4C4VA

Structure of the outer membrane protein insertase bama with one potra domain.
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
462
structure length
445
Chain Sequence
b'FYVRKIRFEGNDTSKDAVLRREMRQMEGAWLGSDLVDQGKERLNRLGFFETVDTDTQRVPGSPDQVDVVYKVKERNTGSFNFGIGYGTESGVSFQAGVQQDNWLGTGYAVGINGTKNDYQTYAELSVTNPYFTVDGVSLGGRLFYNDFQADDADSSDYTNKSYGTDVTLGFPINEENSLRAGLGYVHNSLSNMQPQVAMWRYLYSMGEHPSTSDQDNSFKTDDFTFNYGWTYNKLDRGYFPTDGSRVNLTGKVTIPGSDNEYYKVTLDTATYVPIDDDHKWVVLGRTRWGYGDGLGGKEMPFYENFYAGGSSTVRGFQSNTIGPKAIYFPHQASAKDLCKSDDAVGGNAMAVASLEFITPTPFISDKYANSVRTSFFWDMGTVWDTNWDSSSGYPDYSDPSNIRMSAGIALQWMSPLGPLVFSYAQPFKKYDGDKAEQFQFNIGK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords OUTER MEMBRANE PROTEIN ASSEMBLY FACTOR BAMA
publication title Structure of Bama, an Essential Factor in Outer Membrane Protein Biogenesis
pubmed doi rcsb
source organism Escherichia coli
molecule tags Protein transport
total genus 90
structure length 445
sequence length 462
ec nomenclature
pdb deposition date 2013-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01103 Bac_surface_Ag Surface antigen
A PF07244 POTRA Surface antigen variable number repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.50 Mainly Beta Beta Barrel Porin membrane protein fhac: a member of the omp85/tpsb transporter family 4c4vA02
3.10.20.310 Alpha Beta Roll Ubiquitin-like (UB roll) membrane protein fhac 4c4vA01
2VH2A 4C00A 2VH1A 4QAYA 4N75A 2QCZA 4N74A 3MC9A 4XGAB 4K3BA 2X8XX 3MC8A 4PK1A 4C4VB 3EFCA 2QDFA 4K3CA 2V9HA 3Q6BA 3NJTA 4C4VA 4BZAA 2MHJA 3OG5A
chains in the Genus database with same CATH superfamily
3DA3A 4BBNF 3M63B 4RM8A 1SIFA 1F2RI 3HOLA 3ENEA 4DHJB 1HA5A 3SZDA 5AEKB 2C7NB 4BBNC 5D6JB 4GN1A 3H6NA 2MBHA 4XWTA 3L10B 3Q8EA 3U7DA 4AJWA 1WGDA 1WGGA 2LEKA 4YTNB 3R7RA 1AW7A 3R8BA 1MVKA 3UU2A 2KFKB 4OZBA 5CTRC 2Y5CA 4DBGA 3MC8A 5JH5C 5IN7A 3FILA 2LGXA 2OJRA 3ZLZA 2HDEA 1D4BA 1U4AA 2M06A 1KLGD 4GIVA 4AYDC 2KXJA 3HUIA 4RL9A 2M8SA 4JE3B 1BT0A 3T3OA 4WAFA 3UIOB 3SY7A 2KDIA 4K7SA 5AUIA 4C80A 3WU2O 2KWDA 3CF6E 1J19A 3U8ZA 4A9AA 3P42A 1OSMA 2IZVB 1V1PA 3QCAA 4WJQA 3Q3OC 3HK0A 2G4SA 3W5VB 1MM5A 3DVGX 2BPSA 1CMXB 3AV8A 2BYVE 3HM6X 2KYWA 4FBJB 1XXGA 3I57A 1D5ZC 2PRNA 3IBEA 1QF6A 1R4NI 3T3NA 3AA1A 4BOZB 3BWUD 4KZCA 2Y2XA 2BB5A 3PHWB 2R2QA 4RGMA 5G39A 4K81A 2HE7A 1ZKHA 5E6PA 5FK9C 4D65A 2RR9A 1OQRA 4FADA 5B5EO 3I5JC 2DNFA 3A4SC 1P7EA 2M0AA 2FAZA 4IDIA 2H88B 1IUEA 4BVUC 3U2SC 4RF0A 5HFYA 4LDTB 1GFQA 2IO1B 3WI5A 2M17A 1T16A 3B2FA 3T9LA 3B0AA 5I4DA 2KDFB 1WR1A 4AUIA 4URKA 4BKSA 4TKNA 4YSZB 1C1YB 5EE0A 3V6EB 4LTUA 4OVVA 1K50A 1JWSD 1GB4A 4KKIA 2GBMA 2HD5B 4YSYB 5JHBA 4YTMB 2AYOB 3DOWA 2SEBD 3ONSA 1UNSA 2W54A 3ZNID 3TEYA 1FNVA 1UUPA 3VUXA 1FXTB 4FQEA 2JRIB 2QHOA 1K51A 2VZKB 4DHJD 1XLQA 2D10A 2IDYA 3RNAC 1ZOYB 3ZW3A 2VH1A 2O2VA 1ISNA 3ZTDA 5G55A 2HTHA 2K25A 2N1WA 4DHZE 4WQMA 4JWSC 3RN9C 3P4RB 1WX7A 1WX9A 2K1FA 1SF0A 1T0SC 2NR2A 3KYCD 4WJPA 3R2IA 3IFWB 3AE6B 3SR6A 4PS3A 3H1UA 3VZUX 4FZMA 1QJPA 4JIOU 2JQYA 3G7GA 1N60A 2KWVB 1SE3A 1S1QB 2O6VB 2KDYA 3AE2B 5DPSA 1Y8RC 2W3SA 2DAFA 3Q3NC 3ZJUA 4N75A 1E6EB 2BKFA 4O3WA 2KKCA 3W1SA 2IGDA 3L13A 4IWPA 3VZWX 2R89A 2MBBB 1XO3A 2G1EA 3HIZA 2KHWB 3M95A 2MA9B 4KVGB 2J4XA 5DCNA 1ZUD2 4TV3A 1JWMD 2NS5A 1FNUA 4P16A 2DENB 3KVDD 2N4FA 3QC8B 3KW5B 1GFNA 3N30A 2JZZA 4IUMB 4PJ0O 2CHXA 2KZ7B 1YJJA 2R4LA 1QT9A 2XN9C 3SU8X 3DWOX 1NI2A 4TMAB 2WX1A 2ZPYA 4GDLA 1NVID 1VR9A 4MGZE 1J7AA 5BO4B 3AEDB 4RM9A 1D5XC 4KZ0A 1Q10A 3AECB 3R2TA 1BMLC 1XLNA 3KLSX 4HEA1 1V8CA 4MJSB 3BIID 2DX5B 1FD6A 4J6IA 1WXVA 2JF5A 1G90A 2X8XX 2F1TA 3KVFB 3EHVA 4GXBA 2PVGC 3ML8A 4OW0A 3A9KB 4KIKA 1FNWA 1GFPA 2L76A 2KQ7A 4DDGD 4IL6O 1I42A 4ASWC 4EZKA 5J2RA 2XTQA 2C7HA 1VD2A 2MWSB 2WXLA 5G5GA 2E3TA 4AFKA 4L1BA 1WRDB 2GI9A 2KTRA 5TISO 3IT4B 4FN2A 5BYRA 4DXAB 1SSNA 4B0EA 4TSSA 2DLBA 2IWWA 2DZKA 1C79A 4W9EA 3AAAA 4JQWC 5ADXL 4MM3B 3NVWA 2X38A 1FCCC 4KV2A 2J0JA 4XE0A 2M19A 2R88A 2PVOD 4WWNA 1ZPSA 4GCPA 5FVNA 3DPDA 2J1NA 1NBFC 2N9LA 4S0RA 4ITKA 1MFWA 1HXUA 3E9SA 4FHKA 3RZWC 3KUDB 1WIAA 2RGFA 4LNOA 3P4SB 1PGBA 4WH4A 4MH0E 3NZUA 2AX5A 3A0BO 1KTKA 3AMZA 3VAWA 3ZUNA 3PZ7A 1HQRD 4II3B 3M3JA 2XK5A 5HKHA 2YPVA 3V05A 3EC8A 2KC2A 5H92C 4PUXA 5AZFA 1UZXB 1TIFA 2DYOA 4LSIA 5AZGA 1UWXA 2DHZA 4RGOS 1SB3C 4RMAA 2ZW1A 1FO4A 2JT4B 2QMTA 2DZMA 4C4VA 2W3RA 5D3DA 3AEBB 