8M A;  3DWG C;  3RYT A;  4C4V A;  3NVW A;  4BFR A;  2M17 A;  3K9P B;  3LK4 1;  2KN5 A;  1V81 A;  4MJS B;  2M8S A;  3U2S C;  4GCP A;  1R7S A;  3AV8 A;  4WAF A;  4EE2 A;  1XLN A;  2O6V D;  2XK5 A;  4RF1 A;  2BTE A;  3GE8 C;  2WX0 A;  2R4P A;  1BT0 A;  3RNE C;  4W9H A;  3ZRF A;  3IT4 B;  1SJE D;  1I7H A;  2KN4 A;  2CKH B;  2JQY A;  5KAF O;  4GB9 A;  1YD8 U;  2WHI A;  4ANU A;  1SGH A;  4P6V F;  4NAW B;  3N1Y C;  3AM9 A;  2D5G A;  4AFK A;  4IWP A;  3M95 A;  2WXJ A;  4WH4 A;  1TYG B;  3L10 B;  3RNC C;  3VRA B;  1WH3 A;  2OHF A;  3BII D;  2N7J A;  2KFK A;  4KDL B;  2YPV A;  2ZNV B;  4TUU A;  1XLP A;  2BKR B;  4IUM B;  2VH1 A;  4K7U A;  3NHE B;  1TS2 A;  4GDL A;  1LQB A;  4M01 A;  2K8C A;  1FD6 A;  4KKI A;  3PSE B;  2PE6 B;  3KYC D;  3K19 A;  1ISN A;  3LYY A;  1WXV A;  4PS7 A;  2N7D A;  3DBL B;  3DHG C;  3HK0 A;  2PJH A;  1AAR A;  2KO3 A;  2WNM A;  1IGC A;  2ONQ A;  2BYE A;  4WJN A;  2CR5 A;  2J0J A;  5T5F A;  3TL5 A;  1V9J A;  1ZW7 A;  5JHA A;  3P1M A;  3IG3 A;  5D3I B;  5BMG A;  4FBJ B;  1D5M C;  3CF6 E;  1BT9 A;  2NCN A;  1ZHT A;  1GFQ A;  3VZU X;  3Q69 A;  2IYD B;  4EEW A;  1HZ5 A;  2NVU I;  4OHJ A;  4C00 A;  1WX8 A;  3HUI A;  1N62 A;  4K7W A;  4W9F A;  2AQ1 B;  4O4X A;  3EHV A;  4FUV A;  3NRZ A;  3ZRC A;  4GMV A;  1TS3 A;  1EU4 A;  5TR5 A;  2D07 B;  4IM3 A;  3G7G A;  1YJJ A;  4TKN A;  4FSO A;  3APC A;  2KJH B;  2R4N A;  2XK5 B;  4HPM B;  2G4D B;  1DGJ A;  1YJI A;  2JT4 B;  4DHJ D;  1T0Y A;  1F1H A;  2ZEQ A;  1FMA D;  4F8C B;  2MX2 A;  1K53 A;  1Q9G A;  4RLB A;  2JF5 A;  4YSZ B;  5TIS O;  5L95 C;  1Q0W B;  2AL3 A;  2RDH A;  1WZ3 A;  2QCZ A;  3PGE A;  4AJY B;  2L32 A;  2O6V A;  1H8C A;  4NJ6 A;  4RM9 A;  2LI5 A;  1L0V B;  3BIN A;  1JWU D;  2R89 A;  4A8X C;  2B76 B;  3PGR A;  4PUX A;  2FNJ B;  4MSQ B;  2XTQ A;  1B1Z A;  4DXA B;  1XLQ A;  4CHK A;  4RJX A;  1OEY A;  1CJE A;  5IP4 D;  2OMF A;  1ET9 A;  1SIF A;  2KVZ A;  4PS8 A;  4LSI A;  1R4M I;  2L0F A;  4X57 B;  2VZK D;  3QX1 A;  1WSP A;  4ZRQ A;  5DCN A;  2LRU A;  1N6Z A;  2W55 A;  1STE A;  2KZR A;  3SU8 X;  2JMM