4C4YA

Crystal structure of human bifunctional epoxide hydroxylase 2 complexed with a4
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
314
structure length
314
Chain Sequence
PSDMSHGYVTVKPRVRLHFVELGSGPAVCLCHGFPESWYSWRYQIPALAQAGYRVLAMDMKGYGESSAPPEIEEYCMEVLCKEMVTFLDKLGLSQAVFIGHDWGGMLVWYMALFYPERVRAVASLNTPFIPANPNMSPLESIKANPVFDYQLYFQEPGVAEAELEQNLSRTFKSLFRASDESVLSMHKVCEAGGLFVNSPEEPSLSRMVTEEEIQFYVQQFKKSGFRGPLNWYRNMERNWKWACKSLGRKILIPALMVTAEKDFVLVPQMSQHMEDWIPHLKRGHIEDCGHWTQMDKPTEVNQILIKWLDSDAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BIFUNCTIONAL EPOXIDE HYDROLASE 2
publication title A Combination of Spin Diffusion Methods for the Determination of Protein-Ligand Complex Structural Ensembles.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 93
structure length 314
sequence length 314
ec nomenclature ec 3.1.3.76: Lipid-phosphate phosphatase.
pdb deposition date 2013-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4c4yA00
2XMSA 1BROA 1CQZA 1Y37A 3QH4A 3JWEA 4DNOA 2JGKA 3DQZA 3H19A 3L1IA 5A71A 3H2GA 2BUBA 3PF8A 2ACKA 5AI5A 1O6GA 4K2AA 2DHEA 2OCGA 2ZSHA 3EQ9A 2O2GA 2XUDA 3W04A 4L72A 5CT9A 5AM1A 3DD5A 4BAZA 4TGLA 4HRXA 4FBLA 4BDSA 2WIGA 4L3WA 1U8EA 4UFNA 3DKKA 5EHNA 2DHDA 3DL4A 1VKHA 3LP5A 1O6FA 4AB1A 5BWCA 2BUCA 3FYUC 3Q0TA 4ZI5A 1WB6A 1QJ4A 4Q34A 4X6XA 5JADA 4K5QA 2GBGA 4U2FA 1BCSA 1BE0A 3BF7A 2WFLA 5HF5A 1YAJA 1DINA 4UUQA 2RAUA 2WHPB 3NUZA 3A2LA 2VEOA 1XRPA 4YK7A 1J2EA 1ZD4A 1SCKA 4GECA 3C87A 4BYMA 1ZIXA 5KWJA 4X00A 3KSRA 1RWQA 3BJMA 3W9BA 1XZAA 2QT9A 3GROA 1W76A 1BU8A 4JNCA 5DJ5A 3DKRA 2FJPA 2IITA 4ROTA 4Y2UA 1KU6A 1FFDA 3E3AA 2WFZA 1LZKA 2C7BA 5C81A 1QFMA 3C43A 3O4JA 5FPPA 3G0CA 1ZGCA 3W06A 4N5IX 4UHHA 1R9NA 4M0MA 4OCZA 2VJAA 3G0IA 3HXKA 2V9ZA 4PO3X 1LBSA 1XRLA 3LIPA 5FOQA 5LLSA 5IVIA 2X76A 3DEAA 3RLIA 1ZI8A 2XQIA 2HADA 1D07A 2O2IA 5I8PA 4UBIA 4X92A 1EDDA 1LGYA 1CUUA 4WY5A 2HL6A 1P0MA 1ACJA 4AN1A 3NGMA 1CUBA 3SX4A 1E3QA 1JJFA 5ALLA 1LLFA 5DNVA 3BDIA 3FWHA 4YASA 1CUYA 1FSSA 2PSJA 4PW0A 1HDEA 2XUGA 2OXEA 1GKKA 1E8DA 4AX4A 3M81A 3RM3A 3U0VA 4BCCA 1CUJA 3WYDA 4UHCA 3FCYA 4BAGA 1GKLA 5A7HA 4QDXA 1UFOA 5A7FA 1UKBA 1DU4A 1NU6A 1ORVA 3FSGD 5SYNA 4J0HA 1DQZA 5AKGA 2WUEA 1AQLA 5CT8A 4DMCA 5ALIA 5D3ZA 4CIBA 3TEJA 1CUFA 3KWFA 2DR0A 4GXNA 3LS2A 3HLKA 3N2ZB 3ESBA 5ALEA 4J0IA 2XMRA 4Y2JA 1QIDA 5AM0A 4AO6A 1IUNA 3HJUA 3G9XA 3WWCA 3DL7A 4F60A 2DQYA 2HDWA 1XZKA 1HPLA 1XZGA 5LP1A 5C8VA 3OURA 4QE3A 3WK6A 1IMJA 3VDXA 1XZFA 5AP9A 1SOMA 1XFDA 3R3ZA 4KRXA 4U2CA 1SC9A 5AKEA 2VJCA 5K3AA 4WDQA 2ZVDA 2AJCA 1T2NA 3WKEA 4BVLA 4U2BA 3STUA 2DQZA 4LIPD 3X3HA 1XRMA 3GUUA 2WJ3A 4B0PA 1JU3A 4QWWA 5D3KA 1HQDA 5ALTA 3CN7A 3VXKA 6YASA 5LIPA 3A6ZA 5EI5A 4J0JA 2E3JA 3H17A 2G5TA 5HF9A 3JYHA 1CUDA 4BBZA 2WJ6A 2QOEA 3WJ2A 4B6GA 1GGVA 4Y2VA 3N0TA 2Y6UA 5JALA 5FDFA 1USWA 2X5XA 4MWSA 1H2WA 5HZGA 4FFVA 5JARA 5AO9A 2XB6A 5DYYA 1DWOA 4EY6A 2EDAA 4WFKA 3O4HA 1F8UA 4KAFA 4AO8A 5FXMA 1VOTA 4KE9A 3HI4A 3KDAA 3D2AA 4BP8A 2QKYA 2HIHA 3B12A 4X97A 4DNQA 5C8ZA 1W1IA 3C6XA 4UHFA 4PSCA 2HA5A 5ALOA 3MUNA 5F4ZA 3QVMA 4MJ3A 3I2IA 4UBNA 3E1GA 2V96A 4UHBA 2XQGA 3DLTA 3ZLUA 2G63A 1PV1A 4QZVA 2WILA 3L1HA 5BOVA 1W75A 2B20A 2AXEA 4EZIA 2PUHA 4EUSA 4H7KA 2H7YA 3YASA 3QPCA 4EHBA 3AZOA 1H2ZA 2XQFA 1P0IA 4GEGA 1G42A 1EVEA 1XQVA 3G02A 4FNMA 5CMLA 3WI7A 1EI9A 1I6WA 3QMMA 2Y1KA 1MNQA 2CBGA 1LZLA 4Y2QA 5ALWA 4Q3KA 1E8NA 5CT4A 4LXGA 2PSDA 3D2BA 3O9MA 1CUCA 4Q05A 1CUSA 2CJPA 3G7NA 1QO7A 4EBBA 5AIBA 1H22A 2C4HA 2HU8A 4HTAA 4J3JA 2WJ4A 1NU8A 1WM1A 3STXA 2K2QB 2JGEA 3CN9A 3M3DA 1ODSA 4BTLA 1CUXA 1GZ7A 3WZMA 5HKBA 5HCUA 1WCYA 4BC0A 4OUKX 4CCWA 4DMFA 2WIJA 1SCIA 2JF0A 5J3JA 1U4NA 3QPDA 4ZXFA 3G9TA 4GI1A 5EHZA 3HABA 4MWTA 3F67A 3G0BA 1N1MA 4BB0A 1QFSA 3I6YA 3T52A 3OC0A 3ANSA 2OCIA 2VTVA 1IUPA 1J06A 4OYLA 5ALDA 3AIKA 1WHSA 5FUMA 1W52X 1EK1A 2QJRA 3WK7A 4J0GA 2QVBA 1XZEA 4I19A 1BCRA 2B4KA 3O4GA 5DWDA 2YASA 3KWJA 1MAHA 5JAUA 1TQHA 5JZSA 1ISPA 1QTRA 2D5LA 4RE5A 4QDUA 1YA4A 4W1RA 3IURA 3JW8A 1DWQA 1Y7HA 4W9RA 5A7GA 4Y2YA 4BVKA 3L1JA 5JD5A 3OPMA 1N5MA 2H9YA 1QLWA 1QZ3A 1TKRA 2WHRA 2HFKA 4J0DA 1ZI9A 3PUHA 1IVYA 4Y7DA 2WUFA 3S2ZA 2PX6A 4NS4A 3GELA 2R11A 1XRQA 3STYA 2I3ZA 1EX9A 1XLVA 2C5FA 1CUEA 4H7EA 3DJYA 1A8SA 4MQMA 2CB9A 1Q0RA 3H04A 5AOAA 3M82A 3WWDA 3B3QA 3F96A 4AZ3A 1PJAA 4NZZA 1YASA 3PFCA 3OM8A 1YAHA 7YASA 5ALFA 2GYUA 4CCYB 4YX9A 4KE7A 1XZBA 3WK4A 3IULA 3IUJA 2PSHA 2VA9A 4GW3A 5C7YA 4E15A 5AM5A 3C6YA 3PICA 1CQWA 1AURA 1SFRA 1XROA 2AJDA 2GBFA 5T4FA 1Q83A 1G5FA 5CT6A 5ISMA 1XLWA 3MUOA 3WLAA 2WSLA 1VE6A 1ZIYA 3F8SA 1FJ2A 2XUQA 4E11A 3D3NA 5K3DA 2QUBA 1CIJA 1CUVA 5E2IA 1JJBA 4PQEA 3BF8A 1PFQA 5KBYA 5E4TA 4DM7A 2OLEA 4XWGA 1EB8A 1WB5A 2WFMA 4EY8A 1ZI6A 1EK2A 2I3DA 4ZRDA 3D5EA 2CEKA 4C6HA 3LLCA 5EHQA 2PVSA 4Y2SA 5JATA 4INZA 5AI8A 3CCBA 2Z3ZA 2JBWA 1QIHA 3BL8A 1E89A 2BJHA 2GBIA 5AKLA 5HF8A 3FLBA 1MT3A 4Y9SA 5JAOA 3AIOA 2XUJA 1LPSA 1HL7A 4ZGBA 4KAAA 2DHCA 2I78A 4IH4A 4X85A 3UUFA 5LYYA 3I6MA 1Q0ZA 1UK9A 2ZYRA 4KEAA 2QZPA 5AKJA 1CUZA 1HBJA 5YASA 2QM0A 5CXXA 5ALSA 3STVA 5AIAA 4I4CA 5BWBA 3FAKA 5IH7A 2ACEA 5IVDA 1E8MA 3TRDA 4FKBA 4JUIA 4RNCA 1TRHA 2QRUA 3HC7A 