1T0QC 4G76A 2J7QB 4NAWA 1ZW7A 1B9RA 3X23A 2K6QA 1N63A 2K0LA 2LFIA 1BXTA 4US9A 4AKRA 1P1AA 3UINB 3AULA 1V5OA 3TEWA 4C56C 4DWFA 4O4XA 2C7MB 2MCNB 3KQ4A 3NZ3A 4USAA 3WA0A 2FCQA 1IZNA 1NI3A 3O13A 1KJTA 2NVUI 4JL9A 2C9WB 3UF8A 4EOYA 4F1SA 3GS2A 1YN4A 4LJOB 1RWSA 3AN1A 2NTSA 4G75A 3I3TB 5E6OA 4ZYNA 5CHVC 4MGKE 3PGEA 2WXPA 1FM0D 3URYA 2JZPA 3WCQA 3GZNB 4K7UA 3BVMA 1J8CA 4MEMA 2MH7A 3LDZE 2N1VA 4KDLB 5DL5A 2WHIA 3LK2B 3L17A 4CTDA 3P2BA 4FZLA 2KDBA 2AQ1B 1L6UA 4AP4C 3HM3A 2LASA 2BWES 2KQ4X 1VCBA 5BYQA 4FZNA 2VRRB 3B1LX 1WJUA 5EE9A 1RFAA 2MNHA 1TKGA 3CIRB 5BYSA 4MGYE 3RCZA 1F52A 1I4GA 2KAJA 2LVPA 5FKAC 1VJKA 2E6XA 2J42A 3VTVA 1JWBD 5DPWA 1HXYD 3PQUA 1GAQB 2AQ2B 1LQBA 3LXFA 3A0HO 5DL6A 2V9HA 4JCHA 3LK2A 2WDRB 3QIJA 1OTRB 4LJPB 3NG0A 4K1RB 4ARCA 5D2MB 2D5GA 5L95C 3PLVA 4JGHB 2BS3B 2KXPB 3PRMB 1RRBA 1K53A 1TBEA 2L8JA 3KZIO 5FR6A 2RPVA 2ZNVB 1A70A 2BW2A 3QRAA 1TT5B 4IWQA 3ZNZB 2RPQA 2PMVA 3ML9A 2BYTA 3NRZA 3PF1A 2XEWA 4HKZE 1JRPA 4C00A 3AA6B 4YTPB 3BK1A 3JYUA 2JSVX 5BMGA 2JYEA 3P1MA 3W1YA 2Y0LA 2ZZPB 1IBXA 4ZRJA 2BYEA 1XF5L 2INDC 4A55A 1XCTL 2KXPA 2MX2A 4ACFA 1HTOA 1EM7A 4F4BA 4HDOA 2PPHA 4E1SA 4TQ0A 3SY9A 3A9JA 4KR4A 3NVYA 1WMHB 4B9KA 1E5WA 1RM6C 2K8BA 1BXWA 4WWMA 4MELA 2J0KA 1ZHYA 3VRAB 1WE6A 5C1ZA 4J3OD 5CHWA 2J52A 1NENB 2LRUA 1WZ3A 1Q9GA 2LJIA 4LK0M 3L0WB 3AAEA 1F9JA 1ZGUB 4OZCA 3RI7C 2N7JA 1V81A 3PT2B 2NBVB 1OQQA 3T8MA 1V9JA 5C2TB 3VR9B 2N9EB 5LLIA 3V3XA 3VE2A 4IKGA 2GRIA 4AUQC 4DDID 3W5UB 4WWPA 4LSEA 3VQIA 3O65B 1Y56A 3AEAB 2JY6A 3RYTA 2MBEA 1SEBD 2GLSA 3JSVB 1PHOA 3H9DA 2WXRA 3A4RA 1P4TA 1E8XA 1L4ZB 4O49A 2CJOA 4AYEC 4HPMB 1E54A 3L16A 4EE2A 3VH3B 1WF9A 3PGUA 3AU5A 1E8WA 1I4HA 4FJZA 3APCA 3AA7B 2Z59B 2JWUA 3SEBA 2L05A 2RDHA 4B0MA 1SBBB 1VDVA 3L54A 4G3XB 2CU1A 3QAQA 1YD8U 4IC7B 4PYZA 2ONQA 4W9IA 1FXAA 3LK41 1V49A 4XDCA 4JLCA 2LGSA 3OAWA 2NPTB 2Y5BB 3MFGA 2N9PC 2FGRA 2FIFA 1JCKB 3AE1B 4G11A 3OJ3A 3PPAA 5G3AA 2ZVOA 1PGAA 3Q8BA 1V2YA 3BRYA 1C3TA 4JX1C 2IPKD 1J0GA 4GSWA 4W9GA 3WANA 2Z0DB 2ZCCA 2HTME 3CWIA 1S5LO 2KNBA 1VLBA 1V80A 2GBNA 1V5TA 3Q6BA 1ZDVA 1XCQL 5T8IA 2PE9A 1FEHA 2VH2A 2NPTA 2KC0A 2N9KA 2D3CA 4ZDVA 5E6NA 3IT6B 2MBOA 3PGRA 1IYFA 4DQOC 1WGKA 1F77A 4RGTA 1EUVB 2BB6A 2KFKA 2ACZB 4RJWA 4RLBA 3VVWB 5GMVA 2AEHA 3JTYA 3CMMB 1KLUD 4UB8O 2V3SA 1YJIA 3QX1A 3MC0B 4XNKA 1N5XA 2DYMA 4MT5A 5EE3A 1MPFA 1PUTA 2K5PA 4IWOA 2PORA 2PKOA 1YN5A 4YWGG 3ZNGC 4C7YA 1J7BA 3H8HA 1UBIA 2KX3A 2LXCA 2QJLA 1S3SG 2ZNVC 1L0VB 3VFKA 1Q1OA 2OEDA 1L7YA 4EZJA 4EUTA 4KX6B 2N0SB 4QQ1A 2J4UP 2IYDB 1E9MA 2ZW0A 3PZDA 2KJHB 4FESA 3PRNA 1GNUA 4KRAA 3BYYB 2LZ6A 2WS3B 5LXIB 1SE9A 2C5LC 4FRTA 3Q3FA 2JXXA 1FFUA 1TY0A 3MJWA 4FLHA 4GDKB 1EO6A 1WRIA 2BF8B 2Y7SA 2QCZA 2DBYA 2KTFA 5IOIA 3TL5A 2F1CX 2INCC 1UD7A 4PK1A 4NJ7A 4LNKA 3TEXA 4XWWA 4N59A 2BYFA 2WWZA 3PREA 4HJKA 3FC4A 2BWFA 2AL3A 1I4RA 3TJPA 3ZVVA 2ODJA 5IAAC 3BVZA 4ZHPA 5G2NA 4GDKA 2KLGA 2LUMA 4GOCA 4A8XC 3GOEA 1WH3A 5J17A 2J53A 5JHAA 3VR8B 3IHPC 4GB9A 5HHDG 4FHJA 3TZGA 2N2MA 3AA0B 1TS5A 1T3QA 5DPRA 3PQSA 3C8YA 1I4PA 4I6NB 4HRSA 4WQOB 2LGIA 2CJNA 1XLPA 1YX6B 2WVPA 5GV0A 1L2NA 3PHXB 1CQVA 4RFBA 1E7UA 4M01A 2KN5A 1ZP0B 1L5PA 2BS4B 4IM2A 4X57B 4KSLC 4AZLA 4M8MA 4NZLB 1J7CA 1UF0A 2INNE 2WX0A 3EFCA 4OHJA 1LM8B 4WIPA 4P1CC 5GTIO 3RPFC 2XE3A 2REXA 2EKIA 2FIDA 2JWZA 4F7ZA 2M0XA 4JWUC 3IG3A 2O6VA 5KHQA 1PGXA 3VUWA 4UB6O 4N74A 4MDKE 3AE8B 4C7ZA 3AM9A 3NVVA 4W9FA 5KAIO 2KVZA 1WXAA 3AE5B 2KDEB 3RNCC 4WWOA 1JALA 2ZCBA 3DDCB 1QOFA 3PSEB 1V86A 1ZXIA 3VXWA 2L52A 3WALA 4JFBA 2UU7A 4M8NA 3POQA 4F8CB 4IM0A 3GP7A 4NJ6A 5IKCM 1T0YA 4PS7A 1WE7A 1D3ZA 3I63C 3NOBA 3NS8A 1BUIC 3SFDB 2D2QA 3ETRA 4KKJA 4FOZA 2IY1B 3TCAA 2KZ7A 1T5XD 3TMPB 3W9CB 4US8A 2RDBC 4RNAA 8PRNA 3O0EA 1OGWA 4JPSA 3AE9B 2WDQB 3APDA 2L1AA 1L0YB 1WWTA 2PJHA 2MP2B 3U30A 3DWGC 1BT9A 2AL6A 2IO0B 3PS6A 1ZE3D 3RFZB 3RULA 4MJSA 4BOSC 1L0XB 2BBCA 4LNIA 4ZHOA 2L0TA 3ZJTA 1HXXA 3A9KA 1KM7A 4A6QA 1THQA 1YJ1A 1GC7A 4HVBA 1ZDXA 4O3YA 4HCNB 4Q2JA 5KHOA 5LNK1 4QAYA 5CHFA 1C4AA 2KQSA 2WXGA 1EF5A 1GJZA 2CR5A 2MBQA 1MG4A 4HK2A 4MSMB 3DBLB 1Q9FA 2LHFA 1TS3A 2W80C 4MM3A 4XYCA 3MHZA 4AKMA 2WXNA 1AN8A 2KWUB 2L7RA 2XNAC 1SJED 3QWZB 3KH0A 1WM2A 1I4XA 1MG8A 5JDPA 1TKYA 4I6LB 3BINA 3ZDMC 5TR5A 3NZSA 2I1KA 4W9KA 4B61A 3B9JA 3BY4B 2LI5A 4DXFA 2N7EA 2J0MA 2LXAA 1STEA 1X1MA 4HJGE 3ZRCA 4GLSC 1I7HA 4ZOHC 2JU6X 2D3BA 2Z8LA 3QARA 2QILA 2MQJA 5GXGB 3VDZA 