A;  2DYO A;  4W9G A;  1ZKH A;  4REZ A;  1YMH E;  4LNO A;  1E8Z A;  2ASQ A;  1ORM A;  4W9C A;  3M63 B;  5C1Z A;  2XMX A;  3ZXR A;  4FHJ A;  1GFO A;  3EMN X;  5GTH O;  2J1N A;  1J19 A;  2WXG A;  3AE6 B;  1CQV A;  2JVC A;  4ACF A;  3SYB A;  3MP9 A;  3BVZ A;  3PO0 A;  3VZW X;  1V80 A;  4RF0 A;  2K5P A;  4KGR A;  2AXT O;  4Q2J A;  3AA1 A;  1JRP A;  5D7G A;  1SBB B;  4US8 A;  4G75 A;  4FN2 A;  2REX A;  3BS0 A;  1E7P B;  1E9M A;  1LXD A;  2EMT A;  3IVF A;  3LK3 B;  3URY A;  2KAC A;  3PRM B;  1LM8 B;  1QOF A;  2Y5P A;  5E6N A;  1ZOY B;  2L05 A;  1C3T A;  1V6E A;  3A4R A;  1UGM A;  1NVI D;  2JUO A;  3ZTD A;  4GCQ A;  2MSE D;  3GZN B;  4ZHP A;  3TBL D;  2IBI B;  5EE9 A;  3RT3 B;  4KSL C;  2NTS A;  3AA7 A;  1GUA B;  1T0R C;  4XZ4 A;  2KC0 A;  1OPF A;  5BYQ A;  3DBR I;  4AYI D;  4ANV A;  2FCQ A;  4BOZ B;  4ANX A;  5C2T B;  3VXW A;  1MPF A;  2MHJ A;  3O65 B;  2QIL A;  4FJZ A;  4BAX A;  2D2Q A;  3NZU A;  3QK0 A;  1OGW A;  2N4F A;  1ZXH A;  2PKO A;  3N1Z C;  3RZF A;  2NPT B;  1E90 A;  1HEZ E;  2Q5W D;  2M07 A;  1FCL A;  2KTF A;  2YNK A;  3DA4 A;  3W5V B;  2XTR A;  3UIP B;  2UU7 A;  2KC1 A;  3PLV A;  4GXB A;  4N75 A;  3T20 A;  4FOZ A;  3VTU A;  2IDY A;  4EZK A;  1JAL A;  1KH0 A;  1QT9 A;  1LO5 D;  1PFD A;  3N1X C;  3AXC A;  3TIX A;  4BKS D;  1C4P A;  3QWZ B;  3NG0 A;  2CHZ A;  4AS1 A;  1D5X C;  3ENE A;  3OLM D;  3B08 A;  3A33 B;  2DYB A;  1VZ8 A;  1CMX B;  4E1T A;  4L1B A;  1ACC A;  1XQQ A;  3LXF A;  3N20 C;  3A9K A;  1YNT E;  1PGA A;  1FNW A;  1EWC A;  3Q3N C;  3OG5 A;  3AN1 A;  4FSP A;  3RCZ A;  8PRN A;  5LXH A;  3AA0 B;  5DL7 A;  4A90 A;  3JSV A;  4URK A;  2WXI A;  1GC6 A;  3L0W B;  1E7U A;  3CWI A;  5G3A A;  1Q5W B;  4USA A;  5BMI A;  5CHW A;  3TEX A;  2NS5 A;  1VLB A;  1EO6 A;  1L6U A;  4FRT A;  2IO3 B;  1GB4 A;  2DX5 B;  3AE8 B;  1T5X D;  3WAM A;  1V5T A;  3D32 A;  3KUZ A;  3Q3O C;  2M56 B;  3Q8C A;  2FUH B;  4EFO A;  2D10 A;  3ZVV A;  1Y8R C;  4HJG E;  3MC0 B;  1WRD B;  4O3X B;  1MFW A;  2PPH A;  3PF1 A;  1P7F A;  2GOW A;  3JVZ X;  4KR8 A;  4P1C C;  4XYC A;  3AAE