1LPBB 4ARBA 1SCQA 4U2GA 1EHYA 5D7BA 2VF2A 3LIIA 5T4HA 4IO0A 4A5SA 3WKAA 4AMZA 3QBJA 4UHDA 4TVKA 3AILA 1R1DA 4B7ZA 3R3UA 1YSCA 4UBKA 1UK6A 4P92A 3FOBA 5JD4A 2V97A 4DSZA 2XUOA 3AZPA 2XMDA 3WK5A 2XLCA 3VJLA 2PSFA 3G9UA 4BVJA 5JYCA 4UBJA 2I03A 1GT6A 1X70A 2WU3A 4DIUA 4MYDA 4MEAA 4H7HA 2XMZA 1AGYA 1HLGA 1XKTA 1Y7IA 4OSEA 2PBLA 4UFPA 1QE3A 2WG0A 1IZ8A 2Y2VA 3HRHA 1VZ2A 3B5EA 3O9VA 3WJ1A 3I2GA 3QM1A 2WKWA 2BCEA 4UFOA 1XZJA 2BGNA 3D0KA 3PF9A 4PNZA 4AQDA 4DLNA 4H7FA 1QGED 4B9AA 2H1IA 3TJMA 5AOCA 4B82A 2WIFA 1QIJA 2HA4A 4FLFA 2QUAA 4LYDA 4Y2RA 1CUGA 1LPNA 3HSSA 4CIAA 3I2JA 5EFZA 3UMJA 1E5TA 5ALNA 5AM2A 3DDUA 4J03A 5AOBA 3DNMA 4F21A 3WL5A 4CI9A 1GXSA 3KD2A 1CUWA 4OPMA 4HZGA 2O7RA 3V1KA 3SC2A 2DFPA 4W1SA 3E4DA 3VKFA 3WKBA 2P8SA 2QTBA 5JANA 3A2NA 2ORYA 3KOOA 2J4CA 3GBSA 2YXPX 4DGQA 4W1PA 1BN6A 2OQVA 3HEAA 2WHPA 1UK7A 3QYJA 2C58A 2C0PA 4X95A 4QDTA 5CT5A 2VT7A 4OB6A 1IZ7A 5ALQA 3HACA 5HK9A 3MGAA 4FMPA 1CLEA 1R88A 4FBMA 1WPXA 2WHQA 3RARA 1R9MA 3AZQA 5DLPA 1XZIA 2J3DA 3QITA 1JKMA 1MPXA 3I2HA 3GZJA 3F9CA 3QMVA 4GBGA 1BRTA 3VISA 5AKXA 1WOMA 5AK5A 2HM7A 2J4FA 1ZOIA 3D4LA 2C5GA 1XZLA 4KE6A 5ALPA 4OYYA 3V1LA 4OU4A 4G8DA 4MQLA 1A7UA 2H7XA 3WKDA 3H2KA 2VAVA 1EDEA 1IUOA 4DNPA 4IH1A 1VJ5A 5KWIA 5ALZA 2B9VA 1K6EA 4BP9A 2XMGA 1L7AA 2Y2UA 5C8XA 3AIMA 3ESAA 4ZWNA 1EDBA 3WA7A 4U2EA 3A2MA 1YR2A 4PSDA 4X93A 2Y6VA 2VSQA 3Q8WA 1QO9A 4C87A 3BDVA 5JAPA 1KU0A 2JGJA 1XQYA 3G9ZA 3DCNA 5HQ3B 2YYSA 2CMFA 2VAXA 2XUIA 5SYMA 1DWPA 1VXRA 1UKAA 3C70A 2CZQA 3EF3A 1XKLA 3P2MA 4K6GA 4CFSA 3BXPA 4BZWA 1AZWA 2BKLA 3AJAA 2XUAA 4EY7A 1W6RA 2VQ6A 1GQSA 3D7RA 2PUJA 5ALJA 5CBKA 3EBLA 4WCVA 3V1NA 1JU4A 2Z5GA 1QIKA 4H18A 2EDCA 4X91A 1CRLA 2OCKA 2CUTA 4L0CA 4F0JA 2WM2A 3S8YA 3G8YA 4A23A 2HA0A 4C88A 2XUKA 5D6OA 1H2YA 1L7QA 5KREA 2GZRA 3ICVA 2JGMA 4FFWA 4PV7A 5FP0A 4DSAA 3DOHA 4AZ0A 2PKYX 4CG1A 1MX9A 5FLKA 4G9EA 3BIXA 1UWCA 5E4YA 4XVCA 5DNWA 5IVHA 4FOLA 1YB6A 2GBCA 2X8BA 2ZYHA 5ALKA 3R40A 5LZ4A 4DTCA 3R3YA 3DOIA 1AC5A 4X3CA 2B61A 5AJHA 1DT5A 4GLBA 4WFIA 1EB9A 2XMCA 5AKIA 1M33A 2WFLB 4FTWA 1X2BA 2JGFA 5LZ5A 2QJWA 5ALUA 2WLSA 2XT0A 1LPOA 4YPVA 1R4ZA 3H18A 5CH3A 2WTNA 1F0PA 4G1FA 4F5ZA 5A6VA 4ZV7A 2ZJ6A 4UHEA 3WL8A 2HRQA 4X6UA 1QIGA 3IUQA 3C8HA 4ZREA 5JASA 1TIBA 3I1YA 4JYMA 1DT3A 1MU0A 1W4LA 1B41A 3ZI7A 3M83A 4N8DA 4XIIA 5DTJA 5EIAA 5K5EA 1K8QA 3PFBA 1YB7A 2QS9A 3PE6A 2HU7A 1K63A 3HZOA 1CPYA 4HXFB 5DYTA 1ZJ5A 4BCBA 4EA6A 4BZZA 4DYHA 3LCRA 4Y2PA 2ZJFA 3MVEA 5EGNA 3ICWA 2PU7A 1UT6A 1MNAA 4AMYA 1EA5A 3F97A 2OPHA 2XMQA 2QXUA 3WL6A 3IB3A 3R41A 1HKHA 3TGLA 3O95A 4KR0A 4J7AA 3IBTA 5IKXA 1ODTC 4Q1VA 2AJBA 5AI0A 2ZSIA 4MEBA 2FX5A 4DNFA 3O4IA 4DMKA 4RGYA 2QMQA 2WUGA 5EHXA 1THGA 4QLAA 2G5PA 1S8OA 4U2DA 3FNBA 2RHWA 4IHAA 5HFAA 5ALXA 1ETHA 2JGIA 2ECFA 4AXBA 5K3CA 2OGZA 3C6BA 3WIOA 4C4YA 1LPMA 2WIKA 1LPPA 2VJDA 4JEIA 4JH0A 5IVKA 2HRRA 2W22A 4W63A 1X2EA 4Y2XA 5AKYA 3VVMA 4K6HA 3FYTA 3C8DA 4P08A 3EIOA 4HRYA 2DCMA 4BTVA 1CR6A 5FPQA 4OB8A 4LKOA 4P9NA 2O7VA 4N5HX 4ZV9A 3ILSA 2RHTA 3R3XA 4LXHA 4M0FA 1UKCA 1CEXA 4X94A 4JYPA 4B0OA 1J07A 3O0DA 4B85A 3IIIA 1C7JA 2D0DA 1F6WA 3PDCA 1P0PA 5ALGA 3BWXA 1CUIA 5AM4A 4UBMA 1BN7A 1YS1X 4J0CA 4KJXA 1A88A 2WU4A 4IH9A 4C01A 4L9AA 4FDMA 1H23A 5CXUA 4C4ZA 3FYUB 5ALHA 2XQKA 1J1IA 4WJLA 1BEEA 4QWMA 4PSUA 3KXPA 5CH8A 1AX9A 2G4LA 2PL5A 2J3QA 1A8QA 1VXOA 2HA2A 2ZYSA 3C6ZA 1CFJA 1VA5A 1B6GA 3WWPA 1YCDA 1E66A 1K5PA 3E0XA 1OCEA 4BCDA 5AK4A 1XLUA 4LXIA 2IX9A 3VJKA 2OG1A 1THTA 3WL7A 4A16A 3AFIA 2XLBA 4BE9A 2OGSA 5AHXA 4CG2A 2XDWA 2W6CX 4EY4A 4E46A 4G4IA 1R3DA 1H2XA 1TCAA 4UPDA 3ANTA 1AKNA 4KRYA 4ETWA 2HA7A 4E14A 1XZDA 4BRSA 4X6YA 4BDTA 1EH5A 1VE7A 1XQXA 3C5VA 1LPAB 2ZJ7A 2PU5A 2Z8XA 4QA9A 5AICA 5FRDA 1OXMA 2NW6A 3IVMA 1C4XA 2GYWA 3DYVA 4X90A 4B80A 3H2HA 3QMWA 4CCYA 3WA6A 2XMBA 4NVRA 1UXOA 3FCXA 4OD0A 4C4XA 3BJRA 3H0CA 3RKSA 3FVTA 3V1MA 3W2TA 4GWLA 4ITVA 4HVTA 4S0XA 2BFNA 2OGTA 2Q0XA 3QPAA 1ORWA 2GYVA 5FV4A 1DQYA 2ZYIA 3WZLA 5K3FB 1F0NA 2HA6A 2AJ8A 3STWA 1ZJ4A 4G8BA 5AK3A 3IUMA 1QTIA 4G4JA 2IIVA 3C5WP 1RYYA 1MX1A 2ROQA 2RONA 3STTA 2DSNA 1XQWA 4X71A 4M0EA 2VATA 4GHWA 1VLQA 5BV7A 2GZSA 5CRIA 4AO7A 1A8UA 2Z3WA 3ZLTA 1EVQA 2FJ0A 1EXWA 4B83A 1ACLA 2HU5A 4MYSA 1JJIA 2XUPA 1U65A 2JGLA 3FBWA 2AJLI 2RGUA 2WG2A 2OQIA 3CXUA 1VZ3A 1ZICA 4PF1A 4K6KA 1WPRA 3I28A 3FLEA 4H7JA 3G0GA 3V48A 1N8SA 4EB0A 1QIIA 2JEYA 1G66A 2XI4A 3WMRA 4QDOA 4G9GA 4H35A 1FFCA 5DYWA 5LZ2A 1QIFA 5I7UA 4TPKA 2ONCA 4CG3A 5A2GA 5AKHA 1TCCA 1MTZA 4Y2TA 5AI4A 2BUAA 4FLMA 4I3FA 3FYUA 4QEKA 1QOZA 2R8BA 3WKCA 3I2FA 3R0VA 3CCCA 2WUDA 1ODCA 1YS2X 4OB7A 4B81A 5T4BA 2PSEA 3OOSA 1K4YA 3C45A 4AN0A 2JEZA 2BAGA 2Z8ZA 3DS8A 5CURA 3ESDA 1WB4A 5ALRA 4X7BA 4RE6A 1NX9A 1QIEA 1QIMA 1GPNA 4Q3LA 3WWOA 1AMNA 3W05A 4C89A 4FHZA 1CUHA 4WDRA 4IQ4A 1WHTA 5AI9A 1UOQA 5ALVA 4EY5A 2FUKA 2PPLA 4B84A 3QZUA 3WK9A 2QXTA 2XUHA 4H7DA 2WQZA 5JIBA 2VJBA 5FKJA 2VT6A 4LHEA 4G8CA 2PM8A 1FFBA 1GPLA 3R3VA 3W9UA 4BATA 1XZMA 5AKKA 5AKZA 4FLEA 3K6KA 1MJ5A 2H7CA 3D59A 5T4EA 3T4UA 1QONA 3NWOA 5HFNA 2XE4A 1FFEA 3IDAA 1L7RA 1T4MA 4HXGA 1OILA 2LIPA 1ZGBA 2JIDA 1C7IA 3WYNA 1FFAA 5ESRA 3WK8A 5K3EA 2QR5A 3IUNA 2RIPA 5HF6A 2V98A 2RI6A 4DMHA 