4C4YA

Crystal structure of human bifunctional epoxide hydroxylase 2 complexed with a4
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
314
structure length
314
Chain Sequence
PSDMSHGYVTVKPRVRLHFVELGSGPAVCLCHGFPESWYSWRYQIPALAQAGYRVLAMDMKGYGESSAPPEIEEYCMEVLCKEMVTFLDKLGLSQAVFIGHDWGGMLVWYMALFYPERVRAVASLNTPFIPANPNMSPLESIKANPVFDYQLYFQEPGVAEAELEQNLSRTFKSLFRASDESVLSMHKVCEAGGLFVNSPEEPSLSRMVTEEEIQFYVQQFKKSGFRGPLNWYRNMERNWKWACKSLGRKILIPALMVTAEKDFVLVPQMSQHMEDWIPHLKRGHIEDCGHWTQMDKPTEVNQILIKWLDSDAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A Combination of Spin Diffusion Methods for the Determination of Protein-Ligand Complex Structural Ensembles.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords BIFUNCTIONAL EPOXIDE HYDROLASE 2
total genus 93
structure length 314
sequence length 314
ec nomenclature ec 3.1.3.76: Lipid-phosphate phosphatase.
pdb deposition date 2013-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4c4yA00
2XT0A 3WL5A 4DMKA 4W1RA 1LBTA 4C87A 4ZRDA 2HDWA 3VKFA 4WFIA 4Y2RA 1UOPA 5CT6A 4UPDA 1UOQA 1R50A 4IO0A 2ZYSA 3QPDA 3HSSA 3STVA 1UK9A 1NX9A 2Z3ZA 3FBWA 1JFRA 5DJ5A 5DYYA 5IKXA 2HA0A 2WHRA 1GGVA 3IUQA 1QTRA 3I2KA 3FAKA 1YAJA 4RNCA 4LHEA 6YASA 2XLCA 4QDXA 2JGIA 1BN7A 5E4YA 4ITVA 2R8BA 2QUAA 3QITA 3VISA 4N8SA 1YASA 1VE6A 4G9GA 5AM5A 3SX4A 1GPLA 3W9UA 5ALVA 5CT8A 2X5XA 1W6RA 1UT6A 3G0DA 5LKRA 4YK7A 3DKRA 4BAUA 2VA9A 1YB7A 4FLMA 4LXIA 2WFMA 3RKSA 4AN0A 1QGED 2C7BA 2CKMA 3VDXA 4A16A 2FJ0A 4MEAA 3AFIA 4KRYA 3PFCA 1XQWA 3G9TA 4FLEA 3M3DA 2XUDA 4L3WA 4OB8A 5AICA 1YS1X 3R0VA 3WI7A 4UHCA 4M0FA 1QO9A 2YH2A 2DR0A 4CFSA 1XZMA 4H7EA 4DLNA 1XRMA 1LNSA 1XKTA 1MNQA 1W4LA 1HKHA 2K2QB 3GELA 4I19A 3PUIA 3H04A 1ZJ4A 4B7ZA 5EGNA 2Z8ZA 1NU6A 2GZRA 5FLKA 2JGFA 4JUIA 4HRXA 4KRXA 5K3EA 3IIIA 4B84A 1HLGA 3O4GA 1J07A 4AZ0A 3HABA 2HL6A 5KWJA 1HQDA 4GLBA 3G02A 5FOQA 1ISPA 2JGKA 3BF8A 4N5HX 4AMYA 1N5MA 2Y6VA 1G5FA 2WSLA 3W2TA 4CCYB 2WG2A 2XUOA 4C89A 5DTIA 4OYLA 3UMJA 4LXGA 4QDTA 4S0XA 5HKAA 2AXEA 4OYYA 4P92A 4UHFA 3AIMA 1U4NA 3CCBA 3E1GA 3AZOA 4DSZA 4KE8A 1KU6A 5CRIA 1OCEA 4RGYA 4QDUA 1RYYA 3N2ZB 3HRHA 2ZVDA 2O2HA 3HZOA 1FFDA 3I6MA 4RE6A 2ZJ7A 4MYSA 2WHPB 4X00A 1XFDA 1CUIA 2BUAA 3GA7A 4OB7A 5IH7A 1UZAA 4FBLA 4BE4A 4BRSA 2I3ZA 1XZLA 2WFLA 4DNOA 1DINA 3A2NA 2XDWA 3WK5A 3F98A 4Q34A 1GQSA 1LPNA 4BCBA 3BF7A 1YB6A 1XZDA 3FCYA 4KE9A 4U2EA 1L7QA 4UBLA 1FFCA 3M82A 2PM8A 1R9NA 5D6OA 1T2NA 2H7CA 5JADA 3I6ZA 4C4XA 1CVLA 2XMRA 5E4JA 1J06A 3W04A 4MYDA 1QIMA 5SYNA 1QIIA 4FDMA 4MWTA 1ZI6A 1PV1A 2HM7A 3U1TA 1EX9A 3C6ZA 5AI9A 3ANSA 1LPBB 4UFOA 4BVJA 2PU5A 1AGYA 4U2DA 2RHWA 2E3JA 4Q3OA 4P08A 4FLFA 3DEAA 1CUCA 1E66A 3IUJA 3Q0TA 2Y6UA 4AXBA 4PQEA 3WKAA 3HXKA 4UBOA 4KEAA 3HLKA 4K6HA 4C6HA 5A7HA 2QKYA 1XRRA 3DDUA 5D7BA 4HXFB 3S2ZA 3IULA 5JYCA 3LS2A 1ZGCA 4GDMA 5ALUA 2XQFA 3VVMA 1CQZA 3DJYA 3WWCA 5E4TA 3ZV7A 4Y2TA 1H2WA 5K5EA 3AZQA 3KWFA 2C5FA 2PUHA 4CCYA 1Q83A 3VJKA 1WPXA 4X6XA 5AI4A 1TCCA 5CH3A 2AJDA 4OUKX 4J0IA 1ODTC 3I2JA 1AZWA 3STUA 4HXEB 4YX9A 1UKCA 1Q0ZA 4AX4A 2WU3A 2PSJA 3VJMA 2GBCA 4NMWA 5ESRA 5HFNA 1NU8A 2QUBA 1O6FA 4E11A 4UHEA 5JZSA 3F8SA 2WG0A 2PSEA 4UHDA 4FWBA 1TK3A 5K3AA 3T4UA 4UBMA 4JYPA 2JIDA 1K63A 5FXMA 1E3QA 2X76A 2HA5A 4Q3KA 2Z8XA 1AURA 2HIHA 2HFKA 1C4XA 2XUQA 2ES4A 3STYA 4Y2JA 4AQDA 2JGJA 3ILSA 3DNMA 5YASA 3FOBA 3FVRA 4GXNA 4KAJA 1GZ7A 1XZFA 4DGQA 3V9AA 2J4CA 5D3ZA 3S8YA 3YASA 4X71A 2QJRA 1EK2A 4H18A 1XZBA 4U2CA 5JAPA 4MQMA 4ARAA 1XZHA 1BRTA 4BZZA 3QZUA 1LBSA 5AKZA 5ALLA 3BE8A 3I2FA 3OM8A 2WJ4A 2WJ6A 5AK3A 3HI4A 3WWEA 3DOHA 5AOAA 2BKLA 4FMPA 1QIDA 1UOOA 4IHAA 4X93A 3OPMA 3C5VA 1XLVA 3EF3A 1QO7A 2IIVA 4NZZA 4WFKA 4X92A 3RK4A 2C0PA 4FFVA 4Q1VA 2Y2UA 3P2MA 1JJBA 1CRLA 5A7GA 4B0PA 5T4HA 5AHXA 2WUDA 2XMQA 3X3HA 1RP1A 2XUPA 3C8DA 5EHNA 3ZPXA 3Q8WA 2Y2VA 4Y2VA 4IH1A 4OD0A 1JMYA 2WTNA 4BTLA 4DM7A 4BVLA 3FYUC 4BDTA 1USWA 4G8DA 3PDCA 1BE0A 1ODSA 2OQIA 3H2IA 3E3AA 5JAOA 3B5EA 2AJLI 5CURA 5ALPA 3GFFA 2QXTA 4C01A 3UUEA 3DS8A 1QLWA 3CCCA 3G9UA 4O08A 5A7FA 3WJ1A 4GW3A 4IQ4A 1QOZA 2IX9A 1MJ5A 4FBMA 4OB6A 4HS9A 5A71A 1EB8A 2FJPA 1ACLA 3BIWA 2QRUA 5JAUA 5J3JA 4XWGA 3PE6A 1C7IA 3M81A 2B61A 2QR5A 3EIOA 4JNCA 1EA5A 3WKDA 5EIAA 5AK6A 4G4GA 3FVTA 5KWIA 3IVMA 1WPRA 1IZ7A 3ANTA 3SC2A 3D7RA 1DT5A 4ZI5A 3L1HA 3H18A 1AX9A 3NGMA 1UKAA 1WB5A 4QLOA 3F96A 1DWOA 1P0QA 2XUGA 2XMCA 4JEIA 1MTZA 5JZ9A 3C45A 5C7YA 1E8DA 2GZSA 2GYUA 3M83A 1EH5A 5ALGA 3G0GA 3QPCA 4DNQA 5CXXA 3LCRA 1LPPA 2B4KA 2ORYA 2O2IA 3QH4A 4H0CA 1CLEA 5LZ5A 5LLSA 2HA4A 3JW8A 2O7VA 4KR0A 2WFLB 5DWDA 1QZ3A 2WTMA 2ZYIA 1ZJ5A 4QLAA 3B12A 2G5PA 4DMCA 1P0PA 3ESAA 5K3DA 3WWPA 4TGLA 1I6WA 4BP9A 2HU5A 2H7YA 2XUHA 3IUMA 1FSSA 3O4JA 4KE6A 5ALYA 3G9ZA 4E14A 5CBKA 3QMWA 1VXOA 1QIFA 4RPCA 4X6YA 1D07A 1AC5A 4BDSA 1OILA 3R3YA 3DL7A 5AOBA 3UUFA 5ALTA 1L7RA 3A70A 4G5XA 4N8DA 5F4ZA 5ALDA 2OCIA 5ALOA 1Y7IA 1EHYA 2GYVA 4INZA 5BV7A 1CUBA 1K6EA 4BC1A 5IVIA 1QFMA 4CCWA 1UK8A 2I78A 1DX6A 4W1SA 2PSFA 3WL8A 4B82A 1BEEA 1R3DA 2H9YA 5E2IA 4XVCA 5AK4A 1C7JA 4EY5A 5KBYA 1LZKA 2YYSA 1IZ8A 3KD2A 1VKHA 4Y7DA 5HZGA 3WYDA 4F5ZA 4I3FA 5AM4A 1GT6A 3MUOA 2PKYX 5ALNA 3V1NA 3IBTA 4UHHA 1LGYA 1Y7HA 