4C4VA

Structure of the outer membrane protein insertase bama with one potra domain.
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
462
structure length
445
Chain Sequence
b'FYVRKIRFEGNDTSKDAVLRREMRQMEGAWLGSDLVDQGKERLNRLGFFETVDTDTQRVPGSPDQVDVVYKVKERNTGSFNFGIGYGTESGVSFQAGVQQDNWLGTGYAVGINGTKNDYQTYAELSVTNPYFTVDGVSLGGRLFYNDFQADDADSSDYTNKSYGTDVTLGFPINEENSLRAGLGYVHNSLSNMQPQVAMWRYLYSMGEHPSTSDQDNSFKTDDFTFNYGWTYNKLDRGYFPTDGSRVNLTGKVTIPGSDNEYYKVTLDTATYVPIDDDHKWVVLGRTRWGYGDGLGGKEMPFYENFYAGGSSTVRGFQSNTIGPKAIYFPHQASAKDLCKSDDAVGGNAMAVASLEFITPTPFISDKYANSVRTSFFWDMGTVWDTNWDSSSGYPDYSDPSNIRMSAGIALQWMSPLGPLVFSYAQPFKKYDGDKAEQFQFNIGK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords OUTER MEMBRANE PROTEIN ASSEMBLY FACTOR BAMA
publication title Structure of Bama, an Essential Factor in Outer Membrane Protein Biogenesis
pubmed doi rcsb
source organism Escherichia coli
molecule tags Protein transport
total genus 90
structure length 445
sequence length 462
ec nomenclature
pdb deposition date 2013-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01103 Bac_surface_Ag Surface antigen
A PF07244 POTRA Surface antigen variable number repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.50 Mainly Beta Beta Barrel Porin membrane protein fhac: a member of the omp85/tpsb transporter family 4c4vA02
3.10.20.310 Alpha Beta Roll Ubiquitin-like (UB roll) membrane protein fhac 4c4vA01
4N74A 4XGAB 4K3CA 4PK1A 3OG5A 2QDFA 4QAYA 2X8XX 2VH2A 4K3BA 2V9HA 4N75A 4C4VB 3MC9A 3Q6BA 4C4VA 3EFCA 2MHJA 3MC8A 4BZAA 2QCZA 2VH1A 4C00A 3NJTA
chains in the Genus database with same CATH superfamily
3GE8C 2Z0DB 1RM6C 3N30A 3A0BO 4MGKE 3OG5A 4E71A 3K9OB 3PRMB 2AL6A 2E6XA 1E7PB 1GC6A 1WGGA 1WX7A 3PV1A 3KLSX 4CO7A 5H92C 5IA7A 1F2RI 2ZW0A 2CU1A 2PEAA 1T0QC 4URKA 2W81C 2N9XA 1QJ9A 1TS4A 3KVDD 3ML8A 1FM0D 2NS5A 7PRNA 3SY7A 2F1TA 3IVFA 4CQNA 3MJ5A 2KFKB 2LFIA 1BMLC 3UI3A 4W9JA 2MA9B 4HCPB 2GB1A 1FXTB 4ACFA 1GFOA 5HKHA 3AE5B 4XNKA 4AJYB 4P6VF 4GLSC 1YX5B 1ET6A 2KNBA 3AA0B 4WWPA 3ZLZA 2KT7A 1YJIA 4TSSA 4LTUA 4YSXB 2JZ3B 3DDCB 3ZXVA 1PGBA 2BVCA 1SSNA 2FCNA 3PHXB 1UNSA 3I57A 4BKTA 1J0GA 3B08A 4DHJD 1FPYA 5LNK1 3NG0A 5EE3A 5JHBA 4LSFA 5L95C 1F52A 3ZO5B 2MBEA 4ZRIA 4G75A 4N75A 1Q1OA 3Q8BA 2INPE 3Q8EA 2M1MA 4UDUC 3A9JB 4KRAA 3NZ3A 4YSZB 2R2OA 1ET9A 2WGSA 2WXHA 3PRZA 2FCQA 4FZLA 3BK1A 4HJGE 5HHDG 3NS8A 1FEHA 1GOZA 3CSTA 3HM6X 4KSLC 1YQ3B 1WYGA 3A9KA 2O2VB 1IBXB 2XE1A 3AAEB 4JIOU 4X57B 4DXAB 2PTLA 4DXFA 2ZNVB 3ALBA 4C00A 1EU3A 3RZWC 4XE0A 1SIFA 1RAXA 2GRIA 2KYWA 3EUB2 5AZHA 4XDCA 5FR3A 2MHLA 2V9HA 1WRDB 4RJWA 3WALA 3VZWX 2A5UA 3KWVA 1TBEA 4WWOA 4C80A 4O3XB 4FADA 5G2NA 1PFDA 4DWFA 5DCNA 4P1BC 2LRUA 4HROA 3B9JA 2KXPB 4EZJA 4J3OD 1JWBD 1FFVA 2JYEA 3SFEB 4FQEA 2K6DB 4YWGG 4WIPA 1EUVB 4NY0A 2BYTA 4DDGD 1WFYA 5BYSA 5IOIA 2KZ7B 1EWYC 3ABVB 5G38A 2CS4A 2NBUA 1GUAB 1MVKA 1WJNA 2WNMA 2I2YA 4JPSA 3V8UA 4XWWA 4DHJB 4YL8A 2MQJA 3DBLB 2XK5A 1A5RA 3TSSA 1C76A 1IGDA 4ANXA 2R4PA 4BUMX 1CK1A 2QEJC 3WU2O 2WXLA 4FRXA 4FZNA 3ZYYX 1GAQB 2LXCA 1FNVA 2LZ6A 3DPDA 3UQAA 3PRNA 2XN9C 3GB1A 1WGKA 4BBNF 3AA6A 3GZNB 3HVZA 3SY9A 4BKSD 1VZ6A 4N59A 4LCDE 2K1FA 4HRSA 2L05A 1FFUA 1IUEA 2KHWB 4XWTA 2L0TA 2WXQA 4O3YA 3KWLA 3BRYA 5PRNA 1JMLA 1ZGUB 3B2GA 2R4OA 3RNFC 3WANA 4DHZE 1T3QA 3QARA 3CF6E 3RCZA 1XF5L 1DOYA 2TSSA 2FIFA 1TGZB 1T16A 3JYUA 3H9DA 2IJ0A 2UU7A 3TL5A 1E7VA 4XDDA 3MP9A 2R4LA 4LNOA 4RF0A 1HTOA 2X38A 4EEWA 3JW0X 5E6PA 5HG2A 3KZIO 3SD5A 5AZFA 1UZXB 2EKEC 4JE3B 2ZZPB 2ZLDA 1B9RA 2KWVB 4G3XB 2LUEA 5D5DA 3LK2B 2QSDA 1P98A 2KWDA 3SFDB 1D5ZC 1V5OA 5DL7A 2KN5A 2KMMA 1CQVA 1BT9A 2IGGA 3U8ZA 1WR6E 3DHIC 2SEBD 3BYYB 3NOBA 2CJNA 3N9YC 3DWOX 3AE9B 1I42A 1N5WA 3QJZA 4ZHOA 5IP4D 1R4NB 2UYZB 4IM2A 3UF8A 4ZYSA 4IM3A 3ZNHB 2ON8A 4II2B 3FAHA 5GTIO 2JQRB 2PIAA 3HRDD 2WXKA 4JX1C 1JWMD 4REZA 2DYOA 1N60A 2W82A 4L23A 4ARCA 3RN9C 5AEKB 4Q2JA 3AE4B 3OLMD 1IGCA 5AUIA 1JWAD 3C19A 3V60A 3ZNGC 2MLBA 2MP2A 4W9HA 1WGHA 1B1ZA 1UH6A 2QIEB 3QCAA 2JX5A 4NAMA 2MWSB 3ZNZB 4PS8A 1BT0A 3RFZB 3RNBC 3ZDMC 4PK1A 4O3ZA 1QZEA 3Q14C 4AYEC 2KO3A 2ZVNA 4OZCA 1KLGD 4KIKA 5BYQA 4B6WA 3AE8B 5E79O 3APDA 1EWCA 1WYWB 2BYVE 1DGJA 5HFYA 4B0MA 2BW2A 1TKYA 3NY5A 3HUIA 1DOIA 1L4ZB 2EKIA 4B61A 4DK5A 1TS3A 5IKCM 3A4RA 4PS3A 4BFRA 3DZMA 3SYBA 1VRAB 2D3CA 4HPLB 4F7ZA 3ZDTA 4GMVA 2K22A 2BT6A 3NVWA 1A70A 4NZLB 4AOFA 