4C4VA

Structure of the outer membrane protein insertase bama with one potra domain.
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
462
structure length
445
Chain Sequence
FYVRKIRFEGNDTSKDAVLRREMRQMEGAWLGSDLVDQGKERLNRLGFFETVDTDTQRVPGSPDQVDVVYKVKERNTGSFNFGIGYGTESGVSFQAGVQQDNWLGTGYAVGINGTKNDYQTYAELSVTNPYFTVDGVSLGGRLFYNDFQADDADSSDYTNKSYGTDVTLGFPINEENSLRAGLGYVHNSLSNMQPQVAMWRYLYSMGEHPSTSDQDNSFKTDDFTFNYGWTYNKLDRGYFPTDGSRVNLTGKVTIPGSDNEYYKVTLDTATYVPIDDDHKWVVLGRTRWGYGDGLGGKEMPFYENFYAGGSSTVRGFQSNTIGPKAIYFPHQASAKDLCKSDDAVGGNAMAVASLEFITPTPFISDKYANSVRTSFFWDMGTVWDTNWDSSSGYPDYSDPSNIRMSAGIALQWMSPLGPLVFSYAQPFKKYDGDKAEQFQFNIGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords OUTER MEMBRANE PROTEIN ASSEMBLY FACTOR BAMA
publication title Structure of Bama, an Essential Factor in Outer Membrane Protein Biogenesis
pubmed doi rcsb
source organism Escherichia coli
molecule tags Protein transport
total genus 90
structure length 445
sequence length 462
ec nomenclature
pdb deposition date 2013-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01103 Bac_surface_Ag Surface antigen
A PF07244 POTRA Surface antigen variable number repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.50 Mainly Beta Beta Barrel Porin membrane protein fhac: a member of the omp85/tpsb transporter family 4c4vA02
3.10.20.310 Alpha Beta Roll Ubiquitin-like (UB roll) membrane protein fhac 4c4vA01
3Q6BA 4K3CA 3EFCA 4N75A 3OG5A 3MC9A 2MHJA 4N74A 2VH1A 4PK1A 2V9HA 4BZAA 4QAYA 4K3BA 2VH2A 3NJTA 3MC8A 4C00A 2QCZA 4C4VB 2QDFA 2X8XX 4XGAB 4C4VA
chains in the Genus database with same CATH superfamily
4PYUA 3P2BA 3DVGX 1U4AA 2ZW0A 2WXNA 3VRBB 4MGZE 3O65B 3EECA 5G3AA 4YSZB 4EEWA 5IAAC 4ARIA 1GPXA 3ZJUA 1EU4A 2M17A 1IZNB 2WXJA 3R7RA 4O1NA 3OJ4B 2CR5A 3CF6E 2XG6A 4GCPA 3PGRA 4IW0A 1FRRA 3SR6A 2G4SA 1HTQA 3FILB 3GP7A 4GN1A 2LWPA 1C4CA 5AZHA 4KRAA 5D5DA 2ZPNA 2KC2A 1XQQA 3ZUNA 8PRNA 5HG2A 2LZ6A 3QQ8B 1QLBB 4LSHA 3JW0X 2PORA 3IXSA 3WAOA 2LFIA 3M63B 2AQ1B 3PSEB 2WGSA 2A5UA 2FAZA 3PLUA 4S0RA 1UBIA 5IOIA 2WXGA 2R61A 4BUMX 2FCMA 2Y3AA 2MSED 3WALA 3AA7A 3E56A 4BAXA 4ITKA 2MP2B 1AYFA 2CKHB 4DDID 5AEKB 1WF9A 4A3OA 1P7EA 2WS3B 3RNBC 2LUMA 1Q5WB 1BT9A 4XC2A 1UD7A 2Z0EB 4YSXB 5IA7A 2N9PC 4ZRQA 5J18A 1K51A 2RR9A 3AE5B 1HXXA 4C56C 4IM0A 1BT0A 2JVCA 3EMNX 1FNVA 4K81A 4ASWC 1SE3A 1F77A 4KDLB 2CS4A 1WX8A 3H1UA 3Q8BA 2V3SA 4PR7A 3ZNID 1V6EA 3E9SA 2JF5A 1T0QC 3NHEB 2WXIA 2NS5A 2JT4B 4ANVA 2IWVA 4EZJA 5JHAA 2DZMA 1VZ7A 5GXGB 3PGSA 3RFZB 3PGUA 5J2RA 5IYUA 3NVYA 3WIMA 5DCNA 2FCSA 5IKCM 5D94A 2Z0DB 4DXFA 4YTMB 2QSDA 3MC8A 1OEYJ 1YJJA 3S2AA 2MJ3A 2DZIA 1SE2A 1DYQA 1JRPA 4US9A 3R2TA 3D32A 3N32A 3SYBA 5HHDG 3I9V1 1SBBB 3KUZA 2BKFA 5AUIA 4AKRA 2INCC 3APFA 4WIPA 1Z5SB 2K25A 4HVBA 4JPSA 2JY6A 2CU3A 4W9FA 5JH5C 3KZIO 1I4HA 1IZNA 2MW5A 1KM7A 4ZOHC 3RULA 3VDZA 5DL5A 5C23A 3TEYA 3QRAA 3FILA 4LSIA 4AYMC 4OVVA 3DHGC 4GDKA 5G26A 1EWYC 2G1EA 1T16A 3I57A 2MH7A 1WZ3A 1ZHTA 4WJNA 4HJKA 3HM3A 1ZHXA 4FZNA 2LHDA 3UPGA 2WU5B 2ZPYA 3H7PB 4D65A 1N6ZA 1EO6A 1VDVA 3AEGB 3PRPB 1NDDA 1IBXB 2BS4B 1VR9A 4RJXA 2VZKB 1TS2A 3U7DA 1C76A 1WFYA 3QARA 4AS1A 2KC1A 2KWUB 1WGYA 2MP2A 3PLVA 4PS7A 3VZUX 1FCLA 2PVOD 1WJUA 3ZXVA 2N1VA 2MCNB 2BYVE 1BXTA 1I4GA 3CIRB 3PZ7A 3TZGA 3AEAB 5HFYA 2FGRA 2J53A 3V05A 1RRBA 2RPQA 2VRRB 2IO3B 3ETRA 2RD0A 3UAQA 2BYTA 4FADA 3P1MA 2JWUA 3QK0A 1OTRB 2MEKA 1DOXA 3AXCA 1D5XC 3ZO5B 1SF0A 1EU3A 2QILA 2MRPA 2DWQA 1R4MB 5B66O 2KWDA 3CMMB 2RDHA 4EZLA 1L0VB 2LEKA 4OZCA 2DAJA 4RM8A 3GZNB 3P63A 3U7ZA 1GFQA 1XCTL 4KVGB 2IYDB 4I6PA 4NAWB 1E6EB 4CTDA 2YVCA 1HXYD 3MC0B 4GMVA 3IFWB 2QC8A 2IBIB 1WR6E 4W9KA 1D6EC 4FT6A 4LNOA 3VHTC 1VJKA 3BYTB 4I6NB 4F4BA 4JCHA 4EKUA 2JYEA 3Q8CA 1V80A 4FN2A 4O4XA 3T20A 3AU5A 5E6NA 3RMKC 3RPFC 1N5XA 1JQ4A 3U52E 3L54A 1YD8U 2X8XX 5EE9A 1MVKA 2GBRA 5IP4D 1AARA 1C3TA 4URKA 3BRYA 4FLHA 1WIAA 2G9HD 1LO5D 4JWUC 1N5WA 4B95A 3L0WB 5EE3A 2R4NA 3M3JA 2XK5A 2F1CX 1ZPSA 3H7PA 2ONQA 2LXCA 1D5MC 2M19A 2NMQA 1E0ZA 2MBEA 1GB4A 2YEPB 3OG5A 4M0WA 3MJWA 4MGIE 3DBLB 3PT2B 5C2TB 1ZHZA 2LD9A 2N9LA 4AWJA 3HRDD 4H2AA 1CQVA 1L2NA 4I6LB 2KMCA 2KJRA 2JZZA 2EKEC 5B5EO 1WYGA 3TCAA 5CX3A 4HKZE 1WH3A 1MPFA 2KDBA 3MC9A 4JX1C 2L1AA 1I4RA 2W82A 1RAXA 3NZSA 1WJ6A 3U30A 5JHBA 2R89A 2ZW1A 2JPHA 1PDXA 3BWUD 1R4NB 4BOZB 4AZLA 4YXDB 4KGSA 1WXVA 3NS1A 2F1VA 4W9EA 3R8BA 3ENEA 