3HYSA 4FKBA 2HU7A 5LKAA 4J0CA 5AIAA 1H2ZA 3ESBA 2DQYA 2VT6A 1G66A 5ALQA 1QIGA 2CMFA 1UXOA 1TCAA 4DMFA 3O4HA 2OAGA 4B83A 3WKEA 2B9VA 4F21A 2OGSA 3D5EA 2OCGA 5FUMA 5FPPA 1CUEA 4UBJA 4UBKA 4PW0A 1TKRA 2OXEA 1TAHA 5IVHA 5H3HA 1MAAA 3C43A 3FYUA 4MJ3A 1DT3A 3D2CA 4Y2QA 2PX6A 4EBBA 3F9CA 4RE5A 3QVMA 1BCRA 4PSCA 7YASA 1TIBA 1MT3A 3R41A 4AO8A 3D0KA 4KAFA 4KE7A 2J3DA 1XRNA 2WILA 3BJRA 1VA4A 5DNWA 3FLBA 4K6GA 2QXUA 1CUAA 2EEPA 1QIEA 3A2MA 3FLEA 3C5WP 4ROTA 5I8PA 2DHCA 5A2GA 3C8HA 5K3FB 3VXKA 4B81A 1JKMA 3AIKA 3G9XA 3ZLTA 1QIJA 1QONA 3DCNA 3JWEA 2LIPA 1Y37A 1XRLA 3D2AA 3GUUA 3K2IA 4EZIA 3A6ZA 4XX1A 5IVKA 4B80A 2DHDA 2Q0XA 1O6GA 5DTJA 3KOOA 5SYMA 2CEKA 2P8SA 1ZIXA 4GI1A 2HA7A 3BDVA 2ZYRA 5K3CA 3C6XA 2Y1KA 2XQKA 4XIIA 2RIPA 2BJHA 4WDRA 2BGRA 4OU4A 1XRQA 1BROA 3AIOA 1ORWA 5AJHA 1CUUA 4DTCA 4HXGA 4DIUA 3KWJA 3AILA 5JATA 3ED1A 1J1IA 4Y2SA 1H2YA 2HRQA 2XMZA 4BAGA 1P0IA 3DYVA 4K2AA 1KEZA 3WMRA 3DKKA 4V2IA 3AJAA 5T4FA 1JT2A 3H2JA 5AP9A 1T4MA 2BGNA 3VVLA 4N8EA 4GBGA 3I6YA 3FLAA 1AUOA 4QDOA 5AKHA 4AMZA 3QYJA 1WHSA 4BRZA 1A8SA 4PF1A 1CPYA 5EI5A 3WIBA 1ZOIA 4LYDA 1MNAA 4W1PA 4EUSA 1FFEA 1Q0RA 2OQVA 4HTAA 3C70A 5C81A 4X7BA 3FCXA 4TVKA 4BYMA 1HL7A 3LLCA 2XQGA 2QVBA 2Z5GA 1XQYA 4OPMA 5JANA 2D0DA 4H7HA 2RHTA 5DYWA 4PNZA 5EIHA 5LZ2A 3NWOA 1H23A 1N1MA 1G4HA 2GBIA 2W6CX 2RI6A 4UHBA 3H1BA 2B20A 1YR2A 1OXMA 4JYMA 4X90A 3HC7A 1LPMA 4QWWA 1XRPA 3TJMA 2OPHA 2GBFA 3FSGD 1EK1A 5ALJA 2WUGA 4NS4A 4HRYA 4B9AA 2WM2A 3PI6A 4L72A 1CIJA 1SOMA 2QMQA 1XZKA 2VAXA 1ACJA 3EQ9A 1JJFA 1SCQA 4ETWA 2WLSA 1MX1A 1U65A 2WFZA 2G4LA 2QM0A 2XUIA 4J03A 1AKNA 2DCMA 1F0NA 3D59A 4FNGA 2WKWA 1A7UA 1W76A 1ZD4A 3R3VA 1YA4A 1LPAB 4P9NA 2G63A 4B9EA 4H7KA 3D4LA 1H22A 5ALKA 4E15A 3SK0A 3BJMA 2EDCA 4CG3A 3PUHA 2QS9A 5HQ3B 3R3UA 4WCVA 5C8VA 2JEYA 4TPKA 1N5RA 4WJLA 4FNMA 1X2EA 4Y2YA 2XQIA 2RONA 2O2GA 2ECFA 3C6BA 3OURA 4LKOA 4W1QA 4BP8A 4GECA 1YA8A 1QIHA 2VQ6A 4G9EA 4J7AA 5HFAA 4U2BA 2XUFA 2DSNA 3R3XA 3HACA 2BUBA 5AKYA 4Z49A 4X95A 2JEZA 1CUFA 2J3QA 2JGMA 5LZ8A 3WWDA 1CQWA 4MEBA 1DU4A 3T52A 3WK8A 4PV7A 1XZEA 1MN6A 4J0KA 3LIPA 1A88A 1CUJA 1FJ2A 1K5PA 1E5TA 2BUCA 3OOSA 1XLUA 3WKBA 2O7RA 5ALEA 2HA6A 1E8MA 4DMHA 2Z3WA 3GBSA 3N0TA 1VA5A 1DTEA 2JGLA 3WQHA 4CI9A 1CUSA 1RWQA 5AKXA 4P93A 3DOIA 2OCLA 5FRDA 5HKBA 4L0CA 4D9JA 1HDEA 3STXA 2WHQA 1VJ5A 4KJXA 4W63A 1CUXA 2C4HA 1WM1A 2WJ3A 4J0JA 3D2BA 4Q82A 3U0VA 4BCDA 2JF0A 2IITA 2VT7A 2BCEA 3R3ZA 2HA3A 2HU8A 3H2GA 3BWXA 1EXWA 1ZD5A 4I4CA 4AO7A 5FPQA 1CFJA 1CEXA 1W52X 1X2BA 2UZ0A 2JGEA 3ZI7A 2OG1A 3IUNA 1WHTA 1XZAA 5CT5A 5AM2A 5EHXA 3G0IA 1B41A 1DQZA 3D3NA 5FKJA 4BBZA 4X6UA 3QPAA 1K4YA 4KYVA 4LIPD 2OCKA 5D3KA 4H7FA 3I2IA 5DLPA 2V9ZA 3DLTA 5JD5A 3WLAA 2WUEA 4BTVA 2OGTA 1FFAA 1YS2X 1S8OA 5IVDA 2PU7A 1GXSA 5BWCA 2PVSA 4CG2A 3TRDA 4F0JA 3H17A 3KDAA 1ODCA 2PBLA 4ZGBA 3F67A 3AZPA 5EHZA 4AO6A 5LZ9A 1LPOA 2J4FA 3O9MA 1QJ4A 4EB0A 2BFNA 4HVTA 1F8UA 4ZREA 4CIAA 4L9AA 5ALWA 2DQZA 2XUJA 1BEZA 1MAHA 1TCBA 3CN9A 4FOLA 3MGAA 2C58A 1P0MA 2AJBA 1TRHA 5AKLA 2GYWA 3EQ7A 2HADA 4WY8A 3V1KA 1XZGA 1KU0A 1XQXA 3EQ8A 5LZ4A 3O9VA 4X85A 2WHPA 4ZWNA 1MX5A 1GKKA 5EIEA 2VTVA 1W1IA 3A2LA 5AKIA 1CUVA 5JASA 3RM3A 4WDQA 3E4DA 3GZJA 4BVKA 2XUKA 3OC0A 3NUZA 5AOCA 4BC0A 3L1IA 2HHAA 3DQZA 2OLEA 3TGLA 4JH0A 2V96A 2ZSHA 2WIDA 2ZJFA 1VZ2A 3H2KA 4H35A 5ALSA 2WQZA 4FTWA 4DYHA 3L1JA 3KSRA 3LP5A 3WL6A 1SCKA 5DNUA 1JU3A 3RARA 5KREA 1CUWA 4GWLA 3FWHA 3QMVA 2ACEA 3K9BA 4UFNA 1W75A 1IMJA 3STWA 5HQ3A 4ZXFA 3I2HA 1K8QA 5I7UA 5AKJA 2VATA 5ALFA 4QZVA 1WCYA 2ZYHA 4XJVA 1MO2A 4J3JA 1ZI8A 2WIKA 3WK6A 3AUKA 4KAAA 5HK8A 3PICA 2HFJA 4UUQA 3R3WA 4G4IA 5AO9A 4X3CA 1PJAA 4M0EA 4C4ZA 2HRRA 3IB3A 4BCCA 3W06A 2YXPX 3WIOA 3E0XA 1IUPA 1YAHA 2ROQA 2ACKA 4UBNA 2WG1A 4QWMA 1SFRA 1H2XA 2G5TA 1VLQA 3HEAA 1EB9A 5I9IA 2HA2A 1CUGA 4BAZA 1WOMA 5CT9A 1EDDA 1R4ZA 1WB6A 3FYUB 4QNNA 4G4JA 4EY8A 5AI6A 4G8BA 5C8ZA 2GBGA 4CG1A 1EI9A 2VJDA 1IUOA 5ALRA 5HCUA 3PF8A 2AJCA 5AIBA 1THGA 1TQHA 4OU5A 5AI5A 1UKBA 3DYIA 3ICVA 2VSQA 3BDIA 3BIXA 4K6KA 5BWBA 4DNFA 4MWSA 2XUAA 3GROA 3V1MA 2WUFA 4H7JA 4FHZA 2XB6A 5T4EA 4DSAA 4DNPA 3LIIA 3V1LA 2ZJ6A 4GHWA 2VF2A 3FNBA 3OTQA 5CH8A 4X97A 2OGZA 2D5LA 2NW6A 2I03A 3B3QA 1EINA 5CXUA 3WK7A 4Y2XA 3IURA 2PSDA 3FYTA 2CJPA 1M33A 3SWWA 1R1DA 4OCZA 1JI3A 4Q3LA 1LPSA 5AKKA 3F97A 5HF6A 4Y9SA 2I3DA 1ETHA 5T4BA 4C4YA 3AINA 1GKLA 1F0PA 2QT9A 1XKLA 2C5GA 2CUTA 2FUKA 2YASA 5JIBA 1MU0A 2VJAA 2QTBA 3MVEA 5LYYA 5CT4A 3JYHA 4M0MA 3I2GA 3G0CA 1CR6A 1ZD3A 1IVYA 1E8NA 4BB0A 4IH9A 4YASA 1G42A 3QBJA 1VZ3A 2PUJA 4J0GA 4ZV9A 4LYEA 4G8CA 4B0OA 2PPLA 1XQVA 3IA2A 5FDFA 4IH4A 2WIFA 5JD6A 3WA6A 3PF9A 4B85A 1XZIA 4MXDA 3O0DA 4OSEA 4X91A 1DWPA 2X8BA 1BS9A 3G0BA 3C87A 5EFZA 2R11A 1JJIA 5ALIA 1XLWA 4Y2UA 4J0DA 1J2EA 3OG9A 5K3BA 2QOEA 3I28A 4GEGA 2XMBA 1N8SA 1R9MA 4NVRA 4WY5A 4PO3X 5HK9A 2V97A 5ALHA 4HZGA 1DX4A 1BU8A 2AJ8A 3WJ2A 1IUNA 1DQYA 4EY6A 5ISMA 2H7XA 1VOTA 4EY4A 1UFOA 3ZLVA 4QE3A 3QM1A 1F6WA 4QEKA 2VJBA 2V98A 1MX9A 4AB1A 4HAIA 3H19A 3H2HA 1FFBA 4BATA 1AQLA 5AM1A 4QDZA 4CIBA 1YSCA 3K6KA 4BE9A 1ORVA 1THTA 2RGUA 2XI4A 5CTAA 1R88A 1E89A 2EDAA 5DNVA 1ZGBA 5A6VA 5AM3A 2VEOA 4N5IX 4G1FA 3ICWA 2RAUA 4ARBA 