4K3BA 1ZDXA 3RULA 1ZHWA 3I5JC 2IWWA 1FRDA 4ANUA 3VH3B 3VVWB 3DWMA 3DBSA 3B1LX 2I1KA 3ZIMA 2AWTA 3UPGA 2FUG1 2K39A 3A1QA 2AL3A 3DBRB 2AXTO 3MHZA 4GIVA 1Z2MA 3L4PA 5D3DA 4NJ6A 3AU5A 1PRNA 2M0XA 1GFPA 1N5XA 2WU5B 2J4XA 2WS3B 3DQVA 2NPTA 3FYXA 5KAIO 3Q6BA 3CIRB 4GDKB 2WWZA 1D4BA 1ZPSA 5GV0A 4EOYA 3RI7C 1KRHA 2KC0A 2N9PC 4G0NB 2OEDA 3AV8A 4MJSA 1UELA 1NYRA 4USAA 5EE0A 3WAPA 4CHKA 2LJIA 2B76B 4KGSA 3MC9A 3R3MA 4O49A 1T6BX 2I1JA 3SEBA 2IO0B 1Y8RC 3PQUA 3VUWA 2Z8LA 1VJKA 4LNFA 3HVDA 4RM9A 2W54A 3NVVA 4MH8A 3LK42 3Q3FA 4M01A 1AN8A 2KDBA 1UGMA 1K8RB 4LSEA 3ZUNA 2KLCA 3O65B 2V4LA 2M07A 3AXCA 3VQIA 3NRZA 1IPGA 5I4DA 2X9KA 2XK5B 4EUTA 4S17A 2DWQA 3HIZA 4LNNA 4O4XA 5GMVA 3NVYA 2ZPNA 2M8SA 3O0EA 3VXWA 1E8ZA 2K5PA 1JRUA 4FHKA 2D2QA 4G50A 4K1RB 3BS0A 3VRAB 3AA6B 2BS2B 1FD6A 5J18A 1WMHA 2HD5B 2N9KA 4XGAB 3FILA 5D7GA 4GXBA 1FXIA 4C7ZA 4UB6O 4FLHA 2REXA 2GBMA 2D07B 1MM5A 2KMAA 4C4VA 2QHOA 4KSKC 1GFNA 3LK41 2AQ2B 2WP9B 3RYTA 4I6LB 1NEKB 4LDTD 4AUQC 4KZCA 4ARIA 3GOEA 1ZKHA 3SZVA 2L52A 1IZNB 2KJRA 1KH0A 1CJEA 4MDKE 2GBKA 2IDYA 2CU3A 1WWTA 2BGFA 1GB1A 4GB9A 2CHXA 1FNWA 4E3CA 1IP9A 1KLUD 2XTRA 1R4MB 1STEA 1KJTA 1T0YA 2LGDA 4DHZB 5DPSA 4NAWA 2DBYA 1PQSA 2DYBA 3ML9A 1MPEA 3UU2A 1YMHE 2IPKD 2Y7SA 2K25A 3GP6A 3V3XA 4M0WA 1QOBA 3PGSA 3VY9X 2JWZA 1L7YA 1XLPA 1WRIA 3O13A 2DZKA 5KHOA 2F1VA 8PRNA 2XTQA 2INNE 1C4CA 3APFA 1T5XD 1V1PB 1WGRA 4D2KA 2Z59B 1OEYA 3LXFA 5FKAC 3KH0A 4AUIA 2KVRA 2FNJB 2VRRB 2L76A 3TEWA 2M17A 2OJWA 3T0SA 4AYDC 3RMKC 2BYFA 1SXTA 3HK0A 3JSVA 3Q8FA 1P0RA 1XLQA 2WXOA 2KC2A 2O6VD 3DCGA 1ZE3D 1WGYA 5J17A 3PQSA 4HDQA 1EM7A 2WLBA 3AE2B 1VZ7A 1ZHXA 1H6S1 3A4SC 1NBFC 3KW5B 4FZMA 1RRBA 2VZKB 2V3NA 3X23A 2QDFA 1QILA 2D3AA 1UWMA 2FE8A 1L0YB 3T20A 2MP2B 2CR5A 2PKOA 4ZRPA 1QOGA 3NZUA 1V1OA 2EELA 4PYZA 4AQ7A 4O4UA 1SBBB 4JCHA 3Q3JA 4HK2A 1FXAA 4J6IA 2I38A 4QQ1A 4RMAA 2HJ8A 2M06A 1U4AA 1VDVA 3BYTB 3Q3OC 4LDTB 3ZKJC 4LNKA 5C1ZA 4ZOHC 3I63C 3DWGC 2L00B 2L0FA 3Q8CA 1QJPA 3SYSA 2INDC 2L7RA 3G7GA 4RL9A 1QT9A 4M8MA 6PRNA 1QLBB 1SE3A 2XEWA 2FCMA 3K19A 5E6JA 2RSUA 1F77A 2SAKA 1TTNA 1MPFA 2LGSA 1TS5A 3NVZA 3CSFA 1PGXA 3AU4A 2NVUI 2XMXA 3V62A 3DVNV 3WI4A 1IYFA 1YN4A 3RNEC 3A1QB 3VDZA 2AX5A 3ZTDA 5DPWA 2KK8A 1SE2A 1ACCA 3AM9A 3GS2A 1YNTE 2IYDB 4W9KA 1E6EB 3QAQA 1FRRA 4B95A 1WXMA 3EHVA 4RGNA 2N1VA 2DZMA 2N4FA 1E54A 4WJQA 1RLFA 3R2TA 2NBVB 5DL6A 4OVZA 3TUOA 3L54A 1L0VB 3S2AA 2JPHA 1CMXB 1RFAA 3JCUO 5EE9A 3AMZA 3TIXA 1ZHTA 4AKRA 4JQWC 2O6VB 3W1SA 2JMMA 3TZGA 2LI5A 2KXJA 1ESFA 1TIFA 4KGRA 4WQOB 1WE6A 2MBQA 4FA6A 2LHDA 4G11A 1UGJA 2MJEA 3IBEA 1WJ4A 2YPVA 3QRAA 3PHWB 4GHBA 4IG7B 4D65A 3NS1A 2JZZA 2V4IB 2ACZB 2DAJA 2MNHA 3W5UB 3UINB 3PZDA 1FCCC 3MJWA 1L5PA 4WJNA 2JVCA 3V05A 3PGRA 2JY6A 1UUPA 2HTHA 4HPMB 1HXTA 3R7RA 3DHGC 3QC8B 3QRCA 4AP4C 1ZHYA 3M95A 2ZW1A 2WXJA 1MG8A 2J0JA 1Q0WB 3FILB 3VH4B 3BIID 3H7PB 3U2SC 2LJ5A 4WURA 2JXXA 4WAFA 3L16A 1JRPA 1XEEA 4HKZE 4JLCA 3VHTC 1ISNA 3PRPB 3UGBB 5HI1A 2V3SA 3QX1A 2JT4B 1J7CA 1FMAD 1D6EC 4DDID 2KKCA 1GFMA 1RYJA 3N1YC 3L0WB 1PDXA 1L2NA 3BZDB 2WDTB 1L4DB 3PF1A 4HLEA 4GSWA 4A55A 2J42A 3ONSA 3ZRFA 3BRZA 3AE1B 1I7HA 4JGHB 2DHZA 3UIPB 1WXSA 1MJDA 2BPSA 4GOCA 4PUXA 2LEKA 4LJOB 4NAWB 1WH3A 4IC7B 4PT5A 4A20A 1NVID 1EU4A 4M0WB 5BMGA 2WXRA 2MJ3A 1MM4A 3EFUA 1MG4A 2IWVA 5KHQA 5FK9C 1KTKA 4FOZA 4WWMA 3DA3A 3PSEB 4D64A 2LD9A 3D32A 2N9LA 2L1AA 4C7YA 1WZ3A 1VD2A 4Z3TA 3DWNA 2Q5WD 2FCSA 3TEZA 4BBNC 4HPPA 2ZNVC 1XD3B 3A33B 3L17A 4EZLA 2ZFGA 2BB6A 5LLIA 4BOSC 5KAFO 4K7WA 4ICUA 4WWNA 3PREA 4KR4A 2WHIA 1XT9B 5H8YE 1E8XA 3W1YA 2IGHA 1T1LA 3EC8A 3M62B 4K81A 3LJ3A 1J19A 2KDIA 3AA1A 1MI0A 4YT0B 3TMPB 1JQ4A 2AQ3B 3DVGX 5MPOA 1XCTL 4RGTA 3HM3A 2QCZA 4D5UA 5GXGB 2FIDA 5TISO 1V5TA 4A3PA 4BVUC 1TYGB 4AYMC 1KFYB 5IYUA 2J0KA 1DYQA 3Q3NC 1E7UA 4RLCA 1BXTA 4GCPA 4MACA 5CX3A 1G6JA 2XBBC 3DBHB 1RWSA 3ZGZA 2LRWA 4AFKA 2RMMA 2IO3B 2R8AA 2Y3AA 2J0MA 1I4RA 5B5EO 2R89A 2ZEQA 2XE3A 1E90A 4IM0A 4MELA 3VZTX 2IO1B 1V6EA 2JRIB 2A4ZA 3A0HO 3L13A 5BMHA 4R3DA 2JWUA 3AE6B 1MFWA 1I4XA 1SIJA 3DBLI 3RNGC 1NENB 1LFDA 2JF5A 1OQRA 2J7QB 2C60A 3ZXRA 1GJZA 2W3SA 3UQBA 2DZJA 3U4EG 3RPFC 2ICIA 2NTSA 3ZJVA 5IN7A 4KKJA 2WDVB 1N63A 3GZNI 1M94A 2K0PA 4K7UA 1OTRB 2BS4B 2G3QB 2KFKA 4WQMA 4FMSA 1P9DU 1WJ6A 3VUYA 4I6PA 4KGTA 3ECIA 5DPTA 5TSSA 1NYQA 3A9KB 4FESA 3PS6A 3VR9B 4AKRB 2N1WA 2GBJA 3AA0A 1HXUA 3WIMA 1MHHE 1ZHZA 3RUIB 2M4NA 1M4VA 1P3QU 