4C4YA

Crystal structure of human bifunctional epoxide hydroxylase 2 complexed with a4
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
314
structure length
314
Chain Sequence
PSDMSHGYVTVKPRVRLHFVELGSGPAVCLCHGFPESWYSWRYQIPALAQAGYRVLAMDMKGYGESSAPPEIEEYCMEVLCKEMVTFLDKLGLSQAVFIGHDWGGMLVWYMALFYPERVRAVASLNTPFIPANPNMSPLESIKANPVFDYQLYFQEPGVAEAELEQNLSRTFKSLFRASDESVLSMHKVCEAGGLFVNSPEEPSLSRMVTEEEIQFYVQQFKKSGFRGPLNWYRNMERNWKWACKSLGRKILIPALMVTAEKDFVLVPQMSQHMEDWIPHLKRGHIEDCGHWTQMDKPTEVNQILIKWLDSDAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords BIFUNCTIONAL EPOXIDE HYDROLASE 2
publication title A Combination of Spin Diffusion Methods for the Determination of Protein-Ligand Complex Structural Ensembles.
pubmed doi rcsb
source organism Homo sapiens
total genus 93
structure length 314
sequence length 314
ec nomenclature ec 3.1.3.76: Lipid-phosphate phosphatase.
pdb deposition date 2013-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4c4yA00
1NU8A 3DL4A 3ESCA 1QJ4A 3W04A 2QUBA 4W1SA 2OGTA 3E3AA 4C89A 5AKGA 5JADA 4DNQA 1IZ7A 5FLKA 1SC9A 3C45A 3D5EA 1P0QA 4J0JA 1Q0RA 5IVHA 2GBIA 2PL5A 4ARAA 3LCRA 4WY5A 1XZGA 2RAUA 4GHWA 2UZ0A 3BDIA 3HACA 1WB4A 3BL8A 4N8EA 1DINA 2Y1KA 1GGVA 1PV1A 3S2ZA 2JGFA 1CUEA 4C6HA 1EB8A 4X6UA 2V9ZA 5JAOA 4BZZA 1JI3A 3HXKA 2J4CA 5CMLA 4OYYA 5LZ2A 4WY8A 5AKZA 3UUFA 3FLEA 1XZEA 3PE6A 1B41A 1QE3A 4BE9A 3A2NA 1E5TA 2I3DA 5FDFA 4U2BA 4QZVA 2VSQA 1QIFA 5HF6A 1JFRA 3KSRA 5AKLA 4BE4A 1ZJ5A 2EDCA 5AO9A 3WYDA 1IVYA 3H2JA 4Z49A 5JATA 2XDWA 4H7HA 4C4ZA 4ARBA 1QIJA 1XZFA 1C7IA 4WCVA 5FXMA 4QDOA 4KYVA 4IHAA 3AJAA 1ACLA 2DSNA 1GKLA 1TCBA 3GUUA 2BJHA 1VOTA 1BEEA 2R11A 1XQXA 1YA8A 2W6CX 1BN7A 4PNZA 5CXXA 1HQDA 4FBLA 2VJDA 4GWLA 2HA3A 1JJBA 3QVMA 4OUKX 5LP1A 1XZLA 3WJ2A 1T4MA 4EB0A 4KAFA 4PF1A 3ZLVA 5EGNA 4F60A 3QMMA 2XUOA 1ETHA 2CB9A 2WFLA 1AMNA 1VJ5A 1VA5A 4J0IA 2XQJA 1ZIYA 4FNGA 1E8DA 2DFPA 5AOAA 2Z3WA 2G63A 3I1IA 4NS4A 4CG2A 3DL7A 1XKTA 1CQZA 1E3QA 2FX5A 3D59A 2CMFA 5ALSA 2H7CA 2BFNA 4Y2YA 4D9JA 2VATA 1R88A 4HTAA 4B0PA 5HKAA 4Q3KA 4YX9A 1ZD5A 1A7UA 3D2BA 1CFJA 4Q05A 3BF7A 1RWQA 3EQ9A 3AZOA 2QUAA 2XQGA 3CN9A 2HL6A 4DTCA 1ZGCA 2ZSHA 4E46A 1LPOA 5LKAA 4BRSA 3GELA 2OCGA 4HVTA 3IULA 3F8SA 2XE4A 5T4EA 4BAGA 1UWCA 3WWPA 4BCDA 5AI0A 3DS8A 2ROQA 5AM0A 1LZLA 3ICVA 2BKLA 3H2GA 5AM5A 3YASA 2QZPA 3H2IA 4ZWNA 3IIIA 1UK6A 1R1DA 3AIOA 4X90A 3S8YA 2PUJA 1TK3A 1PJAA 4UBOA 2QOEA 1XRNA 3RLIA 4C4XA 1CLEA 1XRPA 4I4CA 5ALNA 1XLUA 2J4FA 4BBZA 3C6ZA 1QIGA 1ZICA 1CIJA 3L1HA 3WJ1A 3QMWA 4QNNA 1WB6A 2WQZA 3SC2A 1GQSA 1ZD4A 3M82A 3D2AA 5KBYA 4BTLA 4C4YA 3K6KA 2GBCA 4B9AA 2VA9A 4AO6A 1H2YA 3H2KA 4XX1A 2JEZA 4LXHA 2WIJA 3FYTA 3W9UA 1MPXA 2PSHA 1XQVA 5AI5A 1QOZA 5AK5A 3ZLUA 2XUKA 1EB9A 4GLBA 3I2GA 5DYYA 4QWWA 4INZA 1FFBA 2XLBA 4W63A 2H7YA 2ZJ7A 3CCBA 3HLKA 3ZLTA 5EIEA 5JD4A 4Y2PA 1KEZA 3AIMA 3G9ZA 4CIBA 5I8PA 1EVQA 3F67A 1QO9A 4U2DA 4FOLA 4IH4A 1LBSA 4B80A 4M0FA 4V2IA 1CUFA 3UMJA 4J0DA 4AN0A 4LKOA 5ALTA 3EBLA 2PU7A 1YAJA 2HFJA 5ALGA 2HFKA 4BCBA 2WFMA 1VZ3A 2YYSA 2HIHA 3P2MA 3N0TA 1XLVA 2IIVA 2WLSA 3R40A 4J0CA 1PFQA 5H3HA 1UOPA 4N8DA 5HK8A 3WK4A 3GFFA 2WUGA 2X8BA 4G9EA 2G5PA 4EY6A 5HK9A 2OGSA 1O6GA 4FLFA 1ISPA 1DQZA 2BAGA 1C7JA 3HC7A 3C87A 2RONA 4HRYA 4KR0A 3W06A 4BCCA 5AKKA 4QDTA 1H22A 1E66A 3C6XA 1VZ2A 4W1RA 4DMHA 3OPMA 5CT6A 4MEAA 4G5XA 5A62A 2O2IA 2JGJA 4H35A 3RARA 4UBJA 1ORWA 2OPHA 5LYYA 3IDAA 4HXEB 1WCYA 2YXPX 4MYDA 1F8UA 5IVKA 4OB6A 2H7XA 5F4ZA 1CUAA 4BVKA 1UFOA 3AZQA 2X76A 5HF5A 2JGKA 5DYTA 2XQKA 1XFDA 4BP9A 2C7BA 2AXEA 5E2IA 2ORYA 4EY5A 1XZBA 3F98A 4UBKA 3L1IA 3TEJA 4YASA 4PSUA 1TRHA 2I78A 4J3JA 1WHTA 4G8BA 5T4HA 3KOOA 1Q83A 1H2ZA 3FYUB 3WWCA 4EY8A 4LYDA 4XJVA 1QTIA 4DYHA 1HPLA 4Y2UA 4ZRDA 2WTMA 5JD6A 2JF0A 4KRYA 1N1MA 5HF8A 1JMYA 4G9GA 4L72A 5LZ9A 4MWTA 2WM2A 3H0CA 2WHPB 1UKAA 5I9IA 1MT3A 1SCQA 1K8QA 5LZ5A 1X2EA 2WILA 2LIPA 2HRQA 3U1TA 4H7JA 4Q34A 1FFCA 3PICA 5AOBA 1J07A 3CN7A 3M83A 2JGMA 4DNOA 1M33A 3KXPA 1S8OA 3DEAA 4YPVA 1W6RA 1G66A 4U2EA 4AZ3A 2QJWA 2WIDA 4PSDA 1CUXA 4LXIA 2PX6A 3DJYA 4JEIA 2OCKA 3V1LA 3C5VA 2AJ8A 5T4BA 3FWHA 3BIXA 5AI6A 1EA5A 4J0GA 4DSZA 3ANSA 1DTEA 4TGLA 1X70A 4FFWA 4AXBA 1YAHA 4KE8A 1E8NA 2RGUA 4G4IA 1VXOA 1CUGA 5IVDA 3BDVA 4UUQA 5ALKA 2QM0A 4CG1A 2QXTA 4OSEA 4MQLA 5I7UA 3WK9A 5FP0A 4H0CA 5CH8A 4QDZA 3I1YA 2WUDA 3ILSA 3AINA 5KWJA 1SOMA 4E14A 1XZIA 2AJLI 1F6WA 2W22A 3OC0A 1L7AA 3O95A 4H7EA 2C4HA 5IVIA 1N5RA 2VJCA 5DWDA 3EF3A 3MGAA 5DLPA 2O7RA 4GECA 1EDDA 3BJRA 3I2JA 1H2WA 3K9BA 3C70A 5CRIA 1CRLA 3OOSA 4YK7A 1NX9A 2Y2UA 2PM8A 1UK8A 4H7KA 4Q3LA 2HA6A 3IURA 5FKJA 4C01A 2D0DA 2YH2A 2CEKA 2HDWA 5C8XA 4CCYA 5DJ5A 1G42A 2QMQA 3M3DA 1E8MA 2OAGA 3F9CA 1FJ2A 1LBTA 5C8ZA 1CUVA 1OCEA 4GDMA 1IUNA 1LZKA 3C43A 5ALOA 1CUBA 1U4NA 1ZD2P 5CURA 4B84A 2PSFA 4Y2SA 4FKBA 3STVA 5D7BA 3G0GA 1YASA 3AZPA 3H1AA 4HXFB 2VT6A 3ZPXA 2HHAA 4PW0A 3DDUA 3FLAA 4CG3A 3G0CA 3PFCA 2PU5A 2Z3ZA 4U2CA 3WQHA 4BAUA 2XMCA 4X91A 1XZCA 5DNWA 4KRXA 3T52A 1EK1A 2WSLA 2AJCA 1FFEA 4CFSA 4RNCA 3WZMA 2WG2A 1VA4A 1H2XA 2XUDA 2GYUA 3DYIA 1EX9A 3M81A 5ALFA 5AM4A 2WTNA 1K5PA 1XQYA 5ALUA 5JASA 4QE3A 5AH0A 4WDRA 5CW2A 3G9XA 3WA6A 