5CH5A 4C88A 1QE3A 2C0QA 1XZJA 3I1YA 3O95A 1CUDA 3ESCA 3FSGA 4WFJA 2H1IA 2XMDA 1UK7A 5JZBA 3CXUA 3HJUA 3WL7A 2W22A 3WYNA 3PFBA 3W05A 5FV4A 4ZV7A 4U2FA 3WK4A 1Q84A 5CW2A 2XMGA 1GQRA 4QA9A 5AKGA 5ALZA 3WZMA 4FFWA 3BXPA 4UBIA 4YPVA 2JBWA 3VJLA 3WK9A 1GPKA 4EA6A 3V48A 1JMKC 1U8EA 5BOVA 1Z68A 3TEJA 4AZ3A 2WIJA 4H77A 1BN6A 1UWCA 2ZSIA 2XQJA 4EHBA 1B6GA 1EVQA 5K3FA 1XROA 4PSDA 4AN1A 4F60A 1LLFA 1QTIA 1ZD2P 3BL8A 1ZICA 3STTA 1X70A 4W9RA 5AM0A 2CZQA 4U2GA 1SC9A 5JARA 4H7DA 3O4IA 4LXHA 3WWOA 3RLIA 3H1AA 4Y2PA 5CMLA 2FX5A 1AMNA 3EBLA 2CBGA 3NOXA 1HPLA 1ZI9A 1MPXA 5AI0A 5A62A 2XLBA 3R40A 2QJWA 5LIPA 4A5SA 1CV2A 4B6GA 4J0HA 2PL5A 1CUYA 4K5QA 5ALXA 1U2EA 1GPNA 3DD5A 4EY7A 1L7AA 2DFPA 5HF9A 1JU4A 2DHEA 5JAHA 4Q05A 1WB4A 1HBJA 2PSHA 3IDAA 5ALMA 1VXRA 3WZLA 1EVEA 2ONCA 1DWQA 3ZWQA 5FP0A 5DYTA 1CUZA 1QIKA 3G8YA 2OAEA 5HF5A 4UFPA 3C6YA 2VAVA 5EHQA 3MUNA 3W9BA 4X94A 2CB9A 5JD4A 5AK5A 3G7NA 2XE4A 3WKCA 1LZLA 1SCIA 5AI8A 1EDBA 5AH0A 3ESDA 3KXPA 3I1IA 1A8QA 1A8UA 3QMMA 2QZPA 2WU4A 2VJCA 1BCSA 2XMSA 5LZ7A 1CUHA 5HF8A 5LP1A 1EDEA 4MQLA 1UK6A 1PFQA 4H7IA 1XZCA 2BAGA 3H0CA 4BZWA 1YCDA 1QFSA 4E46A 4PSUA 5C8XA 5AKEA 3WA7A 2WIGA 5JALA 3CN7A 1VE7A 1ZIYA 3ZLUA 4A23A 3DL4A 4KACA
chains in the Genus database with same CATH superfamily
2P6UA 1NJFA 3R9KA 4YJ2B 3EXG2 4DMKA 3KIPA 3ZGOA 4EUKA 4RTLA 4W1RA 4WESA 1FVXA 1RYMA 1ZNYA 4WBSA 4LX8A 4Z86A 4PNEA 4LBYA 4OHVA 4Y2RA 1WVIA 1K6XA 4H27A 3DBRB 2JLYA 1B8OA 4UPDA 5K6AA 4YAGA 1EZZA 1R50A 3NASA 3TZHA 2M9MA 4IO0A 4MUIA 2ZYSA 3M6UA 3MAJA 4IDFA 4ZCTA 1ZJZA 3EEQA 4JJIA 1CERA 1SPBS 4CEHA 3OJ0A 1JFRA 2OLJA 2W6MA 2ZAOA 3AQIA 5L4LA 2A0UA 4BNHA 4DCMA 1MTOA 4WLOA 4Z9FA 2JVJA 2C8JA 3ND9A 2PJUA 4JQZA 5LQMA 3G7UA 1O03A 4MW6A 4U8HA 5IN5A 5IKXA 3IUQA 4CLXA 1QTRA 1VG0B 3I2KA 1QV7A 1MO5A 3F1LA 2RJOA 4QPPA 4NESA 4TZ0A 2AN3A 1DGQA 3UAZA 1W19A 4O3FA 5KYYB 4FM9A 1UDBA 4Y6LA 4D98A 4WNYA 5KDLA 1LJLA 4ZEVA 5ADHA 4LHEA 2X7HA 5FOTA 2XLCA 4P8RA 4G0VA 4FP9A 2JGIA 1GV1A 1BN7A 2P35A 1A9RA 4OHRA 4OV6B 4K88A 1T9GS 4QT4A 2H31A 2FI1A 2ZUUA 3JYPA 3QITA 5LYJB 3VISA 2GERA 4IZ6A 4FCWA 2IK8A 3O8QA 3PQ2A 1YASA 1ECBA 2IZZA 2BGMA 3AHJA 3OJCA 4GVPA 4KQEA 5EP2A 3T5DA 2QVYX 2Z3VA 1YHYA 4EI8A 2GM4A 1CY6A 5AM5A 4IIGA 3SX4A 3W9UA 1IJFA 1I7DA 1FS4A 4DBLC 2DEUA 2IWRA 1LRLA 1W6RA 4IIJB 4I81A 4JJ8A 3VR2A 5LKRA 3DKRA 3DVQX 3EFBA 4MWGA 1MHPA 4PTZA 4NV1A 4FLMA 1MFPA 3ROXA 3HJTA 3E9ZA 4HMQA 4XE5A 2QM8A 3WL4A 4DREA 3GJXC 1VCIA 1HQCA 4CM8A 2JFXA 2WTXA 5C1DA 3BAZA 3RHSA 1VM6A 1Z13A 4DEXA 1RLJA 1YDGA 1QGED 3ZGZA 1PVDA 1L4HA 4RK7A 1Z36A 4E5UA 1JEYA 4AC9A 1HORA 2A1TS 1DEHA 5A9SA 4INPA 1SHUX 3N3AC 5LPNA 2J6BA 1EPUA 1E1CB 4F9GA 4KRYA 1WUKS 1XQWA 5BSVA 1A95A 1G60A 2A6PA 3AVPA 1M72A 1Q14A 3G9TA 3QBTA 5BNIA 1CQPA 2VHEA 1IHDA 1W5TA 4EYOA 2H07A 1QYDA 3EH1A 3RRXA 3B1FA 3M3DA 3REOA 4WKGA 1JTFA 4QFMA 1AA9A 3KKNA 4MR9B 4EY3A 1Y8ZA 4E5MA 1QV9A 4EHKA 3R0VA 1V95A 1MZPA 5LBIA 4XDGA 4ROSA 4R84A 1VDMA 2VUIB 2AUNA 4G41A 1VPDA 1ZHFA 2JI4A 4YP7A 3S6JA 3VI3B 4DWWA 2A9RA 3BA6A 3PL5A 2UZ4A 3A04A 4DV1B 1LNSA 4FB4A 1U6JA 3TTYA 1SZCA 2V5AA 3CEAA 3D7SA 2D1QA 4OJYA 1KTIA 2BLLA 4KYUA 4JZKA 5JCJD 2WWWA 2ZCVA 5T6MA 7MHTA 3AOEA 2NZ2A 3LQQA 5IJAA 3H04A 1ZJ4A 3RSLA 3NLLA 2AEFA 1T36B 1J2UA 3K16A 3CR8A 3GJYA 5IJXA 1OX4B 1E3SA 2FA9A 4C7MA 2FG6C 2MSEB 1MT0A 4K9OA 3OPNA 2P2CA 3L43A 3K53A 5IBCA 2OTCA 2VF5X 1QG6A 2P9EA 2NU7B 3PDJA 3ZTWA 1NJ8A 4MLZA 3KPYA 3HR7A 2ODNA 1KEEA 2QN2A 3FOWA 1PRYA 1GL9B 2X3YA 4BX0A 2E18A 1LVUA 3KKEA 2AOUB 1X87A 4UJ3A 3L9WA 1QE5A 5KEIA 1FNNA 2Q3DA 3U4DA 4GNKA 1DIAA 2NGRA 1B0AA 2J5RA 1N5MA 3KPJA 4GDFA 2QTVB 1RWVA 4M83A 2HSJA 4KSCA 3KX2A 3NH6A 3DKPA 3T5MA 1QQBA 2J3HA 1AIPA 4IIYA 3H5WA 4Z9AA 5I5EA 3O1JC 3CZ9A 1CJMA 1HT3A 4L0DA 3K4QA 5DTIA 1GADO 1SQGA 3F6BX 1WMFA 1JAHA 1G4UR 4JU8A 4QU9A 1Y9ZA 5GZ6A 2J5XA 4MLCA 2A88A 2NXNA 1E0SA 1E7YA 3GP5A 3B5JA 3LBYA 3EPRA 4TRJA 4V39A 3KSDO 1T34A 3JQCA 4GWGA 3NUQA 2YZGA 1N9GA 1G7SA 4RGQA 2WSSD 2HF8A 4YONB 1UWVA 4CTKA 3RKRA 1TU3A 1U3VA 1P7WA 2CFTA 2X13A 4RGYA 1AHHA 3NXSA 1ZGAA 2WJZB 3UMBA 2XAAA 4QVIA 4GXTA 1L7EA 1JXAA 3JWJA 1KE2A 3PGXA 3VPHA 1SMKA 4BQPA 2HV8A 2NNWB 3D0OA 1ZVJA 2MWMA 1KAOA 4B3CA 2Z9CA 3R20A 1R0CA 1L9XA 4P3KA 4Y67A 1L7MA 4D3SA 2G8LA 2WHPB 3EGDA 2IZ7A 1E2GA 4GYKA 3F6CA 1NNLA 2OV8A 3D4BA 2QR2A 4NJEB 2HK6A 2IYUA 1DJQA 2LDBA 3GA7A 4G6ZA 4Y1EA 4D56A 2P1RA 5T3UA 3RS8A 4S1VA 3NIDB 1UZAA 5DSZA 4BE4A 2VNHA 2W2LA 2FQ1A 4KOEC 3ULKA 1WSAA 4OI1A 2JBAB 3ELWA 3UUWA 2R2AA 2O8EB 3LW7A 3QNUA 4JBLA 1UBHS 1I30A 1I4TD 4EF4A 1C3EA 1BFKA 4ZYYA 4HDMB 4A0HA 4QPNA 3R0JA 3BE6A 1SVWA 1PJCA 2GHTA 1JPJA 4IS3A 1MOZA 1GQSA 1LPNA 3B1JA 4BCBA 4RQBA 3D3EA 4KE9A 4YB8A 2TYSB 1V8DA 4ZVTA 4U2EA 1L7QA 5E6RB 1FFCA 3B52X 1VYVA 1VLLA 2JLQA 3M82A 1FTQA 1R9NA 4KNVA 2FR0A 3IILA 5D6OA 1G19A 2NU6A 3JAWA 5JADA 1FMTA 5A5DA 3V3TA 4LHVA 1D5WA 4ND8B 2R7NA 1YS9A 1CDOA 3ZGVA 1HYEA 3K9NA 3PHJA 3ZCRA 3QVOA 2D3TA 1C9DB 4FX5A 1A7KA 2XMRA 3DZBA 3MTDA 5ICEA 1QHEA 4EJSB 3IJPA 4NARA 4DDVA 2VQSA 4A82A 4OKIA 3GNLA 1NOIA 4B6JA 1LQUA 2P2NA 1GNSA 1PBTA 1B26A 4ZZ2A 3AUFA 2FLVA 2WPNA 1TM3E 1AQNA 1W88A 2CD7A 1IJKA 2HJ9A 5IM4A 1H8ED 4C7BA 1SCAA 4V0SA 3GJZA 3U44B 1R9JA 1SCUA 