4BAUA 1XRNA 2ES4A 3ZLVA 5AI6A 5JD6A 4G5XA 3H1BA 5K3FA 1MO2A 4N8SA 1JI3A 3VJMA 4KYVA 4HXEB 3WQHA 1BEZA 3PUIA 1R50A 5JZBA 4H77A 5JAHA 1UZAA 2XQJA 1CVLA 3WIBA 3OG9A 2CKMA 4UBOA 5A62A 1JT2A 3ZWQA 3GA7A 4XJVA 2OCLA 5DNUA 3R3WA 4Q3OA 4W1QA 2OAEA 1ZD5A 4UBLA 1MN6A 1TAHA 4ARAA 3BE8A 3I2KA 5H3HA 2BGRA 2HFJA 3I6ZA 3RK4A 5LKAA 3H2JA 2WTMA 5LKRA 3WWEA 5AK6A 3AINA 4FNGA 5CW2A 2WG1A 3UUEA 3BIWA 1KEZA 1Q84A 1YA8A 4WFJA 1LBTA 2YH2A 5AH0A 3NOXA 1JMKC 4QDZA 3ED1A 5DTIA 4N8EA 2UZ0A 1Z68A 5E4JA 3K2IA 1TCBA 1DX6A 1CUAA 4RPCA 3A70A 1UOOA 1AUOA 2C0QA 3IA2A 3G0DA 5LZ9A 2O2HA 2HHAA 3ESCA 1LNSA 1XZCA 4Q82A 3FLAA 4KAJA 3EQ8A 1MAAA 1ZD3A 3U1TA 3AUKA 1TK3A 3EQ7A 4HS9A 4O08A 1GPKA 4H0CA 3V9AA 3FVRA 4WY8A 4Z49A 3ZPXA 4GDMA 1UK8A 3GFFA 2EEPA 5HKAA 4OU5A 4B9EA 3VVLA 3ZV7A 4J0KA 5LZ8A 4BC1A 3D2CA 1XRRA 5JZ9A 1XZHA 1GQRA 3HYSA 5ALYA 3H1AA 1UOPA 4FWBA 1P0QA 5K3BA 3FSGA 1JMYA 3DYIA 4KE8A 4MXDA 5EIEA 5HK8A 4P93A 1G4HA 1BS9A 5CH5A 2XUFA 1RP1A 3K9BA 3SK0A 4NMWA 1MX5A 4QLOA 4XX1A 5AM3A 1EINA 5EIHA 1N5RA 3SWWA 4BE4A 2WIDA 1DX4A 3PI6A 1DTEA 5I9IA 4KACA 5HQ3A 1VA4A 4D9JA 3H2IA 4LYEA 3I1IA 1ZD2P 5ALMA 1CV2A 4G4GA 4V2IA 2OAGA 1U2EA 4BRZA 3OTQA 5CTAA 4HAIA 4QNNA 3F98A 2HA3A 1JFRA 5LZ7A 4H7IA
chains in the Genus database with same CATH superfamily
2OKCA 4WXEA 3WMWA 2I66A 3HWWA 4PX9A 5KDLA 4JI6B 4B48A 3PK0A 4EFMA 1Z0KA 3HDHA 3INTA 1HEUA 5B53A 4D3FA 3GQVA 2ZE5A 1HNZB 3RYFA 3SI7A 4OBEA 4B3SB 4G5RA 3THWB 4HDQB 1NFRA 1IEVA 2IP2A 3DQZA 1UDXA 2AFHA 2K4MA 4ZANA 3H19A 3FHCB 5HX7A 1KS2A 3H2GA 5B3KA 1R12A 2BUBA 4DDVA 1FVHA 4IVRA 4PO8A 3HFGA 1QHIA 3LCVB 4RQBA 1SHJA 2DM6A 2OXTA 3ZDCA 1ADGA 1IEQA 1O6GA 2O06A 2XKAA 4OXYA 3ZYCA 2DHEA 2ZSHA 4PC3A 2P1RA 4X1KA 5K8UA 2O2GA 2W2NA 1QUFA 4YAGA 2XUDA 3OPVA 4KB5A 5D1HA 1D6NA 1I14A 4QPCA 4YTEA 5HKKA 4Z0NA 3VO8A 5TF4A 4L72A 1G8SA 3LX5A 5CT9A 1FXWF 5AM1A 4QOIA 4NZOA 2WSBA 1KK3A 1XSEA 3WYAA 4GZ3A 4ADSG 5KQGA 1GO2A 3BWDD 1A69A 3B5JA 1UBSB 2ECKA 3ZNQA 4FXOA 3K9CA 4FZVA 2WIGA 4L3WA 4HAOA 4AECA 1XA3A 3D3WB 4L6CA 4DXAA 4EECA 1DOZA 1NRIA 1XBTA 2LDXA 5LUAA 4K28A 4OSPA 3TLMA 3DL4A 4Z2AA 1Z7BA 3HHPA 2G5CA 2XCLA 4MHSA 4OATA 4RD4A 3ZGXA 3W8RA 1Q3KA 1XCMA 4U1RA 1XMIA 1WW2A 1GAJA 2B3TA 3KR0A 1G63A 1ZA1A 1M10A 2QTRA 1D1SA 4N54A 4BS9A 4ZI5A 1OU0A 4KL8S 4BUJA 4E7OA 4YLYA 4JL6A 5JADA 1AGXA 4HH3C 2VH5R 3HA3A 2B98A 4K5QA 3VZDA 2ASEA 1K7SN 1O8BA 3AI1A 4OKIA 4R98A 4TXMA 1L1QA 1X92A 3FJ1A 3ZBTA 3NGXA 1BE0A 1WCV1 4CM1A 3SLGA 3ETLA 3R8CA 2WYUA 2XCUA 5T57A 1B6RA 3L8ZA 3EEIA 3R5TA 3P7MA 1KZ7B 4YUVA 2IC5A 3NTRA 1JQ3A 4R2XA 3UFXB 1DINA 3CPEA 2XTMA 1MC1A 1U28C 1AE1A 2JGRA 2WRZA 4LBZA 4LOLA 1ZU4A 3A2LA 4XSHA 5EP4A 2IUTA 4DG5A 3D8UA 1XRPA 2P9BA 3D81A 3V8EA 4YK7A 1ODFA 2BEWB 1N2CB 4JY7A 4IQGA 3ROPA 3TLZA 1Y5IA 1I5RA 4CEIA 1COZA 3ZGZA 5AJVB 1IZYA 2BTQA 2VSFA 3ELDA 1S8FA 2OPBA 2P4UA 4RC9A 3UV3A 3TUIC 1CZNA 1Z16A 1ZY2A 2JFQA 2HCBA 5DRTA 5E1OA 4RTQA 1QVVA 1G3MA 3G6WA 1Q3HA 4BV2A 3K0KA 1XU7A 1EP3B 1M6EX 4TTAA 5BRAA 3FGNA 4NE7A 3W5IA 1GRRA 3GZNB 1WMEA 3OIVA 4CL8A 4BX9A 1BSVA 1Y4DE 2ZAMA 3UJCA 1LKZA 3GBVA 4M7PA 2QT9A 4ZXPA 1PGPA 4B4UA 3UPUA 1DG1G 2H4XA 2J6IA 3NR2A 1I3NA 4NPAA 1DO0A 1JLHA 3CLUC 4P83A 4TM7A 3EE6A 3U19A 2ET6A 2QXYA 4J90A 4QYXA 1LEHA 1KY5A 3ANLA 1STOA 3DKRA 4NZYA 2ZI7A 4RHYA 2HQOA 3UT0A 4EKEA 5KOJB 1DI0A 2RHHA 4CF3A 4D81A 5AVJA 3AVQA 4R1SA 4N6NA 4D9IA 3WQBA 3QNWA 4NOJA 3N70A 1H9BA 5HJ7A 3E3AA 3ETJA 4TX1A 4JI2B 2EKQA 3SIXA 3HA2A 1DBQA 3T7EA 1LZKA 1JL3A 2C7BA 1P3JA 8AT1A 2W4IA 2XB8A 4JLMA 4FB5A 3AK4A 4CNBA 2AD1A 2G67A 2KBFA 5KJFA 4ITUA 1UEXC 3TUJC 3MXOA 3DF7A 2KHZA 1AUQA 2BM8A 3HBNA 3MSCA 2E4YA 1JHMA 3GRPA 4CM8B 1LCIA 1NYRA 4HQ6A 4XDZA 1NKSA 4M0MA 1JEQA 4UCXA 4OCZA 3W3AD 4OP3A 3WLHA 4CLDA 4LE2A 2BM0A 2GZ3A 3QKRA 3R9XA 1A7AA 2A67A 1W5EA 4PO3X 1LBSA 4KX5A 3IV6A 3IE1A 5CW1A 2MSDB 1KY3A 5FPKA 4RZXA 4FU0A 4QOHA 4AC9A 3ASUA 1BH6A 4RQUA 4KXWA 4GI5A 3FCUB 2FPOA 1QRSA 4IJWA 2XWPA 3WYGA 2X8JA 4BO8A 5C0OE 3QG5A 4HEQA 4JB0A 4HLQB 2NG1A 2J87A 2O2IA 3IIKA 4FIDA 4O5AA 4QHTA 4TS9A 2JFYA 3WLTA 2QVCA 4IJKA 4IIHA 3H4MA 1Y4ZA 2X1LA 3NBXX 3LC7O 4X92A 5EKDA 1PFVA 3T1OA 3TCNA 3ZHRA 3JYOA 2QD5A 3TSZA 3ADDA 2AD5A 1R8SA 3HKCA 3E81A 1L9KA 5MGNA 5DULA 2HSWA 1UKYA 1YTLA 3M9XA 1JHYA 1ACJA 2HJWA 2QI9C 4LECA 4LI0A 1CUBA 2YFHA 5ALLA 3E22A 4MRAA 3EVCA 4CM9D 5K0SA 5DX1A 1U7XA 3URMA 2A30A 3LY7A 2FP3A 4TYNA 2REXB 3WNZA 3B7PA 1KJNA 1ZGGA 2FWAA 4MQUA 2HEGA 2D2VA 2HSDA 2WC1A 1C4KA 5TQ2A 3LPDA 2FPKA 3COPA 1Z83A 5ELMA 4D4IA 1G291 1QGUA 2PSJA 4PW0A 1DKQA 4NECA 1ZD9A 1A9TA 3DUFA 2OXEA 5IUKC 1UIMA 1J70A 2JHFA 3I9FA 4FWTA 4OHOA 3K0HA 1NFFA 2O52A 4AJPA 1F38A 1RACA 2DSTA 2JK0A 1P2TA 4GMKA 4AX4A 1XCOA 1WXDA 1L7XA 1O97D 3RM3A 4DWOA 1ABBA 1J5EB 3O3NB 1T3HA 3MTBA 1SIBE 4BO7A 4AUKA 4F04A 4EA7A 1KO1A 2PFGA 1ST3A 1AT1A 2OESA 2QAJA 1ZEJA 2BMVA 4LJ9A 5JVDB 3EA0A 4PLZA 4RSHA 3WYDA 3I01M 1V1RB 3FMFA 1Z63A 1G59A 1EVIA 5CHEA 1EP9A 3OFKA 3CRQA 1Z07A 1VKRA 3HR4A 1GKLA 4QICA 4TKVB 4HPJB 4CN9A 4CDRA 1UFOA 5A7FA 3PQ6A 2C2ZA 5EVCA 4UCWA 4E4YA 1GKYA 3WDLA 2OHHA 3DKIA 3QMPA 3K9NA 1TB4A 1YZUA 1ORVA 3ASZA 2A1TS 3BJIC 3FSGD 4C43A 4JASB 4H0FA 3PSAA 5HSGA 5GAJA 1CRPA 1LX7A 5KNBH 1DQZA 1NWCA 1DRUA 3EZYA 