2LGYA 4BFRA 4BUMX 1ESFA 2N9XA 2UYZB 2NMQA 1BH3A 1R4NB 1ROEA 1UELA 4LSFA 3C0RB 4CO7A 4FMSA 4AYMC 3UQAA 3BZDB 2KZRA 3RNEC 3KUZA 2V3PA 3RMKC 1IPGA 1QLBB 2RDGA 1OEYJ 3N32A 3H7SA 1C77A 3FYXA 4AOFA 1NEKB 1XT9B 4M02A 3EMNX 2ON8A 2KFJA 3HVDA 4RCOA 1PYWD 2IY0B 3ZO5B 1WXQA 3N9YC 2KK8A 4O4UA 1HZ5A 2D11A 4ANWA 1GPXA 4W9CA 3UGBB 4NQKE 3DZMA 2LMCA 1TTNA 3S2AA 4AYID 1VZ7A 2MHJA 4XC2A 3KWVA 1SGHA 4EZLA 3WI4A 3IAM1 3APFA 1NDDA 1K8RB 3K19A 1WYGA 1JROA 1UGMA 3DA4A 4EEWA 4XDDA 4HPLB 5DL7A 2BTEA 1H4RA 1T6BX 5H2FO 1FXIA 1YIWA 3DHHC 4KGTA 4REZA 4DXGA 2KJ6A 5HI1A 1KH0A 2X27X 2I38A 2R4OA 3PVLA 3CSFA 4UDUC 1QKZA 2W82A 3PRPB 4FRXA 2LRWA 2LJ5A 5MPOA 1YOVB 4IOIE 4MACA 3L08A 4BKGA 5AUKA 3EA6A 1IGCA 2V3NA 2NCNA 4YSXB 2M4NA 4HLEA 3T24A 1UGJA 1KFYB 1KLVA 1JWUD 4BAXA 3RT3B 1MI0A 3X0WA 2FBWB 3TEZA 5JZEB 5CX3A 2R8AA 4DHZB 3QRCA 2A4ZA 1AYFA 3UI3A 5ADXK 4GU2A 2PEAA 3QHTA 3I9V1 4HPPA 1MPEA 2CU3A 3A1QB 4EFOA 4HWIB 3PO0A 2F1VA 3L4PA 3VH4B 2LGDA 4KDIC 3N1YC 5G5HA 1ZHTA 1I4QA 5EE1A 3NSGA 1N61A 2DZIA 2G9HD 4GHBA 1L6VA 3HHMA 2G45B 2WXKA 3ZDTA 1E7VA 2WXJA 4ZRPA 1EU3A 2XE2A 2AQ3B 4ZYSA 2JMMA 3AA6A 3ECIA 2KT7A 1TJEA 2QEJC 2KVRA 5IYUA 2GE4A 3JCUO 2LD9A 5AZHA 4ARIA 2K9XA 2WP9B 1PDXA 2C60A 3ZQ4A 1YQ4B 1C76A 5DL8A 4HDQA 2A5UA 4XZ4A 3PRZA 1UWMA 2RSUA 4ANVA 1WI0A 1WMHA 1E8ZA 1GFMA 3A2SX 1OEYA 3ZJVA 1MHXA 1WJNA 3GE3C 2WDVB 4L2YA 3P4PB 1H8CA 3EGRA 1DOYA 1M94A 1C4CA 1P3QU 2WU5B 5L83A 4P1BC 2IWVA 3KUCB 2LVOA 1HE8A 2MLBA 3TBLD 3NY5A 3LYYA 3SYBA 4NAMA 3JW0X 3SDLC 2OOBB 3EUB2 3BYTB 1E10A 3NUHB 3PLUA 1ZXHA 2XMXA 5GTHO 2Z0EB 1KOTA 1L4DB 2Y3AA 3GE8C 1E90A 4O1NA 1YMHE 3Q3JA 1V1OA 3AB5A 2R61A 4N58A 2W55A 2V0GA 1WFYA 3UQBA 3V8UA 2LWPA 3JSVA 2ZLDA 1JW9D 4NNJB 4WAAA 1VRAB 4P6VF 1GFOA 1TYGB 2WYQA 1UBQA 2OJWA 4ZRKA 4ICVA 2XBBC 2KACA 3VHTC 1RAXA 1GB1A 4AJYB 4LLGM 3FILB 4NY0A 2QC8A 1WXSA 2KN4A 3AA7A 3OJ4B 5D3IB 3CSTA 2PE6B 3N3KB 4RF1A 3ZIMA 2X9KA 4FT6A 1MJDA 1QILA 3B08A 3C19A 4CQNA 4ANUA 1WXMA 3Q3MC 4MGIE 4XX5A 4MSQB 4HKQA 5EDSA 5C23A 4LCDE 3R3MA 1ACCA 2MW5A 1V1PB 3FAHA 2FGQX 2JUOA 1SJHD 2CS4A 4M00A 3DBLI 3K9OB 4CHKA 3VE1A 1MHHE 1R4MB 3NJTA 1PRNA 2YEPB 2LUEA 1WZ0A 3DCGA 2IBIB 1V97A 4NPNA 4NQLB 1NYQA 2G4DB 3MTNB 1FPYA 4K7WA 1ZHZA 5D5DA 3AA1B 3RNGC 1N6ZA 2WU2B 3IAS1 1AWDA 5C3JB 2WGSA 1ZHWA 2LVQA 3POUA 4LSHA 1YQ3B 2JRHA 1EF1A 2R4PA 3DVNU 4K3CA 1QOBA 2V4IB 3AE4B 2Y0KA 3V6CB 3ZNHB 3ZKJC 1EU4A 2L83A 3JVZX 4KSKC 1FFVA 3MC9A 1XD3B 1P98A 4E71A 2JX5A 2GOWA 2KJRA 4PT5A 2R4NA 2V4LA 1YQBA 1FRRA 2K4TA 5KAFO 2KWCA 3AEGB 1QOGA 3P63A 1YS5A 4C69X 3N1XC 1KRHA 1C9FA 1TZOA 4ZRIA 4E74A 4HCPB 2DZJA 2JPHA 1OPFA 2D3GA 4OVUA 2KMMA 5TSSA 3VRBB 4FJYA 2DWQA 3D32A 5EE2A 2L00B 2K0PA 4ICUA 4IG7B 3AH7A 3VUYA 4ZRQA 3UAQA 4NJCA 4OVZA 4GMVA 2W81C 2K3UA 1QJ8A 2O2VB 2MRPA 3RUIB 3V61A 3AEFB 5BMIA 2B76B 2K22A 3GZNI 3ABVB 3DWMA 4LNFA 4XNLA 2KO3A 3RNFC 3HRDD 3NS1A 1LO5D 2Q5WD 2QTKA 2FE8A 3RZFA 2GB1A 1P9DU 5E79O 2BVCA 2KLCA 3GB1A 2KC1A 4G0NB 1B1ZA 3POXA 2MJDA 1R7SA 2NTTA 2OMFA 2HJ8A 3K9PB 3SZVA 2BT6A 3OWEB 3A33B 3DBRB 1CZPA 2K8CA 1DOIA 2MSED 5B66O 3P4QB 2OHFA 1M4VA 1ORMA 1D5MC 5PRNA 5E6JA 4D2KA 3AA0A 1JWAD 2L32A 3HW9A 2H89B 2M56B 3AI5A 3HVZA 4IW0A 1V6EA 1XEEA 2CHWA 3VY9X 4AWJA 3PGSA 1T0RC 2M07A 5D7GA 3VTWA 2FCSA 2Y0HA 4II2B 4GDLB 1CJEA 4E1TA 4O3ZA 2PLPA 4ANXA 3PV1A 3V62A 1HZ6A 4BZAA 1EWYC 4GCQA 3QK0A 2WXQA 3DBHB 3ZXVA 1WX8A 2GBKA 2I1JA 2YEPF 4KIKB 3SYSA 4FA6A 1WM3A 2GBRA 4MH8A 5AFUL 1OQYA 3TUOA 3U7ZA 4KR8A 1N5WA 3QQ8B 2QSDA 3H7PB 2KTRB 2NBWB 3DBSA 4BKSD 2WLBA 2FCMA 3WIMA 1E7PB 1NYRA 1LFDA 2IO2B 4BKTA 4XGAB 1WGYA 6PRNA 4H2AA 3AAAB 1N62A 4P7IA 3T0SA 1IGDA 2BS2B 2JZ3B 2XE1A 4M0WB 1WY8A 4RH6A 1D6EC 4LDTD 1OFFA 2KOXA 2XTRA 4Z3TA 3IXSA 1VZ6A 3SHQA 3ZRFA 1ZHXA 1QOAA 4CYEA 1E8YA 2AWTA 2WQYB 3T20A 3H7PA 3RBHA 3EFUA 2K39A 2WXHA 3V60A 2XE5A 2KDMA 1Q0WB 2MP2A 4RJXA 2WXOA 3DHIC 3OLMD 1RLFA 4IM3A 1HTQA 3VY8X 3DWNA 1RFKA 1GG3A 2GMIC 1WSPA 4M0WA 1G6JA 3AU4A 2MEKA 1T1LA 1WJ6A 1FRDA 2WJQA 2XK5B 4W9HA 4AYNA 2VZKD 5H8YE 1GC6A 1CK1A 3U52E 1JQ4A 3VZTX 2EMSA 1PQSA 3AXCA 1KF6B 3AE3B 3DQVA 2IGGA 2WJRA 4B95A 4C4VB 4HXDA 4S17A 1XQQA 4N6EB 5D94A 2UWQA 2IO3B 4NAWB 3BS0A 2EELA 1QQRA 5IO9A 1GOZA 1EWCA 4AKRB 4KGRA 4TQ1A 1UH6A 5G38A 1TS2A 4W9LA 2CHZA 2FCNA 3PZ8A 2O6VD 4OZAA 5JXVA 2PW9A 3Q14C 3Q8FA 3AE7B 1E0ZA 1F1HA 5HG2A 1TZ1A 1YNTE 3AEEB 1YX5B 1IZNB 1VZ8A 4B6WA 2WXMA 1I35A 4YT0B 4I6PA 3GP6A 2RMMA 4AS1A 3TSSA 1Z2MA 4PR7A 