3JQAA 2GPWA 2P78A 2FR1A 3VO9A 4B48A 1TO1E 3D4PA 5AI9A 3U1TA 2CNKA 4DIMA 3ANSA 4H59A 4QXOA 4BP3A 4UFOA 2PUCA 2CF5A 3D6AA 5LJLA 4NNJA 1AGYA 3TF5A 4DF3A 4J9UE 3UB2A 4H3SA 4AF8A 3ELUA 5EWMA 2YWBA 4B5KA 4U2DA 1WLSA 3VR4H 2IYZA 3WQQA 1ZLYA 4TM7A 5D5PA 5DW0A 4P58A 4F86A 4COKA 5CX1B 4YP9A 2VP5A 3NHPA 4UEKA 4BKRA 1CUCA 1YU9A 3IUJA 3OQIB 1Z22A 3HCCA 2XBUA 4X1YB 3GMTA 2R7AA 3Q0TA 5DGCA 3WYFA 4ICIA 4AI6A 4AXBA 2BMEA 4Y1FA 1UBMS 4V0NA 4FMBB 1DCTA 5BRAA 1FLVA 2OZEA 3HLKA 4HVLA 2LD4A 3HGTA 2H3HA 5TGZA 3TW8A 4BMYA 4E32A 5BR1A 3GRRA 4WV3A 2C9ZA 4L8WB 4PIMA 3KM0A 4QGHA 2W2NA 5FPSA 2X9LA 4QOEA 3QK7A 1T9BA 4RZUA 4FDVA 1RHRA 2WSBA 1MOPA 4NBWA 5D7BA 3ZU2A 4HXFB 4A0FA 5LB2A 2C54A 1W9HA 1N6PA 1TPZA 2AYXA 3S2ZA 2IIQA 2WF7A 4LHZA 2VPWA 4F4FA 3WB2A 3BGSA 1WZNA 3GQBA 4YLYA 3RVSA 3HJNA 5CLQA 4LMPA 4MV4A 3L8CA 4MWOA 3VX4A 3NTQA 3UGJA 4AJLA 1CQZA 3JVVA 4DCNA 1Y4SA 3WIUA 3BH7A 3G0HA 3DJYA 4YA6A 3GRPA 2GH1A 3MUFA 3NBMA 4Z1MA 3LWBA 1CZHA 5E4TA 1SOVA 3WRXA 3KSAC 4XRRA 2F3PA 3VSEA 1SBQA 4M46A 2Y1XA 4M38A 4Y2TA 3P9NA 1NTOA 5E2AA 4RDHA 2CVHA 3CLUC 3AUSA 4PZCA 1WAMA 3DVAB 2A9VA 2XWJI 3PWZA 4HP8A 4NTZA 4MQFB 1Y1TA 5CA1F 2B94A 1PJBA 1SUFA 5DX1A 1VB5A 1M3SA 1IWBB 2RGNC 3T3IA 2QLLA 3F5MA 4TTVA 4CCYA 2CBXA 1DAIA 2ODPA 1I4DD 3VJKA 4QO8A 2EW8A 2IQIA 1XK6A 4E7PA 3GRVA 2ZBFA 5AI4A 1TCCA 1VIDA 2JIRA 1YFZA 3OU2A 4OUKX 1U5BA 1DIBA 3RAGA 3Q5EA 2PGDA 3P2EA 4J0IA 4KPFC 1V3VA 2CXRA 2XJ4A 3EVCA 3I2JA 2K5UA 2ZI6A 1ADBA 5G0TA 4YX9A 3QVWA 2FMXA 4JDUA 4NENB 5FPHA 1VG1A 4LJLA 2NVUB 1F1BA 4RS4A 3I1JA 3BB3A 3BERA 1KK3A 1SZJG 1FDUA 3QY0A 4B2LA 3BRSA 3KHSA 1LDEA 2AXNA 3N0XA 1YHZA 1FFGA 3ZY3A 5FLYA 2GBCA 3ABOB 4IEIA 4ZOLA 5K0GA 4KQGA 5TMBA 2HMVA 1UAAA 1NQWA 1K7SN 1M10A 2CXOA 2H3EA 1EWYA 5B2ZA 2XYHA 2BMDA 3LYUA 4PQFA 5D3MB 3QEAZ 1NV8A 2X6RA 4XAQA 4DABA 3F8SA 3KJHA 3CFYA 1A72A 1PEAA 1GZ4A 4M0KA 1Z2EA 3DKIA 1FUEA 4INAA 3MLAA 4M1YA 1W34A 3FB1A 3PT9A 4G5RA 4FWBA 4FUTA 3JAKA 2P6MA 1W88B 1C9KA 3EDOA 1WO8A 5CM2Z 5K3AA 5LQCA 1K63A 1KEKA 1TYDE 1W5FA 3DOCA 4EKYA 1XXHA 2F9LA 4S12A 3BXXA 1CJKC 1KDVA 5TC4A 4IEEA 1N77A 2O0HA 5F12A 4NOKA 4JSYA 1X39A 4K9QA 1W73A 4EVIA 5FTLA 5CEJA 5J2UB 2NP7A 1D8AA 2NSDA 4F2DA 4EKEA 2J30A 1VE3A 5B1IA 1II8A 2FSHA 1T3GA 4GPZA 2Y1FA 4PZYA 3TOVA 1V9CA 2KE5A 5BR7A 1SKBA 2ARKA 1NBOA 1VJDA 1GPBA 4HWOA 4B43A 4EARA 5K8CA 4Z4QA 4L3OA 2XBMA 1N5LA 2OXCA 3DDZX 5EXTA 2PS1A 3RS4A 3K70D 4KXNA 1VSUA 3D4OA 1VSQA 5CJPA 4URYR 4E33A 3FVRA 1MA3A 3O21A 3IVGA 3D31A 4Z3KA 1H3NA 5EIOA 1ULSA 1ZQ1A 4U02A 5CB4A 2VRCA 1HTWA 2J4CA 1I2CA 1E9FA 4K8OA 3S8YA 2G7ZA 4RSGA 4X71A 2ZTSA 1EX6A 2WJGA 4CLOA 2W6PA 4YI5A 4C6SA 3LPMA 1OA0A 5CR9A 2TMYA 4M6WB 1PZEA 1R0WA 1SVUA 2R4QA 3Q9NA 4WT7A 5BUCA 1MB3A 1V4NA 2YV3A 3IHLA 4E09A 3VR3D 1SG6A 3HXTA 2HLHA 3G2KA 3FSEA 4JBIA 1MV8A 4HYTA 3QVSA 5G0VA 4ITRC 5JCJA 4AY4A 2B25A 5K8UA 4NFHA 1P7ZA 2W42A 2MHCA 1BRTA 1OWOA 1PT6A 3CF0A 4BZZA 4FR5A 4MVJE 4MS4B 2XKJE 5ALLA 1UBUS 2P2SA 2XTAA 3OJWA 2E1RA 2HRDA 3AQ4A 3I2FA 3OHSX 3PTAA 1RAEA 3IUBA 2WJ4A 3ZBPA 3JPWA 2WJ6A 1NUQA 3SNHA 4CV1A 4G24A 3WAKA 3TM5A 2X2EA 3N2NA 1HMYA 3EIHA 2NZWA 4MRAA 3LU1A 5AOAA 4IDPA 4YY3B 1Z17A 1AZTA 1MPTA 4FMPA 3TOZA 4IDEA 5EKTA 2FQQA 4ZHQA 2J3JA 1XLVA 4U7TB 1L1QA 2GN6A 3VR2D 2ATVA 3C16C 3KR0A 4X92A 3RK4A 3WLKX 1W1UA 4DT1A 1FTYA 4ZYVA 2OXIA 5LU9A 3TTSA 1PR6A 5JXHA 1JJBA 2R86A 3A37A 3GI1A 4XIJA 4WBNF 4QGFA 4HRVA 2WWGA 4FZVA 1V37A 2ZSAA 4TMWA 5T4HA 1NVMB 5AHXA 1KS2A 5F1KA 2A1UA 4RXUA 3OCZA 1JG4A 4UAUA 1EFTA 2GTHA 1JL3A 2O1SA 3EQ2A 1YUBA 3L0BA 3UOGA 5EHNA 3VR4D 3ZPXA 3Q8WA 5AHWA 1E9RA 1Z5ZA 2WSSA 4KDEA 5EJAA 4KIWA 1G4AE 3X1MA 4YUYA 3LX4A 3L6EA 5EUBA 4OD0A 5C80A 5KTNA 1YZQA 3EEOA 2EKBA 2QRMA 4LE1A 2OVBA 2Q5OA 3GLHE 4BMSA 4WBNA 4HNUA 2K6GA 1I7SB 2OHJA 4BVLA 3TMAA 1WBBA 3R5FA 4DTIA 3MB8A 1USWA 4HGQA 4M8KA 3G0OA 2W93A 4F06A 4H4EA 3PDCA 5K6RA 4AWAA 3OQJA 3QUAA 1X7YB 2OQIA 1XXHB 3E3AA 4RIEA 3GMIA 1WW3A 2ONJA 5JAOA 3HKEA 3WVNA 3CLRC 3NT2A 1C9JA 1X14A 1C3XA 1DC8A 1T5IA 2AJLI 3AV3A 2IRWA 3MCWA 5HS4A 2YVLA 3B7WA 3KZCA 4ZD6A 3VZRA 4FWTA 4P84A 2QXTA 1ZMOA 5E6SA 4NOMA 1WNFA 3DS8A 3HCRA 1P44A 3NX4A 5L3SA 1E60A 3G9UA 4EJMA 1G2PA 3FPHA 2Y1WA 4JCCA 4MH0R 3W2FA 3WJ1A 3HNPA 5GPBA 4EF6A 4GX0A 4QUGA 2H0RA 4LUCA 2J6HA 1P91A 3IHTA 4GGMX 4BNUA 1QTNA 3HXPA 5B7PA 2OY0A 1I5OA 3EBOA 2FJPA 5IXSA 5FIUA 3CUEF 4D1YA 1NIPA 1EP2B 3DG9A 3IJRA 1DTWA 3L79A 3PWSA 1TVEA 2WTBA 5E6SB 1EX1A 3K94A 4AF6A 2WTEA 2G08A 4ENUA 3LC1O 5JAUA 1RAAA 3ZJTA 5B58C 2CXPA 3N5CA 2GJKA 2Y1DA 3EARA 5FJIA 3IIMA 2GXQA 3OAAD 1QAMA 1T2VA 4JNCA 4R54A 3EIOA 1ID1A 3KJXA 2XXJA 4NMHA 2FXIA 3RWMB 3IXLA 1DKMA 4G4GA 4S0ZA 4XDZA 5JYBA 4YFVA 5ARBA 4II7A 3IVMA 2Q3FA 4LECA 1Z4JA 2AWNA 4K03A 4ILKA 1VJTA 3ASVA 2XT9A 1IZ7A 1Z18A 3D81A 3ZU4A 4A3SA 2W6IA 3LVBA 3OFVA 4NKRA 2RFLA 2Y0CA 1Q1AA 9LDTA 1OI3A 1WD5A 3AY7A 3OO1A 1QH9A 3IAFA 1U2QA 4UE6A 1IHXA 4ZAZA 5K8VA 3OIYA 1I2DA 3U60B 3V7UA 2HSZA 4WHMA 2WU1A 1H3FA 3TDMA 1OLUA 3HLTA 3MOSA 3K0FB 2Q2QA 4QLOA 3BZBA 2IHYA 1IFXA 1RPNA 2FDXA 4YMLA 3T1TA 4N0DA 4EG6A 1R5BA 3HA3A 1DAPA 5JZ9A 1SZPA 3IV9A 5HKKA 2D1YA 1U0HC 2CYCA 2VBGA 4U5XA 4YS6A 1N9KA 1UEIA 2JHPA 4REQA 2GZSA 2J9XB 4CIWA 2BM8A 3BK7A 1EH5A 3G0GA 4DHWA 