4C4VA

Structure of the outer membrane protein insertase bama with one potra domain.
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
462
structure length
445
Chain Sequence
FYVRKIRFEGNDTSKDAVLRREMRQMEGAWLGSDLVDQGKERLNRLGFFETVDTDTQRVPGSPDQVDVVYKVKERNTGSFNFGIGYGTESGVSFQAGVQQDNWLGTGYAVGINGTKNDYQTYAELSVTNPYFTVDGVSLGGRLFYNDFQADDADSSDYTNKSYGTDVTLGFPINEENSLRAGLGYVHNSLSNMQPQVAMWRYLYSMGEHPSTSDQDNSFKTDDFTFNYGWTYNKLDRGYFPTDGSRVNLTGKVTIPGSDNEYYKVTLDTATYVPIDDDHKWVVLGRTRWGYGDGLGGKEMPFYENFYAGGSSTVRGFQSNTIGPKAIYFPHQASAKDLCKSDDAVGGNAMAVASLEFITPTPFISDKYANSVRTSFFWDMGTVWDTNWDSSSGYPDYSDPSNIRMSAGIALQWMSPLGPLVFSYAQPFKKYDGDKAEQFQFNIGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Bama, an Essential Factor in Outer Membrane Protein Biogenesis
pubmed doi rcsb
source organism Escherichia coli
molecule tags Protein transport
molecule keywords OUTER MEMBRANE PROTEIN ASSEMBLY FACTOR BAMA
total genus 90
structure length 445
sequence length 462
ec nomenclature
pdb deposition date 2013-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01103 Bac_surface_Ag Surface antigen
A PF07244 POTRA Surface antigen variable number repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.50 Mainly Beta Beta Barrel Porin membrane protein fhac: a member of the omp85/tpsb transporter family 4c4vA02
3.10.20.310 Alpha Beta Roll Ubiquitin-like (UB roll) membrane protein fhac 4c4vA01
3EFCA 4C4VB 4K3CA 2QCZA 3MC9A 4N75A 2X8XX 4PK1A 4N74A 4K3BA 2QDFA 2VH2A 4C00A 4XGAB 2V9HA 3MC8A 3OG5A 2MHJA 2VH1A 4QAYA 3Q6BA 4BZAA 4C4VA 3NJTA
chains in the Genus database with same CATH superfamily
2QTKA 3AN1A 4MSMB 1EM7A 4AYEC 2KWVB 3K9OB 1WX8A 2CJOA 1WZ0A 3QCAA 5C2TB 2QCZA 2KXPA 1SIJA 3WA0A 3H7SA 4RCOA 2X8XX 1LQBA 3HM6X 1C4PA 1FFVA 5DPRA 1GFNA 3L17A 1TIFA 1NEKB 1QJPA 2QC8A 2IWWA 2X9KA 5D3IB 5L83A 4FZNA 4BKGA 3HM3A 2KN4A 3V6EB 2WHIA 1E9MA 3PHXB 4AYDC 2DHZA 3OWEB 4XX5A 2W3RA 1FPYA 4FJVB 3GE3C 1MM4A 1THQA 4RF1A 2INCC 4IUMB 4N59A 2DZMA 4OZAA 2N0SB 1HXYD 2X38A 4EZLA 2GLSA 4OVVA 2MH7A 4AKRA 2O6VD 2MP2A 1TS4A 3ENEA 3VR8B 3AE9B 2AL3A 4L2YA 3RI7C 2XBBC 2N2MA 1FXIA 5C23A 4XDCA 4USAA 3AE5B 2BT6A 2LHFA 4YSZB 4II2B 4F8CB 1FM0D 1YD8U 3POUA 1JALA 2MW5A 3KVDD 2EKEC 3JVZX 5AFUK 3QQ8B 1N5XA 3APCA 3UAQA 3AE4B 3Q3FA 1K8RB 3VVWB 2JWZA 4DDID 3HIZA 4KIKB 1GFPA 1QLBB 3Q8EA 1DGJA 1IGDA 2KDMA 4KSLC 4AFKA 1V80A 3UPGA 1WWTA 3Q3JA 2N7DA 1KLVA 5EE2A 2J4XA 1GFOA 4IM2A 4ZOHC 2RDGA 2ACZB 1RRBA 3AEGB 1NBFC 1FXTB 3DVNU 2D07B 2TSSA 4HLEA 3AE8B 2JSVX 2KTFA 1E54A 4PYUA 3RYTA 2ZCBA 2C9WB 4NPNA 2WXRA 2WNMA 2MBOA 4LSFA 2KD0A 2W9NA 5EDSA 4KZ0A 2JY6A 2AEHA 4LJOB 1CMXB 2JUOA 2LI5A 3CF6E 2Y0HA 2KMCA 4IG7B 4W9FA 1OEYJ 2GB1A 1Q0WB 5CHVC 2I1JA 4ANXA 1QQRA 3HWBA 2Z8LA 4LK0M 2WXFA 3NZUA 3NG0A 2KOXA 3ZGZA 4O1NA 4TQ0A 1VR9A 2L8JA 4JGHB 4F1SA 2WJRA 4W9CA 2LVQA 1MFWA 4NQKE 4OHJA 4BZAA 1BH3A 5DL5A 6PRNA 3SY7A 3TEZA 4GIVA 1FD6A 1ESFA 1ZHTA 4Q2JA 3X0WA 4RGMA 2JMMA 1MG8A 4BKTA 1WGYA 3LK41 2N9EB 2QDFA 4FXCA 1V86A 5HKHA 2IGHA 2M19A 3ZNZB 1NI3A 2Y5BB 3MC0B 1ZDVA 5EE0A 2KDYA 2L7RA 1MI0A 4LJPB 2PMVA 4BFRA 2JQRB 1WH3A 3PRNA 4AWJA 5GMVA 1N61A 5J18A 4HPMB 1C3TA 3VUYA 1N60A 4GU2A 4HK2A 5D6JB 2R4NA 3PT2B 3JYUA 2KAJA 2XTQA 1JCKB 1WJUA 4WWOA 3A9KB 4O49A 2N9XA 1SEBD 1JRUA 3VH3B 1WM2A 3J9CA 4HJGE 2CHXA 3ABVB 1HEZE 3KQ4A 5L95C 3KUCB 1I4RA 1ET9A 1OQYA 3BK2A 4D64A 2KQ4X 1C76A 3FILB 1FFUA 4PJ0O 2BKRB 3BIID 3NVZA 2V3SA 1L2NA 4EUTA 1TJEA 1EUVB 2PE6B 1H6S1 2CJNA 1V5OA 3TIXA 4KGRA 1VJKA 3QAQA 1ZGUB 5GXGB 2A5UA 1S3SG 1QJ9A 3WALA 1WZ3A 2O2VB 4E71A 4N75A 4C56C 5TSSA 3BY4B 3PRMB 4FADA 4FQEA 1TZOA 3NSGA 2NR2A 2BWFA 2K6QA 1XQQA 3VHTC 3I9V1 1YQ3B 1HXXA 5G38A 3WI4A 4KVGB 3U7DA 2G3QB 4FOZA 3H7PA 2L05A 2EMTA 3QWZB 2K5PA 4B61A 3PGEA 2LUEA 2LGSA 5HG2A 1XF5L 2OEDA 3A1QB 2JWUA 2LVOA 1YN5A 2KQSA 3RMKC 2R2QA 2KC0A 3QRCA 3AA0B 2XE5A 2BVCA 4ZDVA 2N4FA 2V4LA 4A9AA 5IN7A 2LVPA 4DK5A 1I4XA 1WGRA 2G4DB 2K22A 4OVUA 4MM3A 1NVID 2Z59B 2Z0EB 2ZVNA 3NY5A 2R2OA 2O6VB 2DENB 1TS5A 2X27X 2L32A 3DA4A 3W5UB 2KDEB 3PGUA 8PRNA 2MJDA 5KAIO 4I6LB 1WE7A 4AP4C 2KVZA 5C1ZA 4O3WA 1VZ7A 4BUMX 3AA7B 1VCBA 1D4BA 1E7PB 4ANVA 1XEEA 5LXHA 4QQ1A 2UU7A 2WJQA 1XCTL 2D3BA 3WAMA 2IO3B 3PTFC 3AEEB 1TKGA 1OEYA 2KDBA 1R7SA 4A8XC 1P0RA 5E6PA 5AZFA 2JPHA 2WXNA 3PGRA 1WRIA 3URYA 3ML8A 3ZXVA 3UF8A 1EF5A 4MM3B 4YSYB 3HRDD 5IP4D 2CU1A 4IWQA 2DYOA 4WJQA 4LSHA 1STEA 