2NBUA 2JVCA 2JQRB 2K6DB 3KYDD 4EKUA 3W1SC 3ZYYX 2BQQA 3Q8CA 3MJ5A 1R4MI 1TY2A 2KD0A 3BRZA 2IGHA 1PFDA 2M1MA 3ALBA 2L0FA 5BMHA 4A20A 2YNKA 2BKRB 2KMAA 4FSOA 2WXIA 1F0ZA 2R2OA 4LNNA 2L3ZA 1TS4A 5FR3A 1QJ9A 2WDTB 4HROA 1RYJA 2O4VA 3LB8C 2AXTO 2IJ0A 3DVNV 3WAPA 4U9CA 4D5UA 2XG6A 4RLCA 4DK5A 1AARA 3PTFC 4WJNA 3J9CA 4W9DA 2HJ1A 1C4PA 4GGQA 2QDFA 2N7DA 2JYTA 3W2DA 2KX0A 4R3DA 2Y5PA 5IP4D 2RD0A 1DYQA 1ENFA 3B2GA 1SIJA 4KGSA 2CKHB 4FSPA 3E56A 4L23A 3IVFA 4K3BA 1ET6A 4FXCA 4WJOA 3UPGA 1WGRA 2W9NA 2I2YA 1H6S1 2PIAA 2KANA 4AQ7A 3BVGA 1SE4A 1HEZE 2INPE 4FULA 1Z5SB 3Q8AA 1TKEA 2SAKA 2MJEA 5AFUK 7PRNA 3WAMA 2MHLA 4A3OA 3NVZA 2LHEA 2ASQA 1WYWB 2N2LA 3RNBC 3EECA 3UIPB 3LK3B 1QZEA 3WAOA 1JMLA 1WR6E 1MM4A 1WJ4A 2K8HA 1F2RC 4A90A 1YN3A 4G50A 4N9F4 3R66C 4O3XB 2ICIA 2LHDA 2BGFA 1TGZB 2EKEC 4YXDB 2LFUA 4GCSA 1DOXA 1GUAB 1IBXB 2B3AA 1WGHA 3TIXA 3MP9A 5LXHA 3VTUA 3M62B 1SXTA 2ZFGA 3LK3A 5J18A 4PYUA 2YLMA 1A5RA 4YL8A 3A9JB 3NHEB 1Q5WB 3DHGC 2YVCA 3LJ3A 2WXFA 5T5FA 2DYBA 3OG5A 4RGNA 2FUG1 4D64A 1LXDA 2FNJB 2ZEQA 4E3CA 1K52A 4WURA 3Q69A 2ERVA 2FUHB 1LGRA 4GF4A 3AAEB 3DBRI 3A1QA 3SFEB 3KWLA 3LK42 2WNMA 2G3QB 3N20C 3MHSD 1FMAD 4PS8A 2ZJDA 3Q2AC 5G26A 1XLOA 3BK2A 1P7FA 2EMTA 1FIQA 3U4EG 3FKYA 2QIEB 3N1ZC 1DGJA 1IP9A 4FJVB 1C78A 3SD5A 3DVGY 3RD2A 3QJZA 2D3AA 4A3PA 5IA7A 1SE2A 1JRUA 3R7QA 2KMCA 3HOEA 3HWBA 2GBJA 3C5OA 3DBHI 5DPTA 3PORA 2V1YA 2ZPNA 3ZGZA 2ZVNA 4TUUA 1P0RA 1HXTA 2DAJA 2PTLA 3QA8A 3ZXRA 2TSSA 2MJ3A 1FCLA 1ET9A 2JXTA 2D07B 4W9JA 3ZTCA 4FUVA
chains in the Genus database with same CATH topology
2VH2A 4C00A 2VH1A 4QAYA 4N75A 2QCZA 4N74A 3MC9A 4XGAB 4K3BA 2X8XX 3MC8A 4PK1A 4C4VB 3EFCA 2QDFA 4K3CA 2V9HA 3Q6BA 3NJTA 4C4VA 4BZAA 2MHJA 3OG5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VH2 A;  4C00 A;  2VH1 A;  4QAY A;  4N75 A;  2QCZ A;  4N74 A;  3MC9 A;  4XGA B;  4K3B A;  2X8X X;  3MC8 A;  4PK1 A;  4C4V B;  3EFC A;  2QDF A;  4K3C A;  2V9H A;  3Q6B A;  3NJT A;  4C4V A;  4BZA A;  2MHJ A;  3OG5 A; 
#chains in the Genus database with same CATH topology
 3DA3 A;  4BBN F;  3M63 B;  4RM8 A;  1SIF A;  1F2R I;  3HOL A;  3ENE A;  4DHJ B;  1HA5 A;  3SZD A;  5AEK B;  2C7N B;  4BBN C;  5D6J B;  4GN1 A;  3H6N A;  2MBH A;  4XWT A;  3L10 B;  3Q8E A;  3U7D A;  4AJW A;  1WGD A;  1WGG A;  2LEK A;  4YTN B;  3R7R A;  1AW7 A;  3R8B A;  1MVK A;  3UU2 A;  2KFK B;  4OZB A;  5CTR C;  2Y5C A;  4DBG A;  3MC8 A;  5JH5 C;  5IN7 A;  3FIL A;  2LGX A;  2OJR A;  3ZLZ A;  2HDE A;  1D4B A;  1U4A A;  2M06 A;  1KLG D;  4GIV A;  4AYD C;  2KXJ A;  3HUI A;  4RL9 A;  2M8S A;  4JE3 B;  1BT0 A;  3T3O A;  4WAF A;  3UIO B;  3SY7 A;  2KDI A;  4K7S A;  5AUI A;  4C80 A;  3WU2 O;  2KWD A;  3CF6 E;  1J19 A;  3U8Z A;  4A9A A;  3P42 A;  1OSM A;  2IZV B;  1V1P A;  3QCA A;  4WJQ A;  3Q3O C;  3HK0 A;  2G4S A;  3W5V B;  1MM5 A;  3DVG X;  2BPS A;  1CMX B;  3AV8 A;  2BYV E;  3HM6 X;  2KYW A;  4FBJ B;  1XXG A;  3I57 A;  1D5Z C;  2PRN A;  3IBE A;  1QF6 A;  1R4N I;  3T3N A;  3AA1 A;  4BOZ B;  3BWU D;  4KZC A;  2Y2X A;  2BB5 A;  3PHW B;  2R2Q A;  4RGM A;  5G39 A;  4K81 A;  2HE7 A;  1ZKH A;  5E6P A;  5FK9 C;  4D65 A;  2RR9 A;  1OQR A;  4FAD A;  5B5E O;  3I5J C;  2DNF A;  3A4S C;  1P7E A;  2M0A A;  2FAZ A;  4IDI A;  2H88 B;  1IUE A;  4BVU C;  3U2S C;  4RF0 A;  5HFY A;  4LDT B;  1GFQ A;  2IO1 B;  3WI5 A;  2M17 A;  1T16 A;  3B2F A;  3T9L A;  3B0A A;  5I4D A;  2KDF B;  1WR1 A;  4AUI A;  4URK A;  4BKS A;  4TKN A;  4YSZ B;  1C1Y B;  5EE0 A;  3V6E B;  4LTU A;  4OVV A;  1K50 A;  1JWS D;  1GB4 A;  4KKI A;  2GBM A;  2HD5 B;  4YSY B;  5JHB A;  4YTM B;  2AYO B;  3DOW A;  2SEB D;  3ONS A;  1UNS A;  2W54 A;  3ZNI D;  3TEY A;  1FNV A;  1UUP A;  3VUX A;  1FXT B;  4FQE A;  2JRI B;  2QHO A;  1K51 A;  2VZK B;  4DHJ D;  1XLQ A;  2D10 A;  2IDY A;  3RNA C;  1ZOY B;  3ZW3 A;  2VH1 A;  2O2V A;  1ISN A;  3ZTD A;  5G55 A;  2HTH A;  2K25 A;  2N1W A;  4DHZ E;  4WQM A;  4JWS C;  3RN9 C;  3P4R B;  1WX7 A;  1WX9 A;  2K1F A;  1SF0 A;  1T0S C;  2NR2 A;  3KYC D;  4WJP A;  3R2I A;  3IFW B;  3AE6 B;  3SR6 A;  4PS3 A;  3H1U A;  3VZU X;  4FZM A;  1QJP A;  4JIO U;  2JQY A;  3G7G A;  1N60 A;  2KWV B;  1SE3 A;  1S1Q B;  2O6V B;  2KDY A;  3AE2 B;  5DPS A;  1Y8R C;  2W3S A;  2DAF A;  3Q3N C;  3ZJU A;  4N75 A;  1E6E B;  2BKF A;  4O3W A;  2KKC A;  3W1S A;  2IGD A;  3L13 A;  4IWP A;  3VZW X;  2R89 