3AA1A 3PV1A 3PS6A 1FFVA 4MH8A 1VZ6A 6PRNA 2BKRB 1TS5A 2WVPA 1R4MI 5E79O 3SZDA 3R2IA 2NPTB 1EF1A 3GZNI 2KC0A 3TSSA 1Q9GA 5C1ZA 4TQ1A 4AQ7A 3FC4A 4KGRA 2HE7A 2KDIA 2JXXA 1E8YA 2I2YA 3AB5A 1Y8RC 2YPVA 4XWWA 1K52A 2PW9A 3O0EA 4WWOA 3AA6B 1Q0WB 1NI2A 2N0SB 2V9HA 3EFUA 3O13A 3R7QA 3RNCC 3U8ZA 1WWTA 3AAEB 3ZW3A 2JZ3B 2DHZA 3Q8FA 3B2GA 4WH4A 2LVPA 3N3KB 4F7ZA 1TY2A 2WWZA 2L76A 2C9WB 5JXVA 3PZDA 1AW7A 2D3BA 4UDUC 4C80A 4GGQA 1P1AA 2L32A 3DQVA 4XNLA 3RBHA 2WXPA 3H8HA 2I1JA 2WJRA 4NY0A 1TBEA 1RLFA 1RM6C 2J52A 2BTEA 1TGZB 4F1SA 1TT5B 1ROEA 1ZUD2 4MM3A 2VH1A 1GC7A 1QOAA 3Q8AA 4IL6O 4M01A 3DHIC 5G39A 3DBLI 3KW5B 1PQSA 2ODJA 3T9LA 2ZVOA 2DAFA 1EF5A 7PRNA 2QJLA 1I4QA 1Y56A 5GMVA 4GOCA 2XE3A 1FO4A 1F1HA 3LXFA 1KTKA 4RF1A 4QQ1A 5FVNA 4GSWA 1XLOA 4BKSD 2J0JA 3V60A 3EGRA 5D2MB 3ZDTA 3ZRFA 1GAQB 3V6EB 2K9XA 1WXAA 1V49A 3ALBA 2PE9A 1GG3A 4FBJB 4B0EA 1AWDA 2BB5A 1C78A 1E7VA 1LGRA 4ARCA 4J6IA 4WURA 4E71A 4GB9A 1E8ZA 2H89B 1T6BX 4TUUA 4ZRIA 3HWBA 3W1SC 2GB1A 2K4TA 2MX2A 1MG8A 4M00A 4S17A 2L3ZA 1ESFA 3AE6B 4GU2A 2VH2A 1J7AA 2LRWA 2WX1A 4NJ6A 2XE5A 3EC8A 3LYYA 2DBYA 1ZE3D 1YMHE 2LGSA 1WZ0A 2LJ5A 4RGTA 5H92C 3ZIMA 3HOEA 1BUIC 1T5XD 3BYYB 4C69X 4IC7B 3BVMA 1Z2MA 4FESA 2KDMA 3PHWB 3A1QB 2KD0A 1RWSA 2KXPB 1T3QA 1J0GA 3AA6A 4IOIE 3HHMA 1J7CA 4DXAB 4O3ZA 3AAEA 1J19A 4C4VB 2J42A 4GLSC 3AE7B 3UQBA 2IO0B 2ZCCA 2REXA 1CJEA 2AL3A 4LNIA 2OOBB 1UZXB 5PRNA 1GNUA 4E1TA 3Q69A 2K5PA 4NJCA 3UGBB 3X0WA 2ZZPB 3W9CB 1LXDA 5LXHA 4KV2A 2JMMA 4PUXA 1OGWA 3NOBA 3PRZA 1DOYA 4KR4A 1NYRA 1WGKA 2L0FA 3P4PB 3TMPB 1OPFA 2K8BA 3VR9B 2QCZA 5FK9C 2LHFA 1TJEA 3DVNV 3KVFB 2JZPA 3AEEB 4YT0B 4G0NB 3MHSD 2OJWA 3AV8A 1AN8A 4P1CC 2L05A 4A8XC 1MFWA 1L0YB 3PRNA 1QOFA 1ZGUB 1VCBA 3DWGC 4USAA 1HTOA 5E6OA 5LLIA 2LMCA 1XXGA 2KYWA 4MEMA 2J4XA 2KZRA 2RGFA 4RJWA 1MHHE 3AI5A 5E6JA 1CK1A 1OQYA 1KF6B 2J7QB 2WU2B 1L4ZB 4NQLB 2KKCA 5BYQA 3ZKJC 4ZRJA 3WU2O 2R8AA 1IP9A 2EMSA 5G2NA 2UU7A 1YJIA 3TIXA 4FJZA 2K0PA 1RYJA 2J0KA 1XF5L 4LDTB 3V6CB 3LJ3A 2BVCA 1JMLA 3AE1B 1FM0D 2FCQA 3UQAA 3AEFB 2KLGA 3B08A 4MELA 4WQMA 3W2DA 2GBNA 2KO3A 4EE2A 3VR8B 2MHJA 4KZCA 1QQRA 3W5UB 3PHXB 3GE8C 1A70A 4BKTA 4YWGG 4XE0A 1C4PA 1UF0A 2JXTA 2OEDA 2KZ7A 3VQIA 2JRHA 3ZTDA 2N1WA 2Y0LA 2VZKD 4A6QA 4MSQB 2PKOA 2IY1B 3L10B 1LM8B 4ICUA 3K9PB 4GXBA 2M06A 2JWZA 2K39A 3BVZA 2L7RA 4KSKC 1YOVB 1WSPA 2D10A 3LDZE 1I7HA 2WXOA 3A1QA 3UU2A 1E10A 2KXPA 3LK3B 4E1SA 1WE7A 4ACFA 1RFAA 2PE6B 3POUA 4WQOB 2KQSA 2BWFA 3AE4B 3DVGY 3VE1A 5H8YE 5CHVC 2KDYA 2O6VB 5CTRC 4C4VA 5ADXL 2FGQX 2Y2XA 2INPE 4MGYE 4LSEA 4G75A 3RCZA 3SDLC 4A20A 5MPOA 3DWMA 2PTLA 2PIAA 1WYWB 2DZJA 1QILA 2PMVA 4GIVA 1P4TA 4UB8O 3QHTA 4L23A 5FR6A 2LJIA 1V1PB 4RNAA 3TL5A 1XLNA 2AYOB 1C77A 2WP9B 2KJ6A 3ZVVA 1MI0A 3QA8A 3FKYA 4BKSA 1YN3A 1SB3C 2JU6X 2LGXA 2KDEB 2MHLA 3KYDD 1YQBA 2NBWB 3NJTA 2WDQB 3PPAA 2MJEA 3T3NA 5DPWA 3SYSA 3ZDMC 1WGHA 1S3SG 1UBQA 3Q6BA 2C7MB 3A9JB 1YIWA 4N75A 3OWEB 2FNJB 5CHFA 1ZW7A 1QJPA 2AQ3B 2KACA 1TKGA 2V4LA 1YN4A 4WAFA 3PTFC 1MM5A 1WGRA 3GS2A 4NZLB 4F8CB 4WJPA 4BOSC 4JFBA 1E8WA 1XLPA 3C0RB 2KVRA 5HI1A 3B1LX 2MNHA 4RL9A 1UUPA 2SAKA 5G38A 2A4ZA 1JROA 5EDSA 2GI9A 4DHZB 4GCQA 2C60A 4GDLB 1C79A 3VTWA 3I3TB 1E7UA 4K7SA 1THQA 1V8CA 1SSNA 2X9KA 4HJGE 3K19A 2W3RA 2LXAA 2FBWB 5TISO 4R3DA 4WWPA 1JALA 3LK42 3PORA 1PYWD 2L52A 4HEA1 4UB6O 2CU1A 3CSTA 4BVUC 4XWTA 4BFRA 3DWOX 2EKIA 5D3DA 1VZ8A 3PGEA 2Z59B 2IGDA 1HQRD 3P42A 2WJQA 3APCA 3NS8A 3DZMA 2FUHB 3W5VB 4FSOA 2LGYA 3BVGA 2HJ8A 4G11A 4HDQA 3AE8B 4DXGA 1WR1A 3AA0B 3AM9A 3L13A 1UNSA 4K7WA 2KHWB 2G3QB 4MT5A 1P0RA 2O6VA 1E8XA 2D11A 5IN7A 4ZDVA 4LJOB 2XTQA 1PGXA 2HD5B 4MJSB 1TS4A 3M62B 3URYA 2KNBA 1FNWA 2GLSA 1L7YA 2K1FA 1JWSD 3A9KB 1IGDA 4RFBA 4XNKA 1SE4A 2V0GA 1HXTA 2N7DA 1M94A 1FXIA 2KVZA 4RLBA 3V3XA 2W9NA 1KH0A 1XO3A 4EOYA 3N1XC 5AFUL 1TTNA 3SEBA 1OEYA 3JVZX 3MHZA 4W9GA 3AE2B 4WAAA 5E6PA 3IAM1 2KFJA 3IT4B 3SHQA 2W81C 3Q3MC 4K7UA 1GC6A 4HRSA 1WRIA 4ANXA 1ZDVA 2W80C 1L5PA 2WXFA 2KN5A 4FHJA 1H4RA 5KHQA 2GMIC 3J9CA 2WLBA 4RH6A 2C7HA 2MA9B 3A9JA 2W55A 2GBMA 1IBXA 1KRHA 2JQRB 2IGGA 4N58A 1SIJA 3H9DA 1I4XA 1WXSA 2KN4A 3WI4A 1MG4A 1NENB 4JIOU 3EUB2 2ZNVC 1E90A 1V5TA 1UGJA 5KAFO 5L83A 3A2SX 3TEXA 5IO9A 4MGKE 1WRDB 1ZP0B 2B3AA 3WAMA 1FNUA 4TSSA 1L6UA 3JCUO 3TJPA 1XLQA 2HJ1A 1V2YA 1D3ZA 2KQ4X 4GDLA 4O49A 1XCQL 1YNTE 2Y0HA 2R88A 2YNKA 1OQQA 1G6JA 4LSFA 2GBKA 4REZA 1PFDA 1K8RB 5L95C 5D6JB 1J8CA 