5IYUA 3UU2A 1F77A 4ICUA 5BMHA 2MQJA 1IP9A 3A9JB 5G26A 1JQ4A 4RH6A 1HTOA 3W1YA 3DWOX 4AZLA 4KX6B 1L7YA 3WU2O 1WGHA 4EOYA 1WXQA 2WU2B 4M0WA 3FILA 2Y0LA 4LCDE 1EF1A 2WXIA 4O3ZA 4EE2A 5GV0A 3U4EG 2ERVA 4TMAB 2JT4B 3KUDB 2LHEA 1G6JA 3R2TA 1FNUA 2MWSB 2LD9A 3W9CB 4TQ1A 3SU8X 2V9HA 1NDDA 1AWDA 5DPSA 4NJCA 3P2BA 1FO4A 2IGDA 1ZXIA 2N1VA 1A70A 1V6EA 2N9PC 4C4VB 2DZKA 3KW5B 2XNAC 1SSNA 3NZSA 2KWCA 1ZKHA 1ZHWA 2PRNA 2WXGA 3PRPB 4MJSA 3M62B 2H88B 3E9SA 1S1QB 2H89B 1VZ6A 2R8AA 2D11A 1ZP0B 4DQOC 3P4RB 1GUAB 3T8MA 1X1MA 3QARA 2KTRA 3LK3B 2KZ7A 2HDEA 1OFFA 2DNFA 3BYTB 2J0MA 3AA0A 3FYXA 4REZA 2FBWB 5H8YE 4A90A 3E56A 2JRHA 3VE1A 3AEAB 1WFYA 2LGIA 4FSPA 1V49A 1TBEA 2XEWA 4KV2A 1YX6B 3U2SC 2HE7A 1HXUA 5ADXK 4W9IA 3Q8FA 2O4VA 3V8UA 4RF0A 2L52A 3G7GA 3AM9A 3DPDA 4LNIA 2JXTA 1V8CA 3EC8A 5BMGA 5J17A 4N74A 1IBXA 2V1YA 3BYYB 3AEFB 2KC2A 3EHVA 2V3NA 4HROA 3T3OA 2BYFA 3BZDB 2A4ZA 2XG6A 4CTDA 2FGRA 2LZ6A 4NAMA 2JYTA 3MJ5A 2INNE 5LLIA 3AU5A 2DAJA 2G9HD 1QJ8A 3PRZA 4FSOA 4P1CC 4NJ6A 1DYQA 2B3AA 2KT7A 4HEA1 2PORA 4IW0A 4LTUA 4EZKA 2F1VA 1QZEA 1DOIA 4UB6O 1P4TA 4B0EA 2LGDA 4W9HA 3PF1A 5I4DA 2XK5B 1QILA 4G0NB 3ZJUA 1J0GA 4M02A 4EZJA 3ZXRA 4AKRB 1IUEA 2PLPA 1PHOA 3RN9C 3L16A 1VLBA 5DCNA 3OG5A 3H1UA 4FULA 3HOEA 1WI0A 1MG4A 3V61A 2R4PA 1TY2A 4G75A 2F1TA 3W1SC 1QKZA 4FBJB 5G39A 3GZNI 3KYCD 2LUMA 5J2RA 2C7NB 2XTRA 2BW2A 2V0GA 4GCPA 3LK3A 4ZRQA 4ASWC 3ZTDA 3Q69A 2O6VA 4ZRJA 2KXPB 5E79O 4CO7A 3NOBA 3P4QB 1J7AA 3BRYA 3DBSA 1L6VA 1SJED 1C78A 3GZNB 2DBYA 4AUIA 2V4IB 2LFIA 3I63C 1OSMA 4ZRIA 3ZDMC 2MA9B 5AUIA 3EECA 4KKJA 4C7ZA 4I6PA 2PKOA 3PPAA 2VRRB 3IT6B 1QOAA 2KK8A 1HTQA 3R3MA 4GCQA 1DOYA 2K0LA 5JHBA 1FNWA 1UZXB 5HI1A 3IBEA 5D2MB 4WAAA 1V9JA 5IKCM 4WQOB 2LEKA 3KH0A 1WJ4A 2I1KA 3DWNA 1UF0A 2CU3A 1ET6A 4BKSD 1V5TA 1XT9B 1ZHYA 1ROEA 5EE3A 2PVOD 4MDKE 2ZLDA 3I57A 4RGOS 1KLUD 1OQQA 3O13A 1MPFA 1GB4A 5G5GA 1VD2A 2FUG1 2N9LA 4UDUC 2QHOA 2NBUA 2BBCA 1WY8A 3Q14C 2J53A 4HVBA 4GCSA 3TSSA 2M06A 2NS5A 5JXVA 3DZMA 1T0YA 4AOFA 1C4CA 2KACA 4KGSA 1G90A 1LM8B 2FAZA 5FR6A 3JSVA 4GDLA 3WIMA 4JFBA 4YTNB 4IL6O 1K53A 2RDBC 1D3ZA 2UYZB 3PO0A 3VY8X 4HCNB 2R4OA 2J7QB 2JF5A 2KDIA 2AQ1B 5AEKB 1F1HA 3V6CB 1N6ZA 2ONQA 2DAFA 3C5OA 3DQVA 4WJNA 4LDTB 2KJHB 3K19A 3KWVA 5GTIO 2XE3A 1Y56A 3ONSA 2K8BA 2JVCA 3P63A 1RFKA 1T3QA 1ZDXA 5CTRC 1YJ1A 2J1NA 4DXFA 3VAWA 2CHZA 1WJNA 5E6OA 4FHKA 3N30A 1V1PA 4GGQA 5CHWA 1BT9A 4K81A 2FCMA 3IXSA 2GI9A 2XMXA 3I3TB 3ZO5B 2LGYA 3B0AA 4YL8A 2KHWB 1KTKA 1PGXA 2M17A 3IHPC 1RWSA 3UI3A 2E3TA 2GRIA 1FRDA 2KFKB 2KWDA 2WLBA 1QOFA 3JW0X 2JZ3B 3VQIA 3DBHI 2D2QA 4A55A 2AX5A 4MGIE 4BAXA 3M3JA 1HA5A 2KLGA 1E90A 1TS3A 2QIEB 2LJIA 5CX3A 4D5UA 2PE9A 2W80C 2BQQA 4FA6A 4LNFA 3POXA 1Q10A 3NZ3A 2AQ3B 4A3OA 5DL6A 1LGRA 2O2VA 3HHMA 4LDTD 1L4DB 1BXTA 1R4NI 4FT6A 2RDHA 5BO4B 2MLBA 3I5JC 3L54A 2GBJA 1JRPA 4M0WB 2M1MA 3Q3OC 1FEHA 3NVVA 4IWOA 3M95A 1TY0A 4EKUA 3OAWA 3DDCB 1NYQA 3DBHB 1IBXB 2MBQA 2ZJDA 1WM3A 2J0JA 4BOZB 4DDGD 1U4AA 2DZJA 4RMAA 3K9PB 2ZPNA 2VH2A 1RAXA 1XCQL 4MGZE 3PLVA 2HTME 1PRNA 2D3GA 2KNBA 1LO5D 1UWXA 3N1XC 2YEPF 4D2KA 1ENFA 1XLOA 4D65A 4E1TA 4I6NB 4EFOA 1V97A 2IZVB 2LFUA 1YNTE 1YN3A 1ZE3D 4KR8A 3AA6B 2FIFA 5IAAC 3VFKA 3X23A 1F0ZA 1JWAD 3U8ZA 2CHWA 3SEBA 3MC9A 3Q8AA 1EWCA 2NCNA 4O3YA 2FGQX 4RM9A 1Z2MA 1JWMD 5HHDG 2NMQA 5JH5C 4J6IA 2WXOA 2GMIC 3B08A 3VRBB 3MC8A 4OZCA 3DBRB 3AI5A 3ZW3A 1RLFA 4R3DA 1ISNA 3IG3A 3LB8C 2Y3AA 2FCQA 3VXWA 5BMIA 1GFMA 2K8HA 2L83A 3AB5A 3WANA 3UIOB 1YMHE 2ON8A 3R7QA 3P4SB 1OTRB 1V1PB 2YNKA 1GC6A 3A2SX 1MJDA 3AV8A 3UQAA 2JXXA 3A0HO 4AYMC 2E6XA 4RGNA 3BS0A 4B0MA 1NYRA 2WXJA 2JQYA 2WXQA 4IM0A 1YJIA 4HXDA 2EKIA 5G2NA 2BYEA 3ML9A 1R4MI 4W9JA 3TJPA 1TKEA 1N63A 3ETRA 2KLCA 3PS6A 3EUB2 2KC1A 4AKMA 3SDLC 4RNAA 2AXTO 1MVKA 2BB6A 2D10A 4QAYA 1IYFA 4HJKA 1RFAA 3RT3B 1ZW7A 3ZUNA 3N3KB 2OJWA 4K3CA 1PGBA 4GDKB 3DHHC 3GOEA 3TMPB 1QOBA 1E5WA 2KZ7B 2Y5CA 4GLSC 3PQSA 3LK42 1P98A 3N1YC 2R61A 1NENB 3IAS1 3MJWA 3NS8A 5AZGA 3SR6A 1KF6B 3VH4B 3APFA 1M4VA 2M8SA 4L23A 1SF0A 2BGFA 1F9JA 3RNAC 3RCZA 2OOBB 1UGJA 1IZNA 2N2LA 3DHIC 4ARIA 1H4RA 3CSFA 1TZ1A 2RGFA 1AARA 4DHJD 1L0VB 1P7FA 2PEAA 4WWMA 4LNNA 2OHFA 5HFYA 3NVYA 3FAHA 4JWSC 1FXAA 1WRDB 4GMVA 4OW0A 2PTLA 3AA1A 3ZRCA 1YN4A 3QIJA 3R66C 2RD0A 5DPWA 4IM3A 1HZ5A 3MFGA 2RPVA 3L08A 1KRHA 1F52A 2HD5B 2ASQA 1K50A 2XK5A 3BVGA 3PHWB 2M56B 4GOCA 2L0TA 1QT9A 3RNCC 3AAEB 2YEPB 3AE2B 2NTSA 