3B3JA 3HMKA 3BOSA 4R2LA 1D2GA 3F6RA 5FUXA 2BZSA 3RRYA 3ZDRA 3C0KA 4CL3A 5ADUS 1IOLA 1ESZA 1I4WA 1FZQA 2NZVG 2QQ0A 4RESA 3F49S 5ENZA 4YRPA 3CLTD 1LPPA 1IEWA 1DMSA 2CJYA 4ERXA 1N92A 4MW2A 4RH3A 4HG2A 2V8OA 3RYHA 3AY0A 2ONYA 2YIMA 4JBNA 1VL8A 3GH1A 4JL6A 3WX0A 1Y7PA 3IDZA 4HN9A 4B7XA 1WA5A 1IB0A 1KKLA 3GVPA 4N03A 2ZULA 5LLSA 1TA9A 1HV8A 3M8KA 1JXOA 2O7VA 3T0FA 2G70A 3IJEB 3Q72A 5H68A 4ZYXA 3HKDA 5DWDA 4UTOA 1CK4A 4KI0A 1WWKA 1O77A 3EZGA 1PJ8A 2AIRA 2QK4A 4I55A 3W5SA 3CJRA 2J0QA 1X7XB 4WASA 4JJKA 2ZIFA 4FS8A 5FOSA 2LGJA 3C3CA 4D9IA 1TLTA 1VYUA 1E5DA 2EIXA 2G5PA 2QX4A 1R0KA 4Q00A 4DMCA 3K20A 2BEVB 3E6AA 4FYVA 4HZUB 3DDWA 3MIIA 4MB0A 5EY5B 2FW1A 2L2QA 4MUEA 1MXFA 1KFKB 1I6WA 1LBHA 2Q6IA 3PJGA 4OGLA 2NSJA 5FL7A 5IN4A 4JOQA 1VSVA 5JNLA 5KNCA 2YJ6A 4FDUA 4JQCA 5FFFA 5AVQA 1G63A 6NULA 4G2TA 1EK6A 4CMIA 4NK4A 1FSSA 1Q1GA 2WVJA 4JHXA 2WEKA 2R6R1 3KL4A 4CNQA 4S2UA 3RHFA 1E2KA 4YALA 4D74A 4E30A 4K6CA 3QMWA 3K6RA 4U7WA 4HSGA 1YXMA 3TW8B 2P68A 3BA1A 4NAVA 1QYIA 1YI8A 3PNPA 4G67A 4RPCA 2PT5A 4WUVA 5F5XA 4JLPA 4E6PA 1KMQA 1QHHB 121PA 1YV9A 4IEFB 4KX5A 5FR2A 3RIGA 4M8IA 3DL7A 4WFQA 5U4QA 3CX6A 3ZIAD 2WV7A 4R2KA 4DZRA 2GR9A 1X1SA 2XKBA 1WCWA 1KYVA 3IP8A 3TFWA 3UC9A 5DU2A 4FEGA 1VL1A 2H92A 3GCXA 1M6NA 4K7JA 4OK6A 4W82A 1ULAA 4BVBA 1NNSA 1T0HB 2I1VB 4CPDA 1Y7IA 1HG1A 2J7PD 2VH2A 4I5FA 4X20A 4WOKA 2G9NA 4INZA 2L0XA 2EW2A 1I2BA 3G85A 3K2QA 1WQ1R 3KBBA 3Q7IA 4PINA 2JJ2A 4QBKA 1CUBA 3OY2A 1PSZA 4YFYA 4ANFA 5FNVF 2W8BA 1S96A 3A4LA 3LWNA 1YR9A 4FN5A 2PRZA 1NXQA 4CCWA 2PH3A 4RNDB 1C7RA 4H0NA 4RS3A 2O8DA 4BX9A 1DX6A 1NLMA 3GB9A 1WXWA 4KV7A 3WL8A 5C4IA 2ZWPA 2BONA 1LWOA 3JWHA 1KAQA 1R3DA 5E2IA 4OL9A 3NAMA 1W85A 1TVCA 3QU9A 1M6VB 5C7LO 1T8TA 4MA5A 4EY5A 1XYGA 5KBYA 2ON6A 2UYOA 2YYSA 4N7BA 4AU1A 3LDFA 3GLIE 1E3MA 1UBKS 5B6IA 1EJ0A 1YJAA 3WYGA 2A78A 3WGTA 3KD2A 3QE2A 1VKHA 1JS1X 4HQLA 1KVUA 1MRSA 4Y7DA 5I5GA 4OQPA 2ZTUA 4RDCA 2I6SA 4YROA 2WNSA 1EKXA 5A3SA 4EVQA 4LJYA 3DC2A 4A10A 4P3NA 4PX5A 3PXCX 5AM4A 3PLNA 3ZDEA 3RYTC 5J4KA 4FGKA 1AV6A 2ILVA 2DFTA 1EWVA 4OL0A 1NKSA 1PG2A 3ZHRA 4H3KB 3ROFA 1MXHA 1V16A 3KYCA 3S2YA 4UHHA 1NWHA 1YNSA 2P9HA 3HWRA 1VP3A 1GRRA 4JLBA 4E5VA 5CIYA 3GLUA 1B6TA 3AI7A 4ER0A 4P7KA 3M6VA 1O5OA 2DKOA 3WLNA 1DP4A 4J0CA 1K8RA 1Q0TA 4I0WB 4J91A 2DQYA 2YW9A 4XGQA 3UTCA 1WXFA 2Q3LA 4GSKA 5ALQA 1YR6A 1MO6A 4MTLA 1UQUA 2FMKA 2P69A 1KY4A 4X8MA 1OH7A 2Y9MB 2G9ZA 5CFZA 2YWRA 3WP1B 3T7TA 3KQMA 1Z37A 4Z7JA 1UXOA 5KDOA 4JVLA 3UA3A 1SIOA 4B7AA 2E4WA 4EB6B 3DGEC 3L93A 1OGJA 3OX2A 2VI5A 1EP9A 4ER3A 1KNQA 1PAUA 2V7TA 1R6VA 2R8EA 4RKRA 5CCDA 4F21A 4GG1A 4C1BA 4ARIA 2BEJA 2IIPA 2EVWX 1L4LA 1DRJA 2JFUA 4UARA 4ZAFA 1ST3A 1ULUA 1Z5NA 2I4OA 2VP4A 3D5EA 3GVIA 3KKQA 5AVSA 3CRVA 1DSSG 5JLAA 1VLVA 2O3RA 3B6MA 4LCJA 4LX0A 5JJIA 1YZHA 2HYDA 2ZUWA 2D1RA 5JTUA 4E2XA 4H7EA 4YXFA 3BH0A 1BXZA 4FZRA 4NZYA 1TAHA 1YBFA 1UJ4A 4UM5A 4LOJA 2A5LA 5EIBD 1FU8A 4MVJF 2ZXEA 2G0AA 2K4MA 4B3DA 4Q48A 2O5CA 3N7TA 5EWMB 2Q1YA 4BBPA 2MMCA 1DKQA 2Q1UA 3C43A 3TZKA 4EYQA 1HEIA 2E4XA 4PRKA 2WMNB 5JZVA 3SZOA 1EFRD 3D2CA 4HQRA 1CEQA 3RU3A 1NURA 1UBSB 1YKFA 3C41J 2OCDA 4EBBA 2FR8C 3N6XA 4GMHA 1KDTA 3LTEA 2HT1A 2NOAA 2PUAA 3CEMA 3QVMA 1YA6A 1RXEA 3FETA 2AG6A 4ODIA 1RWWA 4D79A 1OMOA 1QWSA 1RRKA 5JVDF 4CKBA 4C7OB 4AO8A 4ZIRB 3ZJ4A 2AC2A 3BRWD 2HW8A 3QIVA 2Q45A 2DWOA 3ZZ0A 5DX8A 1YJ5A 2GZHA 2ZZMA 3MJDA 3LL4A 1U5CA 2YRXA 2F4NA 4HB3A 4EFLA 1VA4A 2C2KA 3FLBA 4K6GA 2QXUA 2FZEA 2QRQA 3A10A 1NQUA 4TMFA 4UAVA 5JS8A 1OQAA 1HE4A 4ZCQA 3V4OA 1SVMA 4LDRA 4ARZB 3UN1A 5GINE 4ROTA 2B3TA 4F4HA 2JLXA 3MJVA 2RGAA 3C3WA 3H83A 3IOEA 5A2GA 1TJ5A 2G4VA 1R6UA 5DBOA 4IOKA 5LQDA 1KEUA 2Q0QA 4P81A 4RV9A 4B81A 3HU2A 4J76A 3LVFO 1ZOPA 4LYGA 2JC3A 1DRVA 2XTJA 2OM2A 3GGCA 2VJMB 3IEPA 3Q15C 4MINA 3ZLTA 3NTXA 2V4ZA 4IDCA 4JP1A 4DJDC 1SKYE 5D85A 4YMUA 1U5AA 4OAQA 1WKVA 4EA7A 3GRUA 1VSTA 5KTOA 2NYUA 2FW6A 5H81A 4EHDA 4LOHA 4P4GA 3MJCA 3FDIA 2OMEA 3AETB 3SEQA 4D8TA 3AEUA 1PTKA 2CF6A 2JGNA 4KHPB 3KOMA 2QF7A 3W34A 2FSGA 5CYGA 2I7XA 1MC4A 3TRKA 3ABZA 3S28A 2EBFX 2HSDA 3EXHC 1IM5A 2XCLA 2L18A 4XX1A 2O48X 3EVFA 4TN1A 1Z39A 3N8KA 4B80A 2YJ4A 2EQAA 3D8BA 4M53A 3L02A 2FWRA 4CF7A 3H5AA 4PZUA 3TIFA 1BH6A 3O8OB 4EX7A 3L8ZA 2PLFA 2PGLA 1FW6A 1L4KA 1L5ZA 1N2XA 1Z3CA 4RELA 4YJDA 5DO9A 1ZIXA 1I1NA 2VOEA 2OD7A 3IOYA 2HA7A 1QO0D 2G28A 3UJ3X 3V1UA 3VU0A 2ZYRA 3OUUA 1BMFA 1CS0B 2AMJA 5K3CA 3LPLA 1GPDG 4J90A 4DRXA 4JLOA 3LQYA 4QDJA 1SKQA 3P19A 4XIIA 2OYSA 3KYDA 4MB2A 4Q7EA 4IX9A 4QBGB 1XB2A 5BWNA 4C4PA 3ZD6A 3KB2A 4YRBA 2BJHA 4ZI7A 2G1PA 4MTCA 2RHMA 1M34B 2GMWA 4RY8A 1BROA 5FLEX 4YWHA 4QAJA 2PE5A 3UH1A 1GNLA 1BZYA 1JR3D 1ORWA 2ZT5A 3GAAA 2YHSA 4DTCA 2O8FB 2X3FA 4LW8A 4HXGA 3SIPA 4ENPA 1WXQA 2VHCA 1L1RA 3AILA 2BPOA 3D02A 1U8UA 4N3BA 5HGJA 2B8NA 2D2IA 3GRCA 3NC0C 1NXXA 1ABBA 1G2OA 4J0EA 1Q57A 3KU4A 3UPTA 2QG9A 1RLOA 4KO3S 1IDOA 4BAGA 4OX9Y 1ES9A 2B4YA 3QENA 2C3YA 4K2AA 3FJOA 2BGKA 3TZEA 1QF9A 1OAKA 1KEZA 5BOSB 1CIVA 3HPQA 4JT9A 3NC1C 3DKKA 4V2IA 3WMRA 3EZFA 3CH6A 1QZXA 5COQA 821PA 2QLFA 3GLFB 2AZTA 1T4MA 5AP9A 1FUKA 3RUPA 2JK1A 4OHXA 1NR1A 3MYRA 4B3GA 3NDBB 2XIJA 4JASB 1CEEA 5DM60 1J70A 1ODLA 3QNMA 3R8CA 3C3XA 