B;  4GF4 A;  4OVV A;  1WIA A;  2D3C A;  2V0G A;  2FBW B;  4JLC A;  3DDC B;  2KYW A;  3VY8 X;  2BQQ A;  3PGS A;  3LK4 2;  1VCB A;  2L3Z A;  3KQ4 A;  1C79 A;  4TQ1 A;  1WM3 A;  4MGZ E;  2WP9 B;  3KYD D;  2Y0H A;  1JQ4 A;  4FZL A;  4WUR A;  3WIM A;  3APD A;  1YQ4 B;  2HE7 A;  2LGI A;  1SE4 A;  2I1K A;  4RL9 A;  3N32 A;  3ZTC A;  1N63 A;  1VDV A;  4PR7 A;  3SY9 A;  4YTN B;  1C77 A;  2XNA C;  5DPW A;  2IWW A;  3DCG A;  1ZPS A;  1C4A A;  2SEB D;  3KLS X;  3PRN A;  4DXG A;  3R66 C;  1V97 A;  3H7P B;  3UQB A;  1WJN A;  4HKQ A;  3A9J A;  1HTQ A;  4EOY A;  4E1S A;  2LFU A;  3CIR B;  2CJN A;  2POR A;  1XO3 A;  1WY8 A;  3RNA C;  4XGA B;  4JX1 C;  2SAK A;  1LGR A;  2WWZ A;  2LGY A;  4NAM A;  3TEZ A;  4PS3 A;  2FIF A;  2LGD A;  2WYQ A;  3PQU A;  2N9E B;  1ROE A;  1L6V A;  2QJL A;  2W81 C;  3OJ3 A;  3QJZ A;  1VZ7 A;  1P4T A;  2PTL A;  4KZC A;  3UQA A;  3DBR B;  3JW0 X;  2K0L A;  3V60 A;  3GP6 A;  4QQ1 A;  1HXU A;  3POQ A;  3TCA A;  1NYQ A;  3T24 A;  3B2F A;  4XC2 A;  1BML C;  1XEE A;  1UH6 A;  1YQ3 B;  3FAH A;  2V4I B;  2WDT B;  3V6E B;  1FM0 D;  2WGS A;  3U8Z A;  2QHO A;  1B9R A;  1KRH A;  2GB1 A;  2ZLD A;  4O4U A;  3KVF B;  2FCM A;  2PEA A;  2IGG A;  4GSW A;  2MRP A;  1IYF A;  1D4B A;  4WJO A;  1UBI A;  2JX5 A;  4P7I A;  2WQY B;  1Z5S B;  1TZO A;  1N5X A;  4FJV B;  2LGS A;  3DWO X;  2WJQ A;  4MGI E;  3AH7 A;  5AZF A;  3H8H A;  2UYZ B;  2BKF A;  4KIK B;  2R4L A;  4A3P A;  1UWX A;  4DXF A;  2WXN A;  2DZK A;  2L0T A;  4B95 A;  1JRO A;  4P1B C;  2X27 X;  2LUM A;  1T0Q C;  2V9H A;  4JFB A;  2WXL A;  1JWM D;  1UNS A;  1ZP0 B;  3TMP B;  1MVK A;  2MQJ A;  3VE1 A;  1YIW A;  2WXQ A;  4I6L B;  2M19 A;  1RFK A;  2BS3 B;  3N9Y C;  3BK1 A;  4XX5 A;  1SF0 A;  2KDE B;  2K22 A;  1SXT A;  4ICV A;  1HXT A;  1XD3 B;  3MTN B;  4AYE C;  2GBM A;  1WX9 A;  4LNF A;  1XXG A;  3PHW B;  1XCQ L;  4LJO B;  1IP9 A;  2N9P C;  4A6Q A;  3C5O A;  1WYG A;  2NR2 A;  2KDM A;  1SJH D;  3L08 A;  3ZKJ C;  1R4M B;  4BVU C;  4MM3 B;  2LHF A;  1YX5 B;  2FGQ X;  3I63 C;  1J8C A;  4OZC A;  2AYO B;  1Y56 A;  2K8H