4NQKE 2MJDA 3KYDD 1Q9FA 1WX9A 2AEHA 2NCNA 3RT3B 2FAZA 1QF6A 3TEXA 2PPHA 1E9MA 3APCA 2ZCCA 3KUCB 2DAFA 3P1MA 4XZ4A 1LM8B 4FRTA 2BYEA 4M02A 2KDFB 4RLBA 2LVQA 1YN3A 4HWIB 1X1MA 2JSVX 3E56A 1YX6B 3BVMA 2OJRA 2JQYA 2N7EA 3MTNB 3QWZB 2KQ4X 1JW9D 3UIOB 2O4VA 3AN1A 3V61A 3BK2A 2BKRB 2K9XA 1WR1A 2Y5CA 2MCNB 2KX0A 2DX5B 3EFCA 3P4QB 1V86A 2WX1A 3BWUD 2O2VA 5T5FA 1IBXA 4XNLA 1R4NI 3AAEA 4GGQA 5T8IA 1F0ZA 1FIQA 3ZRCA 1SEBD 2KN4A 4OVVA 2QJLA 4A9AA 3UAQA 1Y56A 2PORA 4HVBA 2KDEB 2N2LA 4EFOA 4MEMA 2VZKD 4EZKA 2BS3B 3ZQ4A 2FUHB 4YSYB 5C23A 2N0SB 2WXNA 2KC1A 3WCQA 5ADXK 2J1NA 2Y0LA 1SJED 2W55A 1YJ1A 3H7SA 4DBGA 1V97A 2BF8B 3NHEB 4AYID 2H88B 4RCOA 4DXGA 4OW0A 1E0ZA 2FGRA 5IAAC 3WA0A 4YTPB 4ZDVA 2V1YA 4S0RA 2YLMA 2KZ7A 3KYCD 1XO3A 3AI5A 2Y2XA 1WXAA 4FBJB 2MX2A 3OAWA 3TCAA 3WAMA 2Y0HA 1V9JA 2LUMA 2L32A 2AQ1B 3PZ8A 1F9JA 4A8XC 3OJ4B 1JWSD 3WAOA 4E1TA 3VE1A 4GN1A 2RPVA 4ANVA 3A2SX 2MSED 1GG3A 1SJHD 3T24A 2G4DB 1WM2A 1HXXA 4M8NA 2WJQA 4HKQA 2V0GA 4NPNA 1UBQA 5LXIB 1FNUA 1OPFA 2ERVA 2N2MA 4OZBA 3V6CB 1GPXA 5D94A 1WXVA 3EGRA 4C69X 2KMCA 3DBRI 5E6NA 3EA6A 5C3JB 2G1EA 3P4SB 5G5HA 2G45B 1BH3A 4W9EA 3P42A 1ZP0B 3VRBB 1EF1A 2Y5BB 4GCQA 2PRNA 1P7EA 1BXWA 1C4PA 1HZ5A 2NR2A 1C77A 2C7NB 2FGQX 1N62A 5D3IB 4IW0A 4BOZB 3DHHC 3SU8X 3SR6A 4TV3A 2LVPA 3HWBA 3LK2A 1GFQA 2BTEA 3NZSA 1C1YB 1WJUA 1WGDA 4GDLA 2D5GA 3ZJTA 1R7SA 2WX0A 1QJ8A 2KDYA 4RFBA 1L6VA 3IAS1 2MBOA 3BY4B 4IKGA 3VE2A 2CKHB 2ZPYA 1YN5A 3M3JA 1TS2A 4MGYE 3VAWA 3KUZA 2PJHA 3AEBB 1F2RC 1GNUA 2K3UA 1XLNA 3LDZE 2RDHA 4K3CA 4ZYNA 4KIKB 5JZEB 3JTYA 1AWDA 4RGMA 3MFGA 2WVPA 2HDEA 3AAAA 2GMIC 2YEPB 5L83A 1K50A 4KDLB 2WXFA 5AFUK 3POXA 4JWSC 2BB5A 2KJ6A 2H89B 3DVNU 1EF5A 3W5VB 2WXPA 4HJKA 2KTRA 3DOWA 5TR5A 1JALA 2N7JA 5EDSA 3RBHA 4KDIC 2M0AA 3AEAB 4BKSA 5ADXL 1QOFA 2LVOA 1WIAA 4RM8A 1QQRA 3KQ4A 4JFBA 3I9V1 4II3B 2KVZA 4PYUA 2VH1A 4TMAB 3T8MA 4FT6A 2D3GA 1LQBA 2KJHB 1Q10A 5G55A 1K53A 1L6UA 4F8CB 4DQOC 2UWQA 2WXIA 2NPTB 2PVGC 4W9DA 1XQQA 2KAJA 3P4PB 1PYWD 5BYRA 1R4MI 3VTUA 2IO2B 3SDLC 2J53A 5AZGA 4FHJA 1FCLA 4LSHA 2R2QA 4KKIA 4MGIE 1E8WA 1SGHA 2KQ7A 2MH7A 1L0XB 1KM7A 4BAXA 1OSMA 2KOXA 4MM3A 3E9SA 4FSOA 3BVZA 1N61A 4MJSB 4ZRJA 2EMSA 1YQBA 5DPRA 2YNKA 2QC8A 4KVGB 1EO6A 4ASWC 1SE4A 4TQ0A 4AYNA 3K9PB 3QQ8B 1N6ZA 2IGDA 4MH0E 3VFKA 2KWUB 2Y5PA 1F1HA 1JROA 1KOTA 4FJYA 2YEPF 3AH7A 1V49A 1HEZE 2KTFA 1Q5WB 4ITKA 1MHXA 4RNAA 4WJPA 4EKUA 3POUA 5JDPA 2CHWA 2W9NA 3QIJA 3N1XC 2JRHA 3AE7B 3VUXA 3IT4B 4JL9A 1NI2A 4P16A 2C9WB 2MHJA 2BWFA 3PVLA 4O3WA 4GDKA 1LGRA 1OGWA 4FN2A 1S5LO 2J4UP 3ZW3A 1J8CA 1WMHB 1ENFA 1WF9A 3NJTA 2WJRA 3AA7A 1AW7A 1SE9A 3ZJUA 3QK0A 2WDQB 3H8HA 3IAM1 3Q69A 2NMQA 3PORA 2C7HA 3Q3MC 4TQ1A 1E8YA 4C4VB 5D6JB 3P4RB 2WXMA 1I4GA 2KDMA 4L2YA 5G26A 3ETRA 2INCC 2KFJA 3EMNX 3W9CB 2IBIB 4LNIA 3PZ7A 2WDRB 1FO4A 4G76A 5CHVC 1VZ8A 2DZIA 2KWCA 1LO5D 1TY2A 4OHJA 2DENB 5JHAA 1TKEA 3V6EB 1H8CA 3PT2B 3VZUX 4MSMB 3R66C 1G90A 2WXGA 2RPQA 3JVZX 2KD0A 1NDDA 2Y0KA 2PE9A 1TJEA 4FULA 2K4TA 3VR8B 1C3TA 1H4RA 1LXDA 2JU6X 1I4HA 3OWEB 3PLUA 2MBHA 4O1NA 4N74A 1S1QB 4N58A 4RJXA 5AFUL 2BKFA 3DVGY 1ZW7A 4A6QA 2YVCA 4HEA1 1ZDVA 1THQA 4MGZE 4A3OA 4B0EA 2D10A 3U7ZA 2OMFA 3C5OA 3KVFB 4AJWA 4AZLA 4PR7A 3PPAA 4RF1A 4LK0M 2ONQA 4KR8A 3AECB 4UB8O 4IUMB 3GP7A 2PLPA 3JSVB 1IZNA 4P1CC 2HE7A 3ZNID 1HZ6A 3AEGB 4M00A 1AARA 1AYFA 3LK3A 3P63A 2QMTA 4KZ0A 3MC8A 4H2AA 3POQA 1PHOA 4IWOA 1UF0A 5G39A 2QILA 1GB4A 4JWUC 2MBBB 3L08A 2D11A 4W9FA 2CJOA 2IY0B 4GDLB 2K8CA 4MT5A 2ODJA 2N9EB 4CTDA 4IWQA 2R88A 2LFUA 1TKGA 3R8BA 4FJZA 2LGXA 2ZCBA 3ENEA 3RD2A 2R61A 3X0WA 2WQYB 2BBCA 2PE6B 2C5LC 4KX6B 2WU2B 4US9A 2N7DA 1V1PA 3ZTCA 1UBIA 3HW9A 3KUDB 3AAAB 3N1ZC 4IOIE 5FR6A 1UWXA 5D2MB 5CHFA 4W9LA 1SF0A 5E6OA 2K6QA 1YOVB 3N20C 3PTFC 1HE8A 2HTME 5J2RA 4XC2A 3R7QA 3AEDB 2KTRB 1SB3C 4NJCA 4ZRKA 1T0SC 1DOXA 4N6EB 2LHFA 2X8XX 2KACA 4FJVB 4NQLB 4GF4A 1YD8U 1QOAA 4ICVA 4KV2A 3IFWB 2LXAA 1HQRD 3AB5A 4F4BA 3URYA 1OQYA 1E5WA 2J52A 3PGUA 3W2DA 3J9CA 2GOWA 3T3NA 5EE2A 4F1SA 2B3AA 2KQSA 1YS5A 2RD0A 1I35A 1YIWA 1ORMA 3QHTA 4QAYA 2RGFA 1VR9A 3L10B 3TEYA 2LGIA 3AEFB 1Z5SB 5FVNA 1TY0A 4C56C 3AULA 2ASQA 1PUTA 1PGAA 4IWPA 5CTRC 1TT5B 3PO0A 4A90A 3IHPC 4ANWA 2LASA 4MM3B 3VTWA 2G4SA 1ZXHA 1C79A 2LHEA 2RDGA 3FC4A 1XLOA 3IT6B 2VH2A 3FKYA 3LYYA 3IXSA 4YTMB 3IG3A 4EE2A 2GLSA 2XE5A 3PLVA 2QTKA 2MEKA 3A9JA 4YXDB 2EMTA 3HOLA 4E1SA 1S3SG 3SHQA 1D3ZA 1V80A 1E10A 