A;  2MBB B;  1XO3 A;  2G1E A;  3HIZ A;  2KHW B;  3M95 A;  2MA9 B;  4KVG B;  2J4X A;  5DCN A;  1ZUD 2;  4TV3 A;  1JWM D;  2NS5 A;  1FNU A;  4P16 A;  2DEN B;  3KVD D;  2N4F A;  3QC8 B;  3KW5 B;  1GFN A;  3N30 A;  2JZZ A;  4IUM B;  4PJ0 O;  2CHX A;  2KZ7 B;  1YJJ A;  2R4L A;  1QT9 A;  2XN9 C;  3SU8 X;  3DWO X;  1NI2 A;  4TMA B;  2WX1 A;  2ZPY A;  4GDL A;  1NVI D;  1VR9 A;  4MGZ E;  1J7A A;  5BO4 B;  3AED B;  4RM9 A;  1D5X C;  4KZ0 A;  1Q10 A;  3AEC B;  3R2T A;  1BML C;  1XLN A;  3KLS X;  4HEA 1;  1V8C A;  4MJS B;  3BII D;  2DX5 B;  1FD6 A;  4J6I A;  1WXV A;  2JF5 A;  1G90 A;  2X8X X;  2F1T A;  3KVF B;  3EHV A;  4GXB A;  2PVG C;  3ML8 A;  4OW0 A;  3A9K B;  4KIK A;  1FNW A;  1GFP A;  2L76 A;  2KQ7 A;  4DDG D;  4IL6 O;  1I42 A;  4ASW C;  4EZK A;  5J2R A;  2XTQ A;  2C7H A;  1VD2 A;  2MWS B;  2WXL A;  5G5G A;  2E3T A;  4AFK A;  4L1B A;  1WRD B;  2GI9 A;  2KTR A;  5TIS O;  3IT4 B;  4FN2 A;  5BYR A;  4DXA B;  1SSN A;  4B0E A;  4TSS A;  2DLB A;  2IWW A;  2DZK A;  1C79 A;  4W9E A;  3AAA A;  4JQW C;  5ADX L;  4MM3 B;  3NVW A;  2X38 A;  1FCC C;  4KV2 A;  2J0J A;  4XE0 A;  2M19 A;  2R88 A;  2PVO D;  4WWN A;  1ZPS A;  4GCP A;  5FVN A;  3DPD A;  2J1N A;  1NBF C;  2N9L A;  4S0R A;  4ITK A;  1MFW A;  1HXU A;  3E9S A;  4FHK A;  3RZW C;  3KUD B;  1WIA A;  2RGF A;  4LNO A;  3P4S B;  1PGB A;  4WH4 A;  4MH0 E;  3NZU A;  2AX5 A;  3A0B O;  1KTK A;  3AMZ A;  3VAW A;  3ZUN A;  3PZ7 A;  1HQR D;  4II3 B;  3M3J A;  2XK5 A;  5HKH A;  2YPV A;  3V05 A;  3EC8 A;  2KC2 A;  5H92 C;  4PUX A;  5AZF A;  1UZX B;  1TIF A;  2DYO A;  4LSI A;  5AZG A;  1UWX A;  2DHZ A;  4RGO S;  1SB3 C;  4RMA A;  2ZW1 A;  1FO4 A;  2JT4 B;  2QMT A;  2DZM A;  4C4V A;  2W3R A;  5D3D A;  3AEB B;  1T0Q C;  4G76 A;  2J7Q B;  4NAW A;  1ZW7 A;  1B9R A;  3X23 A;  2K6Q A;  1N63 A;  2K0L A;  2LFI A;  1BXT A;  4US9 A;  4AKR A;  1P1A A;  3UIN B;  3AUL A;  1V5O A;  3TEW A;  4C56 C;  4DWF A;  4O4X A;  2C7M B;  2MCN B;  3KQ4 A;  3NZ3 A;  4USA A;  3WA0 A;  2FCQ A;  1IZN A;  1NI3 A;  3O13 A;  1KJT A;  2NVU I;  4JL9 A;  2C9W B;  3UF8 A;  4EOY A;  4F1S A;  3GS2 A;  1YN4 A;  4LJO B;  1RWS A;  3AN1 A;  2NTS A;  4G75 A;  3I3T B;  5E6O A;  4ZYN A;  5CHV C;  4MGK E;  3PGE A;  2WXP A;  1FM0 D;  3URY A;  2JZP A;  3WCQ A;  3GZN B;  4K7U A;  3BVM A;  1J8C A;  4MEM A;  2MH7 A;  3LDZ E;  2N1V A;  4KDL B;  5DL5 A;  2WHI A;  3LK2 B;  3L17 A;  4CTD A;  3P2B A;  4FZL A;  2KDB A;  2AQ1 B;  1L6U A;  4AP4 C;  3HM3 A;  2LAS A;  2BWE S;  2KQ4 X;  1VCB A;  5BYQ A;  4FZN A;  2VRR B;  3B1L X;  1WJU A;  5EE9 A;  1RFA A;  2MNH A;  1TKG A;  3CIR B;  5BYS A;  4MGY E;  3RCZ A;  1F52 A;  1I4G A;  2KAJ A;  2LVP A;  5FKA C;  1VJK A;  2E6X A;  2J42 A;  3VTV A;  1JWB D;  5DPW A;  1HXY D;  3PQU A;  1GAQ B;  2AQ2 B;  1LQB A;  3LXF A;  3A0H O;  5DL6 A;  2V9H A;  4JCH A;  3LK2 A;  2WDR B;  3QIJ A;  1OTR B;  4LJP B;  3NG0 A;  4K1R B;  4ARC A;  5D2M B;  2D5G A;  5L95 C;  3PLV A;  4JGH B;  2BS3 B;  2KXP B;  3PRM B;  1RRB A;  1K53 A;  1TBE A;  2L8J A;  3KZI O;  5FR6 A;  2RPV A;  2ZNV B;  1A70 A;  2BW2 A;  3QRA A;  1TT5 B;  4IWQ A;  3ZNZ B;  2RPQ A;  2PMV A;  3ML9 A;  2BYT A;  3NRZ A;  3PF1 A;  2XEW A;  4HKZ E;  1JRP A;  4C00 A;  3AA6 B;  4YTP B;  3BK1 A;  3JYU A;  2JSV X;  5BMG A;  2JYE A;  3P1M A;  3W1Y A;  2Y0L A;  2ZZP B;  1IBX A;  4ZRJ A;  2BYE A;  1XF5 L;  2IND C;  4A55 A;  1XCT L;  2KXP A;  2MX2 A;  4ACF A;  1HTO A;  1EM7 A;  4F4B A;  4HDO A;  2PPH A;  4E1S A;  4TQ0 A;  3SY9 A;  3A9J A;  4KR4 A;  3NVY A;  1WMH B;  4B9K A;  1E5W A;  1RM6 C;  2K8B A;  1BXW A;  4WWM A;  4MEL A;  2J0K A;  1ZHY A;  3VRA B;  1WE6 A;  5C1Z A;  4J3O D;  5CHW A;  2J52 A;  1NEN B;  2LRU A;  1WZ3 A;  1Q9G A;  2LJI A;  4LK0 M;  3L0W B;  3AAE A;  1F9J A;  1ZGU B;  4OZC A;  3RI7 C;  2N7J A;  1V81 A;  3PT2 B;  2NBV B;  1OQQ A;  3T8M A;  1V9J A;  5C2T B;  3VR9 B;  2N9E B;  5LLI A;  3V3X A;  3VE2 A;  4IKG A;  2GRI A;  4AUQ C;  4DDI D;  3W5U B;  4WWP A;  4LSE A;  3VQI A;  3O65 B;  1Y56 A;  3AEA B;  2JY6 A;  3RYT A;  2MBE A;  1SEB D;  2GLS A;  3JSV B;  1PHO A;  3H9D A;  2WXR A;  3A4R A;  1P4T A;  1E8X A;  1L4Z B;  4O49 A;  2CJO A;  4AYE C;  4HPM B;  1E54 A;  3L16 A;  4EE2 A;  3VH3 B;  1WF9 A;  3PGU A;  3AU5 A;  1E8W A;  1I4H A;  4FJZ A;  3APC A;  3AA7 B;  2Z59 B;  2JWU A;  3SEB A;  2L05 A;  2RDH A;  4B0M A;  1SBB B;  1VDV