4G3XB 3PGSA 4GF4A 3JTYA 1FCCC 4K7WA 1WGDA 5H92C 1CZPA 3A0BO 3U30A 3LXFA 3C0RB 4GSWA 3UGBB 4CHKA 3Q3NC 4KZCA 5B5EO 1F2RC 1MHXA 1PYWD 2JZZA 1CQVA 2DX5B 4JL9A 4P7IA 2WU5B 4E1SA 4G50A 2J52A 4FMSA 3P42A 4LSEA 3VZUX 2M4NA 2PW9A 3EGRA 3N1ZC 4W9LA 5AFUL 1KFYB 2OJRA 3RZWC 1I42A 5TR5A 2ZZPB 4RLCA 3VZWX 1P7EA 4XC2A 3ZKJC 3GB1A 4US8A 5E6NA 2AL6A 1F2RI 3KUZA 4CQNA 4JCHA 1N5WA 2L76A 1SIFA 4KGTA 1FNVA 2BWES 3FKYA 5D5DA 1ZXHA 1IPGA 3Q8CA 3VZTX 2EMSA 5BYRA 3ZYYX 3QA8A 3T0SA 3FC4A 4AYNA 1D5MC 4RM8A 3C19A 1SBBB 1YX5B 2YVCA 1L6UA 2Q5WD 1P3QU 2RR9A 2YLMA 4WH4A 4XNLA 4XWWA 2MJ3A 3RFZB 1AN8A 3H7PB 2KQ7A 3QC8B 2L00B 1WGKA 3POQA 2LXAA 3SD5A 1E7VA 2WDTB 4ACFA 3WI5A 4PR7A 4U9CA 4N6EB 2DWQA 5TISO 3DOWA 3BK1A 3IFWB 3QJZA 4HCPB 2ZPYA 4GHBA 5BYQA 3ZJVA 1S5LO 1ACCA 3ZNHB 3PREA 2NVUI 2QMTA 4FLHA 3HK0A 1C77A 4JPSA 4HDQA 1I4GA 2WX1A 4LSIA 3VDZA 1WX7A 4H2AA 3M63B 3BINA 4MH0E 3D32A 3PQUA 4Z3TA 4MGKE 4XWTA 3BVMA 4XE0A 1JW9D 4BKSA 2LRUA 3BVZA 1V81A 1IZNB 4B6WA 2KTRB 3NS1A 4DHZB 3T9LA 3MHZA 3CWIA 3GS2A 1EU4A 1YS5A 1KH0A 4TV3A 2WDRB 2SEBD 4E3CA 2BS3B 4S0RA 3TL5A 4XZ4A 4C80A 3TEYA 1GPXA 1J8CA 1UGMA 3BWUD 1WXSA 4PS7A 3V05A 3VUXA 3VTWA 4NZLB 1MM5A 4HDOA 4MT5A 4PS8A 1PDXA 4NQLB 4DBGA 4NJ7A 3AE6B 3TCAA 1YOVB 2K4TA 2MBBB 2WXKA 1A5RA 3JCUO 1OGWA 3DBLB 2QEJC 3RNFC 1UNSA 1UELA 3SYSA 5CHFA 2AWTA 2IGGA 2MP2B 4PS3A 3DVNV 3Q3MC 5FK9C 2PPHA 2R88A 4UB8O 1JWBD 3AA7A 1KM7A 2KXJA 4IDIA 2NBWB 2LRWA 2M0XA 2BYTA 3AA1B 3OJ4B 4O3XB 1I4QA 3SZVA 1XLNA 3AAAA 1P1AA 5H2FO 2N7EA 3N32A 2ZVOA 5D94A 4RJWA 4FHJA 3DVGY 5GTHO 2WX0A 1WR6E 3IVFA 4JIOU 1TGZB 3AE1B 1J7BA 3DWGC 3AAEA 2JX5A 3DBLI 4ICVA 3APDA 1EWYC 2GBKA 4LNOA 4TSSA 4ARCA 1V2YA 1C1YB 3VUWA 4HRSA 3KZIO 4FN2A 2C7HA 1JWSD 5C3JB 4DWFA 1HE8A 1LFDA 3DCGA 1T5XD 4WAFA 2I38A 3HVZA 1E10A 1UWMA 1J19A 2KVRA 1WXAA 3VTVA 3EA6A 4FRTA 4HWIB 5DL7A 1ZPSA 1D6EC 4KDLB 2WXHA 3RZFA 1BT0A 4JX1C 1WJ6A 1OPFA 2MCNB 3ZTCA 1WR1A 4WQMA 3ECIA 5EE1A 1JROA 1ORMA 1R4NB 4ANWA 3B9JA 2VZKD 3NJTA 4XYCA 2ODJA 3N9YC 5KHQA 1SJHD 1TTNA 2MNHA 1XLPA 2M0AA 1I35A 4FESA 4LNKA 5AUKA 1VRAB 3AEDB 1KOTA 1LXDA 1E8WA 1L4ZB 1WF9A 4ZRPA 2VZKB 3QHTA 4RFBA 4RGTA 3PZ7A 2BYVE 2KMMA 4ZHOA 1N62A 4O4XA 2J42A 5G55A 5JZEB 2ZW0A 3ALBA 4FZMA 3PZDA 3UQBA 2G45B 2KFJA 2IY0B 2BPSA 1JWUD 4C7YA 5DPTA 1WE6A 2MRPA 4A6QA 2G4SA 4MACA 3TUOA 3UINB 1GB1A 4C69X 4NY0A 2GBRA 1D5XC 1DOXA 3AMZA 3WCQA 4G76A 2L0FA 1QOGA 3IAM1 3LK2B 1D5ZC 3CSTA 4DHJB 2PJHA 1ZOYB 4B95A 2JRIB 2REXA 4KDIC 2MBEA 3L13A 2D3CA 1Q1OA 3PLUA 1WMHB 1M94A 4DXGA 4GB9A 2KZRA 2HJ1A 2NPTA 2RPQA 2JYEA 1BXWA 4URKA 3KWLA 4GDKA 2J4UP 2SAKA 1BMLC 1P9DU 3UIPB 4MGYE 1V1OA 4JWUC 3ZNGC 2MEKA 5AZHA 2G1EA 4IKGA 1ZHZA 4X57B 2LJ5A 2ZNVB 2YPVA 4DHZE 2IDYA 4W9KA 4K7SA 3V60A 3U7ZA 1YJJA 2IO0B 3W5VB 7PRNA 1E8YA 1WX9A 4WJOA 1UUPA 2DYBA 3A4SC 2PVGC 1I7HA 2FUHB 4IWPA 4HPLB 3VY9X 3AULA 2L3ZA 4IOIE 5T5FA 4C4VA 2NBVB 3A33B 2IJ0A 5KHOA 2Y5PA 4JQWC 2K0PA 4YTPB 3HVDA 3ZIMA 1CJEA 1BUIC 2BB5A 4MEMA 4P16A 4PK1A 1T0QC 4NAWA 3GP6A 1PUTA 2J0KA 2JU6X 2F1CX 3VR9B 2KN5A 2C5LC 2R4LA 2MHJA 3Q6BA 3QRAA 2DYMA 2INPE 5JDPA 2ZNVC 3ZJTA 4N9F4 3RNEC 2WGSA 2K6DB 4S17A 5LNK1 4A20A 1SXTA 1I4PA 2LHDA 1HZ6A 4J3OD 1VDVA 2MJEA 2Z0DB 1B1ZA 4BBNF 1WIAA 1ZHXA 4JLCA 1KJTA 2W55A 2WQYB 3MHSD 2JZPA 1T0RC 2VH1A 2IY1B 2FE8A 2GOWA 2IO1B 1TS2A 1TKYA 3LK2A 3HUIA 4L1BA 4WJPA 3RNGC 2FNJB 3O65B 4HKQA 1PGAA 4IC7B 4BVUC 3PZ8A 4TUUA 2IYDB 3PSEB 1L0YB 4B9KA 1MPEA 1L0XB 2IO2B 2KYWA 2WXMA 3PVLA 2PIAA 3U52E 1SE2A 4GXBA 1GNUA 4OVZA 1SGHA 3LJ3A 3A9JA 3MP9A 3DWMA 1UBIA 1PQSA 4GDLB 1GOZA 2Y2XA 2FIDA 4XNKA 2KJ6A 3DHGC 2ZEQA 4YXDB 3IT4B 3EMNX 2LXCA 2WXPA 4PT5A 3RPFC 3TEXA 5KAFO 4KRAA 2FCSA 4M01A 1HXTA 2BS4B 2KO3A 4W9GA 4LLGM 2NPTB 4AUQC 2LMCA 4AJYB 5FR3A 1WSPA 4KKIA 5MPOA 4RL9A 2K9XA 2RMMA 2MSED 3QX1A 4W9DA 2Y7SA 3TBLD 5BYSA 3O0EA 3H8HA 1EO6A 5FVNA 5E6JA 5JHAA 3R8BA 3EFUA 3B1LX 3DA3A 2W3SA 1UH6A 2KFKA 1C4AA 1WYGA 1E6EB 2K39A 1GG3A 1T1LA 4K1RB 3OJ3A 2XE1A 3HOLA 2KX3A 2GBNA 1VZ8A 3RNBC 3B2GA 2KKCA 3A4RA 3JSVB 2CR5A 4EEWA 4M8MA 4HKZE 4RLBA 1GC7A 2D5GA 2K25A 2WS3B 4DXAB 3R7RA 1GJZA 2LGXA 3W2DA 2MBHA 5T8IA 3VTUA 2INDC 2ZFGA 3ZNID 4TKNA 4A3PA 3P1MA 2EELA 2KANA 3ZLZA 2C60A 3OLMD 2B76B 4WWNA 5IOIA 5G3AA 3V62A 4NNJB 1WMHA 3H6NA 3SHQA 1WGGA 4O4UA 4YT0B 4FUVA 2BS2B 3SFDB 3T3NA 1YIWA 1K51A 3C8YA 4US9A 2FCNA 3AH7A 3L4PA 4BOSC 2KX0A 1YQ4B 1EU3A 1XD3B 3CMMB 1UD7A 2GBMA 4ITKA 3DBRI 1ZUD2 2N7JA 