3BZDB 4AYDC 3VUXA 2QMTA 1J7BA 4KSLC 2KWCA 1Q9FA 3N9YC 4E3CA 4G3XB 4EZKA 3Q8EA 4W9HA 2LRUA 3U2SC 4RGNA 1QZEA 3JTYA 3DVNU 2JYTA 4NAWA 3AA0A 1FCCC 3B2FA 1PGAA 3NZ3A 1Q1OA 3VUYA 2KJHB 1X1MA 2RSUA 3VTVA 1I4PA 4P16A 2N2LA 4P6VF 1KLVA 2BS3B 2O2VB 2DYOA 4DBGA 2IO2B 2M56B 4DHJB 2FUG1 4MJSA 3IVFA 3SFDB 3T3OA 1UWXA 1V81A 2HTHA 3BK1A 1ACCA 5DL8A 1EUVB 2KT7A 2L00B 1EM7A 3A9KA 4P1BC 2ZCBA 2GOWA 1HEZE 2DNFA 2WXHA 2J0MA 3UINB 5BYSA 4LJPB 1K53A 3VZWX 3RT3B 3UF8A 4FRTA 1QF6A 1K50A 5BMGA 1H6S1 1YX5B 3AEDB 3VFKA 3HVZA 1F9JA 1FFUA 2JQYA 1BH3A 2M8SA 2LVOA 3MP9A 1N63A 3VUWA 4LTUA 3ZXRA 4P7IA 4RM9A 3OJ3A 3OLMD 3EHVA 1KOTA 2NTSA 1IGCA 3NUHB 4HK2A 1MHXA 3GOEA 3HM6X 5H2FO 5DPTA 4PS8A 1KLGD 2R4OA 2N7EA 2NR2A 4FSPA 3VE2A 2AX5A 5GV0A 2WX0A 3L16A 2AL6A 4KKJA 1V86A 4CHKA 3BY4B 4HCNB 4CYEA 1V97A 1GJZA 3DWNA 1PHOA 5AUKA 4WJQA 4B61A 4ZYSA 3KWVA 2UYZB 3SY7A 4HXDA 4W9DA 4AKMA 5G5HA 5BMIA 4AJYB 3VY8X 1SJED 4US8A 4RLCA 1ZHWA 3KUCB 3AN1A 1FXTB 2FCNA 2BGFA 1IUEA 4KR8A 2UWQA 2BS2B 2X38A 2N9KA 2KTRB 1F2RC 5EE2A 2NPTA 3ZJVA 2PLPA 1DGJA 2JUOA 5DL6A 3TUOA 3HVDA 4LDTD 3APDA 2SEBD 4FZLA 2V1YA 4M02A 4AYNA 2V3PA 1CMXB 1MPEA 4O3YA 2Y5BB 3ECIA 4OVZA 3I63C 1T0YA 2IJ0A 4K3BA 2PVGC 2H88B 4KKIA 4DK5A 2ZFGA 4M8MA 2BBCA 3RNFC 1GFPA 1T1LA 2AQ2B 2B76B 2K8CA 2OHFA 3QX1A 2IO1B 4KGTA 3SFEB 2Y0KA 3K9OB 3ZTCA 1WX9A 1GFOA 5D3IB 2BYFA 1QJ8A 1SIFA 2LHEA 1NEKB 4PJ0O 4NQKE 4FRXA 2WQYB 4C7YA 2WDRB 3G7GA 2W54A 4TV3A 4W9CA 1V5OA 1E7PB 1A5RA 2BB6A 3UI3A 4NAMA 3GB1A 4CO7A 5CHWA 1GOZA 1P98A 4FMSA 2WDVB 3NSGA 1T0SC 3A4RA 4N59A 1LFDA 1HA5A 4LLGM 1JWBD 4AKRB 3AULA 4B0MA 5KAIO 2IY0B 3QRCA 1WXMA 3SZVA 4IG7B 2O6VD 4IKGA 3DA4A 3MJ5A 3POXA 2RPVA 4ANUA 1WX7A 2KK8A 3RNGC 2LFUA 2PJHA 1D4BA 1C9FA 4D2KA 3AE3B 1I35A 5BO4B 2BWES 1GFMA 4GDKB 3EFCA 2JSVX 3I5JC 3ML9A 2ERVA 4OZAA 1MM4A 3SU8X 5C3JB 2ZEQA 1JW9D 3C8YA 4XDCA 1G90A 3VXWA 3JSVB 4AOFA 2KAJA 4AFKA 3WA0A 3LK2B 1FMAD 1Q10A 2EELA 2LVQA 4MSMB 5T8IA 1VD2A 4HPPA 3HOLA 1WM2A 2Q5WD 3X23A 1ZKHA 4YTPB 1S1QB 3BIID 2D3AA 4KIKB 2EMTA 3HIZA 4JWSC 4KDIC 1WE6A 2KTRA 1TS3A 3AH7A 1ZDXA 3N20C 4AYID 4MH0E 1WM3A 2LUEA 3RI7C 1PGBA 1GFNA 2X27X 2MBOA 1WY8A 1YX6B 5I4DA 4EFOA 2BT6A 3VY9X 2K3UA 4N74A 2J1NA 2ZVNA 2V3NA 3ZYYX 3T8MA 5J17A 2XE1A 4HPMB 4RCOA 5BMHA 1DOIA 3B9JA 2K0LA 1WJNA 1N62A 1F0ZA 3FAHA 3IHPC 4L1BA 1ORMA 1VLBA 1NBFC 2PEAA 3ONSA 2Y7SA 3QIJA 3DOWA 5DL7A 3NY5A 1TIFA 1WJ4A 4J3OD 3IAS1 2M0XA 2N7JA 1T0RC 1QT9A 4IM3A 5TR5A 3H7SA 3ZNZB 4XGAB 1QOBA 4XDDA 3IG3A 4BBNF 3DBSA 3NVVA 2YEPF 4X57B 3V61A 1QKZA 1TZ1A 3T24A 1XD3B 4U9CA 4ZYNA 3L08A 3DBHB 2BW2A 1CZPA 4XYCA 5AZGA 2D3CA 4E74A 2WXRA 3AAAB 3RZWC 3ZJTA 2N9EB 2L8JA 2NCNA 4O3WA 5ADXK 2XN9C 3N1YC 3PO0A 2D3GA 4FA6A 4G50A 3DHHC 3TEZA 4TMAB 1PUTA 1N60A 4OVUA 1STEA 4WJOA 3PZ8A 3PQSA 2KXJA 5EE0A 1SJHD 1XEEA 3QAQA 2KANA 2XK5B 3JSVA 2QDFA 1NI3A 2AXTO 3NZUA 3LK2A 1HZ6A 4M0WB 4D64A 2R2QA 2I38A 3M95A 2K22A 4M8NA 2M4NA 3VH4B 3LK41 4HLEA 3DA3A 1XT9B 4GHBA 2K6QA 4PS3A 3HW9A 4ZRKA 3PRMB 1KLUD 1NYQA 4FZMA 5EE1A 2MLBA 4QAYA 2MWSB 1JCKB 3W1YA 4FOZA 4ZRPA 4DQOC 3NRZA 3L17A 1P7FA 4C00A 4KIKA 5DPSA 3NVWA 4MACA 3WI5A 2MBQA 4LK0M 2OJRA 3KLSX 2QTKA 1H8CA 2N2MA 3GP6A 4FJVB 4AJWA 1JWMD 3A4SC 4PK1A 4IWPA 4L2YA 5GTIO 2XEWA 2XMXA 2ZNVB 3ZNHB 3LK3A 2RDGA 2WXLA 3RNEC 3AA1B 1BMLC 2FE8A 1TKYA 4IUMB 3ZGZA 1YS5A 2K6DB 4GF4A 1E9MA 2BQQA 3VVWB 5G5GA 3DCGA 1TYGB 4AUIA 3R66C 2KLCA 4WWNA 3KH0A 2ACZB 5JZEB 2XBBC 4LCDE 3TEWA 2JRIB 5G55A 5FKAC 1GUAB 1SXTA 3C5OA 2CJNA 2Y5CA 2JX5A 2IGHA 1V1PA 2R2OA 2YLMA 1JRUA 4KZ0A 3OAWA 3RD2A 4A9AA 1UELA 2BPSA 3LB8C 1ZXHA 1UGMA 5JDPA 2ASQA 3JYUA 3MFGA 2WXMA 4CQNA 2G4DB 1WXQA 2WXQA 3ML8A 2PRNA 1E54A 4II3B 2E3TA 3KUDB 2DYMA 2PPHA 4OW0A 3IBEA 4A3PA 2XTRA 3VRAB 3Q3FA 1N61A 3DBHI 2NTTA 3BS0A 4B9KA 4DHJD 3AAAA 4PT5A 3Q14C 5KHOA 1ZXIA 5FR3A 3UIOB 2M1MA 4FQEA 1B1ZA 1GB1A 2KFKB 1ET9A 3ZQ4A 4BZAA 1P9DU 3ABVB 2IWWA 4DWFA 5GTHO 5BYRA 3T0SA 2KMAA 2GBJA 1ZOYB 3DBRB 3WANA 3N30A 1YQ3B 4A55A 1IPGA 1MJDA 2RDBC 1JWAD 1KJTA 4RF0A 2KWVB 3Q2AC 4NNJB 2L0TA 3BRZA 2INNE 1M4VA 4MM3B 3RYTA 4ICVA 2M07A 1I42A 1IYFA 4B6WA 5AFUK 1EWCA 3RUIB 1WGDA 4W9JA 3KWLA 3V8UA 4JGHB 4IDIA 4ZHOA 4YSYB 4EUTA 4JE3B 4HWIB 4LNFA 3QJZA 2OMFA 1SE9A 1HZ5A 3U4EG 2XE2A 4MDKE 1OFFA 5D7GA 3PQUA 2GE4A 2MJDA 4XX5A 3ZRCA 3MTNB 3CSFA 3AECB 1TKEA 2E6XA 2ON8A 4LNKA 4PYZA 1FXAA 4AUQC 1QJ9A 1NVID 3SD5A 2KDFB 2R4PA 2N9XA 2RMMA 1L6VA 2ICIA 3RNAC 3DPDA 