3BERA 4LTNA 4YT2A 4MA0A 5CT8A 3H2SA 5D3ZA 5ALIA 3ZY4A 4QKQA 4CIBA 5DK6A 1AS3A 4F6RA 1SBCA 3LUHA 1K0FA 1UOEA 1XMSA 3L0ZA 1PQ4A 4GXNA 5J5AA 3GK3A 1KI4A 2FSVA 4S2UA 4UTNA 1WU8A 2ZJYA 2XMRA 4EG8A 1A27A 3H9CA 1QB7A 4ENUA 4MI1A 1BW9B 5LVAA 3O8BA 3OT5A 3NIFB 4LHSA 3SQLA 4A92A 2WD7A 3HJUA 4HBZA 2C9MA 3G9XA 5ALYA 2GERA 1UH5A 4Z7JA 1XHLA 2FE4A 1R6TA 3G2QA 1THZA 4OXXA 2OOKA 2P2CA 2HDWA 4C9BA 3BGOS 3HP4A 4A0FA 1IH8A 1MOZA 1XZGA 4J1SA 2XOXA 1Z5ZA 1O77A 1IMJA 2DWPA 4E5SA 5AP9A 1KVQA 1A9YA 3O1HB 4MWZA 2P3OA 1RRKA 3CH5A 3GOHA 4HWTA 1HQCA 2GPYA 2OHJA 4LJ6A 4U2CA 3VYWA 1UJMA 2QTTA 3R6GA 4RSMA 5AKEA 1FTYA 4PC6A 2CY0A 4W5QA 2VO1A 2PZKA 1N2IA 1T2NA 2HY7A 5BP7A 3BGVA 3DLHA 2H1WA 3E05A 4KIGA 3RS2A 5C4IA 4BVLA 2I54A 2I65A 5KNCA 3LUAA 3PU6A 3OE4A 5BSVA 2PKCA 5ADUS 1D2EA 3M1IA 5FF9A 1PYDA 3JARB 3STUA 4Q3CA 3KPVA 1YI8A 1AKTA 5A4FS 5LU9A 1N78A 1PT8A 3U4GA 4HNSA 1SC1A 1WKBA 1N33B 5ETJA 4ALIA 1LRKA 3DEYX 3SE7A 2W2TA 2RGYA 3L4BA 5JCXA 2FMIA 4TRNA 3WL3A 1G2IA 2K5UA 2R86A 2WJ3A 4M7WA 1XX6A 2CLIB 4OK3A 4P58A 4R83A 4QWWA 1HNNA 3U4QB 4ZQGA 5GWXA 2PZAA 4H4EA 4ECEA 1J8VA 4WZBE 4YLGA 4MX8A 1O97C 1ILEA 1ZX1A 2IXDA 4FOPA 4PRZA 1BCRB 1DDGA 3QUTA 4L08A 3DW1X 4LWPA 2HDOA 1TQ2A 2YY7A 1T6YA 2HOQA 1IQRA 1DUSA 1QDEA 2BFBA 3A6ZA 4D2IA 1KMQA 3DM9B 1G8AA 5AD1A 5DKFA 1HFKA 1F4VA 3S2YA 3A3YA 1B8VA 5HILA 1SXGA 3W8NA 5EIOA 1H1TA 3H17A 5F52A 5HF9A 2QRVA 4K3UA 3V6MA 2AMVA 1E79D 2NVUA 2PGIA 4QU5A 1GQOA 3OETA 4LDQA 1PZXA 2WJ6A 4OMDA 3IV9A 1XXHB 1JEOA 1J33A 4QYIB 2ZUTA 1GGVA 3ETNA 1ENPA 4Y2VA 2GQ0A 4UTOA 4KPEC 2XT6A 1T6ZA 1IHXA 2CLKB 5JALA 5FDFA 3WLRA 4KWEA 3UA4A 4MGEA 5EWMB 4BPRA 1SCUB 4MWOA 3SEAA 4HQNA 4FFVA 5JARA 3A4IA 1XYGA 1MJGM 4XYEA 2RH5A 4JODA 5HKKD 1GZ5A 3KZVA 1U5BB 3ACBA 4DUYB 1A77A 2XB6A 3RAJA 3S40A 2ZAOA 2AQHA 1RHUA 2PKRA 1DWOA 5ULLA 4AP9A 4EATA 2MR6A 1ZS9A 4EY6A 3O93A 4INAA 5KQRA 2EDAA 5BXYA 4ZI7A 3N86A 5E6UA 2ZWOA 4Z4GA 5BUCA 2IWRA 2YFYA 3HN2A 2YINC 2XXJA 3CZCA 3G23A 3ZNNA 5CDGA 5K0JA 1JJVA 4KE9A 5K4AA 3HI4A 2FUEA 4JJ8A 4OOEA 4ZC8A 1ATIA 3SR4A 4HR7A 3UT6A 3CWCA 1S2LA 4FYMA 1WCXA 2I22A 1Q7TA 3CPSA 2AYZA 1JWAB 3B12A 3NC1C 2VQDA 4X97A 4FDTA 3GU3A 1FTGA 4HUTA 1CRZA 1QXSA 3AR4A 3K53A 4R7ZA 4ARZA 1B7GO 4ZYXA 2YBDA 4RIFA 1QPZA 1HY3A 3C6XA 3KZCA 5DGTA 1L4KA 3KB6A 4F93B 1FP6A 1ZMBA 4Q9KA 4KDFA 4V0RA 1HC7A 1Z6XA 3MUNA 4G5SA 4CFYA 2C8JA 3M5WA 4QHSA 4WKCA 3AF5A 1UPTA 3QVMA 4IDHA 4AZ3B 1PD1A 4P3NA 1JPJA 5D2CA 3R9IA 3E8XA 3EARA 1JG4A 4PICA 3DLTA 3DMTC 3RC2A 3ROXA 1D0SA 1GNLA 1DX9A 5BW8A 3IB6A 3VC3A 3BMCA 1PV1A 2DFKB 4QZVA 2ATVA 4M0LA 2V4ZA 2JLWA 4P8RA 4XR4A 2FY8A 2PANA 3L1HA 5B12A 3JY6A 3MCZA 1PKXA 4O29A 3BFPA 2B20A 4GYWA 4RZ3A 3OLZA 1UANA 3DE0X 4RELA 5CLQA 4MMZB 1KE1A 2ZATA 3GG2A 2H7YA 1N36B 2X9VA 4JEMA 2M6SA 2SKEA 4K81B 5B2ZA 1KTIA 4G0NA 2DPYA 3W2GA 1G7CA 4JR1A 1X15A 4EHBA 4YDRA 3PJDA 5KSZA 3NFRA 3AW9A 5DBFA 1A9XB 1JDBB 3UK0A 2MYTA 3AJ8A 3JQFC 4KQCA 1ZH8A 3OZCA 1IB0A 1CVRA 2YWRA 2DWCA 1QZZA 2DERA 2XQFA 1C8BA 4PQFA 2R1ZA 1VPDA 1SUSA 4I50B 4GEGA 3GDHA 1V8BA 3WE7A 1PZFA 3O94A 2PLRA 1EVEA 1XQVA 3HCPA 1H5NA 2P4HX 3H5LA 3A26A 4G0PA 1CDDA 1X1TA 4FNMA 3P97A 3DXFA 5CMLA 5EFOA 3JD1A 3ASYA 4FCTA 3WI7A 2BFCA 3QMMA 4HWGA 3RWOA 4W7SA 4EJSB 4D3SA 3SQDA 2GN0A 1JHXA 2CBGA 1TKCA 2CHUA 4MLDA 3O38A 1NAHA 1E8NA 1CD5A 1KZ1A 2IPNA 1VBNA 1KAHA 2FETA 2JLBA 3NBZC 3KJGA 3OE7A 1EAMA 3CFYA 3KWLA 3T3OA 2G1KA 3CNNA 3SD7A 1JBQA 1R3UA 3QX3A 2ZLBA 3UJ3X 3JYPA 3NOQA 3EH2A 1E64A 4FYVA 3SZUA 4YRZA 1QK5A 4QREA 3DBLA 3G3EA 1O6ZA 4KNWA 1EGAA 2HU8A 1Y1QA 3CQ9A 1P7VA 5DMXA 5CPFA 4TKMA 1IRXA 3B6IA 3ZX5A 6Q21A 1P5FA 3W78A 1T3LA 1KIAA 1L4EA 4D26A 5IJ0A 2BCJQ 1N34B 2JGEA 3ZW7A 2BIFA 4Z99A 4PZAA 3TWOA 1CUXA 3A6LA 3P1JA 4FFNA 2X8AA 1ZUIA 3AHGA 4IGFA 1DOAA 4OJNA 4Z2YA 3L7MA 4FHDA 3L6DA 2Z09A 3WZMA 2AN5A 5I8WA 2GHRA 2AR0A 3OM1A 5HKBA 1MJHA 1NW6A 3BD7A 5H16A 1WCYA 1DFIA 1YBFA 3ZZUA 1PTJC 3FNHA 2O4CA 1PNQA 3K72B 4XYMA 1Y9ZA 4CCWA 1KBQA 1LRJA 1P2DA 1U9JA 1E7MA 4YMLA 2ZIZA 1H1LA 4QC2A 3C7DB 5B37A 3ASVA 3QXXA 3JZDA 4GLFA 2NZXA 2UUOA 1SCIA 3JQCA 2O8FB 4TTIA 4C7KA 1Y9JA 4MQEA 1QQ6A 1NQAO 2HCFA 4JD5A 2O48X 2GH1A 4YPOA 5KYNA 2ZANA 3FNGA 4JAVC 3COSA 1CZLA 2RHJA 3G9TA 1GPWB 3ICPA 5EMKA 5G41A 3TZLA 1GR1A 1NN1A 2UZ1A 5LMZA 3L41A 1QPGA 1YH3A 1T5TA 2BEVB 2IIBA 5KUTA 2ZI6A 4NE2A 5FJIA 1N1MA 1NQWA 2HGSA 4BB0A 2WYIA 1JVBA 1KZ6A 3FYDA 2ODPA 2B7LA 2R7MA 2X9GA 3NP9A 3PKJA 2JB9A 2OCIA 2XADA 1DJLA 1KYIA 3AVXA 2JIQA 3EVDA 2JATA 1J06A 2PGOA 3CLVA 1H69A 3VR6H 3AIKA 3QXCA 3ORHA 4EUNA 1WHSA 4C2TA 3KK0A 5CD1A 4N0DA 4V3CA 3GLFE 1YKSA 1JH9A 2B8TA 3GCZA 4H3HB 1W52X 2J1LA 4YREA 4DA9A 1UZMA 2RGNC 3WLEA 3EN0A 3KKKA 3WK7A 1XZEA 5E0KB 3RODA 1XGKA 1N5OX 1XHFA 3IX7A 4WPGA 4MDFA 1SBYA 3UA3A 4YECA 2FN8A 2FOLA 3NWBA 1POWA 1MKYA 2D0IA 3ND5A 2B4KA 2HEIA 1NNI1 1E9CA 3I8OA 3O4GA 4IDGA 3R7AA 4XFJA 2ZTSA 5A9RA 5JS8A 1EUDB 3VZRA 1L2TA 1OFHA 2HPZA 1QVRA 4GR4A 2B4QA 2A1TR 5AW7A 1ISPA 1JWLA 2PA0A 3SLRA 4AX8A 1EM8A 4JN6B 1FTNA 2EJCA 4WFQA 2PVPA 2GAOA 2OP0A 4W1RA 2UZAA 1XN1A 3K32A 4BB6A 4PLYA 4EOGA 1DWQA 2WWXA 3N0RA 4L07A 5J2TA 4BXOB 5A7GA 1YDGA 2NGRA 4CN8A 1GGFA 3DCYA 4NYJQ 1N5MA 1HO3A 2VDMB 4MW6A 3ST7A 5KJCA 3H1FA 4KFSA 1FXSA 2ZSKA 