1DT3A 5AIBA 1CVLA 1NU6A 4UHBA 3WI7A 1W52X 3WKDA 5C81A 4BVJA 5AI9A 4FFVA 4CIAA 1GKKA 1GPNA 2XUAA 1CUUA 1XZMA 2XMQA 1JT2A 5BV7A 7YASA 4LYEA 5KWIA 1AQLA 1EDBA 3E4DA 5AKIA 4BYMA 5BWCA 2J3QA 4DIUA 2WFLB 3QZUA 6YASA 2B61A 2XUGA 3Q0TA 5FUMA 2O7VA 1WHSA 3DD5A 1YSCA 3SWWA 1BRTA 1BCRA 1LPSA 2C5FA 1VKHA 3PDCA 1MNAA 1A88A 3H18A 2V97A 4XVCA 3WWEA 1EH5A 3LP5A 4F21A 1U65A 1YS1X 3STXA 1K4YA 1EINA 4BVLA 2WHQA 5AKHA 5AJHA 3G0DA 2K2QB 3DOHA 3TRDA 2VJBA 4OD0A 4X71A 2G5TA 2YASA 3BE8A 5AHXA 1X2BA 3O4HA 4ZI5A 1W75A 4OCZA 2OXEA 5J3JA 1IUOA 4N8SA 1UK9A 5FV4A 2BCEA 2C0PA 1YCDA 1JJFA 3IB3A 3FCYA 1BE0A 2QT9A 2ZYRA 4P08A 3V1NA 3FCXA 4K6HA 3STYA 3QPCA 5AM1A 2PSDA 2XMRA 2JIDA 1Q0ZA 4UBNA 4FTWA 1ZIXA 4WJLA 4KE7A 1TKRA 1KU6A 4H7DA 2C5GA 1MAHA 4A5SA 4TPKA 4I19A 4RPCA 3V48A 3AFIA 4FWBA 5JAUA 4FLMA 3PF8A 3WK6A 4KE6A 4RGYA 4A23A 4O08A 4AO8A 2OCIA 3HRHA 5ALJA 1OXMA 3G9UA 2Z8XA 3D0KA 5JARA 1DWPA 4GXNA 4OU4A 4Q1VA 5AKYA 1BROA 1QIHA 4DLNA 2QXUA 1QIEA 4X95A 1AX9A 3PI6A 3R3UA 1IMJA 4BZWA 1LLFA 4EY7A 1W4LA 5CXUA 4OB7A 3C6YA 2WIFA 3QBJA 1U2EA 5K3DA 5C8VA 2GYWA 4B7ZA 4M0EA 1U8EA 2B20A 4BC1A 3G0BA 3F96A 5EHQA 3IBTA 1B6GA 4DM7A 2AJBA 1EXWA 4BB0A 2PPLA 3GZJA 3ZV7A 3R3ZA 1ZOIA 5ALXA 2CUTA 4UFNA 3VISA 1UKBA 3HABA 5LKRA 4PQEA 3QMVA 4J03A 5K3EA 5JZSA 1XZAA 5HFNA 5JAPA 4OU5A 3BWXA 3WK8A 3ANTA 4H7FA 4RE6A 1XZJA 3EIOA 3LIPA 4GEGA 3AIKA 2ECFA 1WM1A 2RI6A 1ZJ4A 3L1JA 1CUIA 1CUDA 2ES4A 2IITA 5K5EA 5LLSA 2XUQA 1YB6A 2VTVA 3KWJA 1QIMA 4U2FA 4XIIA 4DNFA 1P0MA 4DMKA 4LIPD 3IA2A 3DQZA 2CKMA 3WK5A 5CT9A 3W2TA 4DNPA 5DNVA 2XMZA 1AZWA 1WB5A 4QLAA 4UHCA 1TQHA 1EHYA 4AMZA 4Y2XA 2BUCA 2OGZA 1YR2A 5AICA 1CR6A 1YS2X 3HYSA 3OURA 5ALWA 1ZGBA 3QYJA 1J2EA 3EQ8A 4Y2TA 3ESBA 5CT5A 4K5QA 2GZRA 1JMKC 5ALMA 3QM1A 4X7BA 4HS9A 3JYHA 3IUNA 1QLWA 2JGIA 2XUIA 4H18A 2JGEA 1E89A 5AM3A 1VE7A 5JYCA 1TAHA 1QFSA 5K3FA 4B0OA 5CBKA 3KDAA 1G5FA 1DQYA 4FDMA 4MXDA 3FOBA 2WU3A 4ZXFA 2DHEA 4G8DA 4GW3A 4UHEA 1JU4A 1AUOA 3I6YA 5IKXA 5E4TA 2OG1A 1SFRA 1XZDA 5CT8A 5ALHA 4F5ZA 3MUOA 3I2HA 2JBWA 2DQYA 5AOCA 2VJAA 1QO7A 4UHHA 3SK0A 3H1BA 2Y6VA 2AJDA 4K2AA 4B82A 2Z8ZA 1XQWA 1BU8A 3D3NA 3ICWA 4P92A 1FSSA 4X97A 1LPNA 4MYSA 2CJPA 1W1IA 5A6VA 1F0PA 4X85A 1QIDA 3GBSA 2GZSA 4DMFA 1LNSA 2HADA 4KAAA 3WL8A 4BRZA 3O4IA 3ZI7A 5JZBA 4FNMA 5ALDA 2BGNA 3PUIA 5ALLA 2WHRA 3FLBA 1K6EA 2NW6A 4WDQA 1GZ7A 4KJXA 1RYYA 4G4JA 4MJ3A 1LPMA 2HA4A 3OTQA 2XMDA 3I28A 3A70A 4WFIA 3GROA 5A2GA 4HZGA 4RE5A 3ESAA 3LLCA 3R3VA 3WIOA 1R50A 5FOQA 5JAHA 3V1KA 4B9EA 4MWSA 1K63A 2V98A 3A2MA 2HA5A 2RHTA 3I2FA 4PV7A 4UFOA 1UKCA 5ALIA 5LZ7A 5DYWA 5DNUA 2DR0A 2PUHA 5ESRA 4QA9A 3I2IA 5CH5A 2ZSIA 3K2IA 2HU8A 1HL7A 3N2ZB 2WU4A 3FSGA 4H77A 1TCCA 5E4YA 5A71A 4CCYB 1QZ3A 3A6ZA 2XQIA 1CUCA 5LZ8A 4A16A 3R41A 3HZOA 3V9AA 5LIPA 1DU4A 1BN6A 5AK4A 1W76A 2DQZA 2QVBA 5AKEA 5ALZA 4H7IA 1MO2A 2I03A 3O4JA 1YA4A 2WJ3A 2WKWA 2GBGA 5HQ3B 5HZGA 1ORVA 3G02A 4WFJA 3VJLA 3D4LA 4W1QA 4Y9SA 1AURA 2VEOA 5A7GA 4JNCA 5HQ3A 4UHFA 3HJUA 2H1IA 1Y37A 5CH3A 1BCSA 5ALRA 4NZZA 2WIKA 1A8SA 1OILA 2G4LA 4DGQA 4EY4A 5EHXA 3WKBA 1ZI6A 2V96A 4UHDA 3I6MA 2B9VA 1UZAA 3H17A 4BP8A 3H19A 4F0JA 2O2HA 4IQ4A 1ODTC 2WG0A 5EIHA 4Y7DA 2XQFA 4Q82A 3FVRA 2BUBA 2WJ4A 1O6FA 1Z68A 3HSSA 1WPRA 3R0VA 2PKYX 1P0IA 4X3CA 4FHZA 4KE9A 5C7YA 1I6WA 3G0IA 2HRRA 5A7HA 2HU7A 3NOXA 4X6XA 1QIKA 1R3DA 1KU0A 1JJIA 5LZ4A 1GT6A 5AIAA 2OCLA 1CUHA 1MX9A 5DTJA 3JWEA 4EA6A 1GPKA 2HM7A 1QIIA 3C8DA 3NGMA 1GPLA 5T4FA 4BAZA 2ZJ6A 4W1PA 5JIBA 2ZYHA 2OAEA 1J1IA 1AKNA 1MJ5A 1H23A 2J3DA 4S0XA 1GQRA 3QITA 4UFPA 4G4GA 3NWOA 3RK4A 5CT4A 3AUKA 5K3CA 1ODCA 3OM8A 2E3JA 1CUWA 4LXGA 2PBLA 1R4ZA 3WL5A 4E15A 2XMGA 3Q8WA 3AILA 1XRRA 1IUPA 2QRUA 3ED1A 2ZYIA 2JEYA 2XUPA 4N5IX 2XUFA 4L0CA 5EHZA 4BC0A 4KEAA 3MUNA 1HDEA 4P9NA 1VE6A 5K3BA 4AZ0A 4DSAA 1DWOA 2IX9A 1MN6A 1XKLA 4X94A 1L7QA 4HXGA 4IH1A 5AK3A 2CBGA 4B85A 3PFBA 2VQ6A 4W9RA 1J06A 1QFMA 2Z5GA 1EI9A 4PSCA 1THGA 2VF2A 2OQVA 3O9MA 1TIBA 3WWDA 3LIIA 2GYVA 4HAIA 4J0HA 5SYMA 3U0VA 3FSGD 5JZ9A 4LHEA 3WKEA 3D7RA 3DKKA 4HRXA 1MNQA 4NVRA 4K6GA 4X92A 4CCWA 2VT7A 4OB8A 1XZHA 2XMSA 5HF9A 5JANA 3GA7A 4UBMA 2EDAA 1ZI9A 3TGLA 5ISMA 3CCCA 3DKRA 5BWBA 2ACKA 3DNMA 2VAXA 4J7AA 2VAVA 1FFDA 2QR5A 1IZ8A 3HEAA 4BATA 3OG9A 5CTAA 4C88A 5AP9A 4EHBA 2FJ0A 5D3ZA 3VVMA 5ALVA 1SCIA 1LPBB 3T4UA 4BTVA 3C5WP 3QPDA 1CUZA 5FPQA 1DX6A 4P93A 2RIPA 1XLWA 3R3WA 2X5XA 3NUZA 3RKSA 3SX4A 3R3XA 5ALEA 4Q3OA 3IUQA 3PUHA 3LS2A 4U2GA 1ODSA 2BGRA 3BXPA 1LPAB 5HFAA 1WPXA 2O2GA 5AI4A 5EFZA 1UOQA 1THTA 3DCNA 2ZVDA 2GBFA 3X3HA 1AGYA 1DWQA 1LPPA 1L7RA 3DOIA 1TCAA 1SCKA 1CUYA 3MVEA 3WKCA 1CEXA 3WL7A 3O9VA 3DYVA 2QJRA 3DLTA 3QPAA 2QS9A 5ALQA 3FVTA 3VJKA 4ZV7A 5AKXA 1CPYA 3H2HA 4JUIA 2C0QA 3JW8A 2R8BA 4I3FA 2C58A 3HI4A 2XI4A 4Y2JA 3IUMA 3IVMA 4IO0A 2WFZA 3D2CA 1UOOA 2QKYA 4PO3X 4K6KA 1LGYA 1VLQA 4G1FA 3STUA 2XUJA 2EEPA 3WA7A 1F0NA 1Y7HA 2JGLA 3IUJA 4JYMA 1C4XA 1RP1A 2RHWA 1VXRA 1UXOA 4TVKA 3BF8A 3PF9A 4WFKA 3VKFA 4ZV9A 3STWA 5AK6A 4ZGBA 4QDUA 4ETWA 1DX4A 1JKMA 1HLGA 3G7NA 1MX5A 3WYNA 3VXKA 4AX4A 3G9TA 1UT6A 1QONA 4XWGA 2FUKA 2HA7A 5BOVA 5EHNA 4FBMA 4L9AA 4B81A 3VVLA 1ZD3A 5K3FB 4N5HX 4KAJA 2B4KA 5JALA 4QDXA 4KACA 3B5EA 4AO7A 1D07A 