2WYQA 2LI5A 4JL9A 3Q3NC 2DX5B 3KVDD 2Y5PA 4JLCA 4K1RB 2WNMA 2HTME 3BK2A 3KQ4A 4LNNA 1YJ1A 1VRAB 4TQ0A 2C5LC 2KMMA 4NJ7A 2QIEB 1HXUA 4JQWC 2D2QA 3WCQA 3AEBB 2D5GA 2MBBB 3L4PA 4W9IA 4KX6B 5HKHA 4BBNC 4BKGA 1V9JA 1JWUD 2KOXA 4GCSA 3A0HO 4RGMA 3PF1A 4FXCA 4FJYA 3B0AA 4G76A 1WGGA 1FIQA 1ENFA 3NVZA 4RMAA 4HCPB 3VTUA 1WMHB 1B9RA 1PRNA 2LGIA 1OSMA 2TSSA 1S5LO 2CJOA 3AE9B 2LASA 5T5FA 2AEHA 2L83A 2WDTB 1FD6A 3PVLA 3Q3OC 4O3XB 1OQRA 4OHJA 1SEBD 5LXIB 4HKQA 1F52A 2XNAC 3N1ZC 2D07B 3V62A 1YQ4B 3BINA 2AWTA 2KFKA 2QHOA 4WWMA 1ISNA 3KYCD 2ZJDA 3WAPA 4IWOA 4HDOA 3RN9C 1C1YB 3DBRI 4ZHPA 1V1OA 3VAWA 3P4QB 2ZLDA 2MQJA 4II2B 4TKNA 3H6NA 2FIDA 4RGOS 4N9F4 2KQ7A 2FIFA 4FHKA 3QWZB 5LNK1 3POQA 3GE3C 5TSSA 2G45B 2N4FA 3FYXA 1P3QU 3AMZA 1BXWA 1TZOA 4NPNA 4Q2JA 2DLBA 4C7ZA 2BYEA 2NBVB 3R3MA 2R4LA 3ZNGC 2LGDA 2GRIA 2W3SA 2Z8LA 1D5ZC 3AA7B 2NBUA 5DPRA 3Q3JA 2F1TA 1R7SA 3SY9A 3DDCB 2DZKA 1TY0A 1LQBA 1RFKA 1L0XB 5AZFA 1ET6A 3AU4A 3UIPB 2DYBA 2IDYA 3VH3B 4D5UA 1YN5A 2BF8B 1UH6A 4XZ4A 4YL8A 4AP4C 1FEHA 1R4NI 2O4VA 2WHIA 4Z3TA 2IZVB 2KX3A 2QEJC 2KTFA 2V4IB 2DENB 2I1KA 2K8HA 4K3CA 3NG0A 4HROA 4DHZE 4HPLB 4FUVA 2CHWA 1UWMA 2IPKD 4OZBA 2KX0A 2O2VA 2KZ7B 4IM2A 4A90A 1FPYA 2INDC 2WXKA 3IT6B 3QC8B 4ANWA 1ZHYA 3A33B 4DDGD 1C4AA 3P4RB 2CHXA 2CHZA 3A0BO 1QOGA 1E5WA 3CWIA 4FULA 1HE8A 2MBHA 3ZLZA 3TBLD 2M0AA 4N6EB 3PREA 2HDEA 3VZTX 1SGHA 1L4DB 3QCAA 3HK0A 2C7NB 2J4UP 4YTNB 4AYEC 3EA6A 3C19A 1WI0A 3P4SB 2NVUI 4W9LA 3W1SA 1WMHA 4O4UA 1KFYB 3RZFA 4IWQA 3HUIA 1F2RI 1FRDA
chains in the Genus database with same CATH topology
3Q6BA 4K3CA 3EFCA 4N75A 3OG5A 3MC9A 2MHJA 4N74A 2VH1A 4PK1A 2V9HA 4BZAA 4QAYA 4K3BA 2VH2A 3NJTA 3MC8A 4C00A 2QCZA 4C4VB 2QDFA 2X8XX 4XGAB 4C4VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3Q6B A;  4K3C A;  3EFC A;  4N75 A;  3OG5 A;  3MC9 A;  2MHJ A;  4N74 A;  2VH1 A;  4PK1 A;  2V9H A;  4BZA A;  4QAY A;  4K3B A;  2VH2 A;  3NJT A;  3MC8 A;  4C00 A;  2QCZ A;  4C4V B;  2QDF A;  2X8X X;  4XGA B;  4C4V A; 
#chains in the Genus database with same CATH topology
 4PYU A;  3P2B A;  3DVG X;  1U4A A;  2ZW0 A;  2WXN A;  3VRB B;  4MGZ E;  3O65 B;  3EEC A;  5G3A A;  4YSZ B;  4EEW A;  5IAA C;  4ARI A;  1GPX A;  3ZJU A;  1EU4 A;  2M17 A;  1IZN B;  2WXJ A;  3R7R A;  4O1N A;  3OJ4 B;  2CR5 A;  3CF6 E;  2XG6 A;  4GCP A;  3PGR A;  4IW0 A;  1FRR A;  3SR6 A;  2G4S A;  1HTQ A;  3FIL B;  3GP7 A;  4GN1 A;  2LWP A;  1C4C A;  5AZH A;  4KRA A;  5D5D A;  2ZPN A;  2KC2 A;  1XQQ A;  3ZUN A;  8PRN A;  5HG2 A;  2LZ6 A;  3QQ8 B;  1QLB B;  4LSH A;  3JW0 X;  2POR A;  3IXS A;  3WAO A;  2LFI A;  3M63 B;  2AQ1 B;  3PSE B;  2WGS A;  2A5U A;  2FAZ A;  3PLU A;  4S0R A;  1UBI A;  5IOI A;  2WXG A;  2R61 A;  4BUM X;  2FCM A;  2Y3A A;  2MSE D;  3WAL A;  3AA7 A;  3E56 A;  4BAX A;  4ITK A;  2MP2 B;  1AYF A;  2CKH B;  4DDI D;  5AEK B;  1WF9 A;  4A3O A;  1P7E A;  2WS3 B;  3RNB C;  2LUM A;  1Q5W B;  1BT9 A;  4XC2 A;  1UD7 A;  2Z0E B;  4YSX B;  5IA7 A;  2N9P C;  4ZRQ A;  5J18 A;  1K51 A;  2RR9 A;  3AE5 B;  1HXX A;  4C56 C;  4IM0 A;  1BT0 A;  2JVC A;  3EMN X;  1FNV A;  4K81 A;  4ASW C;  1SE3 A;  1F77 A;  4KDL B;  2CS4 A;  1WX8 A;  3H1U A;  3Q8B A;  2V3S A;  4PR7 A;  3ZNI D;  1V6E A;  3E9S A;  2JF5 A;  1T0Q C;  3NHE B;  2WXI A;  2NS5 A;  2JT4 B;  4ANV A;  2IWV A;  4EZJ A;  5JHA A;  2DZM A;  1VZ7 A;  5GXG B;  3PGS A;  3RFZ B;  3PGU A;  5J2R A;  5IYU A;  3NVY A;  3WIM A;  5DCN A;  2FCS A;  5IKC M;  5D94 A;  2Z0D B;  4DXF A;  4YTM B;  2QSD A;  3MC8 A;  1OEY J;  1YJJ A;  3S2A A;  2MJ3 A;  2DZI A;  1SE2 A;  1DYQ A;  1JRP A;  4US9 A;  3R2T A;  3D32 A;  3N32 A;  3SYB A;  5HHD G;  3I9V 1;  1SBB B;  3KUZ A;  2BKF A;  5AUI A;  4AKR A;  2INC C;  3APF A;  4WIP A;  1Z5S B;  2K25 A;  4HVB A;  4JPS A;  2JY6 A;  2CU3 A;  4W9F A;  5JH5 C;  3KZI O;  1I4H A;  1IZN A;  2MW5 A;  1KM7 A;  4ZOH C;  3RUL A;  3VDZ A;  5DL5 A;  5C23 A;  3TEY A;  3QRA A;  3FIL A;  4LSI A;  4AYM C;  4OVV A;  3DHG C;  4GDK A;  5G26 A;  1EWY C;  2G1E A;  1T16 A;  3I57 A;  2MH7 A;  1WZ3 A;  1ZHT A;  4WJN A;  4HJK A;  3HM3 A;  1ZHX A;  4FZN A;  2LHD A;  3UPG A;  2WU5 B;  2ZPY A;  3H7P B;  4D65 A;  1N6Z A;  1EO6 A;  1VDV A;  3AEG B;  3PRP B;  1NDD A;  1IBX B;  2BS4 B;  1VR9 A;  4RJX A;  2VZK B;  1TS2 A;  3U7D A;  1C76 A;  1WFY A;  3QAR A;  4AS1 A;  2KC1 A;  2KWU B;  1WGY A;  2MP2 A;  3PLV A;  4PS7 A;  