4CYEA 4II3B 3WAPA 1JMLA 3HW9A 5D3DA 3SYBA 1GAQB 4ZRKA 3TZGA 1OQRA 1Z5SB 3LDZE 1WYWB 3WAOA 1MHHE 1Y8RC 3AE3B 3QK0A 5DL8A 4FRXA 5ADXL 4BBNC 1K52A 1WXVA 5IO9A 3N20C 1J7CA 4W9EA 2ICIA 4RJXA 3PV1A 1XXGA 1FCLA 2M07A 4FJYA 4MSQB 3NVWA 3KLSX 2CS4A 3AE7B 1RYJA 2IWVA 1Q5WB 3Q2AC 2K3UA 3AXCA 1B9RA 3T20A 1XO3A 2BKFA 2XE2A 1GFQA 1HQRD 3AU4A 1Q9GA 2QILA 2ZW1A 2N9KA 3A9KA 2MHLA 4AS1A 2WYQA 1C9FA 4GN1A 4M00A 4FZLA 2RSUA 3A1QA 4MJSB 2BF8B 2WDQB 2Y0KA 2XN9C 4FJZA 2HTHA 5G5HA 3NUHB 2GE4A 4F7ZA 3VE2A 4HPPA 5LXIB 4MH8A 1KLGD 1SB3C 4YTMB 2K1FA 4JE3B 3AA6A 1SE4A 4WURA 3KYDD 1T0SC 2IBIB 2QSDA 1FMAD 4KSKC 2LWPA 4WWPA 1YQBA 3L0WB 3LYYA 1IGCA 2AYOB 4E74A 2NTTA 2V3PA 2K8CA 4ZYNA 3RUIB 2LASA 5EE9A 2DLBA 4WIPA 4KR4A 2KDFB 3SFEB 1L5PA 4PUXA 2KWUB 2KJRA 3TEWA 1E7UA 5IA7A 2BTEA 4P6VF 3PORA 5PRNA 1FRRA 3NHEB 1T6BX 2CKHB 1E0ZA 2D3AA 2W81C 2AQ2B 4G11A 3GE8C 2IPKD 2C7MB 3CIRB 1AYFA 1RM6C 3ZRFA 4ANUA 4AJWA 4XGAB 1E8XA 3SY9A 3H9DA 4YSXB 3VRAB 5FKAC 4M8NA 4NAWB 3R2IA 4XDDA 2UWQA 5D7GA 2W54A 2WP9B 4AQ7A 2N1WA 4ZYSA 3L10B 3T24A 3V3XA 1FIQA 3S2AA 1CK1A 2W82A 3ZVVA 1TT5B 4C00A 4MELA 3MTNB 4K7UA 3B2FA 3BRZA 1T16A 2KMAA 3EFCA 3KVFB 4OZBA 3SZDA 1TYGB 1NI2A 1PFDA 3W1SA 1XLQA 1SE9A 5B66O 2L1AA 2DZIA 4YWGG 2HJ8A 1C79A 2WDVB 3AECB 4K3BA 3RBHA 4KIKA 3DVGX 1WXMA 2MX2A 1I4HA 2QJLA 4AYID 3P4PB 4ZHPA 4F4BA 2I2YA 3AAAB 2WWZA 1R4MB 4N58A 3RULA 3AEBB 3NRZA 2WXLA 3GP7A 1AW7A 1UBQA 4PYZA 1SE3A 1Q9FA 2OMFA 3Q8BA 3ZDTA 1H8CA 2ZCCA 3ZQ4A 1E8ZA 2WVPA 1QF6A 4P1BC 3RD2A 2R89A
chains in the Genus database with same CATH topology
3EFCA 4C4VB 4K3CA 2QCZA 3MC9A 4N75A 2X8XX 4PK1A 4N74A 4K3BA 2QDFA 2VH2A 4C00A 4XGAB 2V9HA 3MC8A 3OG5A 2MHJA 2VH1A 4QAYA 3Q6BA 4BZAA 4C4VA 3NJTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EFC A;  4C4V B;  4K3C A;  2QCZ A;  3MC9 A;  4N75 A;  2X8X X;  4PK1 A;  4N74 A;  4K3B A;  2QDF A;  2VH2 A;  4C00 A;  4XGA B;  2V9H A;  3MC8 A;  3OG5 A;  2MHJ A;  2VH1 A;  4QAY A;  3Q6B A;  4BZA A;  4C4V A;  3NJT A; 
#chains in the Genus database with same CATH topology
 2QTK A;  3AN1 A;  4MSM B;  1EM7 A;  4AYE C;  2KWV B;  3K9O B;  1WX8 A;  2CJO A;  1WZ0 A;  3QCA A;  5C2T B;  2QCZ A;  2KXP A;  1SIJ A;  3WA0 A;  3H7S A;  4RCO A;  2X8X X;  1LQB A;  3HM6 X;  1C4P A;  1FFV A;  5DPR A;  1GFN A;  3L17 A;  1TIF A;  1NEK B;  1QJP A;  2QC8 A;  2IWW A;  2X9K A;  5D3I B;  5L83 A;  4FZN A;  4BKG A;  3HM3 A;  2KN4 A;  3V6E B;  2WHI A;  1E9M A;  3PHX B;  4AYD C;  2DHZ A;  3OWE B;  4XX5 A;  2W3R A;  1FPY A;  4FJV B;  3GE3 C;  1MM4 A;  1THQ A;  4RF1 A;  2INC C;  4IUM B;  4N59 A;  2DZM A;  4OZA A;  2N0S B;  1HXY D;  2X38 A;  4EZL A;  2GLS A;  4OVV A;  2MH7 A;  4AKR A;  2O6V D;  2MP2 A;  1TS4 A;  3ENE A;  3VR8 B;  3AE9 B;  2AL3 A;  4L2Y A;  3RI7 C;  2XBB C;  2N2M A;  1FXI A;  5C23 A;  4XDC A;  4USA A;  3AE5 B;  2BT6 A;  2LHF A;  4YSZ B;  4II2 B;  4F8C B;  1FM0 D;  1YD8 U;  3POU A;  1JAL A;  2MW5 A;  3KVD D;  2EKE C;  3JVZ X;  5AFU K;  3QQ8 B;  1N5X A;  3APC A;  3UAQ A;  3AE4 B;  3Q3F A;  1K8R B;  3VVW B;  2JWZ A;  4DDI D;  3HIZ A;  4KIK B;  1GFP A;  1QLB B;  3Q8E A;  1DGJ A;  1IGD A;  2KDM A;  4KSL C;  4AFK A;  1V80 A;  3UPG A;  1WWT A;  3Q3J A;  2N7D A;  1KLV A;  5EE2 A;  2J4X A;  1GFO A;  4IM2 A;  4ZOH C;  2RDG A;  2ACZ B;  1RRB A;  3AEG B;  1NBF C;  1FXT B;  3DVN U;  2D07 B;  2TSS A;  4HLE A;  3AE8 B;  2JSV X;  2KTF A;  1E54 A;  4PYU A;  3RYT A;  2ZCB A;  2C9W B;  4NPN A;  2WXR A;  2WNM A;  2MBO A;  4LSF A;  2KD0 A;  2W9N A;  5EDS A;  4KZ0 A;  2JY6 A;  2AEH A;  4LJO B;  1CMX B;  2JUO A;  2LI5 A;  3CF6 E;  2Y0H A;  2KMC A;  4IG7 B;  4W9F A;  1OEY J;  2GB1 A;  1Q0W B;  5CHV C;  2I1J A;  4ANX A;  1QQR A;  3HWB A;  2Z8L A;  4LK0 M;  2WXF A;  3NZU A;  3NG0 A;  2KOX A;  3ZGZ A;  4O1N A;  4TQ0 A;  1VR9 A;  2L8J A;  4JGH B;  4F1S A;  2WJR A;  4W9C A;  2LVQ A;  1MFW A;  4NQK E;  4OHJ A;  4BZA A;  1BH3 A;  5DL5 A;  6PRN A;  3SY7 A;  3TEZ A;  4GIV A;  1FD6 A;  1ESF A;  1ZHT A;  4Q2J A;  3X0W A;  4RGM A;  2JMM A;  1MG8 A;  4BKT A;  1WGY A;  3LK4 1;  2N9E B;  2QDF A;  4FXC A;  1V86 A;  5HKH A;  2IGH A;  2M19 A;  3ZNZ B;  1NI3 A;  2Y5B B;  3MC0 B;  1ZDV A;  5EE0 A;  2KDY A;  2L7R A;  1MI0 A;  4LJP B;  2PMV A;  4BFR A;  2JQR B;  1WH3 A;  3PRN A;  4AWJ A;  5GMV A;  1N61 A;  5J18 A;  4HPM B;  1C3T A;  3VUY A;  1N60 A;  4GU2 A;  4HK2 A;  5D6J B;  2R4N A;  