2WYOA 1EFDN 1QLWA 2CNLA 2H9YA 5IH3A 4IQFA 2NU6A 3IELA 4B7CA 5A3RA 3L4KA 4KAXA 1JA1A 1P7PA 2DJIA 1L5VA 1XUOA 3INYA 1PNOA 3PQ5A 4KPGA 1NVAA 2WHRA 4B2PA 3C3BA 1T24A 2X4DA 1XMOB 1IOLA 2OTCA 2DZDA 2HFKA 4FONA 4J0DA 4C4AA 3PUHA 1J9GA 1IVYA 2X41A 4ZQFA 3JAWA 4BFTA 4QJ3A 1OXTA 2AEJA 1C3JA 4TMYA 1SZCA 4PZDA 3RLFA 5CB0A 1HORA 2WUFA 2DQSA 3QYPA 5BSGA 3I9JA 3OF3A 3OTOB 5HQJA 3BCSA 3GELA 5EUBA 1C14A 1T2AA 5KTYA 1H3NA 1QRAA 3A4NA 3CGGA 4IVPA 2PX8A 1N5DA 2X77A 4M6WA 2ECQA 1CUEA 2PKWA 1KZGB 4RAQA 4WKOA 1TEZA 2JJYA 4D3YA 4YV2A 2NP6A 2TMDA 4MQMA 1QDLB 3KFVA 3OSZA 1OTHA 2EZ8A 1WXGA 5KOYA 3B3QA 4YAIA 1T2EA 3MNFA 5KNCD 1FDOA 4CCAA 1M2JA 1E1NA 1KJWA 1U3GA 1YU6A 2IPXA 3Q6MA 1YUNA 1Z82A 3DLBA 4L1KA 4KLZA 4ZOAA 4R7GA 5DHTA 6REQA 5LOVB 4BGEA 4EPVA 5I7WA 4YDQA 1YQTA 2GYUA 1ZIOA 4RTOA 2VPYA 2HMAA 3DWGA 4X8LA 2JCBA 4YX9A 5HW0A 3A9UA 1O9HA 3A9TA 5DT9A 4UOZA 3LMKA 2J5RA 5BOSB 2YVQA 2O8EB 4LDJA 5CK4A 1HGXA 1M2OB 2GJ9A 5JS1A 4JHLA 1ZK1A 2VSXA 4HDNA 1R6UA 1Y3HA 3IIMA 3PJEA 4TTPA 1WCIA 2GASA 2Q3EA 2VQ3A 3C3WA 1KZ9A 3D54D 4QDJA 5CVDA 5AVYA 1M34A 3AEYA 4PGAA 1NURA 1U8UA 1OREA 2C4MA 3C6YA 5HP4A 5KVQA 1NVWQ 4MVXA 4Y9RA 1SFRA 1U1FA 4HNUA 5JISA 2BL4A 1R0KA 1GYRA 1IK4A 3B82A 1ZJWA 1GNRA 3T3GA 3QFHA 1JQDA 2KB0A 3WGMA 1T15A 2HT1A 5ISMA 2JW5A 3IGFA 4YJGA 2PL1A 3GAMA 3H5AA 1TZBA 3JQAA 1O4VA 1SWWA 2XTNA 5E2BA 4MCJA 5KYWA 2NTYC 3ZWOA 1FUUA 3WLAA 1SU4A 1WBJB 4IDAA 3R0QA 3KUXA 1VE6A 3HEMA 4XZ3A 2H52A 1M0EA 1JSCA 1T2CA 3EPPA 1QYXA 4XD2A 3Q15C 1CF9A 4OL9A 3WXBA 5CM9C 1YACA 1NM5C 1NIJA 4E11A 4KRGA 3AM5A 3J80A 3VNBA 4UPVA 5K3DA 3W6PA 2GX6A 2YRWA 5LMUB 1IAVA 2VDPB 3OX2A 4IIEA 3SP1A 5SV2A 1PJ3A 2A1UA 1EESA 3KLPX 4XWOA 1PFYA 2FSVC 2XOEA 3BULA 3RFUA 3GVHA 4D9HA 5DM70 2WABA 1YDFA 2DR3A 5MGBA 2N75A 3BRQA 3ZCRA 4DM7A 2OLEA 3LGXA 4XWGA 1EB8A 1PZGA 1WB5A 4NYIQ 1HE2A 5C5IA 3HK2A 2JBAB 4MTCA 1LF5A 3PBKA 3BE6A 1EIWA 2ZIVB 3IT1A 1NW5A 1EVYA 4PPYA 4DUZB 4WCFC 1RLTA 1E6KA 4LYFA 1AV6A 1EK2A 1E9RA 4ZCTA 4K6MA 3L7LA 2NUAB 4MDEA 3EVGA 3B51X 2OG2A 2W6MA 2Z8YM 3U60B 2O5CA 3GFOA 2WPDD 2X2OA 2E48A 2TS1A 2CVQA 2XDYA 1E0AA 5CB8A 3GO4A 3N8NA 3DFFA 1MJFA 3RSFA 2WDZA 1S2MA 1USGA 3BK7A 3IDSA 1AN9A 3Q7IA 2BKXA 3QJYA 1VL1A 4KQ2A 5EKSA 3WHKA 4AJ4A 3O90A 3TQQA 1VYTA 2WJAA 5LP6A 1IBCA 3CCBA 3T3IA 3IFSA 5CJJA 3MHPA 4AWXA 3S8EA 1PHRA 1MF7A 3I1JA 4Y6QA 1JIXA 2CDRA 4AICA 2QPTA 4QG7A 2Q3JA 3U3ZA 5FO1A 4TTVA 2GZHA 2V65A 5IULC 4JT8A 5C8YA 3PQ4A 2H8KA 2E5WA 3MAGA 1Q0LA 1ZL0A 5JAOA 2UV8A 4MJLA 2VHTA 3RRBA 3UK6A 1LPSA 3BD9A 1N1DA 4M0PA 5BV2P 3QWIA 4QUHA 3CEHA 2PV0A 4PLTA 3C5EA 3GRFA 5K45A 2RI0A 1NBEA 1W4ZA 4FZ3A 2QM7A 2EG9A 2ZRFA 2DHCA 4M1QA 2J9RA 4P86A 5CX4A 3W1VA 2UYQA 3HVKA 3TQHA 4B7XA 3EG9B 3G59A 3OOHA 4HNAB 4M54A 4X85A 1E7SA 1FFYA 2EIHA 2HZ7A 2E5FA 2P9ZA 1UP6A 5A9TA 3TG8A 4QUEA 1KR2A 4ACBA 1XCLA 3W5HA 4X61A 2Y9PB 2ZYRA 5FOXA 1SY7A 3ZDDA 5DI9A 3BOSA 1FU4A 2MT9A 1J4AA 3PRYA 4P54A 3SZ3A 3DZKA 3L0IB 4Z0TA 5AKJA 4IY1A 1CUZA 5YASA 4LVCA 4BGUA 3LLMA 3UGTA 3UYLA 3UWOA 1DKMA 2FG6C 1F1BA 5KAPA 1VHQA 4C14A 1IN7A 1E2UA 1YRLA 4DJFC 5BN4A 4I55B 1FNSA 3EGXB 4YRAA 3K1AA 3SIPA 1ORDA 4LSWA 3OE7D 5FV7A 4LJLA 3ZVRA 3HFJA 5KKCA 2Y77A 1JDPA 2X40A 5T5QA 5DU2A 5IH7A 2BTOA 1GEEA 4RJLA 3NO4A 2E4WA 3NAMA 4XLZA 2WWFA 3N3BC 5JQWA 2AG0A 2QT0A 3UEOA 4TS1A 3VZCA 4H6VA 3NDRA 2VJLA 3LF2A 3OP1A 4M87A 1R6AA 1RQ2A 1P4HA 1R0BA 1YC5A 1HTBA 2EFEB 1NKTA 2RKOA 3H1PA 4JI5B 1IWPB 1XDGA 5IHXA 3SF8A 3FZEA 3MGCA 3HWX1 1XHEA 3LIIA 1GDHA 1X3LA 1LTHR 4Y6PA 1L4LA 3D7LA 1T2UA 2B83A 4O4IA 2R00A 4D9BA 4IFEA 1Z39A 3QV1A 2CUKA 1B42A 1ESMA 3IHKA 4HY3A 5IAEA 4A5SA 4AMZA 2CXPA 3C24A 2FCAA 4UHDA 1MGPA 2O2DA 3AILA 5G0VA 3X43A 6NULA 1Q19A 2I62A 4JI1B 1G0OA 2G1AA 2QRQA 2PLFA 1GTG1 3R74A 3VYTB 4QRIA 3ZXXA 4CTJA 4H1UA 5MHTA 3AVYA 1VPLA 3IT0A 2J0EA 1HYGA 4PGGA 2AT1A 3ENZA 4UCQA 2ZAYA 4R9VA 4PZ0A 4U4AA 3ZU3A 3QLUA 4QFDA 2Y1DA 1G98A 3WB2A 1DBSA 4J3FA 4OIMA 2H31A 5KWSA 1SKBA 1T0BA 5TLSA 4Z53A 1I4DD 4ZVRA 3QTTA 1QOPB 3FUUA 4LC1A 1FMCA 3ZCVA 2QUIA 1WQ1R 3TW0A 3BKXA 3ZYZA 1GADO 1RWKA 2QVZX 4F85A 1DBIA 1FOEB 1KAEA 1LLDA 2QLLA 1U9CA 2MU1A 3GCGA 4BMCA 1EBUA 3GD7A 3JALB 4IMIB 4JJGA 4A91A 1I7QB 4FQ5A 3OJEA 2W6ZA 1GT6A 4C0LA 3GJQA 2Z98A 3A28A 2E87A 4P36A 5KI6A 1V3UA 3H75A 5AHWA 2ZEJA 4JEHA 5FL3A 5JDCC 3N75A 4MEAA 1RAIA 4LZWA 3CZ5A 2WZCA 5B58C 1UDBA 3CY6A 1W73A 2RHRA 2ZSBA 3A31A 1E99A 5IZCC 1AGYA 4RANA 4CV2A 4WECA 5FR1A 1Q14A 3MFQA 5H7XA 1XKTA 3ZBPA 1UMCA 1V5WA 1O94C 1Y7IA 3KV3O 4HQKA 1OKKA 4OSEA 1RYMA 1GSOA 4NFHA 4U7TB 4BTEA 1CYEA 4TQGA 2WG0A 5JV5A 4X7PA 3O83A 5F2KA 4D99A 3V80A 3G8AA 1F5NA 3F90A 5JNTA 3U7QB 1IZ8A 3L43A 4IDNA 2Y2VA 3OOEA 2PH7A 2ZR0A 1YRBA 4NI5A 2FW1A 4GU5A 1OAKA 3VUFA 3OO0A 3PR2B 5LQAA 3TXYA 4XGIA 4UASA 3ZD7A 3QM1A 2WKWA 3D4IA 2O8NA 3CM0A 3PNMA 2A78A 3EVFA 4QM6A 4NLLA 2PX2A 2ZAIA 2GAFA 3FFAA 3PF9A 3HE3A 4OI4A 4A4DA 3HO8A 4NE9A 2C2MA 2I3BA 4HFJA 2BGGA 5ECGC 4B87A 4BLVA 4DLNA 5EZSA 2ZJ3A 4KIUA 2JVIA 1JDVA 3M5CA 4YNBA 1BWQA 5EL0A 2RGXA 2M32A 3TJMA 1IHUA 2XRYA 2HYIC 4CKCB 1VLMA 3FPGA 1U0FA 2AH5A 4LYAA 5L53A 1VB5A 3LZCA 4PTZA 3RYIA 4DS3A 1OFGA 1M1YB 5LA6F 4NFSA 2ST1A 4OK5A 4CCSA 3NGLA 2PKEA 5FTWA 5TJ9A 3U4DA 1BDBA 2YV2A 3KHKA 4LYDA 4MHTA 