1YB7A 2BUAA 2PSEA 2XT0A 1ZI8A 3I6ZA 5AM2A 3H04A 1ACJA 3V1MA 5AI8A 2H9YA 1XRLA 1HKHA 2Y6UA 1Y7IA 5A7FA 4B6GA 2XB6A 1A8UA 2HA0A 4JYPA 3KWFA 4Y2VA 2I3ZA 3B12A 3TJMA 2XMBA 2OQIA 1QGED 4CI9A 1XRMA 3WMRA 1BEZA 4ITVA 2PSJA 2OLEA 3ESDA 1R9NA 1AC5A 5HCUA 2D5LA 1UK7A 1USWA 4UPDA 5JD5A 3WZLA 3WLAA 3A2LA 2DHDA 1G4HA 4X93A 5EIAA 2ZYSA 3I2KA 4M0MA 2DHCA 2Y2VA 3C8HA 1MAAA 1HBJA 4IH9A 4B83A 3EQ7A 4QWMA 4E11A 2ONCA 1EK2A 4Y2RA 2PVSA 3UUEA 2WJ6A 4J0KA 4Y2QA 2XUHA 4BDSA 3RM3A 4JH0A 1QTRA 1XRQA 4EUSA 2QTBA 5D3KA 2P8SA 3CXUA 2ACEA 4X6YA 3E0XA 3FYUC 4MEBA 3WWOA 5KREA 3C6BA 1CQWA 1Q84A 1XROA 2DCMA 2FJPA 4QEKA 2WUEA 3WK7A 4FLEA 3FYUA 5SYNA 2ZJFA 1N8SA 1P0PA 4X00A 5AKJA 5IH7A 3VDXA 3E1GA 5D6OA 1XZKA 3FNBA 1MU0A 5ALYA 1R9MA 1T2NA 3G8YA 2WHPA 4ROTA 4FMPA 5YASA 1DT5A 5EI5A 2HU5A 4OYLA 3R3YA 4GI1A 1MTZA 4EBBA 4L3WA 2Q0XA 3O0DA 1WOMA 1EDEA 4AQDA 3O4GA 1EVEA 5FPPA 4C87A 4EZIA 5K3AA 4AB1A 3FAKA 4DMCA 2HA2A 5HKBA 4AMYA 5ALPA 2WIGA 1JU3A 1FFAA 1MX1A 2WUFA 1CV2A 1GXSA 3W05A 4BDTA 2XLCA 3WIBA 5FRDA 3BIWA 4AN1A 1N5MA 3W9BA 1CUJA 4UBLA 3STTA 4OPMA 5DTIA 3KD2A 4QLOA 3WL6A 5E4JA 3VJMA 3ZWQA 4GBGA 3QH4A 2CZQA 3FBWA 3B3QA 4ZREA 3BJMA 2WG1A 4G8CA 4UBIA 3WKAA 3F97A 1A8QA 4MQMA 1CUSA 4NMWA 1BS9A
chains in the Genus database with same CATH superfamily
1SULA 1YI1A 4OGGA 4JB8A 4PG8A 4DSUA 2IC5A 3HDTA 3DL4A 3BB1A 2NSDA 4HJXA 4J76A 4BNUA 4Q4HA 3QKWA 4D1YA 3IBFA 5E7MA 3W04A 3JQ7B 2I4MA 2OGTA 2ZR9A 2DQKA 4JX8A 2Q29A 2OMEA 3CEHA 4US1R 1X7WA 3SQMA 3O8CA 3IUSA 1NBME 1XB2A 2NQ8A 1F48A 3ZY2A 1N3LA 4I9HA 3K92A 5FLKA 2E5WA 1E7YA 2IS6A 1SC9A 2PWBA 3INTA 1NQUA 3C45A 3D5EA 1P0QA 5DI3A 3OQJA 4J0JA 2QYOA 2F59A 4MRNA 4O8CA 4WESA 2PRSA 3S4YA 1MT0A 1BX0A 4YQZA 4XDHA 3DZHA 2OPBA 3FPJA 2PL5A 3LL7A 1Z26A 1NMZA 2JZOA 5TMDA 5TPWA 2ATCA 5KZMB 3LCRA 3RS5A 2WAOA 3CSSA 1Q15A 2RAUA 3X1MA 1LF5A 4L57A 4RFSB 1RMTA 4NNOA 4QTYA 4U5QA 1UMCA 5CPFA 3R7SA 1TECE 2J3JA 5NLLA 4PZZA 1FUYB 4P2GA 4N8EA 4S04A 1P2TA 3K20A 1SB9A 3AFOA 3VNRA 1GGVA 4JBIA 4P7GA 1PV1A 3BXFA 1JHZA 1RM0A 2IPOA 2JANA 4NAUA 1E0JA 3S2ZA 4ZK2A 1CUEA 3L1VA 2Y68A 3LT0A 1IN5A 2AW3A 4RVUA 3RREA 4L08A 2XNCA 2F1OA 1VJDA 2F8MA 2IYPA 1N78A 2BI7A 2VOEA 1P45A 3O8RA 1JI3A 3HUFA 1QZZA 2N47A 2DR3A 3VO2A 3HXKA 1B74A 1KIFA 3CT4A 1GTZA 1ODJA 2DBQA 4F9EA 2H9IA 2JIMA 1UM9B 2CYCA 1VKOA 4OYYA 4YB8A 4COOA 3DONA 1PLLA 5AKZA 3CR8A 3ZD6A 3ND5A 1C2TA 1XELA 3PUYA 4Q12A 1O6CA 2Q5CA 3TW4A 3UUFA 3ZN2A 3TS1A 4XIJA 1WCIA 1XZEA 3AJ9A 4AW9A 3PE6A 4UQOA 5J4LA 3L8DA 3SZRA 1B41A 1T24A 1M5UA 1QE3A 2NO1A 4YJHB 1DXOA 5EYPB 3C7KA 4IJMA 1KDOA 3HYRA 1UM9A 1YIOA 3DHWC 4LV6A 3IP5A 1ILWA 1TQ6A 5B2FA 2ZBEA 3C2QA 4QZVA 1N4DA 2X15A 3OSUA 2VSQA 4PO1A 3GVHA 4FZ3A 3TQCA 4KRFA 3O31A 4RD3A 3FG9A 1QPBA 1GGHA 2WBLC 4CM3A 3KSAC 3IBGA 5AOVA 3N8DA 1VE5A 2KW5A 3MCVA 4ALJA 1H05A 3OU6A 2BFCB 1A9YA 1ZJ5A 4M87A 3PRHA 3WB1A 4GGOA 5EYPA 4MULA 1G17A 1P2GA 3B85A 4KV9A 3EFOB 2Q3DA 1OZFA 3LZDA 1O94D 4P0PB 3H2JA 1Y1LA 3LHDA 1HT0A 2H92A 2JFHA 2YHAA 1XTPA 4IKOA 2ZJZA 4N5DA 4O33A 4Y0VA 5F2KA 3W78A 4PNEA 1SAYA 5F9MA 1KJZA 4MVWA 4DBLE 4R98A 3OJOA 1D6NA 5AVYA 4UMVA 4G26A 1MQSA 3T0GA 4F93B 2GCGA 3DE5X 3NOVA 1UZMA 2QN8A 1RWVA 4QDOA 4KYVA 4DQDA 4B3HA 1WE2A 2OKCA 4O1IA 1F14A 2W70A 3U61B 3R5FA 4OHKA 2BBSA 2CXTA 2P35A 3CUEF 1Y98A 3P8ZA 4GC5A 3OLVA 5K4HA 2DSNA 1K7XB 1YT5A 4YWJA 1CNEA 3WY9A 3F4KA 2PBFA 3K73O 3H4VA 2BFDB 1KI6B 1WETA 3ZDQA 3PGA1 4F2PA 4DB2A 1X7GA 4K8OA 2C8KA 1EWQA 2PJRA 2PLWA 2PS9A 4LTDA 2XVYA 1UXKA 1NAIA 1UP6A 1LCIA 1G6KA 1D09A 2PY6A 4YQYA 5FTWA 5B1IA 4JI3B 5JYDA 4HBZA 1YA8A 4FYWA 5EXPA 5HS4A 3REGA 2AC4A 4N12A 5DH9A 3R1IA 1WZNA 5EJMA 2QVCA 1SQ5A 1FTQA 4NFHA 3PFHA 5DHPA 2FFQA 3B3GA 1VIAA 5CTJA 1JFLA 1J00A 1R5BA 2EFGA 1GFZA 1KI6A 1VBNA 5IC6A 4DWOA 2PLFA 3P2OA 3ZOZA 1NNUA 4IOJA 1A71A 4HQ6A 4EKIA 4O4JA 4WKNA 4IOKA 3QVMA 1GN8A 1Z2DA 2IYQA 3GRRA 1C3JA 3NKLA 3SN6A 5LP1A 3WJ2A 4LNUA 1XSEA 4PC3A 3C6KA 1T4MA 1WUKS 4EB0A 2IHJA 1Z5PA 4P5PA 4KAFA 3ZEAA 2QRGA 4PF1A 4DDMA 4NXNB 1G5HA 4O2LA 1RJ9B 3NGLA 3C41J 1ZIOA 4HP8A 2OR3A 4ROSA 4CKWA 1B3RA 3OX2A 4NV1A 3WYBA 1G21B 4AECA 2FW9A 1L5HB 3N2KA 4KIFA 1VJ5A 1AMNA 4MUXA 1QG4A 3A4NA 1T5LA 4PR3A 2PEYA 4NQZA 4OP1A 3U1VA 1FQKA 1JQLB 2ODQA 1B8NA 2IHUA 2ZYUX 1FFHA 3PTZA 3QPWA 1XDSA 4FNGA 4KQIA 5F1KA 5LVAA 4KQXA 2CXQA 4IMJB 2C2OA 4XD2A 2G63A 3I1IA 1XTRA 4MVJH 3EPHA 5ERYA 1U80A 1Y5NA 3HKDB 3LW7A 2R1ZA 3QQ5A 5I7AA 3S99A 3WJAA 1A95A 3SM9A 2WHXA 1THZA 1XKTA 2PZKA 1ZN2A 4LC9A 4OFZA 3T3HA 2XQVA 1QDUA 2JARA 2VAWA 3L6OO 4D9EA 3WLHA 3U37A 5J2TA 2O05A 4KK4A 4ZCPA 4ND5A 4BNVA 2N75A 2CMFA 5E8JA 3UATA 4W4TA 2YUIA 2O2DA 3R7BA 1DNPA 3NC0C 3L0SA 5LU9A 1B15A 1SKAA 1X39A 4X1YB 1K4MA 2ZANA 2YOFA 5IC5A 3T5DA 2IZ0A 4U02A 4HYTA 3EXG1 2ZBFA 4J1QA 3N6VA 1VLVA 3W2EA 4D9JA 4R2JA 4F86A 4WKBA 1R88A 4EPXA 1WKVA 2P2CA 5CYOA 1TRKA 3K1TA 4OTZA 2PSSA 3WHIA 2XDYA 2ACVA 4TOIA 2F55A 4PR0A 3SXJA 1UBCA 2Q3MA 1EBUA 1JSCA 3PE4A 4NZPA 5AK0A 3DLBA 1P5ZB 1J8DA 4Z3OA 5ES3A 1E2GA 3D3WB 1EFDN 5IDYA 4DV3B 1EWTA 2QTWB 2PCLA 3CN9A 1O87A 3QSYA 1LBIA 1MC5A 3EVAA 3BRWA 4MR8B 1TUGA 4ZZ1A 3JSXA 2WDZA 2ZSHA 3H7AA 5KKAA 1GUFA 3REQB 3MOSA 5IYZB 1C30A 5KTNA 4NZNA 4FR0A 5I4BA 2CZCA 3A6GA 1W1UA 4MVJD 