3PT2 B;  3JYU A;  2KAJ A;  2XTQ A;  1JCK B;  1WJU A;  4WWO A;  3A9K B;  4O49 A;  2N9X A;  1SEB D;  1JRU A;  3VH3 B;  1WM2 A;  3J9C A;  4HJG E;  2CHX A;  3ABV B;  1HEZ E;  3KQ4 A;  5L95 C;  3KUC B;  1I4R A;  1ET9 A;  1OQY A;  3BK2 A;  4D64 A;  2KQ4 X;  1C76 A;  3FIL B;  1FFU A;  4PJ0 O;  2BKR B;  3BII D;  3NVZ A;  2V3S A;  1L2N A;  4EUT A;  1TJE A;  1EUV B;  2PE6 B;  1H6S 1;  2CJN A;  1V5O A;  3TIX A;  4KGR A;  1VJK A;  3QAQ A;  1ZGU B;  5GXG B;  2A5U A;  1S3S G;  1QJ9 A;  3WAL A;  1WZ3 A;  2O2V B;  4E71 A;  4N75 A;  4C56 C;  5TSS A;  3BY4 B;  3PRM B;  4FAD A;  4FQE A;  1TZO A;  3NSG A;  2NR2 A;  2BWF A;  2K6Q A;  1XQQ A;  3VHT C;  3I9V 1;  1YQ3 B;  1HXX A;  5G38 A;  3WI4 A;  4KVG B;  3U7D A;  2G3Q B;  4FOZ A;  3H7P A;  2L05 A;  2EMT A;  3QWZ B;  2K5P A;  4B61 A;  3PGE A;  2LUE A;  2LGS A;  5HG2 A;  1XF5 L;  2OED A;  3A1Q B;  2JWU A;  2LVO A;  1YN5 A;  2KQS A;  3RMK C;  2R2Q A;  2KC0 A;  3QRC A;  3AA0 B;  2XE5 A;  2BVC A;  4ZDV A;  2N4F A;  2V4L A;  4A9A A;  5IN7 A;  2LVP A;  4DK5 A;  1I4X A;  1WGR A;  2G4D B;  2K22 A;  4OVU A;  4MM3 A;  1NVI D;  2Z59 B;  2Z0E B;  2ZVN A;  3NY5 A;  2R2O A;  2O6V B;  2DEN B;  1TS5 A;  2X27 X;  2L32 A;  3DA4 A;  3W5U B;  2KDE B;  3PGU A;  8PRN A;  2MJD A;  5KAI O;  4I6L B;  1WE7 A;  4AP4 C;  2KVZ A;  5C1Z A;  4O3W A;  1VZ7 A;  4BUM X;  3AA7 B;  1VCB A;  1D4B A;  1E7P B;  4ANV A;  1XEE A;  5LXH A;  4QQ1 A;  2UU7 A;  2WJQ A;  1XCT L;  2D3B A;  3WAM A;  2IO3 B;  3PTF C;  3AEE B;  1TKG A;  1OEY A;  2KDB A;  1R7S A;  4A8X C;  1P0R A;  5E6P A;  5AZF A;  2JPH A;  2WXN A;  3PGR A;  1WRI A;  3URY A;  3ML8 A;  3ZXV A;  3UF8 A;  1EF5 A;  4MM3 B;  4YSY B;  3HRD D;  5IP4 D;  2CU1 A;  4IWQ A;  2DYO A;  4WJQ A;  4LSH A;  1STE A;  5IYU A;  3UU2 A;  1F77 A;  4ICU A;  5BMH A;  2MQJ A;  1IP9 A;  3A9J B;  5G26 A;  1JQ4 A;  4RH6 A;  1HTO A;  3W1Y A;  3DWO X;  4AZL A;  4KX6 B;  1L7Y A;  3WU2 O;  1WGH A;  4EOY A;  1WXQ A;  2WU2 B;  4M0W A;  3FIL A;  2Y0L A;  4LCD E;  1EF1 A;  2WXI A;  4O3Z A;  4EE2 A;  5GV0 A;  3U4E G;  2ERV A;  4TMA B;  2JT4 B;  3KUD B;  2LHE A;  1G6J A;  3R2T A;  1FNU A;  2MWS B;  2LD9 A;  3W9C B;  4TQ1 A;  3SU8 X;  2V9H A;  1NDD A;  1AWD A;  5DPS A;  4NJC A;  3P2B A;  1FO4 A;  2IGD A;  1ZXI A;  2N1V A;  1A70 A;  1V6E A;  2N9P C;  4C4V B;  2DZK A;  3KW5 B;  2XNA C;  1SSN A;  3NZS A;  2KWC A;  1ZKH A;  1ZHW A;  2PRN A;  2WXG A;  3PRP B;  4MJS A;  3M62 B;  2H88 B;  3E9S A;  1S1Q B;  2H89 B;  1VZ6 A;  2R8A A;  2D11 A;  1ZP0 B;  4DQO C;  3P4R B;  1GUA B;  3T8M A;  1X1M A;  3QAR A;  2KTR A;  3LK3 B;  2KZ7 A;  2HDE A;  1OFF A;  2DNF A;  3BYT B;  2J0M A;  3AA0 A;  3FYX A;  4REZ A;  2FBW B;  5H8Y E;  4A90 A;  3E56 A;  2JRH A;  3VE1 A;  3AEA B;  1WFY A;  2LGI A;  4FSP A;  1V49 A;  1TBE A;  2XEW A;  4KV2 A;  1YX6 B;  3U2S C;  2HE7 A;  1HXU A;  5ADX K;  4W9I A;  3Q8F A;  2O4V A;  3V8U A;  4RF0 A;  2L52 A;  3G7G A;  3AM9 A;  3DPD A;  4LNI A;  2JXT A;  1V8C A;  3EC8 A;  5BMG A;  5J17 A;  4N74 A;  1IBX A;  2V1Y A;  3BYY B;  3AEF B;  2KC2 A;  3EHV A;  2V3N A;  4HRO A;  3T3O A;  2BYF A;  3BZD B;  2A4Z A;  2XG6 A;  4CTD A;  2FGR A;  2LZ6 A;  4NAM A;  2JYT A;  3MJ5 A;  2INN E;  5LLI A;  3AU5 A;  2DAJ A;  2G9H D;  1QJ8 A;  3PRZ A;  4FSO A;  4P1C C;  4NJ6 A;  1DYQ A;  2B3A A;  2KT7 A;  4HEA 1;  2POR A;  4IW0 A;  4LTU A;  4EZK A;  2F1V A;  1QZE A;  1DOI A;  4UB6 O;  1P4T A;  4B0E A;  2LGD A;  4W9H A;  3PF1 A;  5I4D A;  2XK5 B;  1QIL A;  4G0N B;  3ZJU A;  1J0G A;  4M02 A;  4EZJ A;  3ZXR A;  4AKR B;  1IUE A;  2PLP A;  1PHO A;  3RN9 C;  3L16 A;  1VLB A;  5DCN A;  3OG5 A;  3H1U A;  4FUL A;  3HOE A;  1WI0 A;  1MG4 A;  3V61 A;  2R4P A;  1TY2 A;  4G75 A;  2F1T A;  3W1S C;  1QKZ A;  4FBJ B;  5G39 A;  3GZN I;  3KYC D;  2LUM A;  5J2R A;  2C7N B;  2XTR A;  2BW2 A;  2V0G A;  4GCP A;  3LK3 A;  4ZRQ A;  4ASW C;  3ZTD A;  3Q69 A;  2O6V A;  4ZRJ A;  2KXP B;  5E79 O;  4CO7 A;  3NOB A;  3P4Q B;  1J7A A;  3BRY A;  3DBS A;  1L6V A;  1SJE D;  1C78 A;  3GZN B;  2DBY A;  4AUI A;  2V4I B;  2LFI A;  3I63 C;  1OSM A;  4ZRI A;  3ZDM C;  2MA9 B;  5AUI A;  3EEC A;  4KKJ A;  4C7Z A;  4I6P A;  2PKO A;  3PPA A;  2VRR B;  3IT6 B;  1QOA A;  2KK8 A;  1HTQ A;  3R3M A;  4GCQ A;  1DOY A;  2K0L A;  5JHB A;  1FNW A;  1UZX B;  5HI1 A;  3IBE A;  5D2M B;  4WAA A;  1V9J A;  5IKC M;  4WQO B;  2LEK A;  3KH0 