3VZU X;  1FCL A;  2PVO D;  1WJU A;  3ZXV A;  2N1V A;  2MCN B;  2BYV E;  1BXT A;  1I4G A;  3CIR B;  3PZ7 A;  3TZG A;  3AEA B;  5HFY A;  2FGR A;  2J53 A;  3V05 A;  1RRB A;  2RPQ A;  2VRR B;  2IO3 B;  3ETR A;  2RD0 A;  3UAQ A;  2BYT A;  4FAD A;  3P1M A;  2JWU A;  3QK0 A;  1OTR B;  2MEK A;  1DOX A;  3AXC A;  1D5X C;  3ZO5 B;  1SF0 A;  1EU3 A;  2QIL A;  2MRP A;  2DWQ A;  1R4M B;  5B66 O;  2KWD A;  3CMM B;  2RDH A;  4EZL A;  1L0V B;  2LEK A;  4OZC A;  2DAJ A;  4RM8 A;  3GZN B;  3P63 A;  3U7Z A;  1GFQ A;  1XCT L;  4KVG B;  2IYD B;  4I6P A;  4NAW B;  1E6E B;  4CTD A;  2YVC A;  1HXY D;  3MC0 B;  4GMV A;  3IFW B;  2QC8 A;  2IBI B;  1WR6 E;  4W9K A;  1D6E C;  4FT6 A;  4LNO A;  3VHT C;  1VJK A;  3BYT B;  4I6N B;  4F4B A;  4JCH A;  4EKU A;  2JYE A;  3Q8C A;  1V80 A;  4FN2 A;  4O4X A;  3T20 A;  3AU5 A;  5E6N A;  3RMK C;  3RPF C;  1N5X A;  1JQ4 A;  3U52 E;  3L54 A;  1YD8 U;  2X8X X;  5EE9 A;  1MVK A;  2GBR A;  5IP4 D;  1AAR A;  1C3T A;  4URK A;  3BRY A;  4FLH A;  1WIA A;  2G9H D;  1LO5 D;  4JWU C;  1N5W A;  4B95 A;  3L0W B;  5EE3 A;  2R4N A;  3M3J A;  2XK5 A;  2F1C X;  1ZPS A;  3H7P A;  2ONQ A;  2LXC A;  1D5M C;  2M19 A;  2NMQ A;  1E0Z A;  2MBE A;  1GB4 A;  2YEP B;  3OG5 A;  4M0W A;  3MJW A;  4MGI E;  3DBL B;  3PT2 B;  5C2T B;  1ZHZ A;  2LD9 A;  2N9L A;  4AWJ A;  3HRD D;  4H2A A;  1CQV A;  1L2N A;  4I6L B;  2KMC A;  2KJR A;  2JZZ A;  2EKE C;  5B5E O;  1WYG A;  3TCA A;  5CX3 A;  4HKZ E;  1WH3 A;  1MPF A;  2KDB A;  3MC9 A;  4JX1 C;  2L1A A;  1I4R A;  2W82 A;  1RAX A;  3NZS A;  1WJ6 A;  3U30 A;  5JHB A;  2R89 A;  2ZW1 A;  2JPH A;  1PDX A;  3BWU D;  1R4N B;  4BOZ B;  4AZL A;  4YXD B;  4KGS A;  1WXV A;  3NS1 A;  2F1V A;  4W9E A;  3R8B A;  3ENE A;  3AA1 A;  3PV1 A;  3PS6 A;  1FFV A;  4MH8 A;  1VZ6 A;  6PRN A;  2BKR B;  1TS5 A;  2WVP A;  1R4M I;  5E79 O;  3SZD A;  3R2I A;  2NPT B;  1EF1 A;  3GZN I;  2KC0 A;  3TSS A;  1Q9G A;  5C1Z A;  4TQ1 A;  4AQ7 A;  3FC4 A;  4KGR A;  2HE7 A;  2KDI A;  2JXX A;  1E8Y A;  2I2Y A;  3AB5 A;  1Y8R C;  2YPV A;  4XWW A;  1K52 A;  2PW9 A;  3O0E A;  4WWO A;  3AA6 B;  1Q0W B;  1NI2 A;  2N0S B;  2V9H A;  3EFU A;  3O13 A;  3R7Q A;  3RNC C;  3U8Z A;  1WWT A;  3AAE B;  3ZW3 A;  2JZ3 B;  2DHZ A;  3Q8F A;  3B2G A;  4WH4 A;  2LVP A;  3N3K B;  4F7Z A;  1TY2 A;  2WWZ A;  2L76 A;  2C9W B;  5JXV A;  3PZD A;  1AW7 A;  2D3B A;  4UDU C;  4C80 A;  4GGQ A;  1P1A A;  2L32 A;  3DQV A;  4XNL A;  3RBH A;  2WXP A;  3H8H A;  2I1J A;  2WJR A;  4NY0 A;  1TBE A;  1RLF A;  1RM6 C;  2J52 A;  2BTE A;  1TGZ B;  4F1S A;  1TT5 B;  1ROE A;  1ZUD 2;  4MM3 A;  2VH1 A;  1GC7 A;  1QOA A;  3Q8A A;  4IL6 O;  4M01 A;  3DHI C;  5G39 A;  3DBL I;  3KW5 B;  1PQS A;  2ODJ A;  3T9L A;  2ZVO A;  2DAF A;  1EF5 A;  7PRN A;  2QJL A;  1I4Q A;  1Y56 A;  5GMV A;  4GOC A;  2XE3 A;  1FO4 A;  1F1H A;  3LXF A;  1KTK A;  4RF1 A;  4QQ1 A;  5FVN A;  4GSW A;  1XLO A;  4BKS D;  2J0J A;  3V60 A;  3EGR A;  5D2M B;  3ZDT A;  3ZRF A;  1GAQ B;  3V6E B;  2K9X A;  1WXA A;  1V49 A;  3ALB A;  2PE9 A;  1GG3 A;  4FBJ B;  4B0E A;  1AWD A;  2BB5 A;  1C78 A;  1E7V A;  1LGR A;  4ARC A;  4J6I A;  4WUR A;  4E71 A;  4GB9 A;  1E8Z A;  2H89 B;  1T6B X;  4TUU A;  4ZRI A;  3HWB A;  3W1S C;  2GB1 A;  2K4T A;  2MX2 A;  1MG8 A;  4M00 A;  4S17 A;  2L3Z A;  1ESF A;  3AE6 B;  4GU2 A;  2VH2 A;  1J7A A;  2LRW A;  2WX1 A;  4NJ6 A;  2XE5 A;  3EC8 A;  3LYY A;  2DBY A;  1ZE3 D;  1YMH E;  2LGS A;  1WZ0 A;  2LJ5 A;  4RGT A;  5H92 C;  3ZIM A;  3HOE A;  1BUI C;  1T5X D;  3BYY B;  4C69 X;  4IC7 B;  3BVM A;  1Z2M A;  4FES A;  2KDM A;  3PHW B;  3A1Q B;  2KD0 A;  1RWS A;  2KXP B;  1T3Q A;  1J0G A;  3AA6 A;  4IOI E;  3HHM A;  1J7C A;  4DXA B;  4O3Z A;  3AAE A;  1J19 A;  4C4V B;  2J42 A;  4GLS C;  3AE7 B;  3UQB A;  2IO0 B;  2ZCC A;  2REX A;  1CJE A;  2AL3 A;  4LNI A;  2OOB B;  1UZX B;  5PRN A;  1GNU A;  4E1T A;  3Q69 A;  2K5P A;  4NJC A;  3UGB B;  3X0W A;  2ZZP B;  3W9C B;  1LXD A;  5LXH A;  4KV2 A;  2JMM A;  4PUX A;  1OGW A;  3NOB A;  3PRZ A;  1DOY A;  4KR4 A;  1NYR A;  1WGK A;  2L0F A;  3P4P B;  3TMP B;  1OPF A;  2K8B A;  3VR9 B;  2QCZ A;  5FK9 C;  2LHF A;  1TJE A;  3DVN V;  3KVF B;  2JZP A;  3AEE B;  4YT0 B;  4G0N B;  3MHS D;  2OJW A;  3AV8 A;  1AN8 A;  4P1C C;  2L05 A;  4A8X C;  1MFW A;  1L0Y B;  3PRN A;  1QOF A;  1ZGU B;  1VCB A;  3DWG C;  4USA A;  1HTO A;  5E6O A;  