3TS1A 1UEJA 5DP2A 4B17A 4DLTA 3FLAA 4V3CA 4ISBA 3ABIA 4QDOA 1C81A 4MGYR 3IT1A 1UBJS 1U1GA 1N25A 4NH0A 1WHSA 2X86A 1ZCFA 4WL0A 2R47A 3BRCA 3L5KA 3RGGA 3VSDA 3W1EA 4PF1A 2GI4A 3P4UA 1ZUIA 5LQAA 4GZ3A 1PWXA 4UOZA 1ZOIA 1DC5A 3WBJA 1EFUA 2QUHA 4ND1A 2ZCJA 2ZIUB 4LYDA 4MUXA 2H29A 4MQ6A 1GOTA 4EUSA 3GAMA 3FZEA 5DHAA 4DG8A 5K8IA 1WZUA 2II6A 1FFEA 3GPIA 1W59A 2E0IA 1V5EA 2FY8A 4OO3A 3CX4A 4HEQA 3C70A 4HPJB 4RY9A 1GRCA 1TJPB 5BPHA 3FCXA 1E2DA 2NO7A 2QRKA 2WVHA 3F7OA 3O1IC 4K6MA 1O6BA 4WZZA 1HL7A 2IE8A 1PFYA 1QVAA 1C4WA 2H2AA 3NHKA 3ZS9A 4B2YA 2OL4A 2Q5CA 1G8SA 3GN2A 2QUZA 3AHCA 3HS3A 3GPBA 4M9SA 1M7GA 3A36A 1PU2A 2D0DA 3SR4A 2J85A 2R6JA 5K4HA 2QVCA 4PNZA 1SQSA 1E1RD 1V7ZA 3GRKA 5CFOA 4MPPA 1LSJA 4B5LA 2X58A 1R2QA 2P40A 5DT9A 2OE2A 1UMDB 3P1JA 4CM7A 1TU4A 3BMCB 4ZCSA 2IA5A 4S24A 4MR7B 1AUXA 3FNRA 3EMKA 4OJKA 1EG2A 4EAQA 1AUVA 5IF9A 4H16A 1HRDA 3HB9A 1YR2A 1OXMA 3GO4A 4JYMA 1NNUA 2IYYA 3RJ5A 1LPMA 1QQ5A 3L7DA 4O4HB 2Y0BA 4UD2A 3RAFC 5KNBD 2VQEB 3TXAA 3TJMA 4CEJA 5JWOA 5HR5A 1IXSB 1JFTA 1D2MA 2LXNA 4AICA 4BFVA 4ZU6X 3GT7A 5B3JA 3B51X 3AR4A 1V8BA 1ENOA 2H52A 2YV1A 3N39C 2WM2A 4HKTA 5DNAA 5JBIA 3TDKA 1V1JA 4L72A 1CIJA 1G7CA 1P7VA 2BR4A 3LE8A 1WETA 3QU4A 2QW1A 1G9XA 4ME6A 4AP6A 5KWVA 5TQ2A 3W90A 4ZTBA 5F7OA 2FX2A 1EQ2A 1JKJB 1ZS9A 4GVXA 2YZKA 4QBTA 3PXGA 3VSCA 2ZYWX 4HADA 1ACJA 1AZLA 5C7OO 4ETWA 1RM3A 5KYUA 1PL0A 1SQFA 4OREX 2P9FA 4XDHA 3RIYA 1U65A 1VMAA 2AFIE 1A1SA 4RHYA 2G4LA 2WA2A 3JQBC 1Z2DA 4QU5A 1TMGE 1IK6A 4J03A 1GTJ1 1ACMA 4Q4HA 2WKWA 1SG9A 2BKAA 2FP4B 2UZAA 3BICA 3AP3A 5GWXA 2AN4A 3VC3A 3LUFA 5EJ7A 1ZD4A 2C5EA 1N57A 2BFBA 3OLQA 3ZXXA 3R23A 3DBIA 4EB8A 3L4JA 3A2KA 1MA0A 3X1DA 5LA6F 4AKSA 3D4LA 2I8LA 3P0EA 5C53B 5M3BA 1ODKA 2B7BA 4E15A 1G2IA 2QG4A 3O4FA 3TOSA 2IEDA 3D7LA 4KPUA 5JLJA 3LT1A 5T41A 1JT9A 1TB4A 2W8BB 3C3EA 3JASB 1HDRA 1KF0A 4UXHA 4JWKA 2OGUA 3IQHX 3AHEA 1SC3A 1ECJA 2IPLA 4MW9A 4WCVA 5EGSA 3ROMA 4GPIB 5C8VA 3KQHA 3N8DA 1P5JA 1R6BX 1VYHA 1D04A 1PNOA 4HMPA 4FNMA 2P6OA 1OYYA 4GP9A 2JIQA 1X2EA 1YS6A 2VHJA 1G7RA 3HB4X 3MJ4A 4OXRA 3NEJA 1YQXA 2BMVA 5CFMA 2EF0A 1EFPA 1JX6A 5TT0A 4GE3A 2XQIA 2RONA 2ZS8A 3BRWA 4LTDA 5F4BA 3W5BA 1M2OA 2DF8A 2X1VA 4LOIA 1RI2A 1Y9EA 4I6GA 3OURA 3WL3A 4W1QA 1EGAA 4WERA 4ZVKA 4AAYA 5JYEA 3B36A 1P2DA 2FOIA 1IL0A 2R44A 3CT6A 4GECA 3UHOA 1NQTA 4N0QA 5T64A 4BP8A 1UFRA 5CDFE 3T9CA 5FV4A 5JVDA 4PCVA 3E8XA 1ATIA 1FDIA 3HUTA 4UMDA 4UMFA 4UZSA 5COBA 3GFSA 5HJ5A 1LY1A 4G3XA 1JDSA 3BWEA 1N8NA 4OP2A 1QYWA 2AF4C 5TS3A 2AB0A 1TM2A 2PS3A 4EENA 5LYJF 1XC7A 1LX6A 2P2DA 3HACA 1JLHA 2DH5A 5K05A 1B4DA 1U0SY 4RULA 2Q3MA 4YRDA 2QLNA 2GK4A 3AJ8A 4WKCA 1RC0A 3A7EA 3HZHA 3OEHA 4X95A 3CS3A 4G36A 3A1VA 2V6JA 2X4GA 1A8HA 3D64A 2J3QA 1NE2A 3U40A 2ZGVA 2AUMA 1T3HA 2FZWA 3URMA 3Q8KA 4TTTS 4JDPA 3FR7A 1XJ5A 1L3IA 4RJJA 5D8DA 2PX3A 2O1XA 1PQWA 1YS7A 3IT2A 1ETUA 2D5BA 3IYLW 4HH1A 3SU8A 4F3YA 4MJXA 4FGUA 1L4BA 1XZEA 1MN6A 1Q7GA 4OMCA 5C8YA 3SC4A 5BYAA 2C59A 3ILVA 2UUAB 3IEXA 3LIPA 5A9SB 1O96B 3WWZA 4RTQA 2DBYA 1TIKA 2GD1O 3TL6A 5TQ0A 1CUJA 5CB6A 5IWCA 4XB2A 5HKLA 1R4MB 2QQGA 4OH1A 1PG5A 3S2SA 4ZOLF 2A9FA 2JDIA 2ZROA 5KYUB 1SU8A 2XNHA 3FAZA 1XLUA 3OOSA 2O7RA 2ZRJA 1BKDR 2PYDA 4B73A 1ZMRA 3INYA 2CDCA 3K32A 4KLNA 4Q1DA 2XKKA 1JDJA 3FPCA 1WS6A 4EJ6A 5KB3A 1F6DA 3EVEA 3GBSA 3MGGA 1XDGA 4OGGA 5CLGA 3KR1A 4V2UA 5DRTA 3TM4A 1DTEA 1RBMA 3DBHA 2JGLA 3W3AA 3WQHA 2P2LA 1MOSA 1U7HA 4MNTA 4QFDA 3ZY4A 1KEPA 4BVGA 1WMAA 3C7CB 2Q5HA 1BW9A 1WEHA 1RLUA 3QG5A 1CJBA 3S44A 1J22A 1N8KA 4IBOA 5B4TA 4TYWA 4RVOA 5B30A 4FT4A 2AL7A 2CLSA 3DOIA 4PO8A 1G291 2OCLA 3N2EA 3AKDA 4L0CA 5HKBA 4HB0A 5HJEA 4FXOA 2Q28A 3C8MA 2ZE8A 5BSMA 5EERA 3WLHA 1EFRA 4MKHA 2WHQA 1HZZA 3IDOA 1HMPA 1CUXA 4W63A 5K0ZA 1QPZA 4LG1A 4Y18A 1M8FA 1WM1A 4CIVA 4HLQB 4MDHA 3WYEA 4FFPA 2VJKA 2EP7A 2WYIA 5DXAA 4R1UA 1GYQA 2C42A 3W9SA 5CA0B 1XAGA 3DMNA 2BM0A 3GYBA 3JZMA 4Q82A 1MCZA 2FEXA 4YN3A 2CMDA 2JF0A 2O2DA 3OPYI 5CNJA 3REQB 2IFTA 1BSVA 1SXJE 4G0XA 3SKXA 1QP4A 4Q3EA 2YOFA 3MCVA 1HDZA 3EIXA 1PQPA 1GL3A 2G25A 3KFXA 4HWKA 1ZK0A 1ZGJA 3CLHA 3N2KA 4P4LA 3T7IA 2WWHA 1EXWA 2C96A 2G7MC 2H5EA 3GP3A 4GICA 4ZQEA 3RRJA 3U3OA 5FPQA 2R6ZA 5FWNA 3CZ5A 2AG8A 1OH8A 5EMLA 3NJ4A 2XCTB 5DLDA 3B7GA 3G8DA 2BF4A 1Q19A 3LY8A 2CDNA 2O9JA 3F0TA 1JEQA 1VBFA 2P65A 3DL0A 3T5TA 3I5UA 1U02A 4PGHA 2OG1A 4IIFA 1NNEA 1N7HA 2GLUA 2QY9A 3DSRA 3IO5A 2HPZA 4UEJA 5KOHA 2YJZA 3CKYA 2E55A 3G0IA 1DI0A 1EXNA 2Q6KA 3MNFA 4O4JA 5DTEA 4BKQA 2GRJA 1KBZA 4K1XA 1SCJA 1PO7A 4RMGA 4A36A 4U5QA 3LFHA 3ITEA 4WKPA 5L8VA 3DT8A 1C3OB 2UXDB 3B6JA 3CVJA 2HLDA 3GZNB 4LCBA 2QPLA 4AD8A 4DV0B 1FX0A 2Z1DA 5IUNC 5B12A 3NR2A 2RI0A 4FEAA 3D8RA 5D5HA 5LWHA 2ATXA 1HWYA 1JU9A 3JWPA 3PQ5A 4KX3A 4V3BA 3TVTA 5JFOA 4LIPD 1WU7A 2PAAA 4Y9DA 4NRDA 4ZOLB 2W6JA 3HN2A 4B3RB 2JRLA 1ZN7A 3DO5A 4BTVA 1YC5A 1MC8A 2VOJA 5TE9A 4WN9A 2BV3A 2WHXA 3QTBA 5KPJA 1SVKA 3MT9A 3I04A 1C2YA 2HF2A 3M0EA 5D3QA 1YS2X 4R71A 5JS6A 2CLFB 1UCFA 3CZ4A 5JWHA 3UMSA 2FE1A 3NFYA 2M6RA 1LVHA 2G1AA 1BD4A 2FSIA 1T2EA 3E22B 1KKMA 1YDMA 1HL3A 3LOQA 4RVDA 3WG9A 1YACA 3H17A 4I46A 2FX3A 2PANA 3V7FA 1MOQA 3CE6A 1W0JD 3VV3A 3DTNA 3BIFA 1RJ9A 1YMQA 4LPSA 3T3OA 3F67A 