A;  5G55 A;  5HFY A;  1TKY A;  1E0Z A;  5T8I A;  5I4D A;  3EGR A;  3KH0 A;  4IW0 A;  2H89 B;  1H6S 1;  2L83 A;  2W80 C;  3POX A;  3VDZ A;  2PRN A;  2XE1 A;  4HLE A;  2K25 A;  3KWV A;  1ZUD 2;  5IAA C;  4EUT A;  1KLG D;  3GE3 C;  5G5H A;  3R7R A;  3UF8 A;  4KR4 A;  2DHZ A;  5GXG B;  3ZQ4 A;  3VZT X;  4ZDV A;  2ACZ B;  2XE5 A;  4B61 A;  2V3S A;  3KZI O;  1WE7 A;  3NUH B;  3LB8 C;  1V86 A;  4LJP B;  5CHV C;  2MNH A;  4HK2 A;  2DZJ A;  4AP4 C;  2Y0L A;  2HJ1 A;  2MBB B;  2DEN B;  2F1V A;  2ZCC A;  3VRB B;  3QQ8 B;  5G26 A;  2LVQ A;  3P4R B;  3RNF C;  1E6E B;  3APF A;  3UIO B;  1C76 A;  2JYE A;  2LHE A;  1NI2 A;  3QAR A;  1YQB A;  2WVP A;  1M4V A;  3RMK C;  2LWP A;  2LJI A;  4M00 A;  2MEK A;  1FXA A;  2KAJ A;  3A9K B;  4M8N A;  4HJK A;  4K81 A;  5D6J B;  3AEC B;  5IKC M;  4K3B A;  4NJC A;  3S2A A;  1V2Y A;  3KUD B;  4N6E B;  4PYU A;  1N61 A;  3DBH B;  4HPP A;  4LTU A;  4B9K A;  2Y7S A;  1GB1 A;  1MJD A;  4AYD C;  2C7H A;  4W9I A;  3ZDM C;  4AKR B;  1AWD A;  4NQL B;  5CHF A;  2BYF A;  3Q8A A;  2LZ6 A;  4DHJ B;  4F4B A;  3CSF A;  2WDV B;  4NJ7 A;  4DK5 A;  2FCS A;  2JWZ A;  3DVG Y;  4WWM A;  4FMS A;  1BH3 A;  4HXD A;  1QF6 A;  4HRO A;  2KFJ A;  3BRZ A;  1C4C A;  3OAW A;  2XEW A;  1EF5 A;  4ANW A;  4S17 A;  2KDY A;  2G1E A;  4JWS C;  3R2I A;  1NYR A;  2PLP A;  3EUB 2;  1UUP A;  2EKE C;  2MJ3 A;  4BBN C;  2ZW1 A;  3DA3 A;  4IDI A;  2J4U P;  5KHO A;  4MAC A;  1V1O A;  3R3M A;  1ZXI A;  3A2S X;  3V3X A;  3RUI B;  1F52 A;  1KJT A;  1SB3 C;  3Q3M C;  3LDZ E;  4MT5 A;  4TV3 A;  2MCN B;  3AAE A;  2JY6 A;  1T0S C;  2MBE A;  1S1Q B;  4LDT B;  4AJW A;  3DHH C;  4E3C A;  4LSF A;  3EFC A;  3VH3 B;  2I1J A;  2INP E;  1S3S G;  2ZZP B;  4C80 A;  1WJU A;  4XWW A;  1VZ6 A;  1DOX A;  3MHZ A;  4AKM A;  2JRI B;  2ODJ A;  1G6J A;  3V6C B;  1GG3 A;  2KMM A;  4LSE A;  3AMZ A;  3Q6B A;  4WIP A;  3QHT A;  3T9L A;  3HOL A;  4JE3 B;  2H88 B;  2MBQ A;  1I4R A;  1PHO A;  3AE5 B;  2X8X X;  1LFD A;  1NI3 A;  3PT2 B;  2Y5B B;  3FIL A;  1YN3 A;  2A4Z A;  2JZ3 B;  4KDI C;  3PLU A;  3KVD D;  1CK1 