5LLI A;  2LMC A;  1XXG A;  2KYW A;  4MEM A;  2J4X A;  2KZR A;  2RGF A;  4RJW A;  1MHH E;  3AI5 A;  5E6J A;  1CK1 A;  1OQY A;  1KF6 B;  2J7Q B;  2WU2 B;  1L4Z B;  4NQL B;  2KKC A;  5BYQ A;  3ZKJ C;  4ZRJ A;  3WU2 O;  2R8A A;  1IP9 A;  2EMS A;  5G2N A;  2UU7 A;  1YJI A;  3TIX A;  4FJZ A;  2K0P A;  1RYJ A;  2J0K A;  1XF5 L;  4LDT B;  3V6C B;  3LJ3 A;  2BVC A;  1JML A;  3AE1 B;  1FM0 D;  2FCQ A;  3UQA A;  3AEF B;  2KLG A;  3B08 A;  4MEL A;  4WQM A;  3W2D A;  2GBN A;  2KO3 A;  4EE2 A;  3VR8 B;  2MHJ A;  4KZC A;  1QQR A;  3W5U B;  3PHX B;  3GE8 C;  1A70 A;  4BKT A;  4YWG G;  4XE0 A;  1C4P A;  1UF0 A;  2JXT A;  2OED A;  2KZ7 A;  3VQI A;  2JRH A;  3ZTD A;  2N1W A;  2Y0L A;  2VZK D;  4A6Q A;  4MSQ B;  2PKO A;  2IY1 B;  3L10 B;  1LM8 B;  4ICU A;  3K9P B;  4GXB A;  2M06 A;  2JWZ A;  2K39 A;  3BVZ A;  2L7R A;  4KSK C;  1YOV B;  1WSP A;  2D10 A;  3LDZ E;  1I7H A;  2WXO A;  3A1Q A;  3UU2 A;  1E10 A;  2KXP A;  3LK3 B;  4E1S A;  1WE7 A;  4ACF A;  1RFA A;  2PE6 B;  3POU A;  4WQO B;  2KQS A;  2BWF A;  3AE4 B;  3DVG Y;  3VE1 A;  5H8Y E;  5CHV C;  2KDY A;  2O6V B;  5CTR C;  4C4V A;  5ADX L;  2FGQ X;  2Y2X A;  2INP E;  4MGY E;  4LSE A;  4G75 A;  3RCZ A;  3SDL C;  4A20 A;  5MPO A;  3DWM A;  2PTL A;  2PIA A;  1WYW B;  2DZJ A;  1QIL A;  2PMV A;  4GIV A;  1P4T A;  4UB8 O;  3QHT A;  4L23 A;  5FR6 A;  2LJI A;  1V1P B;  4RNA A;  3TL5 A;  1XLN A;  2AYO B;  1C77 A;  2WP9 B;  2KJ6 A;  3ZVV A;  1MI0 A;  3QA8 A;  3FKY A;  4BKS A;  1YN3 A;  1SB3 C;  2JU6 X;  2LGX A;  2KDE B;  2MHL A;  3KYD D;  1YQB A;  2NBW B;  3NJT A;  2WDQ B;  3PPA A;  2MJE A;  3T3N A;  5DPW A;  3SYS A;  3ZDM C;  1WGH A;  1S3S G;  1UBQ A;  3Q6B A;  2C7M B;  3A9J B;  1YIW A;  4N75 A;  3OWE B;  2FNJ B;  5CHF A;  1ZW7 A;  1QJP A;  2AQ3 B;  2KAC A;  1TKG A;  2V4L A;  1YN4 A;  4WAF A;  3PTF C;  1MM5 A;  1WGR A;  3GS2 A;  4NZL B;  4F8C B;  4WJP A;  4BOS C;  4JFB A;  1E8W A;  1XLP A;  3C0R B;  2KVR A;  5HI1 A;  3B1L X;  2MNH A;  4RL9 A;  1UUP A;  2SAK A;  5G38 A;  2A4Z A;  1JRO A;  5EDS A;  2GI9 A;  4DHZ B;  4GCQ A;  2C60 A;  4GDL B;  1C79 A;  3VTW A;  3I3T B;  1E7U A;  4K7S A;  1THQ A;  1V8C A;  1SSN A;  2X9K A;  4HJG E;  3K19 A;  2W3R A;  2LXA A;  2FBW B;  5TIS O;  4R3D A;  4WWP A;  1JAL A;  3LK4 2;  3POR A;  1PYW D;  2L52 A;  4HEA 1;  4UB6 O;  2CU1 A;  3CST A;  4BVU C;  4XWT A;  4BFR A;  3DWO X;  2EKI A;  5D3D A;  1VZ8 A;  3PGE A;  2Z59 B;  2IGD A;  1HQR D;  3P42 A;  2WJQ A;  3APC A;  3NS8 A;  3DZM A;  2FUH B;  3W5V B;  4FSO A;  2LGY A;  3BVG A;  2HJ8 A;  4G11 A;  4HDQ A;  3AE8 B;  4DXG A;  1WR1 A;  3AA0 B;  3AM9 A;  3L13 A;  1UNS A;  4K7W A;  2KHW B;  2G3Q B;  4MT5 A;  1P0R A;  2O6V A;  1E8X A;  2D11 A;  5IN7 A;  4ZDV A;  4LJO B;  2XTQ A;  1PGX A;  2HD5 B;  4MJS B;  1TS4 A;  3M62 B;  3URY A;  2KNB A;  1FNW A;  2GLS A;  1L7Y A;  2K1F A;  1JWS D;  3A9K B;  1IGD A;  4RFB A;  4XNK A;  1SE4 A;  2V0G A;  1HXT A;  2N7D A;  1M94 A;  1FXI A;  2KVZ A;  4RLB A;  3V3X A;  2W9N A;  1KH0 A;  1XO3 A;  4EOY A;  3N1X C;  5AFU L;  1TTN A;  3SEB A;  1OEY A;  3JVZ X;  3MHZ A;  4W9G A;  3AE2 B;  4WAA A;  5E6P A;  3IAM 1;  2KFJ A;  3IT4 B;  3SHQ A;  2W81 C;  3Q3M C;  4K7U A;  1GC6 A;  4HRS A;  1WRI A;  4ANX A;  1ZDV A;  2W80 C;  1L5P A;  2WXF A;  2KN5 A;  4FHJ A;  1H4R A;  5KHQ A;  2GMI C;  3J9C A;  2WLB A;  4RH6 A;  2C7H A;  2MA9 B;  3A9J A;  2W55 A;  2GBM A;  1IBX A;  1KRH A;  2JQR B;  2IGG A;  4N58 A;  1SIJ A;  3H9D A;  1I4X A;  1WXS A;  2KN4 A;  3WI4 A;  1MG4 A;  1NEN B;  4JIO U;  3EUB 2;  2ZNV C;  1E90 A;  1V5T A;  1UGJ A;  5KAF O;  5L83 A;  3A2S X;  3TEX A;  5IO9 A;  4MGK E;  1WRD B;  1ZP0 B;  2B3A A;  3WAM A;  1FNU A;  4TSS A;  1L6U A;  3JCU O;  3TJP A;  1XLQ A;  2HJ1 A;  1V2Y A;  1D3Z A;  2KQ4 X;  4GDL A;  4O49 A;  1XCQ L;  1YNT E;  2Y0H A;  2R88 A;  2YNK A;  1OQQ A;  1G6J A;  4LSF A;  2GBK A;  4REZ A;  1PFD A;  1K8R B;  5L95 C;  5D6J B;  1J8C A;  3BZD B;  4AYD C;  3VUX A;  2QMT A;  1J7B A;  4KSL C;  2KWC A;  1Q9F A;  3N9Y C;  4E3C A;  4G3X B;  4EZK A;  3Q8E A;  4W9H A;  2LRU A;  3U2S C;  4RGN A;  1QZE A;  3JTY A;  3DVN U;  2JYT A;  4NAW A;  3AA0 A;  1FCC C;  3B2F A;  1PGA A;  3NZ3 A;  1Q1O A;  3VUY A;  2KJH B;  1X1M A;  2RSU A;  3VTV A;  1I4P A;  4P16 A;  2N2L A;  4P6V F;  1KLV A;  2BS3 B;  2O2V B;  2DYO A;  4DBG A;  2IO2 B;  2M56 B;  4DHJ B;  2FUG 1;  