A;  3L54 A;  4G3X B;  2CU1 A;  3QAQ A;  1YD8 U;  4IC7 B;  4PYZ A;  2ONQ A;  4W9I A;  1FXA A;  3LK4 1;  1V49 A;  4XDC A;  4JLC A;  2LGS A;  3OAW A;  2NPT B;  2Y5B B;  3MFG A;  2N9P C;  2FGR A;  2FIF A;  1JCK B;  3AE1 B;  4G11 A;  3OJ3 A;  3PPA A;  5G3A A;  2ZVO A;  1PGA A;  3Q8B A;  1V2Y A;  3BRY A;  1C3T A;  4JX1 C;  2IPK D;  1J0G A;  4GSW A;  4W9G A;  3WAN A;  2Z0D B;  2ZCC A;  2HTM E;  3CWI A;  1S5L O;  2KNB A;  1VLB A;  1V80 A;  2GBN A;  1V5T A;  3Q6B A;  1ZDV A;  1XCQ L;  5T8I A;  2PE9 A;  1FEH A;  2VH2 A;  2NPT A;  2KC0 A;  2N9K A;  2D3C A;  4ZDV A;  5E6N A;  3IT6 B;  2MBO A;  3PGR A;  1IYF A;  4DQO C;  1WGK A;  1F77 A;  4RGT A;  1EUV B;  2BB6 A;  2KFK A;  2ACZ B;  4RJW A;  4RLB A;  3VVW B;  5GMV A;  2AEH A;  3JTY A;  3CMM B;  1KLU D;  4UB8 O;  2V3S A;  1YJI A;  3QX1 A;  3MC0 B;  4XNK A;  1N5X A;  2DYM A;  4MT5 A;  5EE3 A;  1MPF A;  1PUT A;  2K5P A;  4IWO A;  2POR A;  2PKO A;  1YN5 A;  4YWG G;  3ZNG C;  4C7Y A;  1J7B A;  3H8H A;  1UBI A;  2KX3 A;  2LXC A;  2QJL A;  1S3S G;  2ZNV C;  1L0V B;  3VFK A;  1Q1O A;  2OED A;  1L7Y A;  4EZJ A;  4EUT A;  4KX6 B;  2N0S B;  4QQ1 A;  2J4U P;  2IYD B;  1E9M A;  2ZW0 A;  3PZD A;  2KJH B;  4FES A;  3PRN A;  1GNU A;  4KRA A;  3BYY B;  2LZ6 A;  2WS3 B;  5LXI B;  1SE9 A;  2C5L C;  4FRT A;  3Q3F A;  2JXX A;  1FFU A;  1TY0 A;  3MJW A;  4FLH A;  4GDK B;  1EO6 A;  1WRI A;  2BF8 B;  2Y7S A;  2QCZ A;  2DBY A;  2KTF A;  5IOI A;  3TL5 A;  2F1C X;  2INC C;  1UD7 A;  4PK1 A;  4NJ7 A;  4LNK A;  3TEX A;  4XWW A;  4N59 A;  2BYF A;  2WWZ A;  3PRE A;  4HJK A;  3FC4 A;  2BWF A;  2AL3 A;  1I4R A;  3TJP A;  3ZVV A;  2ODJ A;  5IAA C;  3BVZ A;  4ZHP A;  5G2N A;  4GDK A;  2KLG A;  2LUM A;  4GOC A;  4A8X C;  3GOE A;  1WH3 A;  5J17 A;  2J53 A;  5JHA A;  3VR8 B;  3IHP C;  4GB9 A;  5HHD G;  4FHJ A;  3TZG A;  2N2M A;  3AA0 B;  1TS5 A;  1T3Q A;  5DPR A;  3PQS A;  3C8Y A;  1I4P A;  4I6N B;  4HRS A;  4WQO B;  2LGI A;  2CJN A;  1XLP A;  1YX6 B;  2WVP A;  5GV0 A;  1L2N A;  3PHX B;  1CQV A;  4RFB A;  1E7U A;  4M01 A;  2KN5 A;  1ZP0 B;  1L5P A;  2BS4 B;  4IM2 A;  4X57 B;  4KSL C;  4AZL A;  4M8M A;  4NZL B;  1J7C A;  1UF0 A;  2INN E;  2WX0 A;  3EFC A;  4OHJ A;  1LM8 B;  4WIP A;  4P1C C;  5GTI O;  3RPF C;  2XE3 A;  2REX A;  2EKI A;  2FID A;  2JWZ A;  4F7Z A;  2M0X A;  4JWU C;  3IG3 A;  2O6V A;  5KHQ A;  1PGX A;  3VUW A;  4UB6 O;  4N74 A;  4MDK E;  3AE8 B;  4C7Z A;  3AM9 A;  3NVV A;  4W9F A;  5KAI O;  2KVZ A;  1WXA A;  3AE5 B;  2KDE B;  3RNC C;  4WWO A;  1JAL A;  2ZCB A;  3DDC B;  1QOF A;  3PSE B;  1V86 A;  1ZXI A;  3VXW A;  2L52 A;  3WAL A;  4JFB A;  2UU7 A;  4M8N A;  3POQ A;  4F8C B;  4IM0 A;  3GP7 A;  4NJ6 A;  5IKC M;  1T0Y A;  4PS7 A;  1WE7 A;  1D3Z A;  3I63 C;  3NOB A;  3NS8 A;  1BUI C;  3SFD B;  2D2Q A;  3ETR A;  4KKJ A;  4FOZ A;  2IY1 B;  3TCA A;  2KZ7 A;  1T5X D;  3TMP B;  3W9C B;  4US8 A;  2RDB C;  4RNA A;  8PRN A;  3O0E A;  1OGW A;  4JPS A;  3AE9 B;  2WDQ B;  3APD A;  2L1A A;  1L0Y B;  1WWT A;  2PJH A;  2MP2 B;  3U30 A;  3DWG C;  1BT9 A;  2AL6 A;  2IO0 B;  3PS6 A;  1ZE3 D;  3RFZ B;  3RUL A;  4MJS A;  4BOS C;  1L0X B;  2BBC A;  4LNI A;  4ZHO A;  2L0T A;  3ZJT A;  1HXX A;  3A9K A;  1KM7 A;  4A6Q A;  1THQ A;  1YJ1 A;  1GC7 A;  4HVB A;  1ZDX A;  4O3Y A;  4HCN B;  4Q2J A;  5KHO A;  5LNK 1;  4QAY A;  5CHF A;  1C4A A;  2KQS A;  2WXG A;  1EF5 A;  1GJZ A;  2CR5 A;  2MBQ A;  1MG4 A;  4HK2 A;  4MSM B;  3DBL B;  1Q9F A;  2LHF A;  1TS3 A;  2W80 C;  4MM3 A;  4XYC A;  3MHZ A;  4AKM A;  2WXN A;  1AN8 A;  2KWU B;  2L7R A;  2XNA C;  1SJE D;  3QWZ B;  3KH0 A;  1WM2 A;  1I4X A;  1MG8 A;  5JDP A;  1TKY A;  4I6L B;  3BIN A;  3ZDM C;  5TR5 A;  3NZS A;  2I1K A;  4W9K A;  4B61 A;  3B9J A;  3BY4 B;  2LI5 A;  4DXF A;  2N7E A;  2J0M A;  2LXA A;  1STE A;  1X1M A;  4HJG E;  3ZRC A;  4GLS C;  1I7H A;  4ZOH C;  2JU6 X;  2D3B A;  2Z8L A;  3QAR A;  2QIL A;  2MQJ A;  5GXG B;  3VDZ A;  2LGY A;  4BFR A;  4BUM X;  1ESF A;  2N9X A;  2UYZ B;  2NMQ A;  1BH3 A;  1R4N B;  1ROE A;  1UEL A;  4LSF A;  3C0R B;  4CO7 A;  4FMS A;  4AYM C;  3UQA A;  3BZD B;  2KZR A;  3RNE C;  3KUZ A;  2V3P A;  3RMK C;  1IPG A;  1QLB B;  2RDG A;  1OEY J;  3N32 A;  3H7S A;  1C77 A;  3FYX A;  4AOF A;  1NEK B;  1XT9 B;  4M02 A;  3EMN X;  2ON8 A;  2KFJ A;  3HVD A;  4RCO A;  1PYW D;  2IY0 B;  3ZO5 B;  1WXQ A;  3N9Y C;  2KK8 A;  4O4U