2OHFA 4FXCA 1YJJA 1P4TA 4CYEA 2M19A 1HTQA 1C78A 3AE3B 4N9F4 5BMIA 1RFKA 2MW5A 2DLBA 2KX3A 3RZFA 2CHZA 4E74A 1WI0A 5CHWA 4BKGA 3AA7B 3CWIA 4OVUA 1YQ4B 3VTVA 1WSPA 1XCQL 5JXVA 1JCKB 2O6VA 4NNJB 2E3TA 2GE4A 4AWJA 3WI5A 2RR9A 4MSQB 1ZUD2 1QKZA 1Q9GA 4HCNB 2ZVOA 3U30A 3N3KB 3HOEA 1HA5A 1WX8A 2ZJDA 4P7IA 5EE1A 2GI9A 1J7AA 4U9CA 3LB8C 1TZ1A 2L8JA 3Q2AC 4GU2A 5AUKA 4BZAA 3BINA 1J7BA 1TZOA 1C9FA 1P1AA 2K8HA 3C0RB 4FSPA 1ZXIA 2JZPA 3DBHI 2F1CX 1VCBA 2DYMA 2DNFA 1UD7A 4W9CA 3T3OA 4B9KA 4I6NB 4XX5A 2W80C 3QA8A 3C8YA 1KLVA 2W3RA 2KXPA 2GBRA 2V3PA 2JYTA 5DL8A 1JWUD 3H6NA 2LMCA 4K7SA 2OOBB 2NTTA 3R2IA 2Z0EB 1WE7A 3N32A 1K51A 5G3AA 1OFFA 3H7PA 5IO9A 3H1UA 4RGOS 1V81A 1WXQA 5BO4B 1D5MC 4LLGM 2FBWB 2XG6A 2KZRA 4US8A 3PGEA 5DL5A 1OEYJ 1BUIC 2BWES 2K8BA 3GE3C 3OJ3A 2MRPA 2GBNA 4YTNB 4TKNA 4LSIA 2KLGA 1XXGA 2LGYA 4W9GA 1CZPA 2KANA 3T9LA 5G5GA 3RNAC 2K0LA 1NI3A 4PS7A 3B0AA 3TJPA 1V2YA 4HXDA 2IY1B 3P2BA 3I3TB 3W1SC 1WZ0A 3SZDA 4ZRQA 1I4QA 2L83A 1WY8A 1KF6B 5C2TB 3LK3B 1OQQA 2R4NA 1HXYD 4NJ7A 3M63B 4IDIA 5JH5C 5H2FO 3TBLD 1P7FA 3ZVVA 4AS1A 4RH6A 3Q8AA 2G9HD 2PW9A 3MHSD 2PMVA 4IL6O 2XE2A 1ZOYB 2D3BA 4OZAA 3CMMB 2IZVB 3AEEB 3U52E 1I4PA 4TUUA 2JXTA 1T0RC 1K52A 4W9IA 3AA1B 1ROEA 1D5XC 2M56B 2XNAC 2PVOD 2JUOA 1C4AA 1WM3A 2WYQA 3VY8X 2HJ1A 4WH4A 3BVGA 3NSGA 2X27X 4LJPB 2C7MB 1V8CA 4GCSA 4FUVA 4HDOA 2NBWB 4PJ0O 4L1BA 3B2FA 2L3ZA 3MC0B 5B66O 1GC7A 1VLBA 3U7DA 3DA4A 3EECA 2LWPA 3HHMA 4ZHPA 3NUHB 4WAAA 4WJOA 4AKMA 4XYCA 5GTHO 2BQQA 2RDBC 3RNCC 5LXHA 2AYOB
chains in the Genus database with same CATH topology
4N74A 4XGAB 4K3CA 4PK1A 3OG5A 2QDFA 4QAYA 2X8XX 2VH2A 4K3BA 2V9HA 4N75A 4C4VB 3MC9A 3Q6BA 4C4VA 3EFCA 2MHJA 3MC8A 4BZAA 2QCZA 2VH1A 4C00A 3NJTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4N74 A;  4XGA B;  4K3C A;  4PK1 A;  3OG5 A;  2QDF A;  4QAY A;  2X8X X;  2VH2 A;  4K3B A;  2V9H A;  4N75 A;  4C4V B;  3MC9 A;  3Q6B A;  4C4V A;  3EFC A;  2MHJ A;  3MC8 A;  4BZA A;  2QCZ A;  2VH1 A;  4C00 A;  3NJT A; 
#chains in the Genus database with same CATH topology
 3GE8 C;  2Z0D B;  1RM6 C;  3N30 A;  3A0B O;  4MGK E;  3OG5 A;  4E71 A;  3K9O B;  3PRM B;  2AL6 A;  2E6X A;  1E7P B;  1GC6 A;  1WGG A;  1WX7 A;  3PV1 A;  3KLS X;  4CO7 A;  5H92 C;  5IA7 A;  1F2R I;  2ZW0 A;  2CU1 A;  2PEA A;  1T0Q C;  4URK A;  2W81 C;  2N9X A;  1QJ9 A;  1TS4 A;  3KVD D;  3ML8 A;  1FM0 D;  2NS5 A;  7PRN A;  3SY7 A;  2F1T A;  3IVF A;  4CQN A;  3MJ5 A;  2KFK B;  2LFI A;  1BML C;  3UI3 A;  4W9J A;  2MA9 B;  4HCP B;  2GB1 A;  1FXT B;  4ACF A;  1GFO A;  5HKH A;  3AE5 B;  4XNK A;  4AJY B;  4P6V F;  4GLS C;  1YX5 B;  1ET6 A;  2KNB A;  3AA0 B;  4WWP A;  3ZLZ A;  2KT7 A;  1YJI A;  4TSS A;  4LTU A;  4YSX B;  2JZ3 B;  3DDC B;  3ZXV A;  1PGB A;  2BVC A;  1SSN A;  2FCN A;  3PHX B;  1UNS A;  3I57 A;  4BKT A;  1J0G A;  3B08 A;  4DHJ D;  1FPY A;  5LNK 1;  3NG0 A;  5EE3 A;  5JHB A;  4LSF A;  5L95 C;  1F52 A;  3ZO5 B;  2MBE A;  4ZRI A;  4G75 A;  4N75 A;  1Q1O A;  3Q8B A;  2INP E;  3Q8E A;  2M1M A;  4UDU C;  3A9J B;  4KRA A;  3NZ3 A;  4YSZ B;  2R2O A;  1ET9 A;  2WGS A;  2WXH A;  3PRZ A;  2FCQ A;  4FZL A;  3BK1 A;  4HJG E;  5HHD G;  3NS8 A;  1FEH A;  1GOZ A;  3CST A;  3HM6 X;  4KSL C;  1YQ3 B;  1WYG A;  3A9K A;  2O2V B;  1IBX B;  2XE1 A;  3AAE B;  4JIO U;  4X57 B;  4DXA B;  2PTL A;  4DXF A;  2ZNV B;  3ALB A;  4C00 A;  1EU3 A;  3RZW C;  4XE0 A;  1SIF A;  1RAX A;  2GRI A;  2KYW A;  3EUB 2;  5AZH A;  4XDC A;  5FR3 A;  2MHL A;  2V9H A;  1WRD B;  4RJW A;  3WAL A;  3VZW X;  2A5U A;  3KWV A;  1TBE A;  4WWO A;  4C80 A;  4O3X B;  4FAD A;  5G2N A;  1PFD A;  4DWF A;  5DCN A;  4P1B C;  2LRU A;  4HRO A;  3B9J A;  2KXP B;  4EZJ A;  4J3O D;  1JWB D;  1FFV A;  2JYE A;  3SFE B;  4FQE A;  2K6D B;  4YWG G;  4WIP A;  1EUV B;  4NY0 A;  2BYT A;  4DDG D;  1WFY A;  5BYS A;  5IOI A;  2KZ7 B;  1EWY C;  3ABV B;  5G38 A;  2CS4 A;  2NBU A;  1GUA B;  1MVK A;  1WJN A;  2WNM A;  2I2Y A;  4JPS A;  3V8U A;  4XWW A;  4DHJ B;  4YL8 A;  2MQJ A;  3DBL B;  2XK5 A;  1A5R A;  3TSS A;  1C76 A;  1IGD A;  4ANX A;  2R4P A;  4BUM X;  1CK1 A;  2QEJ C;  3WU2 O;  2WXL A;  4FRX A;  4FZN A;  3ZYY X;  1GAQ B;  2LXC A;  1FNV A;  2LZ6 A;  3DPD A;  3UQA A;  3PRN A;  2XN9 C;  3GB1 A;  1WGK A;  4BBN F;  3AA6 A;  3GZN B;  3HVZ A;  3SY9 A;  4BKS D;  1VZ6 A;  4N59 A;  4LCD E;  2K1F A;  4HRS A;  2L05 A;  1FFU