4MJS A;  3IVF A;  3SFD B;  3T3O A;  1UWX A;  1V81 A;  2HTH A;  3BK1 A;  1ACC A;  5DL8 A;  1EUV B;  2KT7 A;  2L00 B;  1EM7 A;  3A9K A;  4P1B C;  2ZCB A;  2GOW A;  1HEZ E;  2DNF A;  2WXH A;  2J0M A;  3UIN B;  5BYS A;  4LJP B;  1K53 A;  3VZW X;  3RT3 B;  3UF8 A;  4FRT A;  1QF6 A;  1K50 A;  5BMG A;  1H6S 1;  1YX5 B;  3AED B;  3VFK A;  3HVZ A;  1F9J A;  1FFU A;  2JQY A;  1BH3 A;  2M8S A;  2LVO A;  3MP9 A;  1N63 A;  3VUW A;  4LTU A;  3ZXR A;  4P7I A;  4RM9 A;  3OJ3 A;  3OLM D;  3EHV A;  1KOT A;  2NTS A;  1IGC A;  3NUH B;  4HK2 A;  1MHX A;  3GOE A;  3HM6 X;  5H2F O;  5DPT A;  4PS8 A;  1KLG D;  2R4O A;  2N7E A;  2NR2 A;  4FSP A;  3VE2 A;  2AX5 A;  5GV0 A;  2WX0 A;  3L16 A;  2AL6 A;  4KKJ A;  1V86 A;  4CHK A;  3BY4 B;  4HCN B;  4CYE A;  1V97 A;  1GJZ A;  3DWN A;  1PHO A;  5AUK A;  4WJQ A;  4B61 A;  4ZYS A;  3KWV A;  2UYZ B;  3SY7 A;  4HXD A;  4W9D A;  4AKM A;  5G5H A;  5BMI A;  4AJY B;  3VY8 X;  1SJE D;  4US8 A;  4RLC A;  1ZHW A;  3KUC B;  3AN1 A;  1FXT B;  2FCN A;  2BGF A;  1IUE A;  4KR8 A;  2UWQ A;  2BS2 B;  2X38 A;  2N9K A;  2KTR B;  1F2R C;  5EE2 A;  2NPT A;  3ZJV A;  2PLP A;  1DGJ A;  2JUO A;  5DL6 A;  3TUO A;  3HVD A;  4LDT D;  3APD A;  2SEB D;  4FZL A;  2V1Y A;  4M02 A;  4AYN A;  2V3P A;  1CMX B;  1MPE A;  4O3Y A;  2Y5B B;  3ECI A;  4OVZ A;  3I63 C;  1T0Y A;  2IJ0 A;  4K3B A;  2PVG C;  2H88 B;  4KKI A;  4DK5 A;  2ZFG A;  4M8M A;  2BBC A;  3RNF C;  1GFP A;  1T1L A;  2AQ2 B;  2B76 B;  2K8C A;  2OHF A;  3QX1 A;  2IO1 B;  4KGT A;  3SFE B;  2Y0K A;  3K9O B;  3ZTC A;  1WX9 A;  1GFO A;  5D3I B;  2BYF A;  1QJ8 A;  1SIF A;  2LHE A;  1NEK B;  4PJ0 O;  4NQK E;  4FRX A;  2WQY B;  4C7Y A;  2WDR B;  3G7G A;  2W54 A;  4TV3 A;  4W9C A;  1V5O A;  1E7P B;  1A5R A;  2BB6 A;  3UI3 A;  4NAM A;  3GB1 A;  4CO7 A;  5CHW A;  1GOZ A;  1P98 A;  4FMS A;  2WDV B;  3NSG A;  1T0S C;  3A4R A;  4N59 A;  1LFD A;  1HA5 A;  4LLG M;  1JWB D;  4AKR B;  3AUL A;  4B0M A;  5KAI O;  2IY0 B;  3QRC A;  1WXM A;  3SZV A;  4IG7 B;  2O6V D;  4IKG A;  3DA4 A;  3MJ5 A;  3POX A;  2RPV A;  4ANU A;  1WX7 A;  2KK8 A;  3RNG C;  2LFU A;  2PJH A;  1D4B A;  1C9F A;  4D2K A;  3AE3 B;  1I35 A;  5BO4 B;  2BWE S;  1GFM A;  4GDK B;  3EFC A;  2JSV X;  3I5J C;  3ML9 A;  2ERV A;  4OZA A;  1MM4 A;  3SU8 X;  5C3J B;  2ZEQ A;  1JW9 D;  3C8Y A;  4XDC A;  1G90 A;  3VXW A;  3JSV B;  4AOF A;  2KAJ A;  4AFK A;  3WA0 A;  3LK2 B;  1FMA D;  1Q10 A;  2EEL A;  2LVQ A;  4MSM B;  5T8I A;  1VD2 A;  4HPP A;  3HOL A;  1WM2 A;  2Q5W D;  3X23 A;  1ZKH A;  4YTP B;  1S1Q B;  3BII D;  2D3A A;  4KIK B;  2EMT A;  3HIZ A;  4JWS C;  4KDI C;  1WE6 A;  2KTR A;  1TS3 A;  3AH7 A;  1ZDX A;  3N20 C;  4AYI D;  4MH0 E;  1WM3 A;  2LUE A;  3RI7 C;  1PGB A;  1GFN A;  2X27 X;  2MBO A;  1WY8 A;  1YX6 B;  5I4D A;  4EFO A;  2BT6 A;  3VY9 X;  2K3U A;  4N74 A;  2J1N A;  2ZVN A;  2V3N A;  3ZYY X;  3T8M A;  5J17 A;  2XE1 A;  4HPM B;  4RCO A;  5BMH A;  1DOI A;  3B9J A;  2K0L A;  1WJN A;  1N62 A;  1F0Z A;  3FAH A;  3IHP C;  4L1B A;  1ORM A;  1VLB A;  1NBF C;  2PEA A;  3ONS A;  2Y7S A;  3QIJ A;  3DOW A;  5DL7 A;  3NY5 A;  1TIF A;  1WJ4 A;  4J3O D;  3IAS 1;  2M0X A;  2N7J A;  1T0R C;  1QT9 A;  4IM3 A;  5TR5 A;  3H7S A;  3ZNZ B;  4XGA B;  1QOB A;  4XDD A;  3IG3 A;  4BBN F;  3DBS A;  3NVV A;  2YEP F;  4X57 B;  3V61 A;  1QKZ A;  1TZ1 A;  3T24 A;  1XD3 B;  4U9C A;  4ZYN A;  3L08 A;  3DBH B;  2BW2 A;  1CZP A;  4XYC A;  5AZG A;  2D3C A;  4E74 A;  2WXR A;  3AAA B;  3RZW C;  3ZJT A;  2N9E B;  2L8J A;  2NCN A;  4O3W A;  5ADX K;  2XN9 C;  3N1Y C;  3PO0 A;  2D3G A;  4FA6 A;  4G50 A;  3DHH C;  3TEZ A;  4TMA B;  1PUT A;  1N60 A;  4OVU A;  1STE A;  4WJO A;  3PZ8 A;  3PQS A;  2KXJ A;  5EE0 A;  1SJH D;  1XEE A;  3QAQ A;  2KAN A;  2XK5 B;  3JSV A;  2QDF A;  1NI3 A;  2AXT O;  3NZU A;  3LK2 A;  1HZ6 A;  4M0W B;  4D64 A;  2R2Q A;  2I38 A;  3M95 A;  2K22 A;  4M8N A;  2M4N A;  3VH4 B;  3LK4 1;  4HLE A;  3DA3 A;  1XT9 B;  4GHB A;  2K6Q A;  4PS3 A;  3HW9 A;  4ZRK A;  3PRM B;  1KLU D;  1NYQ A;  4FZM A;  5EE1 A;  2MLB A;  4QAY A;  2MWS B;  1JCK B;  3W1Y A;  4FOZ A;  4ZRP A;  4DQO C;  3NRZ A;  3L17 A;  1P7F A;  4C00 A;  4KIK A;  5DPS A;  3NVW A;  4MAC A;  3WI5 A;  2MBQ A;  4LK0 M;  2OJR A;  3KLS X;  2QTK A;  1H8C A;  2N2M A;  3GP6 A;  4FJV B;  4AJW A;  1JWM D;  3A4S C;  4PK1 A;  4IWP A;  4L2Y A;  5GTI O;  2XEW A;  