3IULA 3WB0A 4JQZA 6LDHA 2WD9A 2C8VA 1E69A 2OCXA 1UWCA 4I36A 2V9CA 1ORHA 2AQIA 2EGHA 4O1MA 5F1OA 3UIEA 3WWPA 2ZTUA 1YNOA 3K70B 4B5LA 3B2QA 4LWQA 5EQTA 1P91A 4MR8A 1O0SA 3HBLA 3REQA 1XBTA 1Z22A 3LWBA 5AM0A 5FFFA 4UJ3A 4DFDA 1I4WA 5H80A 1C4OA 2I7CA 4N0PA 4JP5A 3ICVA 4OFWA 4Q4CA 3GAAA 4G5HA 5AVKA 3COJA 2XCLA 2Q1YA 3H2IA 1RJEA 1W30A 4KO1S 4BTEA 4EHHA 3ICEA 1JHOA 4PX5A 1KKUA 1TK3A 5NULA 4JJ7A 3HMKA 4MWEA 5P8WA 1H6CA 1JVNA 4B3XA 2YZKA 3FWZA 1HM5A 4JY7A 2XEDA 3EQ6A 4PQFA 5FPTA 4AYTA 1FQWA 2Q6KA 3AHIA 1D2GA 3AQ4A 2C3UA 3MTJA 4C4XA 1MTOA 2BEVB 4I4CA 1GKYA 1K0FA 1AQNA 1M74A 1XLUA 1YD7A 2FTKE 4MGEA 3DVAB 1TFRA 4F7WA 5K8VA 1CJVC 2BIFA 4RK4A 2NO9A 5K2MA 3T7EA 5CBPA 1B2LA 2C7RA 3DE7X 2ZSKA 3IMGA 3LY9A 4DNXA 3MBOA 1QH9A 2XOKD 3BJIC 2JIZA 2FWBA 4TMYA 1X7XB 1EJBA 1T9ZA 5JC1A 3O1JC 3EXHC 4EVRA 5KI6A 1VJ1A 5FNZA 1ZICA 2D6FA 4TWBA 1U2TA 1E7MA 5GWXA 5HIKA 5B37A 3EZYA 3HR4A 3QMWA 4PZLA 3IVXA 4DUZB 3W1EA 1CJKC 3LLVA 1X6VA 1C0EA 2P2SA 4LJ8A 1ZD4A 4KXVA 5KWEA 3EXHA 1KVUA 3OKAA 4YMVA 2ZYGA 3QV2A 4NP6A 3R7WA 2HXYA 1J90A 3DEHA 1Y4AE 3TOVA 4EBFA 5JNSA 3ND9A 2QGNA 5FWDA 3KBOA 1R8YA 2VWQA 1VB5A 1H1LA 3AVXA 4HAZA 1L7PA 2GBCA 1I7DA 2PX8A 2VA9A 3RF6A 4ZU1X 1MEOA 1JEJA 2QVZX 1TZKA 5T7BA 2YNMC 2H59A 3MJRA 4OOFA 4OHRA 2ZROA 2MR6A 2IDJA 3FYTA 4WLEA 3BMNB 1D5WA 1KMQA 1Z0AA 3MWFA 1U90A 1BX3A 3CH5A 3WOVA 1CX9B 3H4MA 4KBGA 5AI5A 3VC1A 3BK1A 5CNIA 2AEJA 3DZKA 2F3UA 2Q4BA 3G85A 3I73A 5BRNA 2YNMA 4WMLA 1EB9A 4MMXB 5BQ3A 1D2CA 1SOVA 3BCRA 5GJBA 2JGDB 2OFWA 4GLBA 2REQB 3I2GA 5DYYA 3B1WA 4AK9A 3GJRA 4N6GA 3RUFA 1AKVA 3VZCA 2Y1WA 3LWNA 3W8FA 3BMNA 4RHXA 2ZJ7A 4FOPA 5DBEX 3ZDYB 2QLBA 2HPHA 2VSFA 5KYUB 1UMKA 5JD4A 1SM4A 4M86A 4TYPA 1DAHA 2JD2A 1JPUA 2X8JA 2I6SA 1KEZA 4C7XA 1VECA 1EVQA 1C7RA 3OEWA 3GG9A 5KNLA 3IKTA 5ICEA 4E5NA 1O9HA 2AIRA 1UBNA 4JGGA 2UUOA 4C0SA 4TXNA 1JAYA 3NETA 1LBSA 2EC5A 1CWUA 1PHPA 4RZ2A 4QTXA 4PM4A 4CMAA 3FPGA 4V2IA 1CUFA 4WZZA 1QAQA 3D7MA 4M1WA 4AN0A 4G25A 1WW2A 2B3TA 4D9IA 1RKVA 5ALTA 5IHPA 4FFDA 3O4FA 4JGBA 4QL3A 3GFPA 4NCHA 4P86A 1Q20A 1FXWA 1YAJA 4JAVC 5FR1A 3WGMA 4CF5A 4ANFA 3WTBA 3VRHA 1Z18A 1PYGA 5HIIA 3K0HA 4KODA 3RB8A 1WZUA 3LQ1A 1T8YA 3NKFA 1X7HA 3MJ4A 5TJHA 1KXJA 1TZCA 3WGYA 2HFKA 4JJ4A 3HK2A 2N3ZA 5IMBA 1EAMA 4B31A 3QKUA 1VZ3A 2ZIXA 3HO6A 1XJWA 2H1WA 4BFXA 3P9RA 3U1BA 2H0AA 2HIHA 4G0PA 2CYAA 1QRRA 4ETMA 3UGTA 5KS2A 3ZXIA 3X1DA 3GA0A 1PIWA 3CSUA 2J0UB 3C3PA 3H16A 1OA0A 2ZRJA 3U9SA 1VG9B 3LH5A 4GGPA 4YMSA 2BDTA 1XLVA 4JU8A 5KU7A 1CYEA 4M38A 5AW4A 3R40A 3N7UA 1PX2A 4UQPA 3ZV6A 1AVTA 3OE7D 4HNTA 1VTKA 5BMVB 2X3FA 3FOAA 3H8SA 1M6VA 2HMTA 3NCHA 1ECCA 3NX4A 4PWYA 3AUTA 2X0KA 3DFZA 4N8DA 5BWNA 1X14A 4U8GA 3WK4A 3DAPA 1MF7A 2QLTA 3GO4A 1Z6TA 1GZHB 2IYTA 2UZ4A 4LJLA 1HWYA 1HK7A 2N9UA 1WXXA 3RU2A 5F5XA 1ISPA 2ZU0C 5EG5A 1DQZA 4AKIA 5BMVA 4BKQA 2NNLD 3C87A 3HEBA 5IKEA 4C6SA 3OLQA 4KXXA 1P62B 3ZCSA 1F0KA 4ZJPA 3OZAA 2P0YA 3K9LA 3W7VA 2FP4B 3H2SA 2GPNA 4FGKA 3RBAA 3OX3A 4BGDA 3CRRA 3C3JA 5HE9A 4GMDA 2R6HA 3AP2A 4UUBA 2E4VA 3T1VA 5AKKA 4M36A 4AURA 4CHTA 4RHTA 1GR0A 1Y1QA 4W1RA 1N36B 3J80A 4AMGA 1K7EB 2BYTA 3HDGA 1RZRA 1E9FA 3OCUA 3LU1A 4M89A 1PT5A 2YC2C 4PVCA 3AJDA 3RPEA 3FGPA 4H35A 1F8XA 3ZIAD 3RARA 1B8PA 1NW7A 3AY6A 3OE4A 2FP4A 3SS7X 3W9SA 5L95A 5C8XA 2RSLA 3SEZA 2K87A 2REBA 3B52X 1TK2A 5LYYA 3IDAA 4DHWA 1QJCA 3RRNA 1ZJYA 3VI3B 4HXEB 4MUMA 1NV9A 5E6SA 3I39X 1A7KA 4PGGA 3VAYA 4C76A 1RRVA 2X9QA 3R5XA 4EEKA 2A1UA 1NE2A 2FEAA 4C6TB 1F8UA 3DMNA 3EFBA 3OQOA 2FZCA 3K32A 3NWEA 4UCFA 2Z6UA 4WXPA 3EASA 4ND8A 3VR0A 1DZ3A 3GEPA 1CQJA 5J5VA 2D1FA 3ZDFA 3M6LA 3KV3O 4D3FA 3AKDA 1NW5A 4IJ6A 3GGCA 3HCDA 4HB4A 4Q3NA 2RDMA 3AZQA 3MMXA 4Q4JA 3LT4A 3LQ2A 3ZWBA 1SCUB 2JGKA 5BOSA 3IAXA 2G82A 4CQMD 4F3KA 2LP4Y 2XQKA 5JSFA 2YKGA 1VLZA 2MU1A 4YMHA 3UMVA 4ITUA 1KWGA 2GM3A 3TLKA 2CMGA 2C7BA 1JP7A 3WICA 3WR5A 3DE2X 3C4QA 1SPBS 4NFYA 4HDMA 4Z2YA 4KDFA 2ORYA 4R3NA 3UK1A 3KQWA 4BGEA 3V46A 2IHVA 1FS5A 1PZMA 4M7RA 3BM5A 4YASA 5ER9A 1PKEA 3H3FA 1T5DX 2I78A 4LV5B 1KYIA 1V37A 4PAGA 3HNRA 4MKXA 4D0LB 1CZHA 1I9GA 3OETA 1UAAA 3O38A 4EHAA 4UE2A 1FDVA 1O97C 1U0BB 5JI3E 1HH4A 2Q9UA 4WVFA 3SHWA 3DO5A 4AZVA 4CM8A 5BSUA 4H1WA 4AZTA 1GAJA 2B25A 4LYDA 1U2PA 1X7YA 2GBPA 3EUAA 4UPVA 4XJVA 3AVWA 2PO5A 4DYHA 1E79D 1DHRA 4N0QA 4NTZA 1HPLA 4Y2UA 4ZRDA 3TFWA 3EQ2A 4IHQA 4C3OB 4KRYA 1T9HA 3I6BA 1J20A 1Z0IA 3AB3A 5HF8A 2RG7A 3U80A 1LRJA 4G9GA 4L72A 3HPQA 3L0BA 5LZ9A 4MWTA 1FLNA 1U7PA 4BNGA 3J7TA 5BVGB 1UC8A 3QVGB 4PZDA 1E7RA 4BV8A 1UKAA 3AOGA 4MGHA 4TZ0A 5DX1A 3W5IA 1MT3A 2M6LA 2WABA 4MVJE 4OHBA 4X45A 4KI0A 3UOGA 5IU6A 4HYYA 1VIMA 3KJNA 2MSDB 2AI3A 3PICA 2F3QA 3AEXA 1G0OA 5AOBA 3RAPR 2QENA 4N1AA 1UH5A 3O7WA 4DARA 4LBZA 4WLUA 5BVGA 2ZUDA 3QVGA 3T1OA 1P4AA 1V3QE 1J70A 1NLZA 1S8OA 1FDUA 3DEAA 3IELA 4LGCA 5BMOA 2L17A 3TTTA 5DMHA 6NULA 2WJWA 2X1MA 3WNDA 3EJ6A 4FU0A 1W6RA 1DAIA 2C95A 4QNRA 4UNSA 5KQMA 5CCXA 4RMHA 3VTFA 1GUBA 2HSZA 5EWMA 5BVHB 5IWCA 1KHTA 4E4RA 3BXGA 1CUXA 1ZZEA 1Q1BA 2PX6A 2YV5A 4H6XA 1DX9A 4RQTA 3DJYA 3QP9A 4JEIA 4OHPA 3CZRA 2GRUA 1QQ5A 3HGTA 1MC8A 1H2FA 1OHHA 3EIWA 3KLBA 4LZJA 4AUEA 4BMYA 4CIDA 5BR1A 5CB0A 4R81A 4Q3EA 2ZZNA 3A1CA 3BIXA 4P5EA 3HJBA 