A;  1IUE A;  2KHW B;  4XWT A;  2L0T A;  2WXQ A;  4O3Y A;  3KWL A;  3BRY A;  5PRN A;  1JML A;  1ZGU B;  3B2G A;  2R4O A;  3RNF C;  3WAN A;  4DHZ E;  1T3Q A;  3QAR A;  3CF6 E;  3RCZ A;  1XF5 L;  1DOY A;  2TSS A;  2FIF A;  1TGZ B;  1T16 A;  3JYU A;  3H9D A;  2IJ0 A;  2UU7 A;  3TL5 A;  1E7V A;  4XDD A;  3MP9 A;  2R4L A;  4LNO A;  4RF0 A;  1HTO A;  2X38 A;  4EEW A;  3JW0 X;  5E6P A;  5HG2 A;  3KZI O;  3SD5 A;  5AZF A;  1UZX B;  2EKE C;  4JE3 B;  2ZZP B;  2ZLD A;  1B9R A;  2KWV B;  4G3X B;  2LUE A;  5D5D A;  3LK2 B;  2QSD A;  1P98 A;  2KWD A;  3SFD B;  1D5Z C;  1V5O A;  5DL7 A;  2KN5 A;  2KMM A;  1CQV A;  1BT9 A;  2IGG A;  3U8Z A;  1WR6 E;  3DHI C;  2SEB D;  3BYY B;  3NOB A;  2CJN A;  3N9Y C;  3DWO X;  3AE9 B;  1I42 A;  1N5W A;  3QJZ A;  4ZHO A;  5IP4 D;  1R4N B;  2UYZ B;  4IM2 A;  3UF8 A;  4ZYS A;  4IM3 A;  3ZNH B;  2ON8 A;  4II2 B;  3FAH A;  5GTI O;  2JQR B;  2PIA A;  3HRD D;  2WXK A;  4JX1 C;  1JWM D;  4REZ A;  2DYO A;  1N60 A;  2W82 A;  4L23 A;  4ARC A;  3RN9 C;  5AEK B;  4Q2J A;  3AE4 B;  3OLM D;  1IGC A;  5AUI A;  1JWA D;  3C19 A;  3V60 A;  3ZNG C;  2MLB A;  2MP2 A;  4W9H A;  1WGH A;  1B1Z A;  1UH6 A;  2QIE B;  3QCA A;  2JX5 A;  4NAM A;  2MWS B;  3ZNZ B;  4PS8 A;  1BT0 A;  3RFZ B;  3RNB C;  3ZDM C;  4PK1 A;  4O3Z A;  1QZE A;  3Q14 C;  4AYE C;  2KO3 A;  2ZVN A;  4OZC A;  1KLG D;  4KIK A;  5BYQ A;  4B6W A;  3AE8 B;  5E79 O;  3APD A;  1EWC A;  1WYW B;  2BYV E;  1DGJ A;  5HFY A;  4B0M A;  2BW2 A;  1TKY A;  3NY5 A;  3HUI A;  1DOI A;  1L4Z B;  2EKI A;  4B61 A;  4DK5 A;  1TS3 A;  5IKC M;  3A4R A;  4PS3 A;  4BFR A;  3DZM A;  3SYB A;  1VRA B;  2D3C A;  4HPL B;  4F7Z A;  3ZDT A;  4GMV A;  2K22 A;  2BT6 A;  3NVW A;  1A70 A;  4NZL B;  4AOF A;  4K3B A;  1ZDX A;  3RUL A;  1ZHW A;  3I5J C;  2IWW A;  1FRD A;  4ANU A;  3VH3 B;  3VVW B;  3DWM A;  3DBS A;  3B1L X;  2I1K A;  3ZIM A;  2AWT A;  3UPG A;  2FUG 1;  2K39 A;  3A1Q A;  2AL3 A;  3DBR B;  2AXT O;  3MHZ A;  4GIV A;  1Z2M A;  3L4P A;  5D3D A;  4NJ6 A;  3AU5 A;  1PRN A;  2M0X A;  1GFP A;  1N5X A;  2WU5 B;  2J4X A;  2WS3 B;  3DQV A;  2NPT A;  3FYX A;  5KAI O;  3Q6B A;  3CIR B;  4GDK B;  2WWZ A;  1D4B A;  1ZPS A;  5GV0 A;  4EOY A;  3RI7 C;  1KRH A;  2KC0 A;  2N9P C;  4G0N B;  2OED A;  3AV8 A;  4MJS A;  1UEL A;  1NYR A;  4USA A;  5EE0 A;  3WAP A;  4CHK A;  2LJI A;  2B76 B;  4KGS A;  3MC9 A;  3R3M A;  4O49 A;  1T6B X;  2I1J A;  3SEB A;  2IO0 B;  1Y8R C;  3PQU A;  3VUW A;  2Z8L A;  1VJK A;  4LNF A;  3HVD A;  4RM9 A;  2W54 A;  3NVV A;  4MH8 A;  3LK4 2;  3Q3F A;  4M01 A;  1AN8 A;  2KDB A;  1UGM A;  1K8R B;  4LSE A;  3ZUN A;  2KLC A;  3O65 B;  2V4L A;  2M07 A;  3AXC A;  3VQI A;  3NRZ A;  1IPG A;  5I4D A;  2X9K A;  2XK5 B;  4EUT A;  4S17 A;  2DWQ A;  3HIZ A;  4LNN A;  4O4X A;  5GMV A;  3NVY A;  2ZPN A;  2M8S A;  3O0E A;  3VXW A;  1E8Z A;  2K5P A;  1JRU A;  4FHK A;  2D2Q A;  4G50 A;  4K1R B;  3BS0 A;  3VRA B;  3AA6 B;  2BS2 B;  1FD6 A;  5J18 A;  1WMH A;  2HD5 B;  2N9K A;  4XGA B;  3FIL A;  5D7G A;  4GXB A;  1FXI A;  4C7Z A;  4UB6 O;  4FLH A;  2REX A;  2GBM A;  2D07 B;  1MM5 A;  2KMA A;  4C4V A;  2QHO A;  4KSK C;  1GFN A;  3LK4 1;  2AQ2 B;  2WP9 B;  3RYT A;  4I6L B;  1NEK B;  4LDT D;  4AUQ C;  4KZC A;  4ARI A;  3GOE A;  1ZKH A;  3SZV A;  2L52 A;  1IZN B;  2KJR A;  1KH0 A;  1CJE A;  4MDK E;  2GBK A;  2IDY A;  2CU3 A;  1WWT A;  2BGF A;  1GB1 A;  4GB9 A;  2CHX A;  1FNW A;  4E3C A;  1IP9 A;  1KLU D;  2XTR A;  1R4M B;  1STE A;  1KJT A;  1T0Y A;  2LGD A;  4DHZ B;  5DPS A;  4NAW A;  2DBY A;  1PQS A;  2DYB A;  3ML9 A;  1MPE A;  3UU2 A;  1YMH E;  2IPK D;  2Y7S A;  2K25 A;  3GP6 A;  3V3X A;  4M0W A;  1QOB A;  3PGS A;  3VY9 X;  2JWZ A;  1L7Y A;  1XLP A;  1WRI A;  3O13 A;  2DZK A;  5KHO A;  2F1V A;  8PRN A;  2XTQ A;  2INN E;  1C4C A;  3APF A;  1T5X D;  1V1P B;  1WGR A;  4D2K A;  2Z59 B;  1OEY A;  3LXF A;  5FKA C;  3KH0 A;  4AUI A;  2KVR A;  2FNJ B;  2VRR B;  2L76 A;  3TEW A;  2M17 A;  2OJW A;  3T0S A;  4AYD C;  3RMK C;  2BYF A;  1SXT A;  3HK0 A;  3JSV A;  3Q8F A;  1P0R A;  1XLQ A;  2WXO A;  2KC2 A;  2O6V D;  3DCG A;  1ZE3 D;  1WGY A;  5J17 A;  3PQS A;  4HDQ A;  1EM7 A;  2WLB A;  3AE2 B;  1VZ7 A;  1ZHX A;  1H6S 1;  3A4S C;  1NBF C;  3KW5 B;  4FZM A;  1RRB A;  2VZK B;  2V3N A;  3X23 A;  2QDF A;  1QIL A;  2D3A A;  1UWM A;  2FE8 A;  1L0Y B;  3T20 A;  2MP2 B;  2CR5 