1W4BA 1CUGA 5CLIA 5KTSA 2FKAA 2G6TA 2IHTA 3I2JA 3AJ9A 3W3AH 2C83A 2YN0A 1E5TA 1MVNA 1X1SA 5ALNA 2TMGA 2W6IA 1BC5A 3NDJA 3UOGA 1V9CA 3F5MA 5AOBA 4K40A 3D3WA 3DT8A 3WQQA 4D9KA 4DA0A 3B52X 3OPQA 3SYNA 1FQWA 3WIVA 3IEXA 5DCLA 2RHCA 2RGWA 2BHNA 3IR7A 4Q3EA 1NVEA 2V1UA 1D4FA 3KD2A 4P33A 1CUWA 2FSSA 4EB8A 2GMWA 5EJMA 3F6CA 1YD7A 3I05A 3W2EA 2J08A 4EF4A 3RNOA 5CK5A 1MEJA 3FCSB 3LGAA 4AZVA 1II8A 2VHQA 4ECAA 5EJ4A 3N1UA 3DTYA 3K0FB 4UM8B 4DR6B 2NO0A 4ZQBA 1VJRA 3VKFA 4PLWA 2Z2ZA 2M6RA 4BWVA 2P8SA 1G8KA 3NEJA 2QTBA 5JANA 3EXFA 3SCZA 1XA0A 3A2NA 4BB9A 4CM5A 3IKTA 2CT8A 1E2QA 421PA 3KOOA 1RQXA 1TLFA 2R60A 3ETEA 1GZHB 3DH0A 5BRNA 3SMQA 4QLBA 4GRDA 3UFXA 4RD3A 4IJ6A 4ZO6A 1T4CA 4DGQA 1K3UB 3FF1A 4H1WA 5U4XA 3NT5A 3HO6A 5LBUA 3INGA 2OQVA 2YOFA 1UK7A 2CW5A 3JVUA 3KZMA 3LD9A 4K87A 2OGUA 2V55B 1QP0A 3I2YX 4FW8A 3U31A 2H08A 1L4GA 1V25A 2BEWA 3F71A 4RLFA 3QE9Y 4X95A 3DLCA 3GRYA 4MA4A 2LW7A 1KMNA 4KTTE 2VT7A 3JQAD 4YJ2F 1H8HD 3CZMA 1DE0A 1NI5A 4AIIA 1V7PC 1ZJZA 2ZBGA 1JR3A 3ZS8A 4G0VA 2JLYA 1KJIA 1SU8A 2FTKE 3B1YA 4E5MA 4QU9A 4B1FA 3VBCA 3GZNA 4EJFA 2ICAA 1GSHA 1ESDA 1K8YB 2BE9A 2CXHA 3AHIA 2YXNA 3AZQA 3H99A 4PLCA 4DG9A 1Z3CA 2J3DA 3PENA 3OOWA 3QITA 4JJKA 2CJXA 4OXRA 2H5LA 1NN5A 1MPXA 2VLIA 5DK4A 3I2HA 3ZWKA 2IYZA 3NIDB 2B4TO 3HY3A 2BHTA 2H2AA 2WKRA 3CB4A 3PQDA 3U3RA 1WSDA 3N2LA 4F3YA 4F72A 4GBGA 3R0IA 2XX3A 1LK0A 1Z06A 3VISA 2H1HA 5KQLA 4V02A 1QV7A 4DLTA 5C7LO 4AUMA 1QP4A 3NTOA 2O0LA 3N2EA 1ONPA 4KE6A 4H6XA 5ALPA 3T7AA 3OT1A 1MGOA 4MZXA 2VAWA 1YWGO 3VPHA 1E32A 4OU4A 3IAUA 3FROA 5GIPE 4JJ4A 5E6SA 1SELA 4TKLA 4UZSA 2FR8A 4CT0A 2CFTA 4RW0A 1CB7A 1NLUA 2Z2YA 4IZ6A 4TMFA 2H7XA 3U7EB 3WKDA 4BFZA 4ZD6A 4CM8A 4D8TA 2W2VA 4HH1A 1VI2A 1FX1A 3VSAA 3GMIA 3DVLA 3DSRA 3X44A 4BWYA 5F23A 1PR2A 1KWKA 4MUYA 2WOOA 4DNPA 1C4OA 4IH1A 1SUAA 1X6VA 3C7CB 3L1UA 1HG0A 1QQTA 3SQNA 5KTRA 2B5WA 1VI6A 2G0AA 4H4CA 4HNGA 1T1JA 4MYUA 4YS6A 4CGZA 3OKFA 3I8XA 5H02A 5DGIA 2B9VA 4N0MA 3W8FA 1IQ0A 3DLPX 2OYRA 4BP9A 3BB4A 3ZIDA 4GYKA 4ENSA 5JY1A 2N0SA 4LY6A 1XD8A 4YCLA 1GL9B 1VE3A 1TNDA 2CFOA 4TS4A 3W5VA 3AHFA 4BMSA 2QX4A 3QUAA 2WMOB 4CBVA 4BBJA 5JMWA 4G5QA 4P7JA 1M6NA 4UD6A 5JWOA 2ODBA 3V4RA 3FWNA 5ELXA 1T0JB 3ZHYA 1PR0A 2NTEA 2ZIWB 3RU7A 5CVJA 1F8FA 5JJIA 4BO6A 1FFGA 1G1MA 2PJZA 4OGGA 1KDVA 1KMIY 2O2JA 2DWUA 2PH5A 4RVUA 4TL8A 2F1JA 1IAQA 2WWRA 3FRHA 4R1TA 4YRLA 5C8DA 2GCPA 2I8AA 4HLDA 4C87A 4TT8A 1YDEA 4PR0A 5MFPA 4KX3A 3FTQA 3D0QA 4CL3A 4WXRA 3LDHA 5B2EA 4FSHA 1P17A 1GAXA 3DCNA 3PSHA 2GSDA 3RUFA 2NSHA 2B94A 4IDPA 2IV3A 5HQ3B 3LUPA 4GVLA 1H6DA 1EXNA 1D4AA 2CMFA 2WNIA 4Y1RB 1GZ3A 1SQ0A 3EAFA 4I8XA 4FQ8A 1YRAA 2OXRA 4EW6A 1TTTA 5JJLA 2ZSUA 1PX2A 2J32A 2EFCB 2V5AA 2YWXA 3F7MA 4HWSA 4UREA 5EZYB 2P11A 4POAA 3I4FA 1KC3A 1DWPA 5FFMA 3U4MA 3KZKA 5FUVA 4TLCA 2PKQO 4G5OA 4QULA 1K5DA 2RAPA 1H9AA 2CZQA 3EF3A 1NP3A 2HSEA 3ML1A 3JQQA 1XKLA 3P2MA 4FEGA 4JGGA 2GPNA 4JK3A 5DCWA 5EYPB 2C78A 3ZWAA 1KYWA 2VPXA 5JVDA 3AJAA 1V4VA 5FI0B 3SR3A 2XUAA 4TZTA 1IPEA 1A97A 1V1RA 1FLDA 5TRTA 3UMCA 4F7WA 2GFHA 3PC4A 4EY7A 5JXJA 1BXRB 3USZA 3JZIA 3U4HA 2B1JA 4TKVA 1Z13A 2HUPA 5HIAA 1L7NA 1C9DB 4LUCA 5DLQC 3O26A 2ILTA 4FYHA 1T36A 3LWDA 3DDWA 4FGLA 3GT0A 4A1OA 2JK1A 3IHTA 3QPWA 3UJ6A 3EK2A 5ALJA 5JNWA 5IT0A 3EBLA 1X1RA 2EW1A 2EFGA 1CY6A 3TXXA 4BFSA 2D7DA 3DE1X 1O6CA 1SVWA 3A11A 1U3TA 1YBMA 3Q9LA 2JI4A 2YS6A 4N7BA 2Y1WA 4UU8A 3STHA 3W7AA 5K8JB 2SKCA 2OCKA 1NW8A 3KYCB 3L92A 4L0CA 3Q5DA 4RH3A 5AMXA 4M37A 4BWGA 1QORA 4X9XA 2VYCA 1XPRA 1Q7BA 1SCBA 4M1TA 2R48A 1JQJC 1MEOA 2YJTD 1YJBA 3LCCA 1L7QA 3HUEA 5LP6C 1BW9A 3ONWA 5KREA 3ICVA 3KVVA 4GVPA 1TMGE 5TT1A 4BMVA 1C0EA 4EYKA 1RAGA 2IT1A 2P9YA 1ZWLA 2IEYA 2SNIE 3PEEA 4IYJA 4LRXA 2AOVA 3QE2A 4IDBA 1GPAA 4P22A 4BBPA 3LTEA 1CJMA 2C04A 2F6RA 1TRKA 4MS1B 3N0XA 2XWBF 1TA0A 5LMCA 5EIXA 2X5JO 1J97A 5CGZA 3DOHA 4NBTA 4CL0A 3U1BA 3LFUA 3QLEA 3H9BA 1C9JA 1KKLA 3DP7A 1BIFA 1P2UA 2I0FA 2QL7A 4JVMA 4XVCA 3D1VA 2BELA 1WUHS 3FNIA 4GRAA 2D1TA 3H1TA 4LK3A 4NFLA 5DNWA 4FOLA 2R0QC 4JB2A 3GJYA 1G20E 2Q4DA 2X8BA 4UUMA 3M9LA 1FL9A 4HMOA 5ALKA 5C5EA 1E6EA 2AEEA 4FILA 4IHJA 1HT0A 3G1WA 4KHZA 3MGBA 1Z33A 4HAXA 2X4LA 5C3UA 1I80A 3JARA 2OR3A 3T9CA 2CXQA 1X19A 2ZB8A 3DTTA 4B7UA 3EIUA 5C2JB 5LZ4A 1HDOA 1FFXB 2PZEA 4I4TF 4TLMB 3U7RA 4C30A 3DOIA 4TMZA 4BJ5A 2HO4A 1M8FA 2B61A 4EWLA 3OQBA 4NBUA 1U2DA 5BQPA 4YQEA 3DV0B 5AJHA 3UHJA 2DRIA 1SUPA 2O1WA 3FZYA 3H11B 3U4QA 3RS7A 1EB9A 4P3KA 1VE9A 2LUOA 4TXNA 2ZSAA 1AD2A 5DI3B 3A4VA 5CCBA 2DKOA 2ARKA 3PD7A 2RH9B 1OB2A 4RPIA 2XB2A 4FTWA 1IQUA 3IQHX 4RPHA 3U81A 4LFBB 1PEKE 5ANRB 3LA8A 2JG3A 4O3FA 5LZ5A 3C5HA 1NJ5A 2I8CA 1W36B 2C2XA 3HY4A 4MR7B 2VL7A 3KSMA 4PQGA 1LPOA 5FAKA 4YPVA 3F3MA 1R4ZA 1XXHA 2ZFUA 1MX3A 1Z08A 1DBPA 2EFYA 2I87A 2R96A 4QYIA 4CTNA 2GS9A 1TU3A 3UJPA 1KBZA 2H1VA 3ZG6A 2R00C 1ODLA 4G1FA 1W85B 2W6PA 5EWMA 2VUIB 3GBPA 4GPIB 3J7TA 2HRQA 1IOVA 3IUQA 4OREX 3ZE9A 4I5EA 3ROKA 4A10A 2FMFA 2WF5A 1U5BA 3BXZA 3OZFA 4PS1A 4ZREA 4BO2A 3TCXB 2O8BA 1M2NA 2Q0HA 1GKIA 3ZCPA 3AUTA 4JYMA 2WV7A 4CM7A 1DT3A 1IXSB 1PR3A 3OQIB 4GC5A 4Q02A 3CISA 4KLAA 3FWYA 3ZI7A 3PPVA 4D97A 3P0IA 1YOVB 3DF9A 3BQNB 4XIIA 4B4WA 5JZMA 5DGDA 3OCVA 