1GXSB 1EA5A 4G5YA 2H4YA 1FJXA 1C1YA 4X65B 1Z4JA 2F1IA 1SIOA 1ZNXA 3A4TA 2IY8A 1M6WA 3ANSA 3OO0A 3ZKAA 1BHSA 2X9LA 1DTEA 1X70A 2JI6A 3HFGA 3TJRA 3TAXA 4AXBA 5HKOA 5LSAA 5I7VA 1E8NA 4WK4B 2AE1A 3F3SA 4BJHB 1VXOA 4BV3A 3P2IA 4GPTA 4L16A 3CW8X 4RJTA 2WJIA 1MVLA 4FUQA 5ALKA 4MKZA 2QM0A 2WTUA 1DQPA 2NUTA 3ZKWA 1AXRA 1BGVA 4FDTA 3NBMA 3PGVA 2V0CA 1KAGA 2X13A 4TL7A 5FBVB 3LCVB 4UU0A 3QOYA 1RHRA 1PSZA 2PHZA 2NUAB 1Z2NX 1Z7GA 1L4HA 3WK9A 4Q02A 4LF5B 1RAFA 4FT4A 5CH8A 4QDZA 1E2EA 3I1YA 2ZUVA 3DOJA 1FPMA 4QYIB 2WUDA 5IYZF 2G09A 5ICMA 2JLUA 4FFNA 4CV3A 1GV1A 3NEAA 3LSYA 4XWWA 1ZVVA 1TU4A 3AR6A 3MINB 4BWYA 1H8EA 4D99A 3H5LA 3LFTA 3OC0A 1L7AA 3ITNA 5AYVA 3UTDA 4FWTA 1FFXB 5IPFA 2R4TA 2EFHB 5CB8A 4XJTA 5K8UA 1N5RA 1RWWA 2VJCA 5DWDA 1Q57A 1NIPA 4TWRA 2VDVE 3MGAA 1PR4A 1SIBE 4ZVUA 1UPXA 1YJ5A 4GECA 4Q16A 1AK9A 3JQCA 3LQYA 4PC1A 3I2JA 3TSOA 4COKA 2FH5B 4XVQA 5EEHA 2YZ2A 1E0SA 2HN9A 2QROA 3O3MB 4J75A 3K9BA 3C70A 4GD3Q 4AQYB 1TLLA 2B5WA 2YOHA 4JLDA 3CNBA 5EMKA 1JHQA 1VCOA 2W4IA 2Y2UA 3KU1A 2A3NA 3QE3A 3U7GA 1Y1RA 5EESA 4H7KA 1EP9A 3LXMA 3JPWA 4GBMA 4Q3LA 6REQA 4XGNA 2IQIA 3HA2A 4J3NA 2D0DA 2XZTA 4TMVA 2X0EA 3SI7A 1ZK3A 1JDVA 1JTEA 4BQEA 4Z1MD 2CEKA 1P0CA 2PZGA 4X8OA 1NYRA 3D2LA 4RESA 4EMTA 1NF3A 3QLVC 4GLOA 4L4SA 4RV4A 3INNA 4CCYA 5KTMA 5DJ5A 1A9TA 3EZXA 2ZRMA 1JIQA 3H5WA 1EZZA 1P39A 2GCEA 4ZKEA 5LNK6 1DRVA 4KR6A 1B76A 1F9AA 4TX1A 1YIAA 1B3BA 3BK2A 3WVNA 2H1LA 1M0EA 1IN1A 3MC1A 3I23A 4D9MA 2K7ZA 3W5SA 2ZBDA 3GPDG 3QLVA 1NT2A 1AA9A 1E8MA 2C92A 2CXNA 1TC2A 2GEJA 2MSKA 2H1HA 3CT6A 3HB5X 3HYCA 3RT1A 2BFPA 3VR4H 2F3TA 2ZDHA 1P3DA 3FNEA 3GEMA 1N2XA 3H1GA 1YRQA 3JASA 1IUNA 2ZXEA 3GLUA 4GYWA 1XVTA 2V0NA 3P9IA 5IC4A 4F71A 2C4TA 1CFZA 5BN3A 1PNVA 4XPZA 3ASVA 5DBFA 5TVKA 2PSFA 2A5JA 3P96A 4Y2SA 1KI8A 4FKBA 1FNNA 2Q6TA 1EJ2A 2HLNA 1U0JA 3JAKA 4NHOA 1Y5MA 5JE8A 1U0TA 3CBGA 3VUFA 1L4KA 1R8JA 2VT6A 1MGPA 3CKKA 3GQVA 3WYEA 3ZPXA 3AFMA 2WSBA 3QE2A 4DWWA 3EGDB 4ALMA 1Q7EA 2GVNA 3H7IA 1P6UA 1UFKA 1EUYA 4QM6A 1MAVA 1PL7A 1EUCB 2I2XB 2IYSA 3G0CA 3JAWB 3OU7A 4DF3A 3CBQA 3L4KA 4F8EA 2QM3A 1NT4A 1U8XX 1XMIA 4U2CA 5FT9A 3WQHA 4BAUA 4WV3A 2ZUSA 3CPSA 3PCRB 5DNWA 5LD2B 1FP4B 2YRFA 3OWHA 4KRXA 1IOLA 1C8VB 1OBOA 4R2LA 2CV0A 4KUGA 4CYMA 1G19A 2PR7A 4YP5A 4Z0PA 3ZHQA 1Z3CA 1FFEA 4FCTA 4OXYA 5K4GA 2WG2A 4P54A 4WOPA 3SR3A 1KK1A 1SPXA 4EWLA 3FPEA 4KNYA 3QELB 1VA4A 3CPEA 1RJWA 3NHZA 4IOMA 3ASUA 3U3KA 4L0QA 4YRSA 3DBRA 2UUAB 5EPOA 2O23A 2FOIA 3JZMA 3Q7SA 4BJ1A 1FP4A 5AM4A 4U7HA 3KX2A 2C99A 2EZ4A 3LJKA 3W3AA 1XQYA 2VXBA 4LHYA 3AVTA 5JTTA 2MSEB 5JASA 2W83A 2PS3A 2C4KA 4QE3A 2AA3A 5AH0A 5DBIA 1RI4A 3MUFA 4OAQA 3FW1A 3DEZA 1DT3A 5AIBA 9ATCA 4KX5A 1NU6A 3LI2A 3HXMA 5K3OA 4GOOD 3QU4A 2P2DA 3IR5A 2AOXA 1WXIA 4Q66C 1T29A 5LYJB 5IZCC 3DMPA 2YW9A 4ZVMA 4QG7A 1GPNA 4X41A 2W2XA 2QX8A 5DRTA 4KVZA 1M2WA 2VJLA 4NABA 4UZEA 3PJGA 1SBCA 1ZCBA 4OJYA 4K6CA 2PE5A 1EZ1A 1U1IA 1SKMA 3GI1A 4FSDA 4PC7A 5GONA 4DIFA 4PFJA 3RVQA 5LLTA 4A91A 5GADl 5IZCA 4I4IA 5L40A 4Z9BA 1NLYA 4YRPA 4ZYYA 5BXYA 5AXAA 3GOHA 3T61A 4BFWA 2NIPA 5LOVA 2G17A 1XTBA 2X2FA 4LJSA 3N2GA 3IESA 2J3QA 3N5CA 4RF5A 4BVEA 5THXA 1BTOA 2WFLB 4DIUA 1P6XA 5BMVF 3BB4A 1Z75A 3CGWA 1BVRA 3CVJA 1YHZA 6YASA 3MWDB 5DGXA 1UZLA 2E4ZA 3G79A 5B57C 1NYTA 3PLNA 3B1VA 4FHFA 4HDQB 1ZCAA 2HOQA 4DC0A 1YSCA 4C2BA 3ACDA 1GA6A 3BD7A 3N0VA 3SWWA 2QLFA 1LPSA 2GH1A 5AJUA 2B35A 2H5JA 3PTAA 3KB1A 4XFJA 3I0NA 3RO7A 2B1IA 3CF2A 5EKXA 5MFZA 1MNAA 1A88A 2D0PB 5J9FA 1YL6A 2V97A 5EZYB 1NURA 4I5IA 3Q41A 2Y99A 3ZH9B 1T6ZA 5JQGA 1XCJA 2WJVA 2EJVA 2Y9MB 3WL4A 3LP5A 1M7GA 3IE1A 1S89A 3U4GA 4QSHA 3QTBA 3Q9SA 4F21A 4WBNA 3E2IA 3FYCA 3ZWNA 1LVUA 3STXA 1XMQB 2I76A 3KEOA 4G5RA 4RJ2A 2XD9A 3TQIA 4N3CA 4Q3BA 1UIRA 4JXJA 2Q4TA 5EJ9A 1TX4B 4KDRA 4RZ3A 5CVTA 1K8RA 3WRXC 5G2OA 1TK9A 4IX1A 1SC1A 1BHO1 1QG2A 4IZIA 3G0DA 4GGMX 5EZYA 1A9SA 3KHTA 4LI0A 1QK4A 2OUIA 1X38A 3KJHA 5ILQA 3TRDA 1W9HA 2G67A 3W9YA 4NESA 2Z9DA 4X71A 5A4IS 3M6WA 3AP3A 4KXNA 2NVOA 5AHXA 2FPLA 3RTGA 2Q1XA 1X7ZB 1QDLB 4WXYB 1T4GA 4R05A 4YEDA 5LA6B 3WRXA 4OK5A 3BTSA 3GEGA 5EFOA 3DR3A 4D25A 1NUPA 1SVIA 4XH9B 3D6TB 1MX3A 4XQCA 3ODPA 4FP9A 3Q3JB 1SZJG 1JPJA 2DY0A 2J9FB 1P5FA 2ZB2A 2P1ZA 2Y92A 3V80A 2BCEA 1CP3A 3ISJA 4M8NE 3VR5D 3ZGOA 2A14A 1JJFA 5JBQA 3SJUA 4G81A 4JOCA 2IDZA 4MVJM 3A04A 3RU3A 1OVGA 4R1QA 5LA6A 2Z3VA 2X0JA 1U2SA 2YIMA 2YMLA 2G4VA 4DLTA 5P21A 1CU1A 1UKYA 4GVXA 1DG9A 3WWYA 2B83A 3EFEA 1K6MA 1NM5C 1BGWA 1H8HA 1RWKA 1KVTA 1RYMA 2Q1WA 2BHRA 4R01A 1IEXA 4X1KA 2DUWA 4YFVA 4E2WA 5J47A 1NLMA 1I36A 3FWPA 4FYJA 5GJCA 1NF8A 3TW8A 4LDJA 1PP4A 1XT6A 5KQPA 2QJTA 3M34A 1K75A 2JIDA 3OIWA 1H6BA 4AJKA 3QBTA 4D0GA 1NM5A 5C1IA 3BWYA 1KDZA 4WJLA 5CEEA 4YJFB 1IY0A 1EFRD 1ZW1A 1OGIA 3OJCA 4KE7A 1KU6A 1V47A 1RM5A 4PNPA 4QYTA 5BW4A 2A8YA 3RWOA 4YXFA 4FNOA 3MB5A 3UV3A 2QX9A 1T10A 5DK4A 4HEQA 4YI5A 1GTJ1 4HUQB 3T7AA 1X1AA 2PX3A 2RGGA 3HVJA 4RPCA 4ZDKA 3ZGXA 5TXGA 4WJKB 5AW5A 3AWDA 1GADO 2B8NA 1QZTA 3VOTA 1NBEA 3EXEB 1HFEL 4NYJQ 3PF8A 3WK6A 2IXGA 2RJNA 3CMCO 2P6RA 1GQFA 3BWBA 2XAUA 3R7FA 1XZPA 2CVOA 2JFOA 3L4EA 3LGXA 3KCQA 4G0VA 3L43A 3NRBA 3HRHA 1OXMA 3G9UA 2Z8XA 2OZEA 5LB2A 1DWPA 2VHEA 4A0RA 3VAZA 