A;  2PKO A;  4ZRP A;  1QOG A;  3NZU A;  1V1O A;  2EEL A;  4PYZ A;  4AQ7 A;  4O4U A;  1SBB B;  4JCH A;  3Q3J A;  4HK2 A;  1FXA A;  4J6I A;  2I38 A;  4QQ1 A;  4RMA A;  2HJ8 A;  2M06 A;  1U4A A;  1VDV A;  3BYT B;  3Q3O C;  4LDT B;  3ZKJ C;  4LNK A;  5C1Z A;  4ZOH C;  3I63 C;  3DWG C;  2L00 B;  2L0F A;  3Q8C A;  1QJP A;  3SYS A;  2IND C;  2L7R A;  3G7G A;  4RL9 A;  1QT9 A;  4M8M A;  6PRN A;  1QLB B;  1SE3 A;  2XEW A;  2FCM A;  3K19 A;  5E6J A;  2RSU A;  1F77 A;  2SAK A;  1TTN A;  1MPF A;  2LGS A;  1TS5 A;  3NVZ A;  3CSF A;  1PGX A;  3AU4 A;  2NVU I;  2XMX A;  3V62 A;  3DVN V;  3WI4 A;  1IYF A;  1YN4 A;  3RNE C;  3A1Q B;  3VDZ A;  2AX5 A;  3ZTD A;  5DPW A;  2KK8 A;  1SE2 A;  1ACC A;  3AM9 A;  3GS2 A;  1YNT E;  2IYD B;  4W9K A;  1E6E B;  3QAQ A;  1FRR A;  4B95 A;  1WXM A;  3EHV A;  4RGN A;  2N1V A;  2DZM A;  2N4F A;  1E54 A;  4WJQ A;  1RLF A;  3R2T A;  2NBV B;  5DL6 A;  4OVZ A;  3TUO A;  3L54 A;  1L0V B;  3S2A A;  2JPH A;  1CMX B;  1RFA A;  3JCU O;  5EE9 A;  3AMZ A;  3TIX A;  1ZHT A;  4AKR A;  4JQW C;  2O6V B;  3W1S A;  2JMM A;  3TZG A;  2LI5 A;  2KXJ A;  1ESF A;  1TIF A;  4KGR A;  4WQO B;  1WE6 A;  2MBQ A;  4FA6 A;  2LHD A;  4G11 A;  1UGJ A;  2MJE A;  3IBE A;  1WJ4 A;  2YPV A;  3QRA A;  3PHW B;  4GHB A;  4IG7 B;  4D65 A;  3NS1 A;  2JZZ A;  2V4I B;  2ACZ B;  2DAJ A;  2MNH A;  3W5U B;  3UIN B;  3PZD A;  1FCC C;  3MJW A;  1L5P A;  4WJN A;  2JVC A;  3V05 A;  3PGR A;  2JY6 A;  1UUP A;  2HTH A;  4HPM B;  1HXT A;  3R7R A;  3DHG C;  3QC8 B;  3QRC A;  4AP4 C;  1ZHY A;  3M95 A;  2ZW1 A;  2WXJ A;  1MG8 A;  2J0J A;  1Q0W B;  3FIL B;  3VH4 B;  3BII D;  3H7P B;  3U2S C;  2LJ5 A;  4WUR A;  2JXX A;  4WAF A;  3L16 A;  1JRP A;  1XEE A;  4HKZ E;  4JLC A;  3VHT C;  1ISN A;  3PRP B;  3UGB B;  5HI1 A;  2V3S A;  3QX1 A;  2JT4 B;  1J7C A;  1FMA D;  1D6E C;  4DDI D;  2KKC A;  1GFM A;  1RYJ A;  3N1Y C;  3L0W B;  1PDX A;  1L2N A;  3BZD B;  2WDT B;  1L4D B;  3PF1 A;  4HLE A;  4GSW A;  4A55 A;  2J42 A;  3ONS A;  3ZRF A;  3BRZ A;  3AE1 B;  1I7H A;  4JGH B;  2DHZ A;  3UIP B;  1WXS A;  1MJD A;  2BPS A;  4GOC A;  4PUX A;  2LEK A;  4LJO B;  4NAW B;  1WH3 A;  4IC7 B;  4PT5 A;  4A20 A;  1NVI D;  1EU4 A;  4M0W B;  5BMG A;  2WXR A;  2MJ3 A;  1MM4 A;  3EFU A;  1MG4 A;  2IWV A;  5KHQ A;  5FK9 C;  1KTK A;  4FOZ A;  4WWM A;  3DA3 A;  3PSE B;  4D64 A;  2LD9 A;  3D32 A;  2N9L A;  2L1A A;  4C7Y A;  1WZ3 A;  1VD2 A;  4Z3T A;  3DWN A;  2Q5W D;  2FCS A;  3TEZ A;  4BBN C;  4HPP A;  2ZNV C;  1XD3 B;  3A33 B;  3L17 A;  4EZL A;  2ZFG A;  2BB6 A;  5LLI A;  4BOS C;  5KAF O;  4K7W A;  4ICU A;  4WWN A;  3PRE A;  4KR4 A;  2WHI A;  1XT9 B;  5H8Y E;  1E8X A;  3W1Y A;  2IGH A;  1T1L A;  3EC8 A;  3M62 B;  4K81 A;  3LJ3 A;  1J19 A;  2KDI A;  3AA1 A;  1MI0 A;  4YT0 B;  3TMP B;  1JQ4 A;  2AQ3 B;  3DVG X;  5MPO A;  1XCT L;  4RGT A;  3HM3 A;  2QCZ A;  4D5U A;  5GXG B;  2FID A;  5TIS O;  1V5T A;  4A3P A;  4BVU C;  1TYG B;  4AYM C;  1KFY B;  5IYU A;  2J0K A;  1DYQ A;  3Q3N C;  1E7U A;  4RLC A;  1BXT A;  4GCP A;  4MAC A;  5CX3 A;  1G6J A;  2XBB C;  3DBH B;  1RWS A;  3ZGZ A;  2LRW A;  4AFK A;  2RMM A;  2IO3 B;  2R8A A;  2Y3A A;  2J0M A;  1I4R A;  5B5E O;  2R89 A;  2ZEQ A;  2XE3 A;  1E90 A;  4IM0 A;  4MEL A;  3VZT X;  2IO1 B;  1V6E A;  2JRI B;  2A4Z A;  3A0H O;  3L13 A;  5BMH A;  4R3D A;  2JWU A;  3AE6 B;  1MFW A;  1I4X A;  1SIJ A;  3DBL I;  3RNG C;  1NEN B;  1LFD A;  2JF5 A;  1OQR A;  2J7Q B;  2C60 A;  3ZXR A;  1GJZ A;  2W3S A;  3UQB A;  2DZJ A;  3U4E G;  3RPF C;  2ICI A;  2NTS A;  3ZJV A;  5IN7 A;  4KKJ A;  2WDV B;  1N63 A;  3GZN I;  1M94 A;  2K0P A;  4K7U A;  1OTR B;  2BS4 B;  2G3Q B;  2KFK A;  4WQM A;  4FMS A;  1P9D U;  1WJ6 A;  3VUY A;  4I6P A;  4KGT A;  3ECI A;  5DPT A;  5TSS A;  1NYQ A;  3A9K B;  4FES A;  3PS6 A;  3VR9 B;  4AKR B;  2N1W A;  2GBJ A;  3AA0 A;  1HXU A;  3WIM A;  1MHH E;  1ZHZ A;  3RUI B;  2M4N A;  1M4V A;  1P3Q U;  4NQK E;  2MJD A;  3KYD D;  1Q9F A;  1WX9 A;  2AEH A;  2NCN A;  3RT3 B;  2FAZ A;  1QF6 A;  3TEX A;  2PPH A;  1E9M A;  3APC A;  2ZCC A;  3KUC B;  2DAF A;  3P1M A;  4XZ4 A;  1LM8 B;  4FRT A;  2BYE A;  4M02 A;  2KDF B;  4RLB A;  2LVQ A;  1YN3 A;  4HWI B;  1X1M A;  2JSV X;  3E56 A;  1YX6 B;  3BVM A;  2OJR A;  2JQY A;  2N7E A;  3MTN B;  3QWZ B;  2KQ4 X;  1JW9 D;  3UIO B;  2O4V A;  3AN1 A;  3V61 A;  3BK2 A;  2BKR B;  2K9X