1MRSA 3JVDA 5JTUA 3P2IA 1K8QA 2P6MA 4TV9B 4QGHA 5GMOA 4PC2A 3REOA 4ZZ3A 1SM4A 2XGMA 4KJZA 1RHRA 3RT7A 1BMQA 1HYQA 4KRFA 5AVWA 3LQYA 3KCQA 4U9UA 5FBVB 1N25A 2BMFA 4PAOA 5H59A 3CNOA 3AUFA 5JSQA 4FUTA 3HDYA 4XEUA 2CJWA 4FVTA 5DV9A 3IP3A 3DZBA 4U0KA 3MOGA 5CX1B 3VR4D 1DRVA 1G2QA 1J5PA 3G5AA 2PYZA 3LCRA 4TLBA 2P90A 4WVFA 4Y2PA 4AAYA 2VZ8A 4OQ4A 1C7RA 1PWXA 3ICWA 1K7EB 3RUPA 1IVNA 1Q21A 1QS0B 2EFHB 2PU7A 3NHPA 3E9RA 3WLPA 3ACCA 3C6MA 2ZPUA 1UT6A 1MNAA 3GUCA 3I4LA 5FEMA 4AMYA 1EA5A 1SUEA 3QE3A 3F97A 2ONJA 4IVNA 4QDKA 1W29A 4ZVKA 2PRJA 1X80B 1S3FA 3ANNA 3WLFA 3PNVA 4D3XA 3IB3A 3G82C 1ZN7A 1IE3A 1Y8QB 5B7GA 3O95A 3RW9A 3K5IA 3OT4A 1HEYA 3DFUA 4O0MA 3BBLA 3OCZA 1JR3D 1TMYA 4Q1VA 2RK6A 1N0HA 3R76A 1LDEA 2BSAA 4RAOA 4G63A 2ZQYA 3EC1A 4KFTA 5AI0A 4L5JA 1M8JA 4HWKA 3U0BA 4ZTZB 4ZCMA 1P9OA 5J1SB 4URYR 1R27A 3O4IA 2PR7A 3H5VA 3OIFA 1EWYA 2YN2A 4JQZA 3FUWA 4ER5A 3D8HA 4OA5A 4RJTA 5EHXA 4HATA 4ZMRA 1GFIA 1MQ9A 2G5PA 3RTCA 3JAKA 2C5AA 1RI3A 1ZD1A 2AXPA 5ALXA 4C04A 1XAIA 4S1PA 3CKLA 4DR1B 2ECOA 4JMPA 5ITZB 1P1RA 1L8LA 5COBA 4UTRA 3AEQB 3X1XA 3DDNA 1P0CA 5JCZA 4BECA 4EZBA 5K3CA 1QK3A 1RIFA 2I7DA 2GFIA 2LKDA 1W5TA 1H2EA 3C6BA 1FYDA 4DREA 5DMHA 3WIOA 2I3GA 4F5DA 1FUIA 1RXYA 1V47A 5JXIA 3SOPA 5IXYA 1WB9A 3GQBB 1CEEA 1ZJYA 1SCDA 1OI2A 3VVMA 1GOTA 4K6HA 2C2KA 3CNBA 2DU8A 1XTPA 4ZHQF 3LBYA 1GQFA 1LVHA 2IP4A 3MWGA 4XCQA 4A73A 3C8DA 2P9HA 1XVLA 1XNRB 3MJFA 3A6EA 5IM4A 4EB6B 3HB0A 2R6JA 2R65A 2ZT5A 3TLCA 3AMVA 2V3CC 3RGGA 1UWKA 2GA9A 3KEGA 4BTVA 2JAXA 5A3QA 1J99A 1CR6A 5E38A 4JEUA 2BFOA 3LC1O 4G23A 4JA0A 4ZT5A 4D9CA 2NYVA 3Q7PA 4Q24A 5AFSA 3MZ0A 2QN7A 1KXZA 2CLHB 2Q5HA 3ZHUA 2GCOB 5C37A 2W8ZA 3PXBA 2G4VA 3AOEA 1KQOA 4RKYA 2JHGA 2ZS7A 1D1PA 3E3NA 3JVEA 3RH0A 3P8ZA 3IC5A 2B8WA 3GLVA 5DTRA 3K0AB 3KOXA 3OP4A 5FH9A 2C4NA 2NSJA 5HCIA 3RVDA 3SVZA 3O7MA 4DPMA 3UT5A 4M0FA 2O8FA 5AVOA 3LHIA 4BNZA 1Z7YA 4O4JF 4BIIA 3ND9A 4EUFA 1ITZA 1RW4A 4GP6A 1C3LA 2Z9DA 2I29A 3L8GA 4B0OA 3EGVA 4ALKA 1LW7A 1J07A 1B6SA 2HMYB 5ERGB 2VJPA 3OZ7A 5AT1A 4HN4B 2VZLA 2POCA 4V03A 4OL0A 4RZQA 2BEVA 1PLJA 3GUYA 3ZZNA 2YIMA 1U0HC 2FW7A 1P5JA 1F6WA 1UJCA 4L5IA 2RGEA 1R8XA 4CM6A 3OEEA 1AKEA 2J30A 1AIPA 1UP4A 3ADOA 3QVGA 1UKEA 3H1GA 1LFDB 4XB2A 3PTLA 5LQUA 4J7XA 1T8RA 4KV9A 1DTSA 2FF7A 5IYZB 2ZJBA 4RZUA 5CLJA 3FYUB 3B13B 4KZKA 1DVRA 1OSNA 2MWMA 3JVVA 3HU1A 3KKNA 4FI3C 4WRRA 1FW6A 4WJLA 4L75A 4W6ZA 4TN1A 4EHFA 1YQWA 2AG1A 3HXOA 1HUQA 1XVTA 3EHDA 4PSUA 2PXCA 4KXQA 3UOWA 1GG5A 4EKGA 3DEZA 1P5HA 1WD5A 1ZFNA 2G4LA 2NXWA 1UMDB 1EUDA 2J3QA 5J43A 1A8QA 2EAUA 2RB5A 2ZYSA 3C6ZA 4ZVVA 1PS0A 2IFTA 3RFVA 3VI4B 1DRKA 2UUAB 2J0QA 1B6GA 2NVOA 4K9QA 2EX0A 3V4VB 1YCDA 4AF6A 1XDDA 4TMWA 1NI4B 1E66A 4YACA 1K5PA 3ZH2A 1FSFA 3E0XA 5HEKA 3PNQA 3HJRA 4AJEA 2IYLD 4BXOA 4ZVLA 4NKRA 3B85A 5F12A 2F62A 3GWGA 1T4GA 4LXIA 4RD6A 4Q9HA 4YP6A 4W5OA 5FTNA 2EZTA 1JMVA 2IX9A 3EC2A 3ZGLA 5TXGA 4Q9LA 3TH5A 3WL7A 3AQIA 3JD4A 4Q01A 3AXTA 3HLYA 3RVJA 4IRMA 1QQ7A 1NHWA 1KJYA 2JHAA 3UW1A 2FHPA 3Q12A 1ZJ6A 2WVAA 5AHXA 3R3SA 1ISRA 2GN1A 1TTPB 4IG9A 1SMKA 4ZODA 3I01A 2W6NA 2CL5A 3G49A 4BMYA 1KYQA 2C97A 1PSWA 2M6LA 1X1BA 1I0IA 1HE5A 5FTKA 3TOSA 2XZLA 2WT8A 4FFOA 4I6JA 3ZU5A 3ICQB 4ZPJA 4UPDA 1J39A 1JPVA 4ZCPA 5IT9A 5CA0F 1YB5A 2Z6VA 3UAZA 3BUSA 1WHTB 3MSXA 2HA7A 1JBKA 4DCVA 2YZKA 3N9IA 1QO0A 4X6YA 3ET4A 1TUEA 2H4YA 4BRWA 1JB9A 3U6KA 1FDVA 1ZMXA 2G70A 4N03A 4MRPA 3EGCA 5BYBA 1UT5A 2O50A 1LK5A 1OV4A 2JJ1D 5K09A 4K88A 4MNTA 3GLFB 3KLBA 4ZT7A 3C5VA 3TVTA 1NNEA 2ZJ7A 2PU5A 5FRDA 5AICA 1XVVA 3F5FA 1JG3A 2NW6A 1Z8DA 1C4XA 4K86A 4I9FA 4ZDKA 2VDOB 4X90A 2IS1A 3CWQA 2G83A 4KLNA 4Q1EA 2GNAA 4B80A 4E51A 5LOVA 1X39A 1B0PA 3NBFA 1MP0A 4HJXA 3TKAA 7MHTA 4MVJF 2XMBA 3JATB 5F4BA 1PT9A 3DVQX 2QUJA 2B35A 4GT1A 2RIRA 3RK1A 2DP4E 2ZROA 2IPLA 5BOSA 2DPGA 1M2OA 1T34A 2SECE 3H0CA 5EWLB 5C31A 3R7NA 1QDUA 5F1KA 2R2AA 2PBFA 4PRKA 4YH1A 1KVTA 3EDOA 2IYAA 3QU2A 4LVOA 1GQQA 2R6ZA 1WP4A 2O14A 5G2OA 2ATEA 4IF6A 4IJQA 3W2TA 4YR9A 5KOHB 4HF7A 4HVTA 2FUCA 1EDOA 2EWMA 3L0CA 1IG3A 1CQJB 1I24A 3GLIE 5HYVA 5FBHA 3UXMA 2OY0A 4XQCA 2VDKB 1WMBA 1NE7A 2OC9A 2BDUA 2WOJA 1QTNA 3M6XA 4F5YA 2C88A 4UNRA 2Q0XA 4YALA 2JVJA 3JZAA 1ORWA 1DTWA 2SICE 1E3IA 4L8YA 2ERXA 5BQOA 3V00A 3ZK9A 5FV4A 5J47A 5EPOA 3VKUA 3AY7A 1I8TA 4KXNA 4LXYA 2OSVA 2ZCVA 1L7BA 3WQRA 4IIJF 2BGUA 4MUGA 4G65A 1YI1A 2ZRBA 2FK7A 3GJ3A 2HA6A 3RCBA 1ZJ4A 2JL1A 4GC9A 1RKQA 5KKAA 4G8BA 3GX1A 3V55A 2LIVA 3CT6A 1A8HA 3LL7A 1GZSA 5JXWA 4BKOA 1DAFA 4UNQA 3ZZMA 4FSXA 3OA2A 2ETXA 1M67A 1JEJA 2W2PA 1N3IA 4JT9A 4D43A 2YBEA 3G85A 3NH6A 2IS2A 4RHCA 2N1MA 5FD8A 1I2AA 2J41A 3R5FA 1XQWA 1CR0A 4M0EA 3HB7A 3SYLA 3WNCA 4E3ZA 1KI6B 1GFSA 4DVGA 2GZSA 16PKA 1HT1E 2YRXA 1PFUA 4IUDS 4TYMA 4DN6A 4J1QA 5BVHB 3HV0A 1XJWA 3R9KA 5L3QB 3KKOA 2O7NA 1ZN9A 4J76A 4CPDA 1GGEA 4IICA 1Z8HA 2B5VA 2JI7A 4BLWA 4MPRA 4MVJE 2XUPA 1N1EA 2A9FA 1DBRA 1MJGA 2GK3A 2RCNA 1BKYA 1L0BA 1BGXT 1NC1A 1YVEI 2MMGA 1N0UA 2F43A 2NADA 3LKDA 4NPHA 4WK4B 3SC4A 4UZFA 1W1UA 2DF8A 3HYRA 3KQMA 4M1OA 1O87A 1RJGA 3KKZA 3SF0A 4RF4A 1KEUA 4DY6A 3JQ7B 1RZVA 4BKUA 1BXZA 1OXBB 1X7GA 1M1NB 4ZDJA 1U3UA 1ZICA 5TQ0A 3PXEA 5EZ6B 5J58A 2H06A 3NYRA 3FFBA 