A;  1WJ4 A;  2I1K A;  3DWN A;  1UF0 A;  2CU3 A;  1ET6 A;  4BKS D;  1V5T A;  1XT9 B;  1ZHY A;  1ROE A;  5EE3 A;  2PVO D;  4MDK E;  2ZLD A;  3I57 A;  4RGO S;  1KLU D;  1OQQ A;  3O13 A;  1MPF A;  1GB4 A;  5G5G A;  1VD2 A;  2FUG 1;  2N9L A;  4UDU C;  2QHO A;  2NBU A;  2BBC A;  1WY8 A;  3Q14 C;  2J53 A;  4HVB A;  4GCS A;  3TSS A;  2M06 A;  2NS5 A;  5JXV A;  3DZM A;  1T0Y A;  4AOF A;  1C4C A;  2KAC A;  4KGS A;  1G90 A;  1LM8 B;  2FAZ A;  5FR6 A;  3JSV A;  4GDL A;  3WIM A;  4JFB A;  4YTN B;  4IL6 O;  1K53 A;  2RDB C;  1D3Z A;  2UYZ B;  3PO0 A;  3VY8 X;  4HCN B;  2R4O A;  2J7Q B;  2JF5 A;  2KDI A;  2AQ1 B;  5AEK B;  1F1H A;  3V6C B;  1N6Z A;  2ONQ A;  2DAF A;  3C5O A;  3DQV A;  4WJN A;  4LDT B;  2KJH B;  3K19 A;  3KWV A;  5GTI O;  2XE3 A;  1Y56 A;  3ONS A;  2K8B A;  2JVC A;  3P63 A;  1RFK A;  1T3Q A;  1ZDX A;  5CTR C;  1YJ1 A;  2J1N A;  4DXF A;  3VAW A;  2CHZ A;  1WJN A;  5E6O A;  4FHK A;  3N30 A;  1V1P A;  4GGQ A;  5CHW A;  1BT9 A;  4K81 A;  2FCM A;  3IXS A;  2GI9 A;  2XMX A;  3I3T B;  3ZO5 B;  2LGY A;  3B0A A;  4YL8 A;  2KHW B;  1KTK A;  1PGX A;  2M17 A;  3IHP C;  1RWS A;  3UI3 A;  2E3T A;  2GRI A;  1FRD A;  2KFK B;  2KWD A;  2WLB A;  1QOF A;  3JW0 X;  2JZ3 B;  3VQI A;  3DBH I;  2D2Q A;  4A55 A;  2AX5 A;  4MGI E;  4BAX A;  3M3J A;  1HA5 A;  2KLG A;  1E90 A;  1TS3 A;  2QIE B;  2LJI A;  5CX3 A;  4D5U A;  2PE9 A;  2W80 C;  2BQQ A;  4FA6 A;  4LNF A;  3POX A;  1Q10 A;  3NZ3 A;  2AQ3 B;  4A3O A;  5DL6 A;  1LGR A;  2O2V A;  3HHM A;  4LDT D;  1L4D B;  1BXT A;  1R4N I;  4FT6 A;  2RDH A;  5BO4 B;  2MLB A;  3I5J C;  3L54 A;  2GBJ A;  1JRP A;  4M0W B;  2M1M A;  3Q3O C;  1FEH A;  3NVV A;  4IWO A;  3M95 A;  1TY0 A;  4EKU A;  3OAW A;  3DDC B;  1NYQ A;  3DBH B;  1IBX B;  2MBQ A;  2ZJD A;  1WM3 A;  2J0J A;  4BOZ B;  4DDG D;  1U4A A;  2DZJ A;  4RMA A;  3K9P B;  2ZPN A;  2VH2 A;  1RAX A;  1XCQ L;  4MGZ E;  3PLV A;  2HTM E;  1PRN A;  2D3G A;  2KNB A;  1LO5 D;  1UWX A;  3N1X C;  2YEP F;  4D2K A;  1ENF A;  1XLO A;  4D65 A;  4E1T A;  4I6N B;  4EFO A;  1V97 A;  2IZV B;  2LFU A;  1YNT E;  1YN3 A;  1ZE3 D;  4KR8 A;  3AA6 B;  2FIF A;  5IAA C;  3VFK A;  3X23 A;  1F0Z A;  1JWA D;  3U8Z A;  2CHW A;  3SEB A;  3MC9 A;  3Q8A A;  1EWC A;  2NCN A;  4O3Y A;  2FGQ X;  4RM9 A;  1Z2M A;  1JWM D;  5HHD G;  2NMQ A;  5JH5 C;  4J6I A;  2WXO A;  2GMI C;  3B08 A;  3VRB B;  3MC8 A;  4OZC A;  3DBR B;  3AI5 A;  3ZW3 A;  1RLF A;  4R3D A;  1ISN A;  3IG3 A;  3LB8 C;  2Y3A A;  2FCQ A;  3VXW A;  5BMI A;  1GFM A;  2K8H A;  2L83 A;  3AB5 A;  3WAN A;  3UIO B;  1YMH E;  2ON8 A;  3R7Q A;  3P4S B;  1OTR B;  1V1P B;  2YNK A;  1GC6 A;  3A2S X;  1MJD A;  3AV8 A;  3UQA A;  2JXX A;  3A0H O;  4AYM C;  2E6X A;  4RGN A;  3BS0 A;  4B0M A;  1NYR A;  2WXJ A;  2JQY A;  2WXQ A;  4IM0 A;  1YJI A;  4HXD A;  2EKI A;  5G2N A;  2BYE A;  3ML9 A;  1R4M I;  4W9J A;  3TJP A;  1TKE A;  1N63 A;  3ETR A;  2KLC A;  3PS6 A;  3EUB 2;  2KC1 A;  4AKM A;  3SDL C;  4RNA A;  2AXT O;  1MVK A;  2BB6 A;  2D10 A;  4QAY A;  1IYF A;  4HJK A;  1RFA A;  3RT3 B;  1ZW7 A;  3ZUN A;  3N3K B;  2OJW A;  4K3C A;  1PGB A;  4GDK B;  3DHH C;  3GOE A;  3TMP B;  1QOB A;  1E5W A;  2KZ7 B;  2Y5C A;  4GLS C;  3PQS A;  3LK4 2;  1P98 A;  3N1Y C;  2R61 A;  1NEN B;  3IAS 1;  3MJW A;  3NS8 A;  5AZG A;  3SR6 A;  1KF6 B;  3VH4 B;  3APF A;  1M4V A;  2M8S A;  4L23 A;  1SF0 A;  2BGF A;  1F9J A;  3RNA C;  3RCZ A;  2OOB B;  1UGJ A;  1IZN A;  2N2L A;  3DHI C;  4ARI A;  1H4R A;  3CSF A;  1TZ1 A;  2RGF A;  1AAR A;  4DHJ D;  1L0V B;  1P7F A;  2PEA A;  4WWM A;  4LNN A;  2OHF A;  5HFY A;  3NVY A;  3FAH A;  4JWS C;  1FXA A;  1WRD B;  4GMV A;  4OW0 A;  2PTL A;  3AA1 A;  3ZRC A;  1YN4 A;  3QIJ A;  3R66 C;  2RD0 A;  5DPW A;  4IM3 A;  1HZ5 A;  3MFG A;  2RPV A;  3L08 A;  1KRH A;  1F52 A;  2HD5 B;  2ASQ A;  1K50 A;  2XK5 A;  3BVG A;  3PHW B;  2M56 B;  4GOC A;  2L0T A;  1QT9 A;  3RNC C;  3AAE B;  2YEP B;  3AE2 B;  2NTS A;  4G3X B;  3PGS A;  4GF4 A;  3JTY A;  1FCC C;  4K7W A;  1WGD A;  5H92 C;  1CZP A;  3A0B O;  3U30 A;  3LXF A;  3C0R B;  4GSW A;  3UGB B;  4CHK A;  3Q3N C;  4KZC A;  5B5E O;  1F2R C;  1MHX A;  1PYW D;  2JZZ A;  1CQV A;  2DX5 B;  4JL9 A;  4P7I A;  2WU5 B;  4E1S A;  4G50 A;  2J52 A;  4FMS A;  3P42 A;  4LSE A;  3VZU X;  2M4N A;  2PW9 A;  3EGR A;  3N1Z C;  4W9L A;  5AFU L;  1KFY B;  2OJR A;  3RZW C;  1I42 