A;  4RGT A;  2VZK B;  3WI4 A;  1E8W A;  2KJR A;  1AW7 A;  4HRS A;  1QKZ A;  2RPV A;  1FCC C;  3NJT A;  2V1Y A;  7PRN A;  4ZRK A;  2KJ6 A;  3B2G A;  2BT6 A;  3WA0 A;  2LVO A;  4WWN A;  2NBW B;  1XLO A;  4KGS A;  6PRN A;  3VTW A;  2BB5 A;  4W9J A;  5TSS A;  1SSN A;  2KC2 A;  2TSS A;  1I4G A;  2LUE A;  3ZYY X;  4M02 A;  2MH7 A;  3A0B O;  2R88 A;  3IAS 1;  3V62 A;  3O13 A;  1F77 A;  3VAW A;  2ICI A;  3PZ7 A;  3DBS A;  2HJ8 A;  4EZJ A;  2K39 A;  4O3Z A;  5B66 O;  2EMS A;  3GZN I;  3L54 A;  3POU A;  3RNG C;  3QC8 B;  3PRZ A;  3QRA A;  3BWU D;  1P3Q U;  3LK2 A;  5DPT A;  4UDU C;  3WAP A;  4A20 A;  2VH2 A;  4W9E A;  4AWJ A;  2L8J A;  3AAA A;  4BKG A;  3A4S C;  3HM6 X;  4HDQ A;  4YTP B;  1WF9 A;  2DAF A;  4CYE A;  3SZV A;  2K9X A;  3ZDT A;  2XE2 A;  1IBX A;  3M3J A;  2CU1 A;  4LK0 M;  5D2M B;  2KT7 A;  4WAA A;  2PMV A;  1UBQ A;  2QSD A;  3P4P B;  5KAI O;  4CQN A;  4AYN A;  1DOI A;  2PVG C;  5B5E O;  1JWA D;  4ASW C;  3PRE A;  3P2B A;  5BYR A;  3NZS A;  2WX1 A;  1D3Z A;  2WXH A;  3IXS A;  1T6B X;  1WMH A;  4OW0 A;  4N59 A;  3CMM B;  3ZXV A;  4HCP B;  4RGN A;  4NNJ B;  1MM5 A;  1F2R C;  2CHW A;  1BUI C;  3PQS A;  5AFU L;  3BY4 B;  2AWT A;  4MGY E;  3POR A;  4FQE A;  3ZNZ B;  3JCU O;  3GP7 A;  2LD9 A;  4BOS C;  3UPG A;  3T0S A;  5G39 A;  4GDL B;  4XWT A;  3SFD B;  2E6X A;  4IWQ A;  3N30 A;  1TTN A;  2KZ7 A;  3Q14 C;  2MBH A;  4I6N B;  1OSM A;  3H6N A;  4BBN F;  2WLB A;  1DOY A;  3E56 A;  1A70 A;  3WAN A;  1ZHX A;  2WXF A;  1U4A A;  1WXA A;  2IJ0 A;  4IL6 O;  2QMT A;  3AA6 A;  5BYS A;  2I2Y A;  3WI5 A;  2XBB C;  4DDI D;  4G11 A;  4NAW A;  3TUO A;  2KQ4 X;  1V1P A;  1N60 A;  5EE2 A;  1J7B A;  1RLF A;  3HWB A;  2HD5 B;  1SEB D;  5HKH A;  3I5J C;  2BGF A;  5FR3 A;  2J7Q B;  4HPL B;  3W5U B;  1RAX A;  3AI5 A;  2AQ2 B;  3Q2A C;  1PYW D;  1VR9 A;  1FXT B;  3RNB C;  1L0X B;  2PE9 A;  1WM2 A;  5H92 C;  3U4E G;  1NDD A;  3QCA A;  1M94 A;  1WR1 A;  1L2N A;  4C56 C;  1C9F A;  2KLC A;  3BK2 A;  4XDD A;  2IO0 B;  1FRD A;  4L2Y A;  2GMI C;  4WWO A;  3RPF C;  4ZRJ A;  5HI1 A;  4HCN