A;  1WR1 A;  2Y5C A;  2MCN B;  2KX0 A;  2DX5 B;  3EFC A;  3P4Q B;  1V86 A;  2WX1 A;  3BWU D;  2O2V A;  5T5F A;  1IBX A;  4XNL A;  1R4N I;  3AAE A;  4GGQ A;  5T8I A;  1F0Z A;  1FIQ A;  3ZRC A;  1SEB D;  2KN4 A;  4OVV A;  2QJL A;  4A9A A;  3UAQ A;  1Y56 A;  2POR A;  4HVB A;  2KDE B;  2N2L A;  4EFO A;  4MEM A;  2VZK D;  4EZK A;  2BS3 B;  3ZQ4 A;  2FUH B;  4YSY B;  5C23 A;  2N0S B;  2WXN A;  2KC1 A;  3WCQ A;  5ADX K;  2J1N A;  2Y0L A;  1SJE D;  2W55 A;  1YJ1 A;  3H7S A;  4DBG A;  1V97 A;  2BF8 B;  3NHE B;  4AYI D;  2H88 B;  4RCO A;  4DXG A;  4OW0 A;  1E0Z A;  2FGR A;  5IAA C;  3WA0 A;  4YTP B;  4ZDV A;  2V1Y A;  4S0R A;  2YLM A;  2KZ7 A;  3KYC D;  1XO3 A;  3AI5 A;  2Y2X A;  1WXA A;  4FBJ B;  2MX2 A;  3OAW A;  3TCA A;  3WAM A;  2Y0H A;  1V9J A;  2LUM A;  2L32 A;  2AQ1 B;  3PZ8 A;  1F9J A;  4A8X C;  3OJ4 B;  1JWS D;  3WAO A;  4E1T A;  3VE1 A;  4GN1 A;  2RPV A;  4ANV A;  3A2S X;  2MSE D;  1GG3 A;  1SJH D;  3T24 A;  2G4D B;  1WM2 A;  1HXX A;  4M8N A;  2WJQ A;  4HKQ A;  2V0G A;  4NPN A;  1UBQ A;  5LXI B;  1FNU A;  1OPF A;  2ERV A;  2N2M A;  4OZB A;  3V6C B;  1GPX A;  5D94 A;  1WXV A;  3EGR A;  4C69 X;  2KMC A;  3DBR I;  5E6N A;  3EA6 A;  5C3J B;  2G1E A;  3P4S B;  5G5H A;  2G45 B;  1BH3 A;  4W9E A;  3P42 A;  1ZP0 B;  3VRB B;  1EF1 A;  2Y5B B;  4GCQ A;  2PRN A;  1P7E A;  1BXW A;  1C4P A;  1HZ5 A;  2NR2 A;  1C77 A;  2C7N B;  2FGQ X;  1N62 A;  5D3I B;  4IW0 A;  4BOZ B;  3DHH C;  3SU8 X;  3SR6 A;  4TV3 A;  2LVP A;  3HWB A;  3LK2 A;  1GFQ A;  2BTE A;  3NZS A;  1C1Y B;  1WJU A;  1WGD A;  4GDL A;  2D5G A;  3ZJT A;  1R7S A;  2WX0 A;  1QJ8 A;  2KDY A;  4RFB A;  1L6V A;  3IAS 1;  2MBO A;  3BY4 B;  4IKG A;  3VE2 A;  2CKH B;  2ZPY A;  1YN5 A;  3M3J A;  1TS2 A;  4MGY E;  3VAW A;  3KUZ A;  2PJH A;  3AEB B;  1F2R C;  1GNU A;  2K3U A;  1XLN A;  3LDZ E;  2RDH A;  4K3C A;  4ZYN A;  4KIK B;  5JZE B;  3JTY A;  1AWD A;  4RGM A;  3MFG A;  2WVP A;  2HDE A;  3AAA A;  2GMI C;  2YEP B;  5L83 A;  1K50 A;  4KDL B;  2WXF A;  5AFU K;  3POX A;  4JWS C;  2BB5 A;  2KJ6 A;  2H89 B;  3DVN U;  1EF5 A;  3W5V B;  2WXP A;  4HJK A;  2KTR A;  3DOW A;  5TR5 A;  1JAL A;  2N7J A;  5EDS A;  3RBH A;  4KDI C;  2M0A A;  3AEA B;  4BKS A;  5ADX L;  1QOF A;  2LVO A;  1WIA A;  4RM8 A;  1QQR A;  3KQ4 A;  4JFB A;  3I9V 1;  4II3 B;  2KVZ A;  4PYU A;  2VH1 A;  4TMA B;  3T8M A;  4FT6 A;  2D3G A;  1LQB A;  2KJH B;  1Q10 A;  5G55 A;  1K53 A;  1L6U A;  4F8C B;  4DQO C;  2UWQ A;  2WXI A;  2NPT B;  2PVG C;  4W9D A;  1XQQ A;  2KAJ A;  3P4P B;  1PYW D;  5BYR A;  1R4M I;  3VTU A;  2IO2 B;  3SDL C;  2J53 A;  5AZG A;  4FHJ A;  1FCL A;  4LSH A;  2R2Q A;  4KKI A;  4MGI E;  1E8W A;  1SGH A;  2KQ7 A;  2MH7 A;  1L0X B;  1KM7 A;  4BAX A;  1OSM A;  2KOX A;  4MM3 A;  3E9S A;  4FSO A;  3BVZ A;  1N61 A;  4MJS B;  4ZRJ A;  2EMS A;  1YQB A;  5DPR A;  2YNK A;  2QC8 A;  4KVG B;  1EO6 A;  4ASW C;  1SE4 A;  4TQ0 A;  4AYN A;  3K9P B;  3QQ8 B;  1N6Z A;  2IGD A;  4MH0 E;  3VFK A;  2KWU B;  2Y5P A;  1F1H A;  1JRO A;  1KOT A;  4FJY A;  2YEP F;  3AH7 A;  1V49 A;  1HEZ E;  2KTF A;  1Q5W B;  4ITK A;  1MHX A;  4RNA A;  4WJP A;  4EKU A;  3POU A;  5JDP A;  2CHW A;  2W9N A;  3QIJ A;  3N1X C;  2JRH A;  3AE7 B;  3VUX A;  3IT4 B;  4JL9 A;  1NI2 A;  4P16 A;  2C9W B;  2MHJ A;  2BWF A;  3PVL A;  4O3W A;  4GDK A;  1LGR A;  1OGW A;  4FN2 A;  1S5L O;  2J4U P;  3ZW3 A;  1J8C A;  1WMH B;  1ENF A;  1WF9 A;  3NJT A;  2WJR A;  3AA7 A;  1AW7 A;  1SE9 A;  3ZJU A;  3QK0 A;  2WDQ B;  3H8H A;  3IAM 1;  3Q69 A;  2NMQ A;  3POR A;  2C7H A;  3Q3M C;  4TQ1 A;  1E8Y A;  4C4V B;  5D6J B;  3P4R B;  2WXM A;  1I4G A;  2KDM A;  4L2Y A;  5G26 A;  3ETR A;  2INC C;  2KFJ A;  3EMN X;  3W9C B;  2IBI B;  4LNI A;  3PZ7 A;  2WDR B;  1FO4 A;  4G76 A;  5CHV C;  1VZ8 A;  2DZI A;  2KWC A;  1LO5 D;  1TY2 A;  4OHJ A;  2DEN B;  5JHA A;  1TKE A;  3V6E B;  1H8C A;  3PT2 B;  3VZU X;  4MSM B;  3R66 C;  1G90 A;  2WXG A;  2RPQ A;  3JVZ X;  2KD0 A;  1NDD A;  2Y0K A;  2PE9 A;  1TJE A;  4FUL A;  2K4T A;  3VR8 B;  1C3T A;  1H4R A;  1LXD A;  2JU6 X;  1I4H A;  3OWE B;  3PLU A;  2MBH A;  4O1N A;  4N74 A;  1S1Q B;  4N58 A;  4RJX A;  5AFU L;  2BKF A;  3DVG Y;  1ZW7 A;  4A6Q A;  2YVC A;  4HEA 1;  1ZDV A;  1THQ A;  4MGZ E;  4A3O A;  4B0E A;  2D10 A;  3U7Z A;  2OMF A;  3C5O A;  3KVF B;  4AJW A;  4AZL A;  4PR7 A;  3PPA A;  4RF1 A;  4LK0 