1QVVA 4BEBA 1DJNA 4KIUA 4AUKA 3CF6R 2O1WA 1BMFD 4AZTA 4DA7A 2GPNA 1ZH6A 1JYEA 2F3QA 3HO8A 1GZ5A 3JVEA 3G2JA 4OG2A 3OPYB 4R1PA 3CZMA 2CDRA 5FBHA 3O9MA 1EUDB 1G18A 2C31A 2EJVA 3DDHA 3HU1A 3MTIA 4HVTA 2ZVPX 1F8UA 1GZHB 3TPZA 1JXQA 3PFWO 1V3QE 3LAWA 4FNAA 3ZU6A 3RC7A 4ZREA 3OZXA 1E2UA 1R27A 1AMUA 3X1YA 1IB6A 4G5YA 4CIAA 2A1IA 4JL5A 1W85B 1Z4KA 4UEOA 5MFPA 2XKAA 4DLUA 1YK0A 2RAFA 1EEXB 2HPAA 4D4HA 4LS3A 5DCWA 5GM2A 4E4TA 4IDDA 2UXCB 3Q7EA 4JI1B 4L8VA 3L8EA 2IEZA 4WKOA 5BVGB 2NPIA 3DAPA 2HDHA 3UJ9A 3FKJA 2RKWA 1I4OA 1X7HA 2GFIA 4K9MA 1XMVA 3NBYC 1OA1A 2GXAA 1RVDA 4JEMA 1MQ8B 4K0RA 5KQLA 4LTNA 3GA5A 4BBJA 2FOLA 3NIBA 2BI7A 3F2IA 2Y1LA 3OT4A 3ROPA 1M0EA 2F43B 1SXJC 2YIDA 1S7GA 3H4IA 4YRCA 3EGCA 4W8GA 3C3KA 4JBYA 1FP2A 3EQ7A 4MRVA 2ZR9A 3PD7A 3PFGA 5TV2A 3B3FA 4EECA 1FOEB 3BD6A 2QV7A 1VP9A 4A2PA 4FU0A 1KU0A 1NXSA 1TD9A 2RHHA 4P7GA 5ES3A 4DR2B 1KOGA 4MX8A 1QU3A 4F91B 3ETEA 1JR3E 3GJTA 3MS2A 3HL4A 3I9OA 5K0SA 4L6CA 2ZXUA 4DN6A 4X85A 2B4RO 3BGOS 1YIAA 4U3JB 2AI2A 3MRVA 4BKPA 5DFAA 4YPOA 1CB7A 2V0NA 1YRBA 3FE2A 3WISA 4C3UA 5EIEA 5KZMB 4D4GA 3A2LA 3ZEIA 3RYHB 3RVRA 1GUYA 2OENG 4F1KA 1AXEA 3UKOA 2HAEA 1EWTA 4JI4B 4TQUS 3KXDA 2B4TO 4HWTA 3BMCA 2P5YA 3C1TA 2ZQZA 3ND7A 4E6EA 2JAQA 2WUWE 4RKYA 1FX0B 2R87A 2XUKA 4PSVA 2IC5A 5AOCA 2D62A 4BC0A 1FYDA 4DA6A 1TECE 2AJTA 2HHAA 3DQZA 3I9V1 5DI3B 4JYZA 4PXAA 3D6NB 2G5GX 1IQRA 5IXJA 4PBSA 3O75A 1GAQA 3C98A 1S2GA 2LV8A 5FR1A 4WCFA 2QZSA 3LDUA 1CU1A 1FBTA 2V96A 3LUGA 5J23A 2V5UA 3JZAA 2E4VA 3HNRA 3PG5A 5ESWA 4EG8A 4F6RB 3NATA 1JHMA 1SCNE 4LRSB 4H35A 4GKAA 4NATA 4K9DA 1OLSA 1N4AA 3DFKA 1P9LA 1VIVA 2R96A 4OM8A 5C4GB 1XYVA 2ODAA 1RQNA 3H75A 3IQEA 4NCNA 4RKWA 1KP2A 3L8MA 1QDUA 2Q3BA 4XYGA 3ZQ4A 4F84A 1KY3A 1J8FA 4XUEA 3TTXA 3KSRA 3LP5A 1JNXX 1KJIA 1LFAA 1SCKA 2PR2A 4DL9A 2LTAA 3O5AA 1JHAA 1RJ9B 1I2AA 1TTQB 4R2HA 4B31A 2ZYTX 1D3AA 1NQOA 1JU3A 1OYWA 1YRWA 1ZJJA 4MRMB 5JAQA 1CUWA 2GQ0A 2E4AA 2O2EA 3RYFA 4CKWA 2ACEA 1UZLA 4CKBB 3HVUA 2MIIA 4PX3A 4OFXA 1W75A 1Z2PX 1B42A 2PUGA 1JJ7A 1XNHA 3TG8A 3NM4A 5BSHA 4IIXA 2GF2A 5I4CA 1K8QA 2F00A 1H6AA 2A8YA 2G07A 3ANMA 4Y0AA 3ST7A 5BVHB 4EATA 4WEQA 5IANA 4BPRA 1T26A 4AJ9A 5DMHA 3AIIA 2HGZA 2NUPA 3WGHA 4ETIA 2IP1A 3BN3A 2ZYHA 3ONNA 4DLSA 2GLXA 4J3JA 5K4GA 1TZMA 3PJFA 3Q2OA 2EZ9A 3H7AA 1E9EA 2OCPA 2X6QA 4Q18A 5G1PA 3T9AA 3JASA 2QE7A 3K1YA 3KJQA 3DZJA 3PE3A 3PICA 3KPWA 1Z08A 2IE0A 2OV2A 2Z4RA 3GVXA 3HHPA 2G6BA 1TM1E 4G4IA 3NBAA 4GKKB 5AO9A 1AZSC 5DV9A 1M2WA 4MR8B 5ILGA 1TKCA 2X9VA 3I32A 4GQIA 4KDCA 3VZCA 3WLRA 5BVHA 3KUDA 2WP0A 3K09A 3NPAA 2ROQA 3WGGA 3CMMA 2H1RA 2ACKA 2GA9A 1R8YA 1BJKA 1RZUA 1YQGA 2DTDA 2WVAA 1T4DA 2WG1A 1U94A 4GUAA 2RHCA 2PWYA 4QWMA 1H2XA 1T0BA 1PEKE 2M1XA 1VLQA 1MX3A 1ZCJA 2JBHA 3SCZA 2P1DA 2UVQA 2PWBA 4N18A 5I9IA 3FGOA 5IULC 1Y3DE 3ZJUA 1EUCA 4IZIA 3SC6A 4L78A 4JUDX 3HYLA 3JZIA 3AF2A 4I3HA 4L4YA 2QV0A 5GAJA 1WB6A 2W2KB 3FYUB 5CCBA 3Q6MA 4R6XA 1KVSA 2CK3D 1OYOA 1Y80A 2D7JA 3DMFA 4ZRMA 5JS2A 1YFKA 2Q07A 3QF4A 2P67A 2C99A 1CQIB 1F06A 1WLYA 3KJNA 3R4VA 1MB2A 1ZM3A 4G4JA 4DXAA 2FNAA 4F8EA 2DECA 3FNGA 2DBZA 3DAHA 5TR9A 4BLOA 3RS3A 4CG1A 3KEQA 4TKLA 3PUZA 3BD7A 1IUOA 4NCAA 1E9BA 4PZEA 3V7WA 2A4KA 2XD9A 3RU2A 4O63O 3PFNA 3WB1A 1C3VA 4HWPA 4K9RA 1D6MA 3I0ZA 5ENDA 1TQHA 5GP1A 2Y76A 1NN1A 2ZDHA 3OSUA 1Y33E 3P96A 1OZAA 2JAXA 3DYIA 2I7TA 4QPCA 2PMWB 3BDIA 3JQ9A 5IC4A 3V5NA 3BILA 4EO9A 3KKMA 4MWSA 3QV2A 2JIPA 1U7XA 2VYND 4NU6A 1WDLA 4N49A 3V1MA 2WUFA 2OSBA 3PXBA 3V97A 4P5PA 3IBGA 3H05A 1RWXA 3NO4A 3PWTA 5K9ZA 5H0IA 3K0HA 5FH9A 1KFCB 1Z35A 2WP8J 3DCYA 3MLEA 4ND8A 4Q24A 4F9EA 5IASA 4REMA 2XAUA 2GD2A 1YB5A 2ZJ6A 4R6WA 4GHWA 2G67A 4D3ZA 2OO3A 5J58A 2G4CA 5BV0A 4PBTA 5CLJA 2IYFA 3CIOA 3TGWA 1RM0A 3MIZA 3OUTA 3E70C 1XZNA 1DAGA 5CYPA 4HF7A 2RDMA 2GTIA 2CNNA 3L8DA 3UGQA 1SKYB 4Q9HA 1HRKA 4KFCA 2V45A 3LGSA 5L7WA 3QVVA 1DIHA 1EINA 1JVNA 1YDWA 2RGYA 3WK7A 3A3OA 2XTZA 4TZKA 2FRDC 2AZ4A 5DLQC 4R2IA 3NWEA 3SHFA 1Q77A 3P9PA 4UW9A 3IURA 2Z56A 5ECWA 1T9AA 1N8TA 1ZC3A 1AY0A 1OLSB 3KQLA 1YCHA 2ENWA 3RS0A 1V45E 1SHZA 3UK6A 1V35A 2WDPA 1PLJA 4FT2A 3LQRA 4KIJA 5KUTA 3S0JA 1EGMB 3MB5A 1YR8A 4PQRA 3UF0A 4UTRA 3T34A 3K0EA 2PBRA 4PYIA 3GLGA 4Q01A 3R5KA 4M76B 3DF7A 2W6JD 4ARUA 4GXQA 4HNAA 4BJ3A 3HFSA 1U9YA 4WTOA 3QEBZ 2BYTA 1DPGA 1G8FA 1GKYA 1SA0B 5AKKA 2XNDA 2EZ8A 4FYIA 1D4OA 3A6PC 4R2XA 1IPEA 4JOCA 1MQSA 4JOBA 1CRZA 3VDRA 3AINA 4HNGA 3LUJA 5DLEA 3BORA 1F0PA 4BFCA 4X66B 1EUCB 1NGSA 4AK9A 3RRBA 5CW1A 4J1SA 2FPRA 2JIOA 2ZXFA 2H7VA 2JHAA 4LHSA 5EJ2A 3SDZA 3QWBA 3LT4A 2FUKA 3IQWA 1KI6B 4DB4A 4GRIA 3AF3A 5F64A 3IXMA 4JYCA 3A6KA 4UASA 2YASA 3N8GA 5D3MA 3RUEA 2JHFA 3FM9A 1TIPA 3D6UA 4PCLA 3NPMA 3RS9A 2JAUA 1MU0A 2CLDX 1SIBE 1A76A 3H2YA 4F11A 3IEMA 2V6IA 3Q8XB 1BC5A 1ZUD1 2VHWA 2QJFA 1Q20A 3TB4A 3MVEA 1X9IA 1I10A 2DX7A 1DAHA 1U1FA 3Q1KA 4MI1A 1RI5A 3R09A 1RPJA 1RHKA 2Z1NA 4PAWA 4ZVUA 5KVVA 1NBHA 4WBXC 2DSTA 3TQRA 1Z0AA 2FJUA 3I2GA 1MAUA 1D2RA 1JTVA 2ZPUA 1L1EA 1QP8A 1UZMA 4UMEA 3L3BA 3ZI4A 1Y9DA 3ZW8A 4ZV4A 4FYHA 1RKVA 4IH9A 3VPCA 2ORED 3MMXA 2D4HA 3GNTA 4OUDB 3F5DA 3FHJA 4FYXA 5CK5A 5FL7D 4J0GA 2BKEA 1IWOA 4ZV9A 3SEAA 3TQOA 1HT1E 3PKIA 4WBNB 1CS0A 3QXGA 