A;  1HZ5 A;  2D11 A;  4ANW A;  1GPX A;  4W9C A;  3UGB B;  4NQK E;  3DZM A;  2LMC A;  1TTN A;  3S2A A;  4AYI D;  1VZ7 A;  2MHJ A;  4XC2 A;  3KWV A;  1SGH A;  4EZL A;  3WI4 A;  3IAM 1;  3APF A;  1NDD A;  1K8R B;  3K19 A;  1WYG A;  1JRO A;  1UGM A;  3DA4 A;  4EEW A;  4XDD A;  4HPL B;  5DL7 A;  2BTE A;  1H4R A;  1T6B X;  5H2F O;  1FXI A;  1YIW A;  3DHH C;  4KGT A;  4REZ A;  4DXG A;  2KJ6 A;  5HI1 A;  1KH0 A;  2X27 X;  2I38 A;  2R4O A;  3PVL A;  3CSF A;  4UDU C;  1QKZ A;  2W82 A;  3PRP B;  4FRX A;  2LRW A;  2LJ5 A;  5MPO A;  1YOV B;  4IOI E;  4MAC A;  3L08 A;  4BKG A;  5AUK A;  3EA6 A;  1IGC A;  2V3N A;  2NCN A;  4YSX B;  2M4N A;  4HLE A;  3T24 A;  1UGJ A;  1KFY B;  1KLV A;  1JWU D;  4BAX A;  3RT3 B;  1MI0 A;  3X0W A;  2FBW B;  3TEZ A;  5JZE B;  5CX3 A;  2R8A A;  4DHZ B;  3QRC A;  2A4Z A;  1AYF A;  3UI3 A;  5ADX K;  4GU2 A;  2PEA A;  3QHT A;  3I9V 1;  4HPP A;  1MPE A;  2CU3 A;  3A1Q B;  4EFO A;  4HWI B;  3PO0 A;  2F1V A;  3L4P A;  3VH4 B;  2LGD A;  4KDI C;  3N1Y C;  5G5H A;  1ZHT A;  1I4Q A;  5EE1 A;  3NSG A;  1N61 A;  2DZI A;  2G9H D;  4GHB A;  1L6V A;  3HHM A;  2G45 B;  2WXK A;  3ZDT A;  1E7V A;  2WXJ A;  4ZRP A;  1EU3 A;  2XE2 A;  2AQ3 B;  4ZYS A;  2JMM A;  3AA6 A;  3ECI A;  2KT7 A;  1TJE A;  2QEJ C;  2KVR A;  5IYU A;  2GE4 A;  3JCU O;  2LD9 A;  5AZH A;  4ARI A;  2K9X A;  2WP9 B;  1PDX A;  2C60 A;  3ZQ4 A;  1YQ4 B;  1C76 A;  5DL8 A;  4HDQ A;  2A5U A;  4XZ4 A;  3PRZ A;  1UWM A;  2RSU A;  4ANV A;  1WI0 A;  1WMH A;  1E8Z A;  1GFM A;  3A2S X;  1OEY A;  3ZJV A;  1MHX A;  1WJN A;  3GE3 C;  2WDV B;  4L2Y A;  3P4P B;  1H8C A;  3EGR A;  1DOY A;  1M94 A;  1C4C A;  1P3Q U;  2WU5 B;  5L83 A;  4P1B C;  2IWV A;  3KUC B;  2LVO A;  1HE8 A;  2MLB A;  3TBL D;  3NY5 A;  3LYY A;  3SYB A;  4NAM A;  3JW0 X;  3SDL C;  2OOB B;  3EUB 2;  3BYT B;  1E10 A;  3NUH B;  3PLU A;  1ZXH A;  2XMX A;  5GTH O;  2Z0E B;  1KOT A;  1L4D B;  2Y3A A;  3GE8 C;  1E90 A;  4O1N A;  1YMH E;  3Q3J A;  1V1O A;  3AB5 A;  2R61 A;  4N58 A;  2W55 A;  2V0G A;  1WFY A;  3UQB A;  3V8U A;  2LWP A;  3JSV A;  2ZLD A;  1JW9 D;  4NNJ B;  4WAA A;  1VRA B;  4P6V F;  1GFO A;  1TYG B;  2WYQ A;  1UBQ A;  2OJW A;  4ZRK A;  4ICV A;  2XBB C;  2KAC A;  3VHT C;  1RAX A;  1GB1 A;  4AJY B;  4LLG M;  3FIL B;  4NY0 A;  2QC8 A;  1WXS A;  2KN4 A;  3AA7 A;  3OJ4 B;  5D3I B;  3CST A;  2PE6 B;  3N3K B;  4RF1 A;  3ZIM A;  2X9K A;  4FT6 A;  1MJD A;  1QIL A;  3B08 A;  3C19 A;  4CQN A;  4ANU A;  1WXM A;  3Q3M C;  4MGI E;  4XX5 A;  4MSQ B;  4HKQ A;  5EDS A;  5C23 A;  4LCD E;  3R3M A;  1ACC A;  2MW5 A;  1V1P B;  3FAH A;  2FGQ X;  2JUO A;  1SJH D;  2CS4 A;  4M00 A;  3DBL I;  3K9O B;  4CHK A;  3VE1 A;  1MHH E;  1R4M B;  3NJT A;  1PRN A;  2YEP B;  2LUE A;  1WZ0 A;  3DCG A;  2IBI B;  1V97 A;  4NPN A;  4NQL B;  1NYQ A;  2G4D B;  3MTN B;  1FPY A;  4K7W A;  1ZHZ A;  5D5D A;  3AA1 B;  3RNG C;  1N6Z A;  2WU2 B;  3IAS 1;  1AWD A;  5C3J B;  2WGS A;  1ZHW A;  2LVQ A;  3POU A;  4LSH A;  1YQ3 B;  2JRH A;  1EF1 A;  2R4P A;  3DVN U;  4K3C A;  1QOB A;  2V4I B;  3AE4 B;  2Y0K A;  3V6C B;  3ZNH B;  3ZKJ C;  1EU4 A;  2L83 A;  3JVZ X;  4KSK C;  1FFV A;  3MC9 A;  1XD3 B;  1P98 A;  4E71 A;  2JX5 A;  2GOW A;  2KJR A;  4PT5 A;  2R4N A;  2V4L A;  1YQB A;  1FRR A;  2K4T A;  5KAF O;  2KWC A;  3AEG B;  1QOG A;  3P63 A;  1YS5 A;  4C69 X;  3N1X C;  1KRH A;  1C9F A;  1TZO A;  4ZRI A;  4E74 A;  4HCP B;  2DZJ A;  2JPH A;  1OPF A;  2D3G A;  4OVU A;  2KMM A;  5TSS A;  3VRB B;  4FJY A;  2DWQ A;  3D32 A;  5EE2 A;  2L00 B;  2K0P A;  4ICU A;  4IG7 B;  3AH7 A;  3VUY A;  4ZRQ A;  3UAQ A;  4NJC A;  4OVZ A;  4GMV A;  2W81 C;  2K3U A;  1QJ8 A;  2O2V B;  2MRP A;  3RUI B;  3V61 A;  3AEF B;  5BMI A;  2B76 B;  2K22 A;  3GZN I;  3ABV B;  3DWM A;  4LNF A;  4XNL A;  2KO3 A;  3RNF C;  3HRD D;  3NS1 A;  1LO5 D;  2Q5W D;  2QTK A;  2FE8 A;  3RZF A;  2GB1 A;  1P9D U;  5E79 O;  2BVC A;  2KLC A;  3GB1 A;  2KC1 A;  4G0N B;  1B1Z A;  3POX A;  2MJD A;  1R7S A;  2NTT A;  2OMF A;  2HJ8 A;  3K9P B;  3SZV A;  2BT6 A;  3OWE B;  3A33 B;  3DBR B;  1CZP A;  2K8C A;  1DOI A;  2MSE D;  5B66 O;  3P4Q B;  2OHF A;  1M4V A;  1ORM A;  1D5M C;  5PRN A;  5E6J A;  4D2K A;  3AA0 A;  1JWA D;  2L32 A;  3HW9 A;  2H89 B;  2M56 B;  3AI5 A;  3HVZ A;  4IW0 A;  1V6E A;  1XEE A;  2CHW A;  3VY9 X;  4AWJ A;  3PGS A;  1T0R C;  2M07 A;  5D7G A;  3VTW