2XMX A;  2ZNV B;  3ZNH B;  3LK3 A;  2RDG A;  2WXL A;  3RNE C;  3AA1 B;  1BML C;  2FE8 A;  1TKY A;  4IUM B;  3ZGZ A;  1YS5 A;  2K6D B;  4GF4 A;  1E9M A;  2BQQ A;  3VVW B;  5G5G A;  3DCG A;  1TYG B;  4AUI A;  3R66 C;  2KLC A;  4WWN A;  3KH0 A;  2ACZ B;  5JZE B;  2XBB C;  4LCD E;  3TEW A;  2JRI B;  5G55 A;  5FKA C;  1GUA B;  1SXT A;  3C5O A;  2CJN A;  2Y5C A;  2JX5 A;  2IGH A;  1V1P A;  2R2O A;  2YLM A;  1JRU A;  4KZ0 A;  3OAW A;  3RD2 A;  4A9A A;  1UEL A;  2BPS A;  3LB8 C;  1ZXH A;  1UGM A;  5JDP A;  2ASQ A;  3JYU A;  3MFG A;  2WXM A;  4CQN A;  2G4D B;  1WXQ A;  2WXQ A;  3ML8 A;  2PRN A;  1E54 A;  4II3 B;  2E3T A;  3KUD B;  2DYM A;  2PPH A;  4OW0 A;  3IBE A;  4A3P A;  2XTR A;  3VRA B;  3Q3F A;  1N61 A;  3DBH I;  2NTT A;  3BS0 A;  4B9K A;  4DHJ D;  3AAA A;  4PT5 A;  3Q14 C;  5KHO A;  1ZXI A;  5FR3 A;  3UIO B;  2M1M A;  4FQE A;  1B1Z A;  1GB1 A;  2KFK B;  1ET9 A;  3ZQ4 A;  4BZA A;  1P9D U;  3ABV B;  2IWW A;  4DWF A;  5GTH O;  5BYR A;  3T0S A;  2KMA A;  2GBJ A;  1ZOY B;  3DBR B;  3WAN A;  3N30 A;  1YQ3 B;  4A55 A;  1IPG A;  1MJD A;  2RDB C;  1JWA D;  1KJT A;  4RF0 A;  2KWV B;  3Q2A C;  4NNJ B;  2L0T A;  3BRZ A;  2INN E;  1M4V A;  4MM3 B;  3RYT A;  4ICV A;  2M07 A;  1I42 A;  1IYF A;  4B6W A;  5AFU K;  1EWC A;  3RUI B;  1WGD A;  4W9J A;  3KWL A;  3V8U A;  4JGH B;  4IDI A;  4ZHO A;  4YSY B;  4EUT A;  4JE3 B;  4HWI B;  4LNF A;  3QJZ A;  2OMF A;  1SE9 A;  1HZ5 A;  3U4E G;  2XE2 A;  4MDK E;  1OFF A;  5D7G A;  3PQU A;  2GE4 A;  2MJD A;  4XX5 A;  3ZRC A;  3MTN B;  3CSF A;  3AEC B;  1TKE A;  2E6X A;  2ON8 A;  4LNK A;  4PYZ A;  1FXA A;  4AUQ C;  1QJ9 A;  1NVI D;  3SD5 A;  2KDF B;  2R4P A;  2N9X A;  2RMM A;  1L6V A;  2ICI A;  3RNA C;  3DPD A;  2WYQ A;  2LI5 A;  4JL9 A;  3Q3N C;  2DX5 B;  3KVD D;  2Y5P A;  4JLC A;  4K1R B;  2WNM A;  2HTM E;  3BK2 A;  3KQ4 A;  4LNN A;  1YJ1 A;  1VRA B;  4TQ0 A;  2C5L C;  2KMM A;  4NJ7 A;  2QIE B;  1HXU A;  4JQW C;  2D2Q A;  3WCQ A;  3AEB B;  2D5G A;  2MBB B;  3L4P A;  4W9I A;  4KX6 B;  5HKH A;  4BBN C;  4BKG A;  1V9J A;  1JWU D;  2KOX A;  4GCS A;  3A0H O;  4RGM A;  3PF1 A;  4FXC A;  4FJY A;  3B0A A;  4G76 A;  1WGG A;  1FIQ A;  1ENF A;  3NVZ A;  4RMA A;  4HCP B;  3VTU A;  1WMH B;  1B9R A;  1PRN A;  2LGI A;  1OSM A;  2TSS A;  1S5L O;  2CJO A;  3AE9 B;  2LAS A;  5T5F A;  2AEH A;  2L83 A;  2WDT B;  1FD6 A;  3PVL A;  3Q3O C;  4O3X B;  1OQR A;  4OHJ A;  1SEB D;  5LXI B;  4HKQ A;  1F52 A;  2XNA C;  3N1Z C;  2D07 B;  3V62 A;  1YQ4 B;  3BIN A;  2AWT A;  2KFK A;  2QHO A;  4WWM A;  1ISN A;  3KYC D;  2ZJD A;  3WAP A;  4IWO A;  4HDO A;  3RN9 C;  1C1Y B;  3DBR I;  4ZHP A;  1V1O A;  3VAW A;  3P4Q B;  2ZLD A;  2MQJ A;  4II2 B;  4TKN A;  3H6N A;  2FID A;  4RGO S;  4N9F 4;  2KQ7 A;  2FIF A;  4FHK A;  3QWZ B;  5LNK 1;  3POQ A;  3GE3 C;  5TSS A;  2G45 B;  2N4F A;  3FYX A;  1P3Q U;  3AMZ A;  1BXW A;  1TZO A;  4NPN A;  4Q2J A;  2DLB A;  4C7Z A;  2BYE A;  2NBV B;  3R3M A;  2R4L A;  3ZNG C;  2LGD A;  2GRI A;  2W3S A;  2Z8L A;  1D5Z C;  3AA7 B;  2NBU A;  5DPR A;  3Q3J A;  2F1T A;  1R7S A;  3SY9 A;  3DDC B;  2DZK A;  1TY0 A;  1LQB A;  1RFK A;  1L0X B;  5AZF A;  1ET6 A;  3AU4 A;  3UIP B;  2DYB A;  2IDY A;  3VH3 B;  4D5U A;  1YN5 A;  2BF8 B;  1UH6 A;  4XZ4 A;  4YL8 A;  4AP4 C;  1FEH A;  1R4N I;  2O4V A;  2WHI A;  4Z3T A;  2IZV B;  2KX3 A;  2QEJ C;  2KTF A;  2V4I B;  2DEN B;  2I1K A;  2K8H A;  4K3C A;  3NG0 A;  4HRO A;  4DHZ E;  4HPL B;  4FUV A;  2CHW A;  1UWM A;  2IPK D;  4OZB A;  2KX0 A;  2O2V A;  2KZ7 B;  4IM2 A;  4A90 A;  1FPY A;  2IND C;  2WXK A;  3IT6 B;  3QC8 B;  4ANW A;  1ZHY A;  3A33 B;  4DDG D;  1C4A A;  3P4R B;  2CHX A;  2CHZ A;  3A0B O;  1QOG A;  1E5W A;  3CWI A;  4FUL A;  1HE8 A;  2MBH A;  3ZLZ A;  3TBL D;  2M0A A;  4N6E B;  3PRE A;  2HDE A;  3VZT X;  1SGH A;  1L4D B;  3QCA A;  3HK0 A;  2C7N B;  2J4U P;  4YTN B;  4AYE C;  3EA6 A;  3C19 A;  1WI0 A;  3P4S B;  2NVU I;  4W9L A;  3W1S A;  1WMH A;  4O4U A;  1KFY B;  3RZF A;  4IWQ A;  3HUI A;  1F2R I;  1FRD A; 
#chains in the Genus database with same CATH homology
 3Q6B A;  4K3C A;  3EFC A;  4N75 A;  3OG5 A;  3MC9 A;  2MHJ A;  4N74 A;  2VH1 A;  4PK1 A;  2V9H A;  4BZA A;  4QAY A;  4K3B A;  2VH2 A;  3NJT A;  3MC8 A;  4C00 A;  2QCZ A;  4C4V B;  2QDF A;  2X8X X;  4XGA B;  4C4V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...