A;  5TR5 A;  2ZZP B;  4RLC A;  3VZW X;  1P7E A;  4XC2 A;  3ZKJ C;  3GB1 A;  4US8 A;  5E6N A;  2AL6 A;  1F2R I;  3KUZ A;  4CQN A;  4JCH A;  1N5W A;  2L76 A;  1SIF A;  4KGT A;  1FNV A;  2BWE S;  3FKY A;  5D5D A;  1ZXH A;  1IPG A;  3Q8C A;  3VZT X;  2EMS A;  5BYR A;  3ZYY X;  3QA8 A;  3T0S A;  3FC4 A;  4AYN A;  1D5M C;  4RM8 A;  3C19 A;  1SBB B;  1YX5 B;  2YVC A;  1L6U A;  2Q5W D;  1P3Q U;  2RR9 A;  2YLM A;  4WH4 A;  4XNL A;  4XWW A;  2MJ3 A;  3RFZ B;  1AN8 A;  3H7P B;  2KQ7 A;  3QC8 B;  2L00 B;  1WGK A;  3POQ A;  2LXA A;  3SD5 A;  1E7V A;  2WDT B;  4ACF A;  3WI5 A;  4PR7 A;  4U9C A;  4N6E B;  2DWQ A;  5TIS O;  3DOW A;  3BK1 A;  3IFW B;  3QJZ A;  4HCP B;  2ZPY A;  4GHB A;  5BYQ A;  3ZJV A;  1S5L O;  1ACC A;  3ZNH B;  3PRE A;  2NVU I;  2QMT A;  4FLH A;  3HK0 A;  1C77 A;  4JPS A;  4HDQ A;  1I4G A;  2WX1 A;  4LSI A;  3VDZ A;  1WX7 A;  4H2A A;  3M63 B;  3BIN A;  4MH0 E;  3D32 A;  3PQU A;  4Z3T A;  4MGK E;  4XWT A;  3BVM A;  4XE0 A;  1JW9 D;  4BKS A;  2LRU A;  3BVZ A;  1V81 A;  1IZN B;  4B6W A;  2KTR B;  3NS1 A;  4DHZ B;  3T9L A;  3MHZ A;  3CWI A;  3GS2 A;  1EU4 A;  1YS5 A;  1KH0 A;  4TV3 A;  2WDR B;  2SEB D;  4E3C A;  2BS3 B;  4S0R A;  3TL5 A;  4XZ4 A;  4C80 A;  3TEY A;  1GPX A;  1J8C A;  1UGM A;  3BWU D;  1WXS A;  4PS7 A;  3V05 A;  3VUX A;  3VTW A;  4NZL B;  1MM5 A;  4HDO A;  4MT5 A;  4PS8 A;  1PDX A;  4NQL B;  4DBG A;  4NJ7 A;  3AE6 B;  3TCA A;  1YOV B;  2K4T A;  2MBB B;  2WXK A;  1A5R A;  3JCU O;  1OGW A;  3DBL B;  2QEJ C;  3RNF C;  1UNS A;  1UEL A;  3SYS A;  5CHF A;  2AWT A;  2IGG A;  2MP2 B;  4PS3 A;  3DVN V;  3Q3M C;  5FK9 C;  2PPH A;  2R88 A;  4UB8 O;  1JWB D;  3AA7 A;  1KM7 A;  2KXJ A;  4IDI A;  2NBW B;  2LRW A;  2M0X A;  2BYT A;  3AA1 B;  3OJ4 B;  4O3X B;  1I4Q A;  3SZV A;  1XLN A;  3AAA A;  1P1A A;  5H2F O;  2N7E A;  3N32 A;  2ZVO A;  5D94 A;  4RJW A;  4FHJ A;  3DVG Y;  5GTH O;  2WX0 A;  1WR6 E;  3IVF A;  4JIO U;  1TGZ B;  3AE1 B;  1J7B A;  3DWG C;  3AAE A;  2JX5 A;  3DBL I;  4ICV A;  3APD A;  1EWY C;  2GBK A;  4LNO A;  4TSS A;  4ARC A;  1V2Y A;  1C1Y B;  3VUW A;  4HRS A;  3KZI O;  4FN2 A;  2C7H A;  1JWS D;  5C3J B;  4DWF A;  1HE8 A;  1LFD A;  3DCG A;  1T5X D;  4WAF A;  2I38 A;  3HVZ A;  1E10 A;  1UWM A;  1J19 A;  2KVR A;  1WXA A;  3VTV A;  3EA6 A;  4FRT A;  4HWI B;  5DL7 A;  1ZPS A;  1D6E C;  4KDL B;  2WXH A;  3RZF A;  1BT0 A;  4JX1 C;  1WJ6 A;  1OPF A;  2MCN B;  3ZTC A;  1WR1 A;  4WQM A;  3ECI A;  5EE1 A;  1JRO A;  1ORM A;  1R4N B;  4ANW A;  3B9J A;  2VZK D;  3NJT A;  4XYC A;  2ODJ A;  3N9Y C;  5KHQ A;  1SJH D;  1TTN A;  2MNH A;  1XLP A;  2M0A A;  1I35 A;  4FES A;  4LNK A;  5AUK A;  1VRA B;  3AED B;  1KOT A;  1LXD A;  1E8W A;  1L4Z B;  1WF9 A;  4ZRP A;  2VZK B;  3QHT A;  4RFB A;  4RGT A;  3PZ7 A;  2BYV E;  2KMM A;  4ZHO A;  1N62 A;  4O4X A;  2J42 A;  5G55 A;  5JZE B;  2ZW0 A;  3ALB A;  4FZM A;  3PZD A;  3UQB A;  2G45 B;  2KFJ A;  2IY0 B;  2BPS A;  1JWU D;  4C7Y A;  5DPT A;  1WE6 A;  2MRP A;  4A6Q A;  2G4S A;  4MAC A;  3TUO A;  3UIN B;  1GB1 A;  4C69 X;  4NY0 A;  2GBR A;  1D5X C;  1DOX A;  3AMZ A;  3WCQ A;  4G76 A;  2L0F A;  1QOG A;  3IAM 1;  3LK2 B;  1D5Z C;  3CST A;  4DHJ B;  2PJH A;  1ZOY B;  4B95 A;  2JRI B;  2REX A;  4KDI C;  2MBE A;  3L13 A;  2D3C A;  1Q1O A;  3PLU A;  1WMH B;  1M94 A;  4DXG A;  4GB9 A;  2KZR A;  2HJ1 A;  2NPT A;  2RPQ A;  2JYE A;  1BXW A;  4URK A;  3KWL A;  4GDK A;  2J4U P;  2SAK A;  1BML C;  1P9D U;  3UIP B;  4MGY E;  1V1O A;  4JWU C;  3ZNG C;  2MEK A;  5AZH A;  2G1E A;  4IKG A;  1ZHZ A;  4X57 B;  2LJ5 A;  2ZNV B;  2YPV A;  4DHZ E;  2IDY A;  4W9K A;  4K7S A;  3V60 A;  3U7Z A;  1YJJ A;  2IO0 B;  3W5V B;  7PRN A;  1E8Y A;  1WX9 A;  4WJO A;  1UUP A;  2DYB A;  3A4S C;  2PVG C;  1I7H A;  2FUH B;  4IWP A;  4HPL B;  3VY9 X;  3AUL A;  2L3Z A;  4IOI E;  5T5F A;  4C4V A;  2NBV B;  3A33 B;  2IJ0 A;  5KHO A;  2Y5P A;  4JQW C;  2K0P A;  4YTP B;  3HVD A;  3ZIM A;  1CJE A;  1BUI C;  2BB5 A;  4MEM A;  4P16 A;  4PK1 A;  1T0Q C;  4NAW A;  3GP6 A;  1PUT A;  2J0K A;  2JU6 X;  2F1C X;  3VR9 B;  2KN5 A;  2C5L C;  2R4L A;  2MHJ A;  3Q6B A;  3QRA A;  2DYM A;  2INP E;  5JDP A;  2ZNV C;  3ZJT A;  4N9F 4;  3RNE C;  2WGS A;  2K6D B;  4S17 A;  5LNK 1;  4A20 A;  1SXT A;  1I4P A;  2LHD A;  1HZ6 A;  4J3O D;  1VDV A;  2MJE A;  2Z0D B;  1B1Z A;  4BBN F;  1WIA A;  1ZHX A;  