1A77A 3SVTA 2Q9BA 3ETEA 4Q1VA 4P81A 2E82A 4ZO9A 4KQGA 1OLXA 5AKYA 2QD1A 4D97A 4V1CA 3T7TA 2V45A 1MIOA 5L6LB 4I1UA 1YUBA 2GN0A 2J5XA 2OO7A 3AERB 3IR6A 4OQQA 2W2VA 3GRFA 4CMIB 4DLNA 3GLVA 5T64A 1CY8A 1QIEA 3VM6A 1W5FA 1DQRA 1BD3A 1NONA 3QYFA 1AX9A 1JSLA 4GOND 1L7MA 4F3NA 3PI6A 2V7GA 2CXRA 1UQUA 2WF9A 1XJ5A 1E1YA 1E2KA 3CNQS 4RVCA 5HJ5A 1TYBE 3ZZ1A 2BGIA 4MV7A 4EY7A 3I9NA 4NPAA 4OP3A 1EWVA 4Q4AB 2JLCA 2V6BA 1L5OA 3FFXA 4IS2A 4I3HA 4RTOA 3ZVKA 4OB7A 4WZAA 1Q3KA 4U7TB 3ZNNA 2EYQA 2W5UA 3PQFA 1IBLB 3QUQA 1XWIA 5EZQA 2ZWVA 3P5BA 3UAWA 4JC5A 1T36A 1PDOA 4FINA 2PH7A 4JBHA 4ESEA 3PP8A 1T0UA 2GRAA 4ZU6X 2CUNA 1ABFA 5C8VA 4D42A 1KNXA 2XYHA 3GFGA 3W6OA 4N41A 4Q4AA 5AJVB 1DQSA 1R5OA 3FHJA 4LGMA 5ELMA 1U8EA 3T9FA 3JVIA 3ZXYA 2JDID 4E3ZA 3KVOA 5IJ9B 3AMVA 5EHQA 1A8IA 3TTWA 2JH9A 1I2CA 1V0JA 2OCYC 2VRCA 1YJBA 2WB4A 1SK9A 1KR5A 1W25A 2WEKA 2Y0BA 1EXWA 3IBTA 1GCAA 3G88A 2PPLA 4YJ3A 5DT9A 3RFVA 4NS1A 2BEWB 1KFEB 2VDOB 1OBCA 4EJSC 2XE8A 5DN6A 2HIGA 3I9OA 4QOEA 3MWYW 1FDRA 4WOKA 3PPXA 5BNWA 3GV0A 2X8AA 1VPWA 2FUNB 4O5OA 5L3SB 3K0FA 3P9ZA 3K6SB 4IRMA 5DV9A 1TO2E 2QLJA 2WVAA 1L5NA 3TTXA 4TVSA 4DLYA 3NPMA 3HABA 3M6FA 5G0WA 2OCPA 4EJSA 2OLKA 8OHMA 3IXMA 2UXBB 4PCVA 1A27A 2GFHA 1NWCA 4QU5A 1HYBA 2N1BA 3T7RA 3L79A 2EGUA 3VH2A 1GRQA 4LDZA 1XZAA 1ZESA 3HR8A 5T41A 1PBNA 2VBIA 2QL5A 3PDWA 1F4PA 1ETUA 1ZUNA 3BWXA 4FCVA 1CETA 3WK8A 4F84A 4CV0A 5KPJA 2D7DA 5L3SA 4CL3A 3OQHA 1QV9A 1TL7C 4IDCA 4D9GA 2ZW9A 3K6SA 2R79A 1XZJA 1GL9B 3LIPA 2EEZA 3QWAA 2ZB3A 1UFVA 1AKUA 1DKNA 3AIKA 3P71T 5ECGC 4D80A 1MAUA 4YECA 4AP5A 3LK7A 4CLRA 1GD1O 3AR7A 5IVPA 1N8NA 4RA9B 3CVVA 1T2FA 1DMRA 4HDNA 4QU8A 1SXJB 3UYLA 1MPTA 1JJAA 3DSRA 4NBSA 2BW0A 2MWMA 5LLDA 3CKMA 5KTSA 1NRWA 4GPAA 4QAQA 4WLOA 2H00A 1YB6A 1G8SA 3HKCB 3KWJA 1QSGA 2QRKA 3KXDA 4L8VA 3WLJA 2HZ7A 4F72A 4IXTA 3WGHA 1E9DA 3O1IC 5EKTA 4RHFA 1DG3A 3MBKA 3DMYA 5AJYA 4F96A 1XCGB 4LIPD 6Q21A 3Q8MA 2JD1A 5JCPA 3JQAB 3PL1A 1APBA 1BXGB 3QOFA 5E3JA 4NOKA 4QAJA 1RXEA 5CT9A 3PNLA 4HB0A 4NK5A 2XZLA 4AJ1A 4HADA 1O96A 1XR3A 4I1RA 5J59A 5DNVA 4MWGA 1EXDA 1E4EB 2JFGA 2HO4A 3ABQB 5H70A 4HT3B 1XMPA 3FMVA 2R3SA 1AZSC 4LS3A 4C20A 3IAEA 1DAKA 2W42A 3HU5A 1PK9A 5FI1B 1SUFA 3UJDA 1R4MB 1EHYA 1X1DA 3HADA 4Y2XA 1HG0A 4DYDA 1JVBA 1F2UB 2WOOA 4CEJA 1OXBB 1V35A 3A3KA 3I37X 3OE5A 4LK3A 4J2TA 1IOZA 4NMMA 1BXGA 1CR6A 3KK0A 1YS2X 1N6IA 2BDUA 2FMFA 3HYSA 2JGRA 3D6MA 3LPNA 3NR2A 1V11B 3OURA 4PLYA 2I6UA 1ADJA 1IATA 4PRLA 3ADCA 4EAQA 3TIGA 1SG0A 1L8OA 4RXUA 3C7AA 1HTWA 3EISA 3HP4A 4K5QA 4MRSA 1Y9JA 1EGHA 4QGFA 4TVOA 2I7TA 4GEKA 1QPGA 1ONSA 2ZDGA 4OJQA 5BN4A 4ODIA 2WAMA 1E2FA 1V3UA 2YWCA 1QU3A 3E35A 3QM1A 5ALMA 4AUKA 1TW3A 1T4BA 3K6RA 2Q45A 3OLCX 3U60B 1M54A 1SQ0A 3OUZA 3IUNA 1QLWA 1SO8A 3D8HA 2XVXA 4Q19A 4JBNA 1I3CA 3FMIA 4Z99A 1V11A 3V2GA 3ZGNA 3PBKA 5GIOE 1LWOA 1E89A 1TOAA 2A9VA 2EFYA 2HRZA 1NBAA 3OEHD 1VE7A 2VP0A 3F3MA 4C2AA 2FW7A 3O84A 3OEYA 4DY4A 3VNQA 3M6XA 1UWLA 1XEFA 2W37A 3LPAA 3HN2A 1RQGA 4OL0A 5JYCA 1GCUA 1WV0A 1TAHA 2DPYA 5A2QA 4ABTA 2AZXA 1JQBA 4HQRA 4TZTA 2WM8A 4WH0A 5EP3A 4B73A 4BX2A 1KSFX 3IPRA 4R2XA 3MT7A 5JRDS 3DLAA 3EYWA 2A9QA 3BH7A 3KDAA 2NO0A 2YZNA 3OHMA 5B1EA 1DQYA 3U2QA 3OIYA 3E9CA 1UMDA 2GYYA 5C5CA 2O14A 2GNOA 5CNKA 2WA1A 1J8FA 3BVPA 3TLXA 4BNIA 1YCFA 2VNSA 4EB6A 3G2JA 1JG7A 5ESDA 3UT6A 3TE6A 1EUQA 3IP8A 4M9QA 4U6SA 1GZDA 5C4IA 4AG3A 5JMOA 4MW1A 3A37A 4XCQA 2GA9A 5FEUA 3B5IA 3GUCA 1AUOA 1A4IA 3VO1A 1RRPA 5E4TA 2YL2A 3EGXA 1J7JA 3BORA 4Q9JA 3VBEA 2AMFA 1Z47A 3H05A 1A4RA 4LE2A 4ENUA 5CT8A 1QMGA 4F5ZA 4EHJA 5IEBA 4RKQA 3IAAA 1R0BA 1P3JA 1JBQA 4E4TA 1DFIA 5E9WA 2ODBA 1CW2B 2KE5A 1ZITA 4MGYR 4OUDA 4BQQA 1NXSA 1B6SA 2ZT8A 3IQHX 2IZ1A 4B7UA 5LYJF 1QF9A 3BE4A 3PUWA 3EXFA 3MTEA 4PPFA 2ZSEA 1CRZA 3SK0A 3WGQA 3VR4A 2ID4A 3H1BA 4K2AA 3VYSB 1G8HA 3WGZA 4JMLA 4B82A 2W6IA 1MFZA 3GDFA 2DU8A 1SGWA 4I9GA 1PSDA 1YJAA 1CY4A 2Q5EA 3IRUA 1RJDA 4QHYA 4H27A 2OAQ1 4R7TA 5DLYA 2OO5C 4U0JA 3PIIA 5K4AA 3F4LA 4MICA 4U1RA 4NFSA 5A6VA 3D9QX 1QKJA 4IDNA 4R8MA 4X8MA 3GY0A 4XUDA 1C81A 1QIDA 3GBSA 4LECA 3U3DA 4U3JA 1A5BB 1QVVA 2H52A 3DW1X 3ZCPA 1KTIA 2HADA 2OO5A 3KFXA 1KQOA 4KAAA 2W4QA 1NTOA 2FPPB 3THXA 3KVVA 3CGGA 4JC4A 2Z9CA 1T6YA 3FPBA 1U94A 4L02A 4Y9TA 3TYXA 3WL8A 3VGJA 1YE5A 3L6UA 3U3MA 2QP9X 4YUVA 1FMFA 5HCIA 3IEPA 4AZ3B 2C5EA 4BRZA 3K1AA 3BCHA 1UP7A 2JAWA 3ZI7A 2VYND 3L9WA 5JZBA 2FQ1A 1L1EA 1LXCA 3VGPA 4D4GA 4F91B 3LC0A 2IVFA 5EZYF 2ZT6A 3CYFA 1MBZA 5CUQA 4HDAA 4KG7A 5ALDA 2EHJA 4HN2A 2P67A 1JYFA 2WHRA 2COKA 3ILXA 3V9PA 4ZQBA 1K6EA 1TVKA 4XYMA 2DKFA 5TEWA 4A0FA 2JFBA 4UXJA 3QG1A 5JZVA 1HNWB 4IGIA 4PIMA 1PEYA 1ZVMA 4NEHB 3ZC3A 3QU7A 4JBGA 4UUPA 3RSZA 4G4JA 4EI8A 4EYGA 2CHFA 4I46A 4L6IA 3K5HA 4UTOA 4UQLA 2G6TA 2SNIE 2FKAA 1SC6A 1YL5A 2II6A 2XMDA 1GL3A 1GLVA 2EBHX 2YJ5A 4FQ7A 2DWUA 4LCJA 4WFIA 4EW6A 1G9SA 5AW2A 2DBZA 4L28A 2EGGA 4DG5A 3OAAD 1SCJA 4JEUA 4NDNE 1H94A 1K68A 4KMMA 5A2GA 1QH8A 3CVWA 4XTRA 4QGBA 3ZCRA 1VI5A 1W7AA 5LA6F 2BSXA 1QR2A 4NYJR 4ZT5A 5FQOA 2WQ6A 1Z2EA 4MV4A 5BNZA 1XXHE 3ZDAA 3LLCA 2V7VA 3R3VA 2HDHA 2EP8A 2IK8A 2ZB8A 1JPVA 4NBRA 3IEXA 3IIKA 2A7XA 3LZ6A 5F73A 1ADCA 1CR2A 2VH5R 3QYAA 3VKHA 5LJLA 1XDWA 3ZU3A 