4BS9A 4BBAA 2JLWA 1U98A 2YUIA 3IGFA 4TKVB 4U9IS 5CGZA 2V9CA 5H80A 2JHCA 1PS8A 4M7WA 4MUKA 2WIFA 4B85A 3NTOA 4HEHA 4MLDA 4DEYA 1SK9A 2P0AA 1N9ZA 1PDWA 3ZDQA 3PPWA 4X91A 3DJFA 1UPFA 3HDQA 3HA7A 1DWPA 2X8BA 1FU7A 3NHFA 4Q9KA 5M5BA 1PBNA 5LWQA 1NDUA 2Y1CA 3I01A 5IAGA 1E9SA 1JQEA 1JHVA 1ECLA 1MH9A 3C87A 3G0BA 2R11A 2YFKA 5HRUA 1KOJA 2EWVA 3ICOA 1F48A 2EHDA 3KWMA 4RUKA 3HBFA 3M5PA 3L7IA 2GOYA 3CUKA 1ZUNA 3E18A 1DJOA 4HS4A 5F52A 1QMGA 2AMYA 1JG2A 5BW8A 2UUBB 1F1JA 2V7BA 3HI6A 2QTLA 4U6SA 1KJ9A 4V0LA 1RQXA 4KFTA 3DL2A 5K3BA 3IHWA 1EGQA 1QZZA 4NZPA 2HY7A 4KREA 1DOAA 3I3OA 3I28A 2JJ2D 2CDAA 2D0OB 4GEGA 5ELLA 2IYPA 4MEJA 1GP2A 3I6IA 4RJLA 1R9MA 2I1LA 3IAM6 4CM4B 1JSLA 1BGWA 1QQ6A 1W4CA 3OTWA 4CHGA 5HK9A 1I3KA 2VHQA 2W9XA 4O1HA 4JYAB 1R5OA 2YY6A 1DX4A 4DQLA 4E0BA 1ULTA 4XYEA 4LY3A 3CVYA 1NW9B 3X43A 2IW3A 5K0BA 4Q4LA 3WJ2A 1IUNA 2P5SA 2FGKA 3WY9A 1WTCA 1DQYA 4Q9JA 3SJBA 3HM9A 2H1OA 2ZJ2A 1T1EA 4TL6A 1Z6QA 1V1MA 3G6WA 3DO6A 3QJGA 1AHNA 1EDZA 2BFAA 1AGXA 3ICQB 3QM1A 3AX6A 3KOUA 3NETA 3ZK8A 2WQ7A 5LMNB 2HKIA 3D8HA 4LJSA 5IKEA 2VYFA 2VJBA 1YJ8A 1MX9A 5E2BA 4HAIA 1ESDA 2AI3A 1W1WA 3WHLA 5HHTA 3U61B 3D8NA 1VJ0A 4LYYA 5KHOC 1T15A 2VP9A 2VSNA 4L51A 3E2PA 2BFCB 4ZHQF 2KB0A 3BM5A 1PFWA 5AM1A 1IZZA 3A6EA 3GARA 3MTQA 4MICA 4CKZA 1V1MB 3NRBA 1UMDA 2FPIB 1NQAO 3LQ4A 3L6RA 1RWMA 3VUEA 4BE9A 3C3JA 1FK8A 2CNDA 1C7ZA 4BFSA 1N0HA 3A1UA 3FI9A 2WOJA 1O96A 3H3JA 3LW8A 2IZOA 1NE7A 2PLNA 4LWPA 1EIWA 4GF5A 1THTA 3GJSA 5KU7A 3RANA 3U7EB 1C1XA 1E89A 5DNVA 3SQMA 2HJGA 4G0NA 3ZHUA 5TMPA 1YHNA 2FKAA 3BHNA 2Y1GA 3B3GA 4JUFA 4CLRA 5L3SB 2BFCA 3ZV5A 1USGA 2EG9A 3QQPA 5I8WA 2QENA 4JP2A 1CF2O 1UJCA 2VTBB 2BBOA 1M75A 2F1RA 2LE0A 2WJPA 2XZDA 4XLZA 1WXIA 4NPHA 2Y93A 2PRSA 3Q3EA 3OA0A 5IHPA 4LF9B 4MRNA 3O95A 3WDKA 2QRVA 3KLOA 2HBRA 1W25A 3WGJA 3SY8A 1XR3A 1WNTA 1A9YA 3VNQA 3QTLA 4F6CA 4E12A 2DLNA 2NXJA 1Z6TA 3PR2B 4KH1A 5EUMA 1AK2A 2ACVA 3HJRA 5FHRA 3CXUA 1PP4A 3OJLA 2AOTA 3WLSA 4BVFA 2Q3JA 3HDJA 3THRA 1GR1A 1NMXA 3UJNA 1Y8CA 3KQOA 3MK31 2O4CA 4RAQA 1RHMA 5F9HA 4I66A 3WYNA 1WSDA 2VLIA 7REQA 1XU4A 4QXMA 1WMEA 4XA8A 3PFBA 4PAMA 3WHPA 4KXWA 5BWLA 1E1YA 2FSSA 4KR2A 1N9GB 3UB4A 2C7OA 4IJQA 5HSGA 4A0QA 4KQHA 2H5IA 3WDSA 2I34A 4F46A 1UDXA 5HQTA 4B3TB 3A4IA 5SV2A 1O94D 1QKIA 4TV8B 4AURA 4D8VA 3TPFA 4C3VA 1P7PA 2V5VA 3UMVA 5AKGA 1OHHA 3GA0A 4L07A 4JGIA 4RVFA 4XM2A 1IQ0A 2H2FA 1EQAA 2PFKA 3ZHQA 2J9GA 1P19A 1KK2A 3B38A 3LHDA 1K9VF 1GY8A 1DKRA 3LLMA 4TYNA 4IGFA 4KC0A 3R7DA 1F2TB 2EZ4A 4FYJA 5CHEA 4NJEA 4N47A 5CLLA 1JMKC 2Q3HA 2DVMA 1RJWA 4DMMA 1EYZA 4FEEA 2UUCB 2FLWA 2OZLB 3ICCA 1YS4A 1Y8AA 2IZ0A 4ONEA 4EGAA 1AQUA 3GZNA 5K3OA 3DEIA 5JH7A 2N1MA 3NHAA 2IDZA 4XD7D 4F3RA 1OKKD 3TEJA 3D4NA 3NXKA 1TLLA 2WIJA 4NCBA 4H77A 4R8SA 2ZSIA 1S3FA 3ET5A 1CHNA 2BCJQ 1TYAE 4Q12A 4RZXA 1TU0A 5T8KC 1A2OA 2GFHA 2GVDC 1IE3A 5DW3A 2BGWA 2XZLA 3H4VA 2OD9A 4BLRA 2XCUA 3LQKA 3V2HA 1JHPA 3CYFA 3CEPB 1M2GA 3LD9A 4I6EA 1JWAB 2AA3A 4UTXA 3PP8A 1O6ZA 2OVFA 3STTA 4EUEA 5CD9A 5H59A 5DYIA 5KYXA 1NYRA 3AV0B 5B64A 3BDAA 3UC5A 4UHKA 2ZS9A 3OT5A 1FNBA 3JQFC 5KSWB 1YZTA 4PHHA 3P9KA 4GIBA 1Z4OA 4XVRA 5JHHB 2SKEA 1SC9A 5JARA 1Z5OA 3R7SA 4IHQA 5IJ9B 1BE8A 1E7MA 4WLFA 2MMGA 3AEZA 3EIWA 3ZUGA 1BCSB 3WWOA 1GVNB 4N6NA 2IH2A 2HJSA 3H1AA 3TJRA 1TEHA 3CRQA 4FHEA 4EOGA 4QYIA 2FX5A 1VKOA 3PFFA 4BNWA 3IBCA 5LNK6 1NP7A 2FFRA 2GCPA 3Q87B 5FPTA 3UPDA 4EJ2A 5IT5A 3D3QA 2B6HA 2I22A 3NOXA 1HPLA 4NV3A 3FZYA 5ICGA 5A62A 4US0R 2XLBA 1L8AA 2UAGA 4AKHA 4ENSA 3PCRB 1T9ZA 4RACA 5F5NA 5FI1B 3WXBA 2AEJA 4HDNB 4IIJA 4MULA 4U6QA 5JYDA 1RW4A 1BH2A 2Z4SA 3VO8A 3ZNOA 3ZWKA 3CLSD 5TJ9A 2A3NA 2PK3A 3GMSA 2BDUA 3H0KA 4IJKA 1FTNA 1NY5A 1BVUA 1CUYA 1RWBA 3FFBA 1W9MA 2DPGA 3N53A 3H97A 2YWXA 3HN6A 3ZUPA 4RJTA 1MF7A 1U2EA 3OQNA 2H0QA 4K46A 3PRJA 5AHKA 3WYAA 1XXLA 1WQ4A 3PNBA 4R2JA 3F4LA 2A35A 1BWQA 1O9HA 4KWTA 4BV8A 1YGYA 3GZ4A 2IV2X 1AO3A 1TOAA 4Z2AA 4KMSA 4Y0VA 1VIAA 3HKDB 2OZKA 4JKYA 3H9BA 4JLNA 4RIIA 5I9MA 2MT9A 3C7TA 4IWYA 1XTSA 2VK2A 4BEVA 2VXCA 4I8IA 3S2FA 4BLVA 1X13A 3L49A 4RTJA 2IEIA 2MTBA 1XP8A 1PDOA 3NDPA 1RTTA 1SU7A 4Q05A 1E64A 5BW6B 3S1AB 1F8GA 3CNOA 3UGKA 3UWDA 3QSYA 4CKCB 1Y1LA 3H6KA 4KN9S 1EU1A 3A06A 3W8NA 1U8XX 1X74A 1Y8QA 2TMKA 3OBIA 4J6FA 3VKWA 2BFFB 3P2JA 1Y5MA 3NCHA 1QHNA 5E1MA 1BKSB 5C4MA 2FW7A 3EXHB 1AG9A 3T5CA 2KPOA 4GMXA 3HQ4O 4J94A 4URZR 5DYTA 2QPOA 2VN8A 1FNCA 3AESB 1QH8A 4RDXA 1CUZA 1I14A 1GGNA 2AF3C 5JNRA 4DR1B 3TQSA 2Q2WA 3EEFA 5EHQA 3SSNA 3LDGA 1XVLA 1SZDA 3H1FA 3MUNA 3OZRA 3P8ZA 4LZZA 4X94A 3F4KA 2CXTA 2VDUE 2Y3IA 2O7NA 4NHOA 3TBHA 1K3FA 1J2RA 2CB9A 1RTKA 2X1HA 2YINC 4YQYA 5JD4A 3DHEA 3SVTA 3PVCA 1F3OA 3KAKA 3KYBA 4FPXA 1ZCZA 3W5AA 3VH2A 3WGMA 2XTMA 3C97A 5H9WA 1KZ1A 4MKIA 2E6UX 3AT1A 1KP9A 3I2YX 5AI8A 5K8LA 3EOAI 2BMFA 4HV4A 3PDHA 4F4CA 2ZYVX 3Q11A 3T3DA 1DC4A 2JAOA 4RTOA 5FO1A 1ADJA 1IG3A 4RY0A 1KRXA 2XYQA 3HDVA 3SR3A 1A8UA 1TEXA 5EKSA 2HGSA 2QTAA 3VI4B 4W5TA 4RD6A 1C1YA 1WU8A 1UKYA 2WU4A 2XRZA 2VJCA 5KNBA 1BCSA 1CUHA 1YONA 4ZALA 4OI0A 1RYZA 1U3UA 2NT3A 4IS2A 3LPAA 4MK4A 3HCOA 2E37A 2NPFA 3SJZA 4AS1A 4INOA 1H2RS 1RI1A 2BAGA 2FU5C 2WKPA 1T5DX 3DWIA 3NZEA 3OT1A 4I99A 4NICA 3OZVA 4YJGB 4YR9A