4JLC A;  1KJT A;  2W55 A;  2WQY B;  3MHS D;  2JZP A;  1T0R C;  2VH1 A;  2IY1 B;  2FE8 A;  2GOW A;  2IO1 B;  1TS2 A;  1TKY A;  3LK2 A;  3HUI A;  4L1B A;  4WJP A;  3RNG C;  2FNJ B;  3O65 B;  4HKQ A;  1PGA A;  4IC7 B;  4BVU C;  3PZ8 A;  4TUU A;  2IYD B;  3PSE B;  1L0Y B;  4B9K A;  1MPE A;  1L0X B;  2IO2 B;  2KYW A;  2WXM A;  3PVL A;  2PIA A;  3U52 E;  1SE2 A;  4GXB A;  1GNU A;  4OVZ A;  1SGH A;  3LJ3 A;  3A9J A;  3MP9 A;  3DWM A;  1UBI A;  1PQS A;  4GDL B;  1GOZ A;  2Y2X A;  2FID A;  4XNK A;  2KJ6 A;  3DHG C;  2ZEQ A;  4YXD B;  3IT4 B;  3EMN X;  2LXC A;  2WXP A;  4PT5 A;  3RPF C;  3TEX A;  5KAF O;  4KRA A;  2FCS A;  4M01 A;  1HXT A;  2BS4 B;  2KO3 A;  4W9G A;  4LLG M;  2NPT B;  4AUQ C;  2LMC A;  4AJY B;  5FR3 A;  1WSP A;  4KKI A;  5MPO A;  4RL9 A;  2K9X A;  2RMM A;  2MSE D;  3QX1 A;  4W9D A;  2Y7S A;  3TBL D;  5BYS A;  3O0E A;  3H8H A;  1EO6 A;  5FVN A;  5E6J A;  5JHA A;  3R8B A;  3EFU A;  3B1L X;  3DA3 A;  2W3S A;  1UH6 A;  2KFK A;  1C4A A;  1WYG A;  1E6E B;  2K39 A;  1GG3 A;  1T1L A;  4K1R B;  3OJ3 A;  2XE1 A;  3HOL A;  2KX3 A;  2GBN A;  1VZ8 A;  3RNB C;  3B2G A;  2KKC A;  3A4R A;  3JSV B;  2CR5 A;  4EEW A;  4M8M A;  4HKZ E;  4RLB A;  1GC7 A;  2D5G A;  2K25 A;  2WS3 B;  4DXA B;  3R7R A;  1GJZ A;  2LGX A;  3W2D A;  2MBH A;  5T8I A;  3VTU A;  2IND C;  2ZFG A;  3ZNI D;  4TKN A;  4A3P A;  3P1M A;  2EEL A;  2KAN A;  3ZLZ A;  2C60 A;  3OLM D;  2B76 B;  4WWN A;  5IOI A;  5G3A A;  3V62 A;  4NNJ B;  1WMH A;  3H6N A;  3SHQ A;  1WGG A;  4O4U A;  4YT0 B;  4FUV A;  2BS2 B;  3SFD B;  3T3N A;  1YIW A;  1K51 A;  3C8Y A;  4US9 A;  2FCN A;  3AH7 A;  3L4P A;  4BOS C;  2KX0 A;  1YQ4 B;  1EU3 A;  1XD3 B;  3CMM B;  1UD7 A;  2GBM A;  4ITK A;  3DBR I;  1ZUD 2;  2N7J A;  4CYE A;  4II3 B;  3WAP A;  1JML A;  3HW9 A;  5D3D A;  3SYB A;  1GAQ B;  4ZRK A;  3TZG A;  1OQR A;  1Z5S B;  3LDZ E;  1WYW B;  3WAO A;  1MHH E;  1Y8R C;  3AE3 B;  3QK0 A;  5DL8 A;  4FRX A;  5ADX L;  4BBN C;  1K52 A;  1WXV A;  5IO9 A;  3N20 C;  1J7C A;  4W9E A;  2ICI A;  4RJX A;  3PV1 A;  1XXG A;  1FCL A;  2M07 A;  4FJY A;  4MSQ B;  3NVW A;  3KLS X;  2CS4 A;  3AE7 B;  1RYJ A;  2IWV A;  1Q5W B;  3Q2A C;  2K3U A;  3AXC A;  1B9R A;  3T20 A;  1XO3 A;  2BKF A;  2XE2 A;  1GFQ A;  1HQR D;  3AU4 A;  1Q9G A;  2QIL A;  2ZW1 A;  2N9K A;  3A9K A;  2MHL A;  4AS1 A;  2WYQ A;  1C9F A;  4GN1 A;  4M00 A;  4FZL A;  2RSU A;  3A1Q A;  4MJS B;  2BF8 B;  2WDQ B;  2Y0K A;  2XN9 C;  4FJZ A;  2HTH A;  5G5H A;  3NUH B;  2GE4 A;  4F7Z A;  3VE2 A;  4HPP A;  5LXI B;  4MH8 A;  1KLG D;  1SB3 C;  4YTM B;  2K1F A;  4JE3 B;  3AA6 A;  1SE4 A;  4WUR A;  3KYD D;  1T0S C;  2IBI B;  2QSD A;  1FMA D;  4KSK C;  2LWP A;  4WWP A;  1YQB A;  3L0W B;  3LYY A;  1IGC A;  2AYO B;  4E74 A;  2NTT A;  2V3P A;  2K8C A;  4ZYN A;  3RUI B;  2LAS A;  5EE9 A;  2DLB A;  4WIP A;  4KR4 A;  2KDF B;  3SFE B;  1L5P A;  4PUX A;  2KWU B;  2KJR A;  3TEW A;  1E7U A;  5IA7 A;  2BTE A;  4P6V F;  3POR A;  5PRN A;  1FRR A;  3NHE B;  1T6B X;  2CKH B;  1E0Z A;  2D3A A;  2W81 C;  2AQ2 B;  4G11 A;  3GE8 C;  2IPK D;  2C7M B;  3CIR B;  1AYF A;  1RM6 C;  3ZRF A;  4ANU A;  4AJW A;  4XGA B;  1E8X A;  3SY9 A;  3H9D A;  4YSX B;  3VRA B;  5FKA C;  4M8N A;  4NAW B;  3R2I A;  4XDD A;  2UWQ A;  5D7G A;  2W54 A;  2WP9 B;  4AQ7 A;  2N1W A;  4ZYS A;  3L10 B;  3T24 A;  3V3X A;  1FIQ A;  3S2A A;  1CK1 A;  2W82 A;  3ZVV A;  1TT5 B;  4C00 A;  4MEL A;  3MTN B;  4K7U A;  3B2F A;  3BRZ A;  1T16 A;  2KMA A;  3EFC A;  3KVF B;  4OZB A;  3SZD A;  1TYG B;  1NI2 A;  1PFD A;  3W1S A;  1XLQ A;  1SE9 A;  5B66 O;  2L1A A;  2DZI A;  4YWG G;  2HJ8 A;  1C79 A;  2WDV B;  3AEC B;  4K3B A;  3RBH A;  4KIK A;  3DVG X;  1WXM A;  2MX2 A;  1I4H A;  2QJL A;  4AYI D;  3P4P B;  4ZHP A;  4F4B A;  2I2Y A;  3AAA B;  2WWZ A;  1R4M B;  4N58 A;  3RUL A;  3AEB B;  3NRZ A;  2WXL A;  3GP7 A;  1AW7 A;  1UBQ A;  4PYZ A;  1SE3 A;  1Q9F A;  2OMF A;  3Q8B A;  3ZDT A;  1H8C A;  2ZCC A;  3ZQ4 A;  1E8Z A;  2WVP A;  1QF6 A;  4P1B C;  3RD2 A;  2R89 A; 
#chains in the Genus database with same CATH homology
 3EFC A;  4C4V B;  4K3C A;  2QCZ A;  3MC9 A;  4N75 A;  2X8X X;  4PK1 A;  4N74 A;  4K3B A;  2QDF A;  2VH2 A;  4C00 A;  4XGA B;  2V9H A;  3MC8 A;  3OG5 A;  2MHJ A;  2VH1 A;  4QAY A;  3Q6B A;  4BZA A;  4C4V A;  3NJT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...