B;  4IC7 B;  1IZN A;  4NPN A;  1T16 A;  1R4N I;  1VRA B;  1WGY A;  4LLG M;  4FZM A;  2BWE S;  4E74 A;  2IZV B;  2XG6 A;  2FUG 1;  4O3Y A;  2LEK A;  1WI0 A;  5G5G A;  2AL6 A;  1FPY A;  2QEJ C;  2IO2 B;  1I4H A;  2BYV E;  4OZB A;  2ZW0 A;  5AZH A;  1T1L A;  3ZNI D;  2PIA A;  2JXT A;  3H1U A;  4D5U A;  4FHK A;  4HWI B;  4LCD E;  3T8M A;  2BBC A;  2G4S A;  3T3N A;  4JIO U;  1JRU A;  1OEY J;  3BRY A;  3Q3F A;  4AUQ C;  1WXS A;  4W9K A;  4C7Y A;  2FAZ A;  5EE1 A;  1I4P A;  2N9K A;  2Z0D B;  3DZM A;  2NPT A;  3WAL A;  5IYU A;  1I35 A;  1UGJ A;  2D3A A;  1QIL A;  2Y2X A;  3PV1 A;  4US9 A;  5FKA C;  1C1Y B;  1X1M A;  2JRH A;  1E54 A;  4GDK B;  3U7Z A;  4XDC A;  3ECI A;  1HZ6 A;  2R61 A;  3KUC B;  1IGD A;  3GOE A;  4MH8 A;  2OJR A;  1E8Y A;  5IA7 A;  1OQY A;  5JZE B;  1ZE3 D;  2DYM A;  4G0N B;  2AEH A;  1WE6 A;  3AE2 B;  4RM8 A;  4HDO A;  4F1S A;  1DYQ A;  1TKG A;  4PJ0 O;  1GFM A;  4ICU A;  3C19 A;  3VHT C;  3OJ4 B;  2M06 A;  3I3T B;  4ZOH C;  1FIQ A;  3QAQ A;  1RM6 C;  4JPS A;  3W1S A;  2WXO A;  2X9K A;  2KWU B;  1P9D U;  2KHW B;  3C8Y A;  3DQV A;  2WS3 B;  1G90 A;  5C3J B;  5LNK 1;  4LDT D;  5AZG A;  3IFW B;  5H8Y E;  1WGG A;  2MA9 B;  2G45 B;  3FIL B;  3L16 A;  4ZYN A;  3W9C B;  2K1F A;  2J0K A;  2BVC A;  3B0A A;  1HXY D;  4IOI E;  1AN8 A;  4J6I A;  1L5P A;  4OVU A;  2GLS A;  1EF1 A;  1CZP A;  4P16 A;  4F7Z A;  1J7C A;  2ZVO A;  4LSH A;  4UB8 O;  1QOG A;  3PZD A;  4GU2 A;  3ML9 A;  1GOZ A;  2V3N A;  2KFK B;  3VFK A;  3R7Q A;  4YT0 B;  5DPR A;  5DL5 A;  1PGB A;  4AKR A;  1L0Y B;  4DHZ E;  1TY0 A;  3ZIM A;  3DOW A;  2JXX A;  3UAQ A;  3HW9 A;  2KX3 A;  4YSX B;  5FK9 C;  2GRI A;  2F1C X;  2IGH A;  2W3S A;  3A1Q B;  3EFU A;  2L76 A;  4D2K A;  2GE4 A;  2ON8 A;  5H2F O;  1C78 A;  1IBX B;  4U9C A;  3AE7 B;  4KV2 A;  3RUL A;  2M0X A;  2JSV X;  1PUT A;  3ZLZ A;  2KQ7 A;  2J4X A;  2L52 A;  2MBO A;  2MJE A;  4YL8 A;  2BW2 A;  1TIF A;  3RFZ B;  3A0H O;  2GBK A;  4FES A;  1E10 A;  4B0E A;  4DDG D;  5BMH A;  2D3G A;  1EUV B;  2OOB B;  3NS1 A;  2BWF A;  5J17 A;  4K7S A;  2KXP