A;  2FCS A;  2Y0H A;  4II2 B;  4GDL B;  1CJE A;  4E1T A;  4O3Z A;  2PLP A;  4ANX A;  3PV1 A;  3V62 A;  1HZ6 A;  4BZA A;  1EWY C;  4GCQ A;  3QK0 A;  2WXQ A;  3DBH B;  3ZXV A;  1WX8 A;  2GBK A;  2I1J A;  2YEP F;  4KIK B;  3SYS A;  4FA6 A;  1WM3 A;  2GBR A;  4MH8 A;  5AFU L;  1OQY A;  3TUO A;  3U7Z A;  4KR8 A;  1N5W A;  3QQ8 B;  2QSD A;  3H7P B;  2KTR B;  2NBW B;  3DBS A;  4BKS D;  2WLB A;  2FCM A;  3WIM A;  1E7P B;  1NYR A;  1LFD A;  2IO2 B;  4BKT A;  4XGA B;  1WGY A;  6PRN A;  4H2A A;  3AAA B;  1N62 A;  4P7I A;  3T0S A;  1IGD A;  2BS2 B;  2JZ3 B;  2XE1 A;  4M0W B;  1WY8 A;  4RH6 A;  1D6E C;  4LDT D;  1OFF A;  2KOX A;  2XTR A;  4Z3T A;  3IXS A;  1VZ6 A;  3SHQ A;  3ZRF A;  1ZHX A;  1QOA A;  4CYE A;  1E8Y A;  2AWT A;  2WQY B;  3T20 A;  3H7P A;  3RBH A;  3EFU A;  2K39 A;  2WXH A;  3V60 A;  2XE5 A;  2KDM A;  1Q0W B;  2MP2 A;  4RJX A;  2WXO A;  3DHI C;  3OLM D;  1RLF A;  4IM3 A;  1HTQ A;  3VY8 X;  3DWN A;  1RFK A;  1GG3 A;  2GMI C;  1WSP A;  4M0W A;  1G6J A;  3AU4 A;  2MEK A;  1T1L A;  1WJ6 A;  1FRD A;  2WJQ A;  2XK5 B;  4W9H A;  4AYN A;  2VZK D;  5H8Y E;  1GC6 A;  1CK1 A;  3U52 E;  1JQ4 A;  3VZT X;  2EMS A;  1PQS A;  3AXC A;  1KF6 B;  3AE3 B;  3DQV A;  2IGG A;  2WJR A;  4B95 A;  4C4V B;  4HXD A;  4S17 A;  1XQQ A;  4N6E B;  5D94 A;  2UWQ A;  2IO3 B;  4NAW B;  3BS0 A;  2EEL A;  1QQR A;  5IO9 A;  1GOZ A;  1EWC A;  4AKR B;  4KGR A;  4TQ1 A;  1UH6 A;  5G38 A;  1TS2 A;  4W9L A;  2CHZ A;  2FCN A;  3PZ8 A;  2O6V D;  4OZA A;  5JXV A;  2PW9 A;  3Q14 C;  3Q8F A;  3AE7 B;  1E0Z A;  1F1H A;  5HG2 A;  1TZ1 A;  1YNT E;  3AEE B;  1YX5 B;  1IZN B;  1VZ8 A;  4B6W A;  2WXM A;  1I35 A;  4YT0 B;  4I6P A;  3GP6 A;  2RMM A;  4AS1 A;  3TSS A;  1Z2M A;  4PR7 A;  2NBU A;  2JVC A;  2JQR B;  2K6D B;  3KYD D;  4EKU A;  3W1S C;  3ZYY X;  2BQQ A;  3Q8C A;  3MJ5 A;  1R4M I;  1TY2 A;  2KD0 A;  3BRZ A;  2IGH A;  1PFD A;  2M1M A;  3ALB A;  2L0F A;  5BMH A;  4A20 A;  2YNK A;  2BKR B;  2KMA A;  4FSO A;  2WXI A;  1F0Z A;  2R2O A;  4LNN A;  2L3Z A;  1TS4 A;  5FR3 A;  1QJ9 A;  2WDT B;  4HRO A;  1RYJ A;  2O4V A;  3LB8 C;  2AXT O;  2IJ0 A;  3DVN V;  3WAP A;  4U9C A;  4D5U A;  2XG6 A;  4RLC A;  4DK5 A;  1AAR A;  3PTF C;  4WJN A;  3J9C A;  4W9D A;  2HJ1 A;  1C4P A;  4GGQ A;  2QDF A;  2N7D A;  2JYT A;  3W2D A;  2KX0 A;  4R3D A;  2Y5P A;  5IP4 D;  2RD0 A;  1DYQ A;  1ENF A;  3B2G A;  1SIJ A;  4KGS A;  2CKH B;  4FSP A;  3E56 A;  4L23 A;  3IVF A;  4K3B A;  1ET6 A;  4FXC A;  4WJO A;  3UPG A;  1WGR A;  2W9N A;  2I2Y A;  1H6S 1;  2PIA A;  2KAN A;  4AQ7 A;  3BVG A;  1SE4 A;  1HEZ E;  2INP E;  4FUL A;  1Z5S B;  3Q8A A;  1TKE A;  2SAK A;  2MJE A;  5AFU K;  7PRN A;  3WAM A;  2MHL A;  4A3O A;  3NVZ A;  2LHE A;  2ASQ A;  1WYW B;  2N2L A;  3RNB C;  3EEC A;  3UIP B;  3LK3 B;  1QZE A;  3WAO A;  1JML A;  1WR6 E;  1MM4 A;  1WJ4 A;  2K8H A;  1F2R C;  4A90 A;  1YN3 A;  4G50 A;  4N9F 4;  3R66 C;  4O3X B;  2ICI A;  2LHD A;  2BGF A;  1TGZ B;  2EKE C;  4YXD B;  2LFU A;  4GCS A;  1DOX A;  1GUA B;  1IBX B;  2B3A A;  1WGH A;  3TIX A;  3MP9 A;  5LXH A;  3VTU A;  3M62 B;  1SXT A;  2ZFG A;  3LK3 A;  5J18 A;  4PYU A;  2YLM A;  1A5R A;  4YL8 A;  3A9J B;  3NHE B;  1Q5W B;  3DHG C;  2YVC A;  3LJ3 A;  2WXF A;  5T5F A;  2DYB A;  3OG5 A;  4RGN A;  2FUG 1;  4D64 A;  1LXD A;  2FNJ B;  2ZEQ A;  4E3C A;  1K52 A;  4WUR A;  3Q69 A;  2ERV A;  2FUH B;  1LGR A;  4GF4 A;  3AAE B;  3DBR I;  3A1Q A;  3SFE B;  3KWL A;  3LK4 2;  2WNM A;  2G3Q B;  3N20 C;  3MHS D;  1FMA D;  4PS8 A;  2ZJD A;  3Q2A C;  5G26 A;  1XLO A;  3BK2 A;  1P7F A;  2EMT A;  1FIQ A;  3U4E G;  3FKY A;  2QIE B;  3N1Z C;  1DGJ A;  1IP9 A;  4FJV B;  1C78 A;  3SD5 A;  3DVG Y;  3RD2 A;  3QJZ A;  2D3A A;  4A3P A;  5IA7 A;  1SE2 A;  1JRU A;  3R7Q A;  2KMC A;  3HOE A;  3HWB A;  2GBJ A;  3C5O A;  3DBH I;  5DPT A;  3POR A;  2V1Y A;  2ZPN A;  3ZGZ A;  2ZVN A;  4TUU A;  1P0R A;  1HXT A;  2DAJ A;  2PTL A;  3QA8 A;  3ZXR A;  2TSS A;  2MJ3 A;  1FCL A;  1ET9 A;  2JXT A;  2D07 B;  4W9J A;  3ZTC A;  4FUV A; 
#chains in the Genus database with same CATH homology
 2VH2 A;  4C00 A;  2VH1 A;  4QAY A;  4N75 A;  2QCZ A;  4N74 A;  3MC9 A;  4XGA B;  4K3B A;  2X8X X;  3MC8 A;  4PK1 A;  4C4V B;  3EFC A;  2QDF A;  4K3C A;  2V9H A;  3Q6B A;  3NJT A;  4C4V A;  4BZA A;  2MHJ A;  3OG5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...