4URVR 5ULLA 2C03A 2VDKB 5IAJA 2AOUA 2ZEJA 3X1JA 3SC3A 2VQSA 3M9LA 1ZUWA 2NN3C 3EAFA 3EZGA 3OM1A 4R54A 2WKQA 4RF2A 1P7ZA 1T4CA 5FULA 4B9EA 2V59A 1BC5A 3THOA 2BEKA 2V98A 4XSHA 2HA5A 1DEKA 2PMEA 4UEJA 1YVUA 3GCGA 4UFOA 2G9VA 4LN1A 3RG2A 7MDHA 4YRAA 1HZZC 1HOTA 1WS6A 1GDDA 2JVJA 2XTMA 4FONA 2NWQA 5DHRA 4RACA 5LZ7A 4ZOCA 1IHUA 3AKYA 3ENNA 1N2HA 4DIBA 2BGWA 1ZQ9A 2DR0A 1VPTA 2R8YA 3D8BA 4RSMA 4YV7A 1FNCA 4XR4A 4AKEA 2ZSIA 4CRWB 3KZMA 3K2IA 1K66A 3LOQA 2I4LA 5E95A 1EGAA 1ENOA 2WU4A 2KYRA 1W2WB 3CHYA 1HZZA 3DULA 5JCXA 3A6JA 3QNMA 5TPZD 1FNMA 3P9CA 1VHWA 2HWWA 5A71A 4YAKA 3A6ZA 5GGXA 1CUCA 3Q7QA 1OU4A 2J0VA 1JS1X 1ORRA 3EDCA 4AJHA 1T1IA 4AJ4A 3R41A 1BJRE 3QKIA 3CVOA 2YQ5A 4PLWA 3HZOA 1WQ1R 4WN9B 1COWD 3QI7A 2LIVA 4J94A 2FDRA 3F2VA 3KDPA 3LBFA 3OPNA 4E2XA 1L4YA 1P2VA 2AXQA 2EV9A 4D3DA 4XEUA 3L8MA 3KS9A 5ALZA 5E1OA 3HWX1 5TQVA 1CQIA 4RENA 1PNQA 1YI0A 3BJZA 2G4CA 2SICE 3EEIA 4US0R 1YA4A 3VV3A 1CNMA 3WGJA 2C1ZA 3I92A 3QEMB 4WFQA 4GP9A 5KJ1A 3N59A 2FRVA 1CJCA 5HZGA 3Q7EA 2ZWOA 5JLAA 4WFJA 4AS3A 4FFBB 1JDUA 2I1WA 1KZYC 4DLKA 1XN4A 2CCGA 2G7MC 3WRWA 4FM9A 2UDPA 4RWZA 1KRHA 1I10A 2UZ1A 1LLUA 3QE0A 4GRIA 2P3OA 1P33A 2PRJA 4QT4A 5K0FA 4GMFA 3G2NA 4YUAA 4G1VA 4LI3X 1W6UA 1OH7A 1TMKA 1RYHA 3HJUA 4ZYTA 3UJ7A 2QMEA 1Y37A 4CUKA 4FFBA 4HDSA 5ALRA 5KDLA 1ISIA 1M8FA 3COVA 4NZZA 1XIVA 2WIKA 3BD8A 4WZBE 5EUMA 1Y3CE 2AOWA 2DQSA 2QE6A 4DJDC 4G07A 4E1VA 4F8JA 3NT5A 4Q1EA 4B09A 4EJFA 1KAQA 1ZCJA 4DGQA 5I7HA 2GO7A 2VP9A 4EATA 1VHDA 3B8EA 4HS4A 2FF5A 2I7XA 1UPUA 3IO3A 1CQPA 5HJ7A 3U7JA 1IXKA 3GFQA 1EBFA 5DEOA 1RHUA 3JD4A 1T6NA 3S29A 3RJMA 3AVVA 1TJYA 1MJGA 2GK4A 4IJUA 3UN1A 3GCXA 1BE8A 1FQJA 2IEGA 4GKBA 3W4KA 5EPUA 4D45A 3I6MA 5IASA 3I9KA 2CNOA 2BCGY 1G38A 2D3TA 3OFND 3CH4B 4OGKA 4R8SA 4YGXB 4HFRA 4K03A 4GLJA 2G72A 3HDYA 5DNEA 1DRWA 2D00A 2YJTD 4M53A 3GLQA 4JCCA 4F0JA 3TG8A 2O2HA 2DFDA 1R9GA 3H5NA 1WSAA 4V0NA 3Q40A 1M34A 1KEKA 2BGGA 2ZATA 4MAMA 5BYBA 4FFPA 1C8BA 1IAQA 4ZODA 4Q82A 4EDFA 2OO3A 1PFUA 4ZAWA 1CRPA 1O6FA 4HGOA 1U3DA 4DLSA 4B43A 1L4MA 2PWPA 3BK7A 3GEDA 1IZ9A 4WNAA 5DLQC 3GEEA 3N3AC 3GDWA 4MDHA 4EPVA 2FFRA 3I0MA 2AR7A 3HSSA 3NJ4A 1IFXA 2E1PA 3JV7A 2P75A 2X7HA 2D1SA 2V7QA 3OOEA 5COAA 3BA6A 4X1OA 5DM4A 5ELXA 1JR6A 4OLHA 1T4DA 1CE8B 5IAEA 1C0KA 2BPOA 5JXGA 1ONPA 4BO9A 4H6WA 4GPIB 5C7YA 1XNRB 4RY9A 4EGQA 3NO4A 2OGWA 3NHBA 4YQEA 5CLGA 4BWGA 2XF8A 4ZI3A 3DBHA 1QK5A 2AYZA 3NOXA 4ONEA 3TDKA 1U7XA 4P83A 3HFRA 4NJMA 5B1HA 1U63A 5KOHA 3BHMA 4Z5XA 2K5UA 2WE7A 4JFRA 5AIAA 4EG6A 1WR8A 2OCLA 4N7MA 1CUHA 4N5NA 2Q4EA 2GF9A 4RKYA 1UJMA 4IMIB 4F6CA 1KJYA 2G5CA 1KH3A 2HJ9A 3R5SA 5DTJA 1PQWA 1Q1NA 2YMQA 3CXRA 5FTJA 1M8GA 1SHJA 2IYEA 3G1TA 5EP2A 3UV6A 2Y1OA 3D3KA 1C9YA 5CGQB 2WQ7A 1NQWA 1QIIA 2FZ4A 1A8HA 1VE9A 1BCRB 3CUUA 1GPLA 4IDPA 5T4FA 1JA9A 3DZJA 4ARIA 1IPEA 3PS9A 2ZJ6A 4H1TA 4I5DA 1LF0A 2C31A 4W1PA 4KOEC 3PZBA 3JQ6A 3RRJA 4KQWA 1MQAA 5DZSA 4KQEA 1LFDB 2IU4A 2ZYHA 3GK3A 4NCXA 4RPIA 1M1NA 4P4GA 2Y4OA 4MI9A 1AKNA 5H83A 4UM7A 1ZMOA 3P0RA 3Q85A 2VJMB 4IGEA 4D44A 4DR2B 2J3DA 3MGBA 4RGVA 5FF9A 1TUIA 1ENYA 2DPGA 3LDGA 5B7PA 4ARCA 1EEXB 2JI7A 1BWRA 4G4GA 3ID6C 1OLOA 3TXXA 1U0SY 4LBVA 2CHUA 4JI7B 5CT4A 3TIFA 4RTRA 5K3CA 1RQRA 4N01A 4JVOA 4EGFA 4DRXB 4BFVA 3MTBA 1CCWA 3TEFA 4IFEA 5LWHA 2AX3A 2YR0A 3TZHA 3X2FA 5HGXA 2PBLA 3MA0A 2R0QC 3EIXA 4YAFA 1R4ZA 3DMGA 5GAJA 1KMIY 3E58A 1MOQA 1SWVA 3EMBA 2JGAA 4AJ9A 4D3XA 5G4KA 4S0ZA 4E15A 4CLHA 3CNLA 1GG9A 1IJKA 1LKZA 3AETB 5I7EA 1OMOA 3N0XA 5ER6A 5EUBA 4E7OA 2ZRIA 5D3QA 5GVSA 4C4AA 2PWYA 2P7IA 3A4YA 4IDEA 4K46A 4K9OA 5L3RA 2H4ZA 2DUUA 1ZH6A 4DWVA 2O6LA 3S68A 5EHZA 4UNIA 2NU6B 2IOHA 2J0QA 3EAGA 5CVUA 2M6RA 3UH0A 4MUNA 3WDLA 4KQHA 1DIBA 2CE7A 3B13B 3TVDA 3O8NA 2VYCA 3RS0A 2YINC 2E87A 2ZQYA 3SBXA 1CF2O 3IQDB 3ITKA 3WSVA 4I81A 2GPAA 3QVUA 3A28A 1DWOA 2KQUA 2MINA 2F62A 1XKLA 1B4DA 2E4YA 3B6EA 3MSCA 4X94A 4HXGA 2CLIB 4BO3A 4IH1A 2PGAA 1O95D 5AK3A 3NOQA 4ER3A 2EHDA 2O0KA 1NQ5A 2DGDA 2PGOA 2ZVQX 4U9HS 5FA6A 4HAVA 3SQOA 4B85A 3PFBA 3GJXC 3QY9A 1UBOS 2FI1A 4HC4A 4PPGA 3BL6A 1JLSA 4S05A 1Z0JA 1GFSA 2O59A 4ER5A 1QFMA 2Z5GA 3DC7A 5HW0A 5JO0A 3OIDA 4LQ4A 2HEIA 2VTKA 3A4MA 2AFIA 4WKOA 1PDVA 3TAUA 4MS4A 3HR7A 4F6RB 3GRYA 3FSJX 2GN9A 3LD9A 5EEGA 4HAIA 4QXOA 4HDKB 2GD0A 2OV3A 2NP7A 3WLIA 1PVVA 1YJXA 1QAOA 4JWTA 1P8JA 4QEDA 5JZ9A 2H3HA 2HREA 2RK6A 3D7RA 4NSNA 2MYTA 1JE1A 3I6IA 1RXVA 4X8LA 1EVIA 2PWZA 4W8HA 4LOHA 3QLUA 4CCWA 4Q9KA 4H1HA 2TMDA 2F1RA 3AYZB 1A5ZA 2DWOA 2NPOA 4FZVA 4I8XA 4OP2A 1N75A 1S2GA 4XIGS 3TLGA 3H2ZA 2A9OA 4M9UA 4CF4A 4CI0B 2XMSA 2KI5A 2QXYA 3OPYI 4GU5A 4MAFA 3RAFC 3AXTA 1N9KA 2E1RA 2WSYB 3BRSA 2EDAA 1NC1A 1UZNA 2O3TA 2I67A 3CY6A 3D1JA 1VP9A 1RLOA 3KYDA 3OPVA 3KEFA 3KR1A 4IDGA 3E8MA 4GBED 4LXQA 4QSMA 4R2KA 1ESNA 2AH5A 5BWBA 1E59A 2EQBA 4TRNA 4GWGA 3IV7A 1J1ZA 4Q6WA 4LJ9A 4DEYA 4EFDA 5HX7A 5JH7A 1EPUA 3B3AA 1OH5A 3FRIA 4OGWA 5DEIA 3TZBA 4Y30A 2ZI7A 5E6RB 4G4SO 1YJCA 3RVLA 2O8FB 2HDNB 1HDYA 4QVGA 1T8SA 1B16A 2ONYA 4Y0NA 5I48A 3AM1A 4B3SB 3DMHA 5AP9A 1VL5A 2HLDD 1LPBB 4MGIR 3GLIA 2NPIA 1E62A 3AEQB 1DX6A 3SYKA 5FAKA 1W0KD 4K9LA 2X1LA 1F7UA 4HPJB 2HQ1A 1VP3A 2RIPA 3D4IA 4R1TA 3SF8B 4DMMA 4EVIA 