3LH5A 4IDOA 4WI1A 2IU0A 2SCUA 2JIMA 1ZSVA 1Z6YA 3G0GA 4EB0A 1N8SA 2DE0X 2YKGA 1YJQA 4LGVA 2ODQA 1QIIA 1SCNE 1AH2A 8MHTA 3RTBA 3S55A 2JEYA 4NHEA 5C53B 1U2DC 1EYZA 5EG5A 2QRHA 3WMRA 1L7OA 3QOWA 4H35A 4CI0B 2VVTA 1T29A 1ULHA 3UAVA 3VSBA 3WLQA 2YX1A 1F20A 3HP7A 4QOGA 4RPGA 3RABA 5LZ2A 1UJBA 2G6BA 2FPIB 1ZM7A 1DCKA 1QIFA 2RBGA 3EG9A 3FGOA 2IHKA 4DJEC 3THOA 5I7UA 4YJHA 2OZPA 3PD1A 4TPKA 3NORA 2GJKA 2R4UA 4JUBA 5A2GA 5AKHA 2YY5A 2ZCJA 2FF5A 2H18A 5AI4A 2BUAA 3OX1A 4DPKA 1G16A 1GGNA 4KPUB 4G0YA 2ZS9A 2MINB 4R1OA 1TM5E 1QYWA 3RYTC 3U40A 5BY2A 2BMEA 3ZDYB 4DB4A 2EF0A 3VKHA 5EESA 4YUAA 2R8BA 2WZQA 2A7QA 2ZJ1A 3PWKA 4KGXA 3WWYA 3RIHA 2VA8A 3RAFC 4CR6A 4F56A 4H17A 1RD4A 2ZIAA 3EAQA 4MVJP 4PFJA 3ONNA 4OFWA 4I55A 2XGOA 5FUQA 5GV7A 3TVDA 1ODCA 3EGXA 4D8WA 5KNDH 1JECA 3RRMA 1H0RA 3ILYA 3UAOA 1GPDG 2HQRA 1T26A 4L74A 1VG1A 3QJGA 1VC2A 2XECA 3G1UA 3QU9A 2R25B 2GKSA 4YWJA 2PSEA 3ONEA 4WOCA 1K4YA 1PWEA 2IYNA 5T3UA 3ORRA 3A06A 1LB1B 3KEFA 2WTUA 3MJCA 1RQPA 4G89A 2VF8A 3UMGA 1RIIA 2B3DA 2H1LA 4OIFA 5ENVA 1E6MA 3ESZA 3RJ5A 2Z8ZA 1XB2A 1BE6A 4UOQA 3U7HB 2Y0BA 3LAWA 2G7MC 3MPUA 3B1ZA 5EOVA 4DR2B 2E7ZA 2GF0A 4LQDA 1ISSA 4RDIA 3FG9A 4GR9A 4PS0A 4NY1A 1NVBA 1QIMA 2ZYDA 2UYGA 5JS6A 4C21A 5KVCA 2VJKA 1QKIA 1L7EA 3IAM6 4MCAA 5JJ5A 2JA1A 4FDVA 2YDYA 4I8DA 5HVNA 2CLOB 1OA0A 1ULAA 1CLUA 2FQ1A 3AYZB 3GEMA 1C41A 2BGJA 1ZLXA 3KHTA 4M88A 4B4DA 3HB9A 2WQ7A 2OBFA 2ETVA 3RVNA 1FBTA 1VBKA 1Y1LA 1UOQA 3CX3A 4O2BF 2IUUA 1ZH4A 2AFIE 3N39C 4R16A 4RFLA 4CHGA 4EY5A 2FUKA 1C1HA 1P2BA 4Z4QA 1BHQ1 4QUKA 2JH3A 4B84A 4DIEA 1DIRA 4H7DA 5LXTA 2WQZA 4M60A 2HJVA 3B9RA 4W8OA 4ANFA 1HR0B 1TMOA 5JIBA 4XJTA 3NTQA 2VT6A 3NNDA 1J8QA 2IPMA 1SKUA 2E1RA 2PM8A 4QTZA 1FFBA 1GPLA 3HB1A 3JALA 3W9UA 2BWJA 2UVQA 5AKKA 1DGQA 1ZNWA 1P19A 4J49A 1XF1A 3VTKA 4D4MA 3DWIA 1NJ1A 4Q7LA 1MJ5A 3ABQB 5T4EA 1JFLA 3BHIA 3T4UA 1OFVA 2Q7XA 2NUTB 1QONA 3HYNA 3FDJA 1KEWA 4RK4A 3JYQA 1ZGAA 2OV6A 3MD0A 1VIMA 3EEYA 4MUBA 4MP8A 4YT4A 5E3JA 2NPFA 2W2QA 1MZPA 5KAMA 4I1RA 4NV3A 1DJQA 3T0GA 4RTLA 3VNAA 1ZGBA 5IF3A 4B40A 2JIDA 3MWDB 2L69A 5T41A 3WYNA 1FA9A 2YYZA 5ESRA 3NIWA 4MVYA 3WK8A 3ZHBA 4DG8A 2QX6A 3AG5A 2QR5A 3NJ4A 5E1MA 2VQFB 1EBBA 5DTMA 1UZNA 2CNNA 1T9DA 2WSIA 4HUQB 1W7AA 1I33A 2JAPA 2RIPA 2X6RA 4CHTA 1P6UA 3AEZA 1JYFA 2XRFA 2R47A 2YCLA 1G8PA 2Q5EA 3CUUA 3SZMA 1Y6RA 3FTDA 4W5TA 4KVAA 5TGZA 1EP2B 1HZZA 3TAHA 2FUG1 3AJDA 1RAHA 5BNWA 4AI6A 4YAEA 1I0LA 4OFZA 4ZVOA 1L8QA 4TOIA 3CPHA 4UDOA 2A3NA 5EE3A 4KN6A 4F8JA 1Z4KA 1YS7A 3HCCA 4RADA 2PS0A 2O6LA 3DGFC 4M0CA 3VJMA 1R4MB 3QRWA 4IUYA 1RLMA 3LNCA 4TL7A 4C5AA 3F6BX 2QLMA 4DJAA 1WP9A 4H77A 1U63A 5IWAB 2LRHA 3WBKA 1F2TB 1S6YA 3OUUA 2HWXA 3LVRE 3NUQA 1VIVA 2C95A 3ZGYA 2H29A 5H9VA 3Q10A 2FW0A 2PGLA 4LN1A 4CKCA 2PR2A 2XVYA 1RJWA 1SVOA 3EHEA 3OG9A 2CKMA 3OH8A 1PJTA 3L18A 4JSYA 3T7RA 3R09A 3WIBA 1JT2A 1U0GA 1M1YA 3IKMB 3GLQA 3LLSA 2PJUA 2EJWA 4WT7A 3TX2A 1TMKA 4BX8A 4WLNA 1YCGA 2NACA 2OCLA 3B3GA 3Q8KA 3NASA 3TI7A 3TKLA 1LC3A 1G5TA 1VJGA 2HLDA 2ZB7A 3LUCA 4Q3OA 4W1QA 4DQKA 2VHUA 3KAPA 2YHUA 1EM6A 1T4DA 2OAEA 3HCNA 1L6IA 4FE4A 3UVEA 3CJTA 1C29B 1WR8A 3H42B 1Q11A 2G07A 1N2SA 3HU3A 1MN6A 5E1BA 4A6PA 5H3HA 4R8RA 4DL9A 2HFJA 1K97A 2ZU6A 5B6PA 5CA1B 4UHJA 3WWEA 3RS5A 5AK6A 2OO5A 1VMIA 1M6HA 5IDVA 2IZ7A 1N0VC 2YIDA 5CW2A 3T3PB 4BJ6A 5L3SA 1KERA 3LSYA 1H66A 5EHGA 1JP7A 1L1EA 1Q84A 2OZVA 3LBIA 3ORSA 3TFOA 1J23A 2F17A 5EPUA 2APJA 2VK8A 3K0FA 1P29A 2ILVA 4WFJA 3EPKA 2B8NA 4UTPA 2QTAA 4JUFA 3LPMA 4YJ3F 3E1SA 4JHXA 3A37A 4NG4A 5AH0A 4B3BA 2IXFA 4RZSA 3W6UA 5KTTA 4F96A 3H5OA 5C5CA 2FH5B 1J00A 1GU0A 2AZ4A 4N8EA 2PG3A 2UZ0A 3B3AA 4EKIA 2V7QA 1Z68A 5F2NA 4P82A 4IUCS 5A05A 2WW8A 1DX6A 2XHEA 1CUAA 1CJCA 1TF7A 3B6KA 1V8PA 2BBTA 4QT4A 2XYQA 3W5CA 1T35A 1U2SA 2YW2A 3G0DA 2X0NA 3KPUA 3PV0A 4MVJI 4E07A 2WB4A 2O2HA 1EBFA 2IDZA 4QATA 2HHAA 1IEXA 1L5LA 3SHVA 3ZN2A 5BQ3A 3D6VA 2XVMA 3FPHA 1W5BA 3G8CA 3C1UA 3EFOA 2XUZA 1MAAA 3ID6C 3EGOA 1EPUA 3AUKA 3H84A 1I7LA 1TK3A 2AEFA 2CXTA 2QIPA 3GCWA 1QYVA 2CXUA 3K9HA 2WV9A 3OWXA 4O08A 2WY2D 3DO8A 4F38A 5ICCA 1RKUA 3H6GA 5TEVA 4FEYA 1UPBA 4B3GA 3CH7A 5L4LA 3RASA 1F2DA 4UU7A 4O4HF 5I7VA 1RHQA 4TXHA 1IEWA 3I12A 4EEXA 4F45A 1M2WA 1Z2NX 4N12A 2NLOA 3ZPXA 4GDMA 1V5FA 3RI3A 1V4NA 4YT5A 2Q1UA 3S1LA 1MV8A 5T64A 5C1OA 4R1QA 2G40A 4RJJA 1I1NA 2EEPA 3EZLA 1YTUA 4FMDF 3HBAA 3M8KA 3NDBB 1JAXA 1Y4UA 1GPYA 1MVLA 3H5NA 4L57A 3RVOA 3DOEA 3PX2A 4MLCA 2Q6VA 4IINA 4YRTA 2QD3A 2WWVD 5G0UA 1YQEA 2DLDA 4BL5A 4B6QA 1LF0A 3PITA 3KNZA 5CB4A 2AC4A 4M1EA 2H1SA 2C8LA 3R3HA 2R1TA 4O33A 1G6KA 1Q7CA 1TX4B 4BC1A 2XWQA 4QARA 2IYFA 5D00A 3W5BA 2D13A 1DG9A 2CF5A 4BQSA 4CIDA 5JZ9A 2XDQB 1Z35A 2ZBVA 1E2MA 3H1AA 5JQGA 1P0QA 1ZXBA 3R1IA 4NDNE 5EJGA 4PVCA 3IHLA 1YQQA 4JP2A 1JMYA 2IEGA 5BW6B 2PNJA 1M83A 2VTKA 1IBMB 2FP4B 5HDBB 3DE4X 3MJTA 2PZ8A 1KJ9A 1KXJA 1G4HA 1WQ4A 4UNSA 3RVBA 3BPSA 1BS9A 1D5CA 5LWHA 2X13A 5CH5A 4S35A 2XUFA 3F1LA 3I0ZA 1VSVA 4BN5A 3B3FA 1V1MB 3T8YA 5CFOA 3JQGB 5EUCA 3W0LB 1YKGA 3ZDFA 2GI4A 3H6HA 4QLOA 3O03A 8LDHA 4XX1A 4CM4B 3NHMA 4GWKA 1SXPA 3CMMA 4ZCQA 5EIHA 4JX9A 4G0XA 5K6AC 1UBEA 4C1NA 4U2KA 1VP3A 2WIDA 3QIAA 5AJTA 1H05A 3RNLA 2Z8YA 1DX4A 5C34B