A;  4K1R B;  1HA5 A;  2MP2 B;  2DBY A;  3DVN V;  2OJW A;  3WCQ A;  4WJP A;  5AEK B;  4GHB A;  3V8U A;  4E71 A;  1KLU D;  2NBU A;  2CS4 A;  3RN9 C;  5FR6 A;  3IT6 B;  2M0A A;  3CST A;  4G3X B;  1HXX A;  2RPQ A;  2NTT A;  2DZI A;  4AQ7 A;  3QA8 A;  4C69 X;  1Q1O A;  3JYU A;  1P0R A;  4RMA A;  1ET6 A;  5JH5 C;  5E79 O;  2IO1 B;  4B0M A;  1EWY C;  2K6D B;  4MH0 E;  4A55 A;  3C0R B;  1J7A A;  3W2D A;  1UEL A;  3PVL A;  2V4L A;  3Q8F A;  2DLB A;  1UD7 A;  4RNA A;  3VR9 B;  3AED B;  2LGX A;  3NS8 A;  1P98 A;  4GIV A;  1PRN A;  3I9V 1;  2KWC A;  1WZ0 A;  3NOB A;  4II2 B;  5DL8 A;  4R3D A;  3H9D A;  1TBE A;  4AUI A;  1YJ1 A;  4GGQ A;  2R8A A;  4ARC A;  2DWQ A;  4CTD A;  3Q8B A;  3T3O A;  3AEE B;  3ZJU A;  3AAA B;  2W82 A;  4PK1 A;  3MJ5 A;  1QJ8 A;  4HEA 1;  3PZ8 A;  4D65 A;  1MG4 A;  3O0E A;  2ZCB A;  2BPS A;  1E5W A;  2N9X A;  2KXJ A;  3KWL A;  2N7E A;  3BYT B;  2MJD A;  3NVZ A;  3LK3 A;  2JYT A;  3LJ3 A;  1TT5 B;  4RFB A;  1FO4 A;  2D11 A;  2IND C;  4LNK A;  3RD2 A;  2UWQ A;  2GBN A;  2PW9 A;  5J2R A;  1QJP A;  4ZRP A;  2L1A A;  3X0W A;  5LXI B;  3WAO A;  1XT9 B;  3HOE A;  1GJZ A;  2WXK A;  3SY7 A;  3AEB B;  2GBJ A;  4OZA A;  1IZN B;  2GI9 A;  3PS6 A;  1L4Z B;  2HTH A;  4WQM A;  1MG8 A;  3W1S C;  4KZ0 A;  1WMH B;  4G76 A;  5ADX K;  1Z2M A;  2KKC A;  3AU4 A;  4J3O D;  5IO9 A;  2CU3 A;  2IGD A;  5G38 A;  2L00 B;  4O49 A;  2INN E;  4GOC A;  1MHX A;  1I42 A;  2I38 A;  4DBG A;  1F0Z A;  1TS5 A;  5CTR C;  1NBF C;  2RMM A;  4II3 B;  1YN4 A;  3JSV B;  1V8C A;  4AYM C;  3DWN A;  3ETR A;  3QIJ A;  4MJS A;  4WJQ A;  1P1A A;  2Z59 B;  2WDQ B;  2ZJD A;  3BZD B;  1Q9F A;  3PTF C;  2ZPY A;  2WXM A;  1KTK A;  2WU5 B;  3JTY A;  3VQI A;  3P63 A;  2K3U A;  4AOF A; 
#chains in the Genus database with same CATH homology
 2X8X X;  4C4V B;  4C4V A;  2V9H A;  4PK1 A;  3OG5 A;  2VH1 A;  2QDF A;  4XGA B;  3MC8 A;  3MC9 A;  4K3C A;  3Q6B A;  2QCZ A;  4N74 A;  4QAY A;  4BZA A;  4N75 A;  2MHJ A;  4C00 A;  3NJT A;  3EFC A;  2VH2 A;  4K3B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...