5KO2A 2JKZA 3Q4GA 4WXMA 1U8YA 2WSMA 4EFKA 3LZCA 1E2LA 3IVGA 5C8DA 1P9LA 3M6IA 4KO8A 5C8YB 1R18A 1PZXA 1YC5A 4N3NA 4TRRA 1PFVA 5ALEA 1TA9A 2VRNA 2WTXA 4KQCA 2FPRA 3IUQA 3K9FC 1OY1A 1U5CA 1U6JA 2WYVA 4OHUA 5TNXA 1TLTA 2D3WA 4IFIA 4YP1A 1W36D 3AESA 2XECA 3GDOA 3SJZA 1E5QA 2J0SA 4RU1A 4CTKA 1O58A 2P8JA 3IKMB 2AD5A 1BDMA 1OIVA 2VYVA 3GVCA 2O2GA 3VBCA 3WS7A 5LIRA 2JC3A 1IJFA 3MWKA 3UMMA 2C1EA 3K0SA 1THTA 1Z8FA 4II7A 4OQDA 2PX5A 4S1VA 5C8YA 2V6GA 3X3HA 3DBLA 1X19A 2GJKA 2NO4A 1G60A 2XWQA 3JQBC 1IXRC 1UANA 1DWQA 2FZKA 4ZAZA 4E31A 4DXAA 3IPYA 1DLIA 1VRVA 4OQMA 3R7NA 1LPPA 3QVJA 5TY0A 2BZGA 4PYQA 5GJVC 3Q2KA 3ZHSA 3QKSB 4MHSA 1GUDA 1H3FA 4UREA 3H4IA 3ZOKA 1AN9A 4N7RA 4JUFA 1CUYA 4UCWA 3EC2A 2A0XA 5TGDA 1FE8A 3V7WA 1E2HA 2QNIA 3FOWA 3JQBA 4LXTA 5TB5A 1CZNA 2HKIA 4B34A 5K2OA 3DLTA 3IT2A 3WQQA 3K9CA 4M98A 3JY6A 4TKMA 2OCDA 1HFKA 2WUVA 2FAXA 2HHLA 4EEXA 3M1LA 1X94A 1F8YA 1BS1A 1N5DA 2HNBA 3CF4G 1EFUA 1XX6A 3QFSA 3QKSA 5TR9A 2P65A 3BSWA 4QXMA 3KQNA 1YJ8A 2ZSJA 1YVEI 2R8BA 3UOAB 1M2GA 1OT5A 4I3FA 3WFIA 1CIPA 2PZJA 1W94A 2O6HA 3NTOA 2Q1TA 3HI4A 3HVIA 1YRLA 4Q7QA 4D81A 1Z56C 1SMKA 2JVIA 4QO8A 5CJJA 3IUMA 1JBEA 4CR8A 2J41A 2I99A 3CVYA 4MHTA 2BF4A 1P9NA 2Z95A 4WK6A 3GEIA 1T6XA 4FI3F 5HS6A 3IPCA 1EIWA 3A1TA 5BUCA 1L6RA 4GI2A 4HXYA 4PO3X 1LC0A 1J42A 3PVZA 1B14A 4K6KA 4OEHA 4XXHA 4QELA 4I3GA 4YUYA 2Q5OA 1VLQA 2RHGB 3MTAA 2A9RA 3SYLA 1H2AS 3GMTA 3BXEA 2EEPA 3EA5A 1F0NA 3JWPA 5KQSA 1XVUA 4BE7B 1Y7HA 3IDFA 3SM3A 2JGLA 4KYIB 4MW5A 1RP1A 3BYZA 2NACA 2QTZA 4NNPA 3FVQA 3R5TA 4PYLA 1PR3A 4R1NA 4R6XA 4CJXA 3HYTA 3K5WA 3BF8A 5A3QA 3HNOA 3B2EA 4G1UC 4WFKA 5IUKC 4FW8A 3OM0A 3IHWA 4LY6A 4OQNA 5HPYB 4TWJA 4YMIA 5ARBA 3KHSA 2R47A 3KQSA 4LMRA 3V4FA 3ANNA 4ZC8A 2OK7A 4OHCA 3AXSA 2W00A 3PGLA 2VEDA 4PLTA 4Q39A 5CDFE 2QB5A 4QDUA 3HKBA 4LCEA 3LAWA 4QO7A 4Z0NA 4A6PA 1ZY2A 2POQX 3ROQA 1D4AA 1L4UA 1FVFA 1RZVA 4UEKA 1QK3A 3BFJA 5DOVA 2Z98A 3NOOA 1FRVA 1ZJ6A 3V1YA 1RLJA 2AEEA 3G9TA 4M1MA 4BLUA 4DREA 3CEAA 4ZOLA 5FEMA 5CNJA 3SY8A 1POXA 1L5YA 4ZT6A 1OI4A 3SR4A 5KHOC 3HJCA 3C3YA 1SH7A 3CE6A 3CIOA 5C3UA 1ZIPA 1ZNZA 2FUKA 1L0BA 5DYGA 4ZU3A 4NDZA 5ARDA 2ZUWA 4ZVVA 3UA4A 3BMCB 3ZV3A 4MRMB 2PLNA 4XW2A 3WB9A 4EW2A 4ZI7B 3TI7A 3RVPA 2QF7A 1CZLA 3L0CA 3OJLA 4CDRA 3QUTA 4FD2A 3DO6A 4WXHA 2VNJA 3VDNB 2BJWA 4DCVA 3CX4A 1NFFA 1T3LA 3F4BA 5BW5A 2I5PO 1KIMA 3CUYA 1GZUA 2X7XA 5LBIA 2HJVA 5KYWA 5IT9A 1HDOA 2JJQA 5JALA 4RD0A 4LBWA 5G3ZA 3S81A 1RLIA 1VHJA 3JARA 4AU1A 3B5EA 3ITDA 3ZU4A 3BMCA 3KB2A 1G8JA 2DKOA 5CK4A 4BLPA 2WTBA 3PXEA 5F76A 1KOJA 3Q5EA 2QYTA 1YB7A 1Z4LA 1NVKA 1IUKA 1R8XA 2PSEA 2ZJOA 2XT0A 1ZI8A 3NUGA 4FNAA 4R69A 1J5PA 2OHFA 2HBQA 2QN9A 5AM2A 5C7OO 3D6UA 4LXXA 4KO2S 3ZHVA 1LFAA 4RHCA 4Z4GA 2AC7A 1KI3A 1UBKS 1HKHA 1RSZA 3EW9A 4YRCA 3TINA 3FTFA 2E55A 5JYBA 3FNQA 3V8MA 1DBVO 2VJOA 5FJJA 4CM4B 1JLMA 1U11A 4C7OB 2HA0A 2C04A 2ZWPA 3KVYA 3OTWA 4C7JA 4HHEA 2VNAA 4WKPA 4LXUA 4CDGA 3RSHA 3U7EB 3DP9A 3NYWA 4IAOA 3TLZA 3WHLA 4CT4B 4REQB 4Z53A 1RXIA 4GPBA 2FEMA 2QTVB 2CN1A 3GCWA 2ECQA 1NUQA 3CO0S 3OQ6A 2QQ0A 1ZD1A 2XMBA 2P1RA 2J6CA 2ATEA 2P6PA 4EM6A 2NO5A 1NQXA 1XMJA 2BLLA 5SY9A 3RG8A 3PGMA 3M9WA 1NN5A 4ETNA 4A0GA 2XV1A 4QXPA 4BO6A 1W0JA 3M89A 3QIAA 3EWSA 4FIZA 4INOA 3RC2A 3ESQA 3LTEA 1HDGO 1VB3A 1DBIA 5HCNA 4D6XA 3L06A 3W2HA 3ESDA 2RHCA 1PQPA 5M04A 4RTNA 2O8EA 1DTWB 1V8FA 1PT6A 3W5HA 3CF6R 4EHLA 3SSNA 3WADA 4DKXA 3OMWA 3UHFA 2Z8YA 2XYPA 3WZLA 2FPGA 2ZS8A 2DHDA 1FZQA 4BN4A 4N6NA 5ICGA 4XQEA 4YPFA 1O94C 4X93A 4HRAA 3I2KA 1YE8A 1Y33E 1M1YE 3C8HA 4OYHA 5ITSA 1MAAA 4KLNA 2QI9C 2UYOA 2FWAA 1HBJA 4G9BA 4AX8A 1PS9A 1GSOA 1L5ZA 1UBMS 2IT1A 4U0KA 1HRKA 1DTWA 3D4OA 3EQ7A 3L0PA 3FN4A 1N3YA 3B3JA 3DWEX 3I4CA 3TQOA 3UQZA 4BEBA 2AF3C 3VH4A 3VDRA 1O94A 3MAJA 5CYGA 3A25A 2D8MA 1ZEJA 3S70A 4IDHA 1EFAA 4J0KA 1ZK4A 1Y1SA 2D7JA 1FYWA 2NAPA 4TRMA 3TOXA 3NANA 4BDSA 1WY7A 4D9HA 1L3BA 1IOWA 3L8HA 2D2FA 3PGKA 4PLCA 1K9VF 4MUGA 2V6MA 2CFSA 3D7SA 2JH8A 3COZA 2DLCX 2A57A 1XCLA 4PY2A 1SD2A 3CVUA 2QTBA 1RBQA 2XYQA 2P8SA 3C74A 4B6OA 2AFHE 2LGJA 1RLMA 2HLPA 3ER9A 1VFPA 5LBUA 2ECKA 3C5CA 4BASA 2GHQA 1IPHA 3MJVA 4LDAA 3LNTA 2P78A 1J0BA 3FYUC 2PUAA 2OHGA 4M2LA 1LJUA 3FNIA 1XTVA 3COWA 1J2RA 4V39A 5ETJA 1R0XA 4JEMA 1CQWA 3GLHE 1P1RA 1P7VA 1Y5IA 2WWIA 2DCMA 3N58A 3THRA 4B6PA 4QEKA 2O8BB 4A2QA 2R8EA 3QJGA 2OY0A 4W5NA 3FYUA 1GGNA 5B7QA 3SQWA 3AHGA 2CXXA 2W93A 4KWTA 4DA9A 3V7YA 3IT1A 1P0PA 2PX4A 3AC0A 4KSYA 4BNLA 5KNCD 1DXQA 3TAHA 2XB4A 4JQYA 1QANA 3GMDA 3OOWA 4QARA 1Q0LA 1M5TA 3O21A 2WRZA 1XZKA 2IZZA 2O1XA 5LMCA 5DNCA 3C14C 4OK3A 2IHNA 4JLBA 4HNGA 2IEBA 2ACWA 5C1BA 2BFBA 3LYHA 2V54A 1XDDA 3OBIA 2O52A 2YIJA 1GPBA 4KK3A 1DWUA 4XX0B 1V71A 2WHPA 4R9SA 1BJKA 1Z45A 1H5QA 3HY3A 3M4XA 4RXTA 4RKEA 2K4MA 4CN8A 1U7UA 1NOIA 2J7PD 4FMPA 3DMRA 5DHSA 3O3NB 5YASA 3VKVA 4ED9A 2BY4A 2VDPB 3A31A 3MIIA 1JXQA 2NVWA 1VLLA 2CKDA 2ZAMA 3NH9A 3MPUA 1LU9A 1HKUA 2ZSDA 3K05A 2HTFA 3NPAA 1PZHA 4YJ2B 4EW3A 3RIEA 4KH1A 3O0DA 2FSHA 4MQEA 2BBOA 1WOMA 3UJ3X 3GC6A 2PMFA 1RYEA 1XP8A 2QTMA 2V7BA 4QXQA 4KPGA 4MVJP 4C0LA 2Q6OA 3O4GA 1FY2A 4Q00A 4X66B 1A9ZA 1F0YA 1OX5A 5KJCA 4NEGA 3Q1KA 4RVSA 4DMCA 5A5FA 5GIPE 2NZWA 4H7PA 1QYRA