M;  2ONQ A;  4KR8 A;  3AEC B;  4UB8 O;  4IUM B;  3GP7 A;  2PLP A;  3JSV B;  1IZN A;  4P1C C;  2HE7 A;  3ZNI D;  1HZ6 A;  3AEG B;  4M00 A;  1AAR A;  1AYF A;  3LK3 A;  3P63 A;  2QMT A;  4KZ0 A;  3MC8 A;  4H2A A;  3POQ A;  1PHO A;  4IWO A;  1UF0 A;  5G39 A;  2QIL A;  1GB4 A;  4JWU C;  2MBB B;  3L08 A;  2D11 A;  4W9F A;  2CJO A;  2IY0 B;  4GDL B;  2K8C A;  4MT5 A;  2ODJ A;  2N9E B;  4CTD A;  4IWQ A;  2R88 A;  2LFU A;  1TKG A;  3R8B A;  4FJZ A;  2LGX A;  2ZCB A;  3ENE A;  3RD2 A;  2R61 A;  3X0W A;  2WQY B;  2BBC A;  2PE6 B;  2C5L C;  4KX6 B;  2WU2 B;  4US9 A;  2N7D A;  1V1P A;  3ZTC A;  1UBI A;  3HW9 A;  3KUD B;  3AAA B;  3N1Z C;  4IOI E;  5FR6 A;  1UWX A;  5D2M B;  5CHF A;  4W9L A;  1SF0 A;  5E6O A;  2K6Q A;  1YOV B;  3N20 C;  3PTF C;  1HE8 A;  2HTM E;  5J2R A;  4XC2 A;  3R7Q A;  3AED B;  2KTR B;  1SB3 C;  4NJC A;  4ZRK A;  1T0S C;  1DOX A;  4N6E B;  2LHF A;  2X8X X;  2KAC A;  4FJV B;  4NQL B;  4GF4 A;  1YD8 U;  1QOA A;  4ICV A;  4KV2 A;  3IFW B;  2LXA A;  1HQR D;  3AB5 A;  4F4B A;  3URY A;  1OQY A;  1E5W A;  2J52 A;  3PGU A;  3W2D A;  3J9C A;  2GOW A;  3T3N A;  5EE2 A;  4F1S A;  2B3A A;  2KQS A;  1YS5 A;  2RD0 A;  1I35 A;  1YIW A;  1ORM A;  3QHT A;  4QAY A;  2RGF A;  1VR9 A;  3L10 B;  3TEY A;  2LGI A;  3AEF B;  1Z5S B;  5FVN A;  1TY0 A;  4C56 C;  3AUL A;  2ASQ A;  1PUT A;  1PGA A;  4IWP A;  5CTR C;  1TT5 B;  3PO0 A;  4A90 A;  3IHP C;  4ANW A;  2LAS A;  4MM3 B;  3VTW A;  2G4S A;  1ZXH A;  1C79 A;  2LHE A;  2RDG A;  3FC4 A;  1XLO A;  3IT6 B;  2VH2 A;  3FKY A;  3LYY A;  3IXS A;  4YTM B;  3IG3 A;  4EE2 A;  2GLS A;  2XE5 A;  3PLV A;  2QTK A;  2MEK A;  3A9J A;  4YXD B;  2EMT A;  3HOL A;  4E1S A;  1S3S G;  3SHQ A;  1D3Z A;  1V80 A;  1E10 A;  2OHF A;  4FXC A;  1YJJ A;  1P4T A;  4CYE A;  2M19 A;  1HTQ A;  1C78 A;  3AE3 B;  4N9F 4;  5BMI A;  1RFK A;  2MW5 A;  2DLB A;  2KX3 A;  3RZF A;  2CHZ A;  4E74 A;  1WI0 A;  5CHW A;  4BKG A;  3AA7 B;  3CWI A;  4OVU A;  1YQ4 B;  3VTV A;  1WSP A;  1XCQ L;  5JXV A;  1JCK B;  2O6V A;  4NNJ B;  2E3T A;  2GE4 A;  4AWJ A;  3WI5 A;  2RR9 A;  4MSQ B;  1ZUD 2;  1QKZ A;  1Q9G A;  4HCN B;  2ZVO A;  3U30 A;  3N3K B;  3HOE A;  1HA5 A;  1WX8 A;  2ZJD A;  4P7I A;  5EE1 A;  2GI9 A;  1J7A A;  4U9C A;  3LB8 C;  1TZ1 A;  2L8J A;  3Q2A C;  4GU2 A;  5AUK A;  4BZA A;  3BIN A;  1J7B A;  1TZO A;  1C9F A;  1P1A A;  2K8H A;  3C0R B;  4FSP A;  1ZXI A;  2JZP A;  3DBH I;  2F1C X;  1VCB A;  2DYM A;  2DNF A;  1UD7 A;  4W9C A;  3T3O A;  4B9K A;  4I6N B;  4XX5 A;  2W80 C;  3QA8 A;  3C8Y A;  1KLV A;  2W3R A;  2KXP A;  2GBR A;  2V3P A;  2JYT A;  5DL8 A;  1JWU D;  3H6N A;  2LMC A;  4K7S A;  2OOB B;  2NTT A;  3R2I A;  2Z0E B;  1WE7 A;  3N32 A;  1K51 A;  5G3A A;  1OFF A;  3H7P A;  5IO9 A;  3H1U A;  4RGO S;  1V81 A;  1WXQ A;  5BO4 B;  1D5M C;  4LLG M;  2FBW B;  2XG6 A;  2KZR A;  4US8 A;  3PGE A;  5DL5 A;  1OEY J;  1BUI C;  2BWE S;  2K8B A;  3GE3 C;  3OJ3 A;  2MRP A;  2GBN A;  4YTN B;  4TKN A;  4LSI A;  2KLG A;  1XXG A;  2LGY A;  4W9G A;  1CZP A;  2KAN A;  3T9L A;  5G5G A;  3RNA C;  2K0L A;  1NI3 A;  4PS7 A;  3B0A A;  3TJP A;  1V2Y A;  4HXD A;  2IY1 B;  3P2B A;  3I3T B;  3W1S C;  1WZ0 A;  3SZD A;  4ZRQ A;  1I4Q A;  2L83 A;  1WY8 A;  1KF6 B;  5C2T B;  3LK3 B;  1OQQ A;  2R4N A;  1HXY D;  4NJ7 A;  3M63 B;  4IDI A;  5JH5 C;  5H2F O;  3TBL D;  1P7F A;  3ZVV A;  4AS1 A;  4RH6 A;  3Q8A A;  2G9H D;  2PW9 A;  3MHS D;  2PMV A;  4IL6 O;  2XE2 A;  1ZOY B;  2D3B A;  4OZA A;  3CMM B;  2IZV B;  3AEE B;  3U52 E;  1I4P A;  4TUU A;  2JXT A;  1T0R C;  1K52 A;  4W9I A;  3AA1 B;  1ROE A;  1D5X C;  2M56 B;  2XNA C;  2PVO D;  2JUO A;  1C4A A;  1WM3 A;  2WYQ A;  3VY8 X;  2HJ1 A;  4WH4 A;  3BVG A;  3NSG A;  2X27 X;  4LJP B;  2C7M B;  1V8C A;  4GCS A;  4FUV A;  4HDO A;  2NBW B;  4PJ0 O;  4L1B A;  3B2F A;  2L3Z A;  3MC0 B;  5B66 O;  1GC7 A;  1VLB A;  3U7D A;  3DA4 A;  3EEC A;  2LWP A;  3HHM A;  4ZHP A;  3NUH B;  4WAA A;  4WJO A;  4AKM A;  4XYC A;  5GTH O;  2BQQ A;  2RDB C;  3RNC C;  5LXH A;  2AYO B; 
#chains in the Genus database with same CATH homology
 4N74 A;  4XGA B;  4K3C A;  4PK1 A;  3OG5 A;  2QDF A;  4QAY A;  2X8X X;  2VH2 A;  4K3B A;  2V9H A;  4N75 A;  4C4V B;  3MC9 A;  3Q6B A;  4C4V A;  3EFC